4UC4A

Crystal structure of hybrid tudor domain of human lysine demethylase kdm4b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
AVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Lysine-specific demethylase 4B
total genus 20
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4uc4A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4uc4A02
4QQDA 2L3RA 2O4XB 2F5KA 3UT1A 2L89A 4N4HA 4BE1A 2LRQA 4QQ6A 3LX7A 3L2QA 1WJQA 2RHIA 1KHCA 2R58A 2LVMA 2DIQA 5KE2A 4IUTA 4GY5A 5D6WA 2GF7A 3OYDA 3DB4A 3PMIA 3OMGA 5FROA 2M1HA 1OYXA 4IUVA 3EAEA 2RI3A 2RJFA 4HCZA 2M16A 2BIVA 4QVZA 5D6YA 3H8ZA 4N4IA 3FEOA 4II1A 3O8VA 4A4HA 4BD3A 4NS5A 4C5IA 3L2VA 3MEVA 1G5VA 2XK0A 2LTOA 4FU6A 2RO0A 2EQUA 3ME9A 2X35A 4BE0A 4UC4A 3P8HA 4L59A 3OQ5A 3S3MA 2RHUA 5KCHA 2QQSA 3UWNA 4Q5WA 4CRIA 5KCOA 3MEUA 1XNIA 2CKKA 2IG0A 2L8DA 3E9GA 3MP8A 4PL6A 3KUFA 4A4FA 3OS0A 2DAQA 3OYGA 2R5MA 5CIUA 3OYFA 4IUPA 5IAYA 2DIGA 2R57A 4IKFA 4EDUA 3OS1A 4IUUA 4PLIA 5M9OA 1OZ2A 2GFAA 4ZTJA 2VYTA 3OYJA 2K3YA 2RHXA 3OS2A 3S3NA 4C5GA 2EQJA 3META 3NTIA 4C5HA 3L2UA 1H3ZA 2G3RA 3MP6A 5IN1A 2K3XA 4OVAA 4X34A 4QW2A 3MEWA 4E7HA 4A4EA 3MO8A 4B9XA 4B9WA 2WACA 2RJEA 3OYKA 3L2RA 1RI0A 5FRMA 5D6XA 2HQXA 3LYIA 3PNWC 2QQRA 3C4SA 3DB3A 2MWOA 3OYNA 3MP1A 3ASKA 2BUDA 3M9QA 4E7KA 3S3OA 4C5EA 3NTHA 3Q1JA 3FDRA 3E9FA 4ZTFA 2M0OA 3OB9A 3LGLA 2O4XA 3OMCA 4E7LA 2EQMA 3QIIA 3SD4A 2X4XA 2LDMA 2MWPA 1MHNA 3P8DA 3OYBA 1OZ3A 2EKOA 3OYMA 3H6ZA 4BDZA 1SSFA 4BE2A 2EQKA 2FHDA 3OYIA 2R5AA 3QKJA 2XDPA 4PLLA 5FRNA 4FL6A 4Z02A 4N4GA 1OI1A 4IURA 2RHZA 2RHYA 4RG2A 2RI5A 2E6NA 3ZEHA 2P0KA 3PMTA 3CEYA 3LGFA 3OY9A 3FC3A 4BDYA 3QJ6A 5J39A 1WGSA 2GFUA 2YRVA 4IUQA 2RI2A 2X4WA 3FLGA 3OYAA 2JZ2A 2E5QA 3OYHA 3DLMA 3L42A 2B8AA 5KH6A 3GOXA 1WJRA 2PQWA 5C0MA 2RJDA 4A4GA 3OA6A 3L2WA 2X4YA 3F70A 2D9TA 4E7JA 4E7IA 2BKDN 1N27A 2LCCA 3BDLA 3S6WA 2NLUA 5J26A 3OYCA 4LD6A 3MEAA 1WJSA 2EFIA 3LLRA 2HQEA 3NTKA 3QBYA 3LH0A 3PFSA 2RJCA 2JTFA 4QQGA 5KE3A 3OYLA 4BACA 3OYEA 5C6SA
chains in the Genus database with same CATH superfamily
2ZPGB 1WXTA 2MCNA 1WJQA 3QDRB 2LVMA 1EFNA 4BUGA 2D1XA 3QXEB 5GAMf 1VQPQ 4KDLA 1JBMA 4M77C 1G3SA 2CP0A 2CREA 4FU6A 2RO0A 4EMKC 3M0TA 2HSPA 3DLLA 4FT4A 2V8KA 5KYXB 3MB5A 5D7UA 1CSKA 1JJ2A 1WHMA 1X6OA 1M8MA 2A0FB 4Q5WA 3UA6A 3MP8A 1G3YA 4IUPA 4WCIA 2DL8A 3A8LB 2WSCE 2D8JA 1YJWQ 2JMCA 3S3NA 3QQ7A 3LWIA 2CGHA 2EQJA 1S72T 2EJ9A 4J8OA 2LNHB 1VQPT 1ZSZC 4VUBA 4MZMA 1YFNA 4J9GA 2NUPA 1KC8U 3OYKA 3CMEQ 4DA4A 1M1KU 5L23A 4JRPA 2LW6A 3NTHA 2MM2A 1H3HA 3FDRA 1BI3A 1M8VA 3OB9A 3I5RA 2ZZDA 2DJQA 4N0AC 3H6ZA 5CD1A 2LCLA 1YHQT 1RADB 2VVKA 5CAIA 1GXIE 3LGFA 1GFCA 2CP6A 4LXCA 3ZJTA 2GFUA 3QJYA 1HYOA 1QP2A 2JZ2A 2DERA 2EKHA 3VS5A 2QQ9A 3TVTA 4E7ZA 2DRMA 1WPYA 4E7JA 1AWWA 2LCCA 1BKBA 4J9IA 5LJ3g 2AZSA 3HL8A 1ZUYA 4F04B 2HNIA 2FZKB 4RTXA 4AMCA 2MIOA 4HVWA 1I5OB 4BE1A 1SKUB 2LRQA 5DM7R 1N8RU 2ESWA 4FW1A 4C8QG 1KHCA 3G71T 4GY5A 1UUEA 2PNIA 9ATCB 3V7SA 1CZ4A 4C0DC 3EAEA 1UGRB 4A4HA 1WLPB 2COYA 4FM4B 5GAN8 3HRTA 1QLYA 3JCMf 3TSZA 4UC4A 2CP3A 2V8IA 1FXXA 1NYFA 4L59A 2P84A 4RMOA 4M7AC 3UWNA 5KCOA 4PL6A 4JRIA 8ATCB 1Y96A 2JOYA 1BI1A 2R57A 2YRDA 2CP7A 3PTAA 1X6GA 3ZGZA 2RHXA 3M57A 1K9MC 2AZVA 1OOTA 5GMKh 5LJ3j 4C5GA 3META 1OU9A 3NFCA 2K7AA 3R6OA 2QDLA 3MO8A 1QCNA 2COZA 5KYUB 5EQJB 2BZXA 3CCQT 2CZ0B 3OYNA 1MNEA 1X6BA 1FWZA 3FJ5A 4C5EA 3CCVA 2F5TX 2CUBA 1NJIU 1UDLA 3AHUA 3CCRA 1VQMT 1NPRA 2XI9A 1YIJA 2RK2A 4FL6A 4Z02A 4C92E 3CXCP 1ZC1A 2VB6A 3V7RA 5CK9A 1I0CA 3CBOA 3HSBA 3CPWA 7AT1B 4NOYA 5GAMe 1G3TA 4DQ2A 5LJ3h 1WZOA 3CCJQ 3GF5A 2OAWA 2P0PA 1UJYA 3JCMW 1VQ5T 1VQ7Q 3S6WA 2JUFA 4OB2B 1M3AA 2G6FX 1DJ7B 1OQKA 2JTFA 1C1AA 3JCMe 2LQKA 3TREA 1UJ0A 1SHGA 2DZ9A 2NYSA 2B86A 2QA4Q 1ZLMA 1E6GA 5GAMh 2QA4T 4IUTA 3CCJA 2GNCA 2E5KA 2WSFE 3VV0A 2DD4A 1XQHA 3H8ZA 3L2VA 1N9RA 1C0MA 1W2BP 3X24B 1Q7YR 1CR5A 2YWWA 1Y96B 2QQSA 4JZ4A 4C92B 2E12A 3CCRT 2BZYA 4ZN3A 3J7AF 1KSWA 3PT9A 4M78C 4HKEA 5A0DA 2L5QA 4JJCA 2ZPEB 1BI2A 1V1CA 2DF6A 1M5Q1 2QEXT 2BE7D 3ULRB 2AKLA 2JVVA 2RM4A 3SWNC 4M75G 2W0ZA 2DVEA 3FB9A 3QZ9B 1N8RC 1G2BA 2JNGA 5LJ5h 4OP0A 4ME7A 2P4RA 2M0OA 5IHNA 4BI8B 4E7LA 2H3EB 2K79A 2CT3A 2ZPBB 5FTJA 1KQ1A 5KYYB 2X3XD 1OI1A 1KHIA 1NEGA 4F7UB 1D0YA 1Y7XA 4M75C 3SDZA 1OX9A 1SRLA 3CCST 2YRVA 3G4ST 2RI2A 4ELYC 3PVLA 2ROLA 5I11A 2VV5A 1YHQQ 3JV3A 3KFVA 1M1FA 2D9TA 2QAZA 2FL7A 2RA2A 2QQBA 4LD6A 1QQJA 1K4US 1M2VA 3CXCA 1LVKA 4RV0A 4P5NA 3OYEA 1OEBA 1VQ7T 1NEBA 3UT1A 2L89A 4N4HA 1Q82C 4J7FA 1O9SA 4J9BA 2KT8A 2DIQA 2JT4A 2DJZA 5D6WA 2A3LA 5GLFA 4BB7A 1Q82R 1GRIA 3O8VA 1IREB 3CCET 1T3SA 3G71A 3X20B 2DTHA 2X35A 2QG9B 3PVQA 1I4K1 2JXBA 4E7SA 2RHUA 1GCPA 3E19A 3MKDA 1JQQA 3EG9B 3TEEA 1K8AU 1JRIA 2KR3A 4XTZA 2DIGA 4N0AA 1PRMC 2OI3A 3I9QA 5DLQE 2CP2A 1QCFA 3G6EQ 3A8OB 1H3ZA 1MMNA 3CCMT 1E7OA 3UF4A 2OTJQ 1PWTA 3PGGA 2DYIA 3M4YA 4XU3A 4C92G 2KSSA 4M4ZA 3DB3A 2AK5A 4XU2A 2ZGWA 4MDXA 1Z9QA 3EFRA 3OBWA 5KYYA 5GAOn 5GANg 2CZ7B 1SSFA 1UGVA 1B34A 2XD0A 1WXBA 1KD1U 4J7IA 2CP5A 4RTUA 3RMQA 4KT0E 3QJ6A 2E6ZA 2KT1A 1VQMA 2QXFA 3OYHA 1S3SA 4LD9K 1VUBA 2DNUA 4J9HA 5GANe 2FRWA 2LX9A 2AIRB 3F70A 1I81A 4DBFA 1QDNA 3CMAQ 1YITT 3EHQA 2JTMA 1P92A 2EYWA 3QBYA 2XG8D 2Q1CX 5CQXA 4QQDA 4AQ7A 1S1NA 2HKQB 4M78E 1FX7A 4KO8A 1MNDA 1QCOA 1TU0B 5I2MA 5GANf 2DA9A 3A8GB 2J6KA 4AFZC 1QWEA 1UGPB 1XJWB 3CCMA 4FCYA 2M1HA 4LDWA 4JS4A 3GLXA 4QVZA 3FEOA 4C5IA 3EH1A 3CMET 2BTTA 2ABLA 2KEAA 3M59A 1XNIA 3E9GA 3NMZC 3VS1A 3OYGA 5CIUA 4M75F 1OPLA 3QUIA 3OS1A 4PLIA 3CC7A 1VQ4A 3AT1B 2F2WA 3JCMP 1QVFP 1K9AA 2L0AA 4R0KA 1QWFA 3QG1A 1VQ8T 3C94A 4CQNA 2LX7A 5GAOl 2Z0WA 5GJWB 2EVRA 3MEWA 2HDAA 1M9SA 2RJEA 3ZL7C 5FRMA 3LYIA 2EPDA 4M77B 2LCSA 4RTYA 1Q82U 2MWOA 3MP1A 4EMKB 4PJMA 1VQLA 4L5GA 1UGQB 3Q1JA 2QDYB 1YJWA 4ARCA 4M7DF 3CC2A 1VIEA 4AT1B 2EQKA 1VYTA 3C0CA 4PJOA 2XDPA 1S72Q 1YBYA 1BCOA 4YTLA 2M02A 3VS2A 3OBYA 5KYUA 1WJRA 5GAMj 1I8FA 1ZSZB 1D0ZA 4A4GA 5GMKm 4E7IA 2J7IA 1VYVA 1UG1A 1UTIA 1FMVA 3VRYA 4M77E 1YJNA 3REAB 4LDXA 1WX6A 1VQ8A 1D1BA 2ECZA 2QTXA 1MMGA 1UEBA 1EIFA 2GF7A 4JJBA 1GBQA 1LCKA 3G71Q 4OMMA 3JCMJ 1G83A 1SF9A 4D6WA 5HCKA 1VQ7A 3ZJVA 1ZQ1A 4HCZA 1O54A 2V1RA 4JZ3A 1PRLC 3HHTB 2OTLA 4M7AA 3IQLA 4M75D 2EQUA 1U1SA 1VQNQ 1EZZB 1QVFA 1WQWA 3P8HA 1X27A 4HVVA 5DLOA 4FYVB 3S3MA 4JS5A 2P4TA 1OV3A 3CCEA 2R5MA 5IAYA 2DX1A 3BFMA 1WHHA 3U23A 4ESRA 4R55A 1RAEB 2LJ3A 4JRQA 2CYZB 3G1JA 3OS2A 1PKSA 3VYGA 2DD5A 5LJ5d 3HRUA 3NTIA 4XQ3A 2AHJB 4X9CA 4AFSC 3JRZA 2HAXA 2F69A 5DYIA 3M0UA 3CMAA 3L2RA 3PNWC 3TQ7P 3EG3A 3S3OA 2DO3A 2O9VA 3MPUB 1YJNT 3MCAB 3L2ZA 2X4XA 1OZ3A 4FW2A 2YRCA 2L3PA 3OYIA 3CC4T 1AZEA 1GCQC 2HBPA 4RG8A 3CCUT 4JPBW 4PJLA 1LOJA 3FC3A 2KY9A 2IPOB 1YIJQ 4X1VA 4J9CA 5LJ3f 3QWZA 1MMAA 1TUDA 4XTWA 4A53A 4DBHA 1WFWA 2VC8A 1NJIC 4HT9A 1W2BA 1W2BS 2RD1A 3QC8A 2L3RA 5CCBA 1PNJA 3ZBDA 1YN8A 4IIMA 3L1AA 4Z88A 3LWHA 1WQ7A 3QO3A 1JJ2S 1KQ2A 4M7AD 1ZUKA 1ACMB 4JDSA 1R77A 1KD1R 2MMPA 4XTUA 2M16A 3CMAT 1IO6A 5D6YA 4LNPA 1KK7A 4BD3A 1ZBXA 4PJOC 1WLFA 2XK0A 4KGVB 4J9DA 3CD6T 2YUOA 4PJOF 4DEXA 5LJ5g 2ROTA 4XAXB 1AZGB 2Q1AX 3P8BB 1IZ6A 3MEUA 2L8DA 1W70A 3OYFA 1VQNT 2QASA 1Y0MA 4EDUA 4IUUA 5M9OA 2DBKA 4ZTJA 1VQMQ 1H92A 1AEYA 2RK1A 4C8QC 2DL3A 4RKUE 1O75A 5FLXE 3ZFJA 4DOWA 3CCLQ 2D8HA 2DL7A 4OGEA 2QQAA 2BZ8A 2RQRA 4CC4B 2E1HA 1U1TA 2HQXA 2HMAA 3E9FA 1YJ9A 2O4XA 3OMCA 1JO8A 4M75A 1M90C 3SB2A 2MWPA 2X3WD 3P8DA 1HK9A 2X9HA 2O88A 3INZA 3NGPA 5IHIA 4O6JA 3T9NA 3EG1A 1AWOA 2GQVA 4M78B 3EHRA 2RHZA 1SRMA 2RHYA 1CKBA 5LJ5j 1TTHB 1J3TA 4M78F 3GNGA 1RI9A 5CO7A 1M1GA 1D09B 5FWBA 2WSEE 3CQTA 3DLMA 2B8AA 3H0HA 3O5ZA 4EPCA 2OJ2A 1ARKA 2EYQA 1Q86U 3JCMV 4PFPA 5L8RE 5IXFA 1OU8A 1WJSA 4KULA 5FU6B 2CSQA 2NUPB 3OYYA 1TSFA 2EYXA 4J6XA 2F5KA 2DL4A 3RKWA 5HY6A 1ABQA 1K0XA 4PK4A 1QKXA 2ZPHB 5C1BA 3I55T 1IRXA 1UFFA 2OTJT 2RH2A 1BU1A 2KK4A 2IVWA 4FYWB 4PJJA 1OYXA 1RLPC 4JLGA 1TWBA 2RJFA 4KODA 3KBGA 3FPUA 4FYYB 4PNOA 4MZPA 4Y28E 2F2VA 4C0GA 3I5SA 4C8QE 3GP8A 2JJ9A 1K1ZA 1NBEB 3M4GA 4HVUA 3J80E 2OTLT 1RUWA 3KUFA 3EGDA 1VQLQ 4F17A 4J9FA 1NE8A 2VYTA 2E3HA 1PC0A 2D6FA 2MAMA 3QDFA 2PVOB 4F7UA 3H0FA 4WF2A 3URGA 1NLPC 2L3QA 2J05A 4B9XA 3JAME 2WACA 1H641 1K73R 1LPLA 1M2VB 2MI6A 3JB9J 2F1LA 2QEXQ 1I1JA 4LUDA 5CVIA 3NHNA 1Q7YU 1I5LA 2FO0A 1Q81R 3OW2A 4JJNK 3EFSA 1QVGA 6AT1B 1HXDA 3QKJA 3JCMh 2HL5C 4KH1B 2P0KA 1WHGA 4AG1C 3X26B 5J39A 1NYGA 4PFOA 5GAOr 4RUGA 3LGAA 4NL3A 2RJDA 2OTLQ 3V8LA 1YP5A 2X4YA 2BKDN 3FJPA 3OYCA 4CC7A 3EFOA 1T0JA 1WHJA 3G7ZA 3LH0A 2K2VA 3VU3C 1M90R 1SG5A 1RLQC 1G3WA 2R58A 3FIFA 3QWXX 2VASA 4BY6C 1PD1A 3A1PA 3I55Q 5A0LA 1D3BB 2HCKA 3VJPA 4II1A 2KQWA 3MEVA 1QCSA 4JRKA 3LW5E 4XU0A 3ME9A 1XOVA 2Q18X 3FRNA 1OULA 2O01E 1YNZA 5KCHA 5FW9A 2O31A 3FPTA 4ZGEB 4OB0B 2KRNA 3QYHB 3R6NA 2EWNA 4KBMB 1NG2A 1S72A 2KDSA 4O5VA 1YIJT 2LT4A 1IGUA 2EW3A 4M77D 1KC8R 2RQTA 2ED0A 1SPKA 2GBQA 3I35A 3JB9F 1VQ6Q 3QQ8A 4X34A 1RAHB 4C8QF 3OW2P 5FU7B 5GAN5 2EQIA 2VKNA 4B9WA 1YCSB 1QVGP 3ZJUA 1Q81C 1RAAB 1RAGB 2QQRA 2ENMA 2YVLA 3JB9I 4C8QD 3NPFA 4ELZC 1IXDA 3M55A 2JS0A 1HD3A 3I56T 2J6FA 3VKIA 4LDVA 1K8AR 5FRNA 3CD6Q 5GAN6 3D7SB 1ZA2B 4M7DA 1BIBA 2V1QA 2SEMA 1QKWA 4BDYA 2PVDB 2X4WA 3FLGA 2AT1B 2FRYA 2GTJA 2VXFA 4Y91A 4ZNXA 1U8RA 2HD0A 5GAOp 2A36A 2PVGB 3SEMA 2LZ6B 4M78D 4XU1A 3CBMA 1E32A 1VQ9Q 1RABB 2YUQA 2HQHA 2KXDA 3CCRQ 1KG1A 3I56Q 2JW4A 3VS4A 3L2QA 5GMKe 2RHIA 2DLPA 2Y4YA 4NL2A 2QYZA 1Q81U 3C95A 2DFUA 4C92D 4M7DC 1KJWA 2DMOA 4HXJA 4AG2C 4GLMA 4JLIA 2ZPFB 3QYGB 3RBBB 2ZPIB 4NS5A 3E2UA 4ZGDB 2LTOA 4M77A 4BE0A 2LNVA 4AS1A 2E70A 5GANd 1MUZA 2XU8A 4PJNA 5EG2A 2LMJA 3CCSQ 1YJNQ 4EMKA 3OS0A 1WHLA 2K3BA 2OX7A 4XTXA 4MZTA 2L3SA 1N6AA 3CCSA 1B07A 5I21A 3PIOA 4M7DG 2JV2A 4PJOE 1EX4A 5GANh 2FG0A 1UHCA 3VS3A 3JB9H 1VQOT 5GMKl 3E1SA 2HEQA 1VIFA 1VOMA 1JU5C 4ZTFA 3LGLA 4DBQA 1UGSB 1MHNA 1LJOA 2ZCFB 3CCQA 4RTWA 2EIFA 1FMWA 3CCVT 1PD0A 2CT4A 1AWXA 2LQWA 2RI5A 2E6NA 1U3OA 1D0XA 2DXUA 2CSIA 2DZCA 3HRSA 5GAMd 1VQKT 2A08A 3REBB 1VQPA 2NUZA 2CH4W 1BK2A 1IB8A 1VQKQ 3HFNA 3RKXA 2NLUA 2DRKA 2EFIA 1X01A 2MK5A 2DETA 4BACA 2JTEA 3M5AA 5HK3A 2NUTA 2LT1A 2J6OA 2A37A 4J5YA 3X25B 5IH2A 2M0YA 2EBPA 1SSHA 4EMGA 2LP5A 3LHDA 2EYYA 1B34B 3EGUA 3HP9A 1G5VA 1VQ5Q 1T0HA 4JUVA 1K0SA 3DKMA 3JCMd 4WTOB 3HU3A 3JB9G 1NZ9A 3M0PA 5KYWA 2PUKB 4CRIA 2E41A 2FPDA 2IG0A 2K9GA 1KIKA 4A4FA 2DAQA 1KC8C 1K9MU 4IKFA 5ERGB 2QEXA 5ECAA 5KYNA 2AKKA 3MHXA 3A8MB 1RACB 2HSEB 4J83A 5GJVB 1IHVA 1SHFA 3JB9D 1NPPA 4HA8A 3THKA 1K73U 3GNFB 3RNJA 4HT8A 1YITA 4M75E 1M2OA 4PJOB 3ASKA 4ORZA 4E7KA 3TU4K 3SD4A 2EQMA 2LDMA 4LN2A 1PCXA 3VS7A 1UB4A 1KQSA 2LJ1A 2R5AA 4PLLA 3RKYA 1R7RA 4OMPA 3RUXA 2JM8A 4XTVA 4OGCA 4OMNA 1WDXA 1M4ZA 4AFQC 2QGGA 4C8QB 2KXCA 2JM9A 4IUQA 1G8XA 3QZ5B 1NM7A 5CKDA 3PIPA 1F1BB 2RF0A 3CMEA 2YHTA 4XTYA 3SWNA 1YI2A 5CCAA 2JMAA 3CC2Q 5J26A 3VUZA 4DBRA 2E3IA 3G4SA 3VS0A 4KGZB 2XICA 2OAUA 2IIMA 5C6SA 2GQIA 2KYMA 1B7TA 3TIWA 1AOJA 2D0QB 1QVGS 1KQSS 3OYDA 1PSEA 3PMIA 4KGXB 4AFUC 5GAMg 3OMGA 2EYZA 4FIBA 2C0IA 2BIVA 1PG5B 3BDUA 2K5FA 3EH2A 1R0BG 2C0OA 1ZHIA 1M27C 3PE0A 4OMQA 3H9NA 2DXBA 2DTOA 2H3JA 3A5ZB 4PJOG 1H8KA 2DBMA 1YJWT 2X51A 3VYHB 5FU6C 1QVPA 5IT9E 4QKUA 1X69A 4PFZA 3SFMA 2HKNA 4ANJA 1ZUUA 5EPPA 2DK3A 1VQOQ 1ZA1B 3HPWA 2FPEA 1BI0A 1I07A 2DL5A 2PUOB 1D3BA 1Q95G 5CKHA 4E47A 1BCMA 5IHKA 2C0TA 1GBRA 1XTDA 3H41A 4GLKA 1ZBJA 2BUDA 4CI0C 4FYXB 4J6YA 5CR2A 1Q86C 3VS6A 3JSCA 2VGNA 1GL5A 3EG9A 1VQOA 1ZSGA 1YWOA 4RTTA 1WHKA 2YXYA 2EKOA 4KDIA 3X28B 4F16A 4D8KA 2FHDA 1M1KR 4N4GA 2RPNA 3ZEHA 2V8JA 3PMTA 2ATCB 2YT6A 4HCCA 3V8JA 2DVJA 2E5QA 2PTKA 2RB6A 4QT7A 3JCMc 4ZGJB 1YWPA 2DE0X 3OA6A 3RESA 5GAN7 1OPKA 1N27A 2NWMA 3LLRA 1VQKA 1FMKA 4IIOA 2RMOA 2Q19X 3BE3A 2RJCA 1A0NB 2FZCB 4ARIA 3J81E 4A54A 1KD1C 3CXCS 4V2SA 1IHWA 5B6CA 2YUPA 2KGTA 1N9SA 3BW1A 2CDTA 3OSVA 2SRCA 3G4SQ 3WVDB 2VGMA 4DEYA 3H0IA 1RAFB 1TUGB 4N4IA 3CCMQ 2ZAEA 4PKCC 5I2SA 4R56A 3RERA 1NJIR 2W10A 1IGQA 5AYFA 1X75C 3CCUQ 3GPLA 1K76A 2JS2A 2P0QA 4KH0B 3FPRA 3RIRA 4ATOA 4M77G 4OMOA 3M58A 5HKCA 3UA7A 1Y71A 3M0QA 2GGRA 1K8AC 4C5HA 1MV3A 3EG0A 3RDVA 1VQLT 4BY6B 5GMKi 4QW2A 1VQ4T 3CC7T 2O9SA 5GAOq 2KRMA 4X9DA 3HFOA 4Y92A 3C4SA 2PU9B 2DPPB 3V7CA 1N5ZA 1Q86R 2Y90A 2FB7A 3JCMX 2EGEA 1M30A 4Z8AA 1AT1B 5CQYA 3OYMA 3CCVQ 4BDZA 1YI2Q 2X4JA 4F7UE 2YLBA 2B25A 1JB0E 1Z9ZA 4IURA 3HKSA 4C0DB 3UDCA 1UE9A 4C0ZA 1BBZA 2KMTA 4RCCA 2DM1A 3CC2T 4MMLA 2QTVA 2JN0A 2K4YA 1JEGA 2Y4XA 4M7AF 2E4HA 1HJDA 5GAN3 5FTMA 5FU7C 3JCMb 5GAN2 4M7AB 3MEAA 2PJHB 4C8QA 4A63B 1AHJB 4KUDK 2O2OA 4HCBA 1VQNA 4JJDA 4KLNA 1YI2T 2O4XB 4QQ6A 1B3QA 4MDWA 1CKAA 1YCYA 4F7UG 2RQWA 4DOVA 4LDYA 1R0CB 1U5SA 2MPXC 1UECA 5FROA 5GAOm 2RI3A 4L6V5 4M78A 5FTLA 3C12A 1HSQA 2EGCA 1MMDA 3CPWS 3A8HB 3CCLT 1U06A 4FSXA 5LJ3d 1VQ9T 5DYGA 3M0SA 1WI7A 4J6WA 5FTKA 2RNAA 2VUBA 1X2KA 2QI2A 5FWCA 1AD5A 1QVFS 3CPWP 5KYXA 1SEMA 4E6RA 1QP3A 1X2QA 3OYJA 2MYSA 2Q1DX 1PHTA 2DEUA 1TH7A 4OVAA 1WYXA 2FPFA 4M7DB 2EJFA 2EAYA 3WXMB 2CUDA 3EGXA 3CBPA 2M9UA 2PZ1A 3CC4A 1VQ4Q 3CC7Q 1M3BA 2CZ6B 1M3CA 1OX8A 1X43A 4EIKA 5CKEA 2RQVA 1VQ8Q 3I55A 3BY7A 2A7YA 1RAIB 3HTRA 2BE9B 4BI4A 4E2FB 4RG2A 3CEYA 4MMKA 1YITQ 3RR6A 3M56A 2KE9A 2YSQA 1KFZA 2XMFA 2KNBB 3OYAA 2XKOC 1QW1A 5AT1B 3UPUA 5KH6A 1TOVA 2DKGA 3CCUA 3EGXB 4C92C 1V76A 3RMSA 1I9GA 1CZ5A 2YUNA 3JCMQ 4C92F 4QQGA 4QVCA 2KROA 5GMKj 5LJ5f 3GBQA 3LX7A 4XK8E 1PSFA 5KE2A 1KQSP 4OB3B 4CC2A 3TCJA 4OF1A 4A4KA 1JXMA 2H8HA 4M77F 3OW2S 2J06A 4OMFB 3SWNB 1VA7A 4ZN1A 1AVZC 3V8KA 2KVQG 2LC4A 2XHCA 3EG2A 3HU1A 4TVRA 2CH4A 4M7DD 5EC7A 1PKTA 4KUIA 1MV0B 1W4SA 4F7UF 1LNXA 3A98A 1FYNA 4J9EA 4OB1B 3CD6A 5A0GA 2KRSA 3ER0A 4BI3A 1OZ2A 4PJOD 5LJ3e 2MM0A 2ED1A 4M75B 3EFOB 2K3YA 1ZSZA 4M7DE 1YJ9Q 2LQ8A 3L2UA 2E10A 2G3RA 1TUCA 2K3XA 1V29B 2MOXA 3OS5A 4HCKA 2K5LA 2YLCA 2HL3A 2HBWA 4RTVA 4A4EA 3G6EA 1ZX6A 2L2PA 1RI0A 5D6XA 3CPFA 2M51A 4KRTA 4EMHA 1YHQA 3WVEB 2RQUA 3M9QA 3CCQQ 3CCEQ 5LL6S 4M7AG 1N8RR 3KXTA 3QIIA 3M54A 3CF2A 3OYBA 2KI7A 2FZGB 4CC3A 2K5IA 2V26A 1YJ9T 2PWYA 5J3BA 1AWJA 2FEIA 5CKBA 4M78G 1TG0A 2YUJA 5LJ5e 2QGFB 1UHFA 2E65A 3GOXA 5C0MA 1BYMA 1W1FA 5GAN4 3BQBA 5GANj 5C18A 3QSUA 3NTKA 2E64A 2XIDA 1WIEA 2A28A 3M53A 5KE3A 1D1CA 1GFDA 5KYWB 4M7AE 5CKFA 1JXOA 3VUBA 2GTOA 4LDUA 4B6MA 3QHSA 5CCXA 1ABOA 3EGDB 1WA7A 1BB9A 3DB4A 4K11A 1PM3A 1QMCA 1K73C 4IUVA 4QVDA 3G6ET 2K2MA 3UATA 5DY9A 2FVUA 2EJGA 2OTJA 2VWFA 2XDBA 1RL2A 1VQ6T 4RCBA 2I0NA 8AT1B 3OQ5A 2KAFA 2D0NA 2NUTB 1WNLA 1TS9A 2CKKA 4E7HA 3I56A 2K6DA 2MF2A 2COWA 4D8DA 4RTZA 3CCLA 2DXCA 1TXQA 1VQ9A 2EGAA 2GFAA 2LQNA 3OSSC 2KYBA 2LJ0A 4C0FA 2XDDA 4C92A 2F2XA 3MP6A 4LUEA 5IN1A 3CC4Q 5HK0A 1WXUA 4GBQA 4FT2A 1Y07A 5I22A 2I2LA 2FYKA 2CS7A 1T3LA 3QWYA 2DYBA 1VYUA 5IXBA 1Y57A 3M0RA 1C6VX 3QPHA 1E6HA 2DTIA 3SHWA 5FTNA 4OMLA 3HU2A 2DXTA 3TSWA 2K57A 2HZYA 2RN8A 4LE9A 4BE2A 4F14A 1BIAA 1W6XA 3N5BB 5A2QE 3LH5A 1K9MR 1GCQA 1R8OB 1VQ5A 3OY9A 4FSSA 2C06A 1WGSA 2DEQA 3VRZA 3GIBA 4Z89A 2VXEA 3L42A 2DILA 1VQ6A 2PQWA 2GCXA 2YDLA 1M90U 3L2WA 1D1AA 3BDLA 3JCMg 1NLOC 1JJ2P 2KBTA 2HQEA 3MJXA 2QA4A 1M1KC 1MGQA 3CCJT 3PFSA 1Q7YC 3OYLA 2CZ1B 2QK0A
chains in the Genus database with same CATH topology
4QQDA 3J81E 4AQ7A 4A54A 1KD1C 4M78E 1FX7A 3CXCS 4KO8A 4V2SA 2ZPGB 5I2MA 5B6CA 1WJQA 1G3WA 2R58A 2LVMA 3QDRB 5GANf 3FIFA 1N9SA 3A8GB 3BW1A 4BUGA 3OSVA 4BY6C 1UGPB 3QXEB 5GAMf 3WVDB 3CCMA 2M1HA 5A0LA 1D3BB 4LDWA 2VGMA 4JS4A 4KDLA 3GLXA 4QVZA 4N4IA 3VJPA 3FEOA 4II1A 2KQWA 1JBMA 4C5IA 4M77C 3MEVA 1QCSA 1G3SA 4FU6A 3LW5E 4JRKA 2RO0A 3ME9A 1XOVA 4XU0A 3VU3C 4EMKC 4E7LA 4PKCC 3DLLA 2Q18X 4FT4A 2V8KA 3FRNA 5I2SA 4R56A 3CMET 3RERA 3MB5A 2O01E 5AYFA 1X75C 5KCHA 1JJ2A 1X6OA 4Q5WA 3M59A 3GPLA 4ZGEB 4OB0B 1XNIA 3MP8A 1G3YA 3QYHB 3E9GA 2EWNA 4KBMB 1S72A 2KDSA 5CIUA 2P0QA 4M75F 4IUPA 3OYGA 4O5VA 1YIJT 3FPRA 3QUIA 3RIRA 2LT4A 4ATOA 3OS1A 4M77D 4M77G 4PLIA 3CC7A 1VQ4A 3A8LB 3M58A 5HKCA 3JCMP 2WSCE 3QG1A 1Y71A 3S3NA 1VQ8T 3QQ7A 3LWIA 2CGHA 2EQJA 3C94A 1S72T 2EJ9A 4J8OA 4C5HA 5GAOl 1VQPT 1K8AC 4CQNA 3JB9F 3QQ8A 4X34A 4C8QF 4BY6B 5GMKi 1VQLT 4QW2A 4VUBA 1VQ4T 3CC7T 5GAOq 3MEWA 4MZMA 5FU7B 5GAN5 4B9WA 3ZJUA 1KC8U 1Q81C 1M9SA 2RJEA 3OYKA 4X9DA 5FRMA 3HFOA 3LYIA 4DA4A 2QQRA 4M77B 3C4SA 2PU9B 2DPPB 1M1KU 1Q82U 3V7CA 2MWOA 3MP1A 2YVLA 4EMKB 3JB9I 2Y90A 4JRPA 4C8QD 1VQLA 2FB7A 4L5GA 3NTHA 4ELZC 1UGQB 3Q1JA 3FDRA 3JCMX 1BI3A 1M8VA 2MM2A 2QDYB 3OB9A 1YJWA 4ARCA 2ZZDA 4M7DF 3M55A 3CC2A 4N0AC 5CQYA 1VIEA 3OYMA 3H6ZA 4BDZA 3I56T 3VKIA 2EQKA 5CD1A 2X4JA 4LDVA 2LCLA 1YHQT 4F7UE 2YLBA 4PJOA 2B25A 2XDPA 5FRNA 1JB0E 4IURA 5GAN6 3HKSA 5CAIA 1YBYA 4M7DA 1GXIE 1BIBA 4C0DB 3UDCA 4C0ZA 3LGFA 4BDYA 4YTLA 2KMTA 4RCCA 3CC2T 3ZJTA 2GFUA 2PVDB 3QJYA 4MMLA 2X4WA 2JN0A 1QP2A 2JZ2A 2K4YA 2Y4XA 3FLGA 3OBYA 2QQ9A 4M7AF 5GAN3 1WJRA 5GAMj 1I8FA 2VXFA 4Y91A 4A4GA 5GMKm 5FU7C 5FTMA 1U8RA 2HD0A 1WPYA 5GAOp 3JCMb 2PVGB 5GAN2 4E7JA 4E7IA 2LCCA 4M7AB 1BKBA 5LJ3g 4M78D 4XU1A 3MEAA 3CBMA 1E32A 3HL8A 4C8QA 2PJHB 4KUDK 1AHJB 4HCBA 2HNIA 1VQNA 4M77E 4KLNA 1YJNA 1KG1A 1YI2T 2LW6A 2O4XB 4LDXA 4BE1A 5DM7R 2LRQA 4QQ6A 1N8RU 4C8QG 1VQ8A 2QTXA 4MDWA 5GMKe 3L2QA 1KHCA 2RHIA 2Y4YA 1UEBA 4NL2A 3G71T 1YCYA 4F7UG 4DOVA 4GY5A 1EIFA 3C95A 2GF7A 4LDYA 1Q81U 4C92D 4M7DC 4M7AG 3V7SA 3JCMJ 5FROA 4D6WA 3ZJVA 5GAOm 1VQ7A 1CZ4A 4C0DC 1ZQ1A 2RI3A 3EAEA 1UGRB 4HCZA 4JLIA 1O54A 4L6V5 4A4HA 4M78A 3HHTB 2ZPFB 3QYGB 5FTLA 2ZPIB 4NS5A 4FM4B 2OTLA 5GAN8 4M7AA 4ZGDB 2LTOA 3HRTA 3C12A 4M75D 2EQUA 1U1SA 3CPWS 3A8HB 4M77A 3JCMf 3CCLT 4BE0A 4UC4A 1QVFA 1WQWA 3P8HA 4FSXA 2LNVA 2V8IA 5LJ3d 1VQ9T 1FXXA 5DYGA 4AS1A 2E70A 4L59A 5GANd 5DLOA 3S3MA 2XU8A 5EG2A 4RMOA 2P4TA 4JS5A 4M7AC 3UWNA 4J6WA 5KCOA 4EMKA 5FTKA 4PL6A 4JRIA 3OS0A 3CCEA 1Y96A 2R5MA 2VUBA 2JOYA 5IAYA 2QI2A 1BI1A 2R57A 3BFMA 4R55A 3PTAA 1QVFS 4XTXA 4MZTA 3OYJA 4JRQA 2CYZB 1QP3A 1N6AA 3ZGZA 2RHXA 3M57A 3OS2A 3CCSA 1K9MC 5GMKh 5LJ3j 3VYGA 5I21A 2DD5A 4C5GA 3HRUA 3META 3NTIA 5LJ5d 3PIOA 2Q1DX 4XQ3A 4M7DG 1TH7A 2JV2A 2AHJB 4PJOE 4OVAA 4M7DB 4X9CA 3JRZA 5GANh 2EJFA 3NFCA 2EAYA 2HAXA 3R6OA 3JB9H 3WXMB 2F69A 5DYIA 3MO8A 3CMAA 3L2RA 1VQOT 3PNWC 5EQJB 5GMKl 3E1SA 3CCQT 3CBPA 2CZ0B 1VIFA 2M9UA 3OYNA 3CC4A 3S3OA 1FWZA 2DO3A 4C5EA 3CCVA 2CZ6B 1YJNT 4ZTFA 3MCAB 2F5TX 3LGLA 3L2ZA 1NJIU 2X4XA 1UGSB 5CKEA 3AHUA 1MHNA 3CCRA 1LJOA 1OZ3A 2ZCFB 1VQMT 3I55A 3CCQA 3BY7A 2A7YA 3FPTA 1NPRA 2EIFA 3OYIA 3CC4T 2XI9A 1YIJA 2RK2A 4FL6A 4Z02A 3CCVT 4BI4A 4C92E 1ZC1A 4RG2A 2RI5A 2HBPA 2E6NA 3V7RA 5CK9A 3CBOA 3HSBA 3CEYA 4MMKA 4RG8A 3CPWA 2DXUA 3M56A 1LOJA 3FC3A 2KY9A 3CCUT 2DZCA 4NOYA 3HRSA 5GAMe 5GAMd 1G3TA 2XKOC 1QW1A 3OYAA 1VQKT 3UPUA 1VQPA 4ARIA 4DQ2A 5LJ3h 5KH6A 3GF5A 3HFNA 2P0PA 3RKXA 3JCMW 1VQ5T 3CCUA 2DKGA 3S6WA 4C92C 5LJ3f 2NLUA 2JUFA 3RMSA 4A53A 4XTWA 4OB2B 1I9GA 2EFIA 3QWZA 1X01A 1CZ5A 2VC8A 3JCMQ 1DJ7B 1NJIC 4C92F 4HT9A 2JTFA 4QQGA 3JCMe 2LQKA 4BACA 3TREA 2RD1A 4QVCA 1W2BS 3M5AA 5GMKj 2DZ9A 5HK3A 2L3RA 5LJ5f 3QC8A 2LT1A 5CCBA 3LX7A 4J5YA 3X25B 4XK8E 3ZBDA 5GAMh 1PSFA 5KE2A 3L1AA 2QA4T 4IUTA 3LWHA 4OB3B 4EMGA 3TCJA 3CCJA 1WQ7A 3QO3A 4OF1A 1JJ2S 1KQ2A 4M7AD 2WSFE 3VV0A 4A4KA 2DD4A 4M77F 3OW2S 1W2BA 4JDSA 1XQHA 2MMPA 4XTUA 4OMFB 2M16A 3CMAT 3SWNB 5D6YA 3LHDA 3H8ZA 4ZN1A 4BD3A 3L2VA 1B34B 1ZBXA 4PJOC 3HP9A 1G5VA 2XK0A 1WLFA 4JUVA 3V8KA 1N9RA 3DKMA 2KVQG 2LC4A 2XHCA 3JCMd 3X24B 3CD6T 4PJOF 1CR5A 3HU3A 5LJ5g 3JB9G 1NZ9A 3HU1A 1Y96B 4TVRA 4XAXB 2Q1AX 3P8BB 4M7DD 1IZ6A 2PUKB 2QQSA 4C92B 4CRIA 2E12A 2E41A 2L8DA 3MEUA 2IG0A 4KUIA 1W4SA 4A4FA 3CCRT 4ZN3A 4F7UF 1LNXA 2DAQA 3OYFA 1KC8C 3PT9A 1VQNT 3J7AF 4OB1B 1K9MU 4M78C 4IKFA 3CD6A 4EDUA 5A0GA 2QEXA 4IUUA 5ERGB 3ER0A 4HKEA 4BI3A 1OZ2A 5M9OA 5LJ3e 4ZTJA 4PJOD 2MM0A 4M75B 3MHXA 5A0DA 3A8MB 2RK1A 4J83A 2K3YA 4C8QC 2L5QA 4M7DE 2LQ8A 3L2UA 2ZPEB 4RKUE 1BI2A 1O75A 2E10A 2G3RA 3ZFJA 2K3XA 1V29B 3OS5A 5FLXE 4DOWA 1NPPA 4HA8A 3JB9D 1M5Q1 2K5LA 4OGEA 2YLCA 2QEXT 1K73U 2QQAA 3GNFB 4A4EA 3G6EA 2JVVA 2E1HA 2RM4A 3SWNC 4M75G 4HT8A 1YITA 1RI0A 2DVEA 1U1TA 5D6XA 2HQXA 3CPFA 3FB9A 3QZ9B 4M75E 4PJOB 1N8RC 4EMHA 2JNGA 5LJ5h 1YHQA 3ASKA 4OP0A 3WVEB 3M9QA 4ME7A 4E7KA 3E9FA 1YJ9A 2M0OA 3TU4K 4BI8B 2O4XA 3OMCA 5LL6S 4M75A 3KXTA 2EQMA 3QIIA 3SD4A 3SB2A 2LDMA 2MWPA 3M54A 1M90C 3P8DA 1HK9A 3OYBA 3CF2A 1UB4A 2ZPBB 5FTJA 1KQSA 1KQ1A 3INZA 4O6JA 3T9NA 2R5AA 4PLLA 3RKYA 2GQVA 4M78B 1R7RA 2K5IA 1OI1A 1KHIA 2RHZA 3RUXA 1YJ9T 2PWYA 2RHYA 4XTVA 4OGCA 4F7UB 1Y7XA 4M75C 5J3BA 5LJ5j 3SDZA 1M4ZA 4C8QB 4M78F 3CCST 2YRVA 3GNGA 5CKBA 3G4ST 4IUQA 2RI2A 4M78G 5CO7A 4ELYC 2YUJA 3QZ5B 5LJ5e 1M1GA 2E65A 2WSEE 3DLMA 5CKDA 3PIPA 2B8AA 2VV5A 3GOXA 4EPCA 5C0MA 3CMEA 1BYMA 2YHTA 4XTYA 3SWNA 1YI2A 5CCAA 5GAN4 1M1FA 2D9TA 2EYQA 1Q86U 3BQBA 2FL7A 3JCMV 5GANj 2RA2A 5C18A 5J26A 5L8RE 3VUZA 3G4SA 2QQBA 4LD6A 1WJSA 3QSUA 3NTKA 4KULA 5FU6B 3OYYA 2E64A 2XIDA 3CXCA 4RV0A 4P5NA 3M53A 5KE3A 2XICA 4J6XA 4M7AE 2OAUA 3OYEA 5C6SA 1VQ7T 5CKFA 2F5KA 3UT1A 3VUBA 4LDUA 2L89A 4N4HA 5HY6A 3RKWA 3TIWA 1Q82C 3QHSA 5CCXA 4J7FA 1O9SA 2ZPHB 2D0QB 2DIQA 3I55T 5C1BA 1QVGS 2OTJT 2DJZA 5D6WA 2RH2A 3OYDA 1KQSS 3DB4A 2A3LA 2KK4A 5GLFA 4BB7A 1PSEA 3PMIA 1K73C 5GAMg 3OMGA 2IVWA 4FIBA 1OYXA 4IUVA 4JLGA 4QVDA 2RJFA 3G6ET 4KODA 3KBGA 2BIVA 5DY9A 3FPUA 2FVUA 3O8VA 3BDUA 2K5FA 2EJGA 4PNOA 1IREB 4MZPA 1ZHIA 3G71A 3CCET 2OTJA 3X20B 2DTHA 1RL2A 2XDBA 2X35A 4Y28E 1VQ6T 4RCBA 4C0GA 4C8QE 3GP8A 1I4K1 2KAFA 3OQ5A 2DXBA 1WNLA 2DTOA 2H3JA 3A5ZB 2RHUA 4PJOG 1YJWT 3M4GA 2CKKA 3E19A 3J80E 2OTLT 4E7HA 3I56A 3KUFA 2MF2A 3VYHB 5FU6C 3TEEA 1K8AU 1QVPA 5IT9E 1JRIA 3CCLA 4XTZA 2DIGA 2DXCA 4N0AA 3SFMA 1VQ9A 2GFAA 1NE8A 3OSSC 2VYTA 4C0FA 5DLQE 5EPPA 2XDDA 2DK3A 2D6FA 3HPWA 4C92A 2MAMA 3A8OB 1H3ZA 3MP6A 1BI0A 5IN1A 2PVOB 4F7UA 4WF2A 3URGA 5HK0A 3CCMT 2PUOB 4FT2A 1D3BA 1Y07A 3PGGA 5CKHA 4B9XA 4E47A 3JAME 2WACA 2FYKA 2I2LA 2CS7A 3M4YA 4XU3A 4C92G 1H641 2KSSA 1XTDA 3DB3A 4GLKA 2MI6A 4CI0C 2BUDA 3JB9J 4J6YA 4XU2A 2ZGWA 3QPHA 5CVIA 5CR2A 1Q86C 4MDXA 3EFRA 2DTIA 1Q7YU 1I5LA 5FTNA 3JSCA 2VGNA 3OBWA 5GAOn 4JJNK 3OW2A 3HU2A 2DXTA 1VQOA 3EFSA 5GANg 2EKOA 1QVGA 2CZ7B 2K57A 4KDIA 1SSFA 3X28B 4BE2A 1HXDA 1BIAA 1B34A 2FHDA 2XD0A 3N5BB 3QKJA 5A2QE 4N4GA 3JCMh 1KD1U 4J7IA 3ZEHA 2P0KA 1R8OB 2V8JA 3PMTA 3X26B 1VQ5A 3RMQA 3OY9A 4HCCA 4KT0E 3QJ6A 2E6ZA 3V8JA 5J39A 2C06A 1WGSA 1VQMA 2QXFA 2DEQA 2E5QA 3OYHA 5GAOr 2RB6A 3GIBA 1S3SA 2VXEA 3L42A 4LD9K 1VQ6A 3JCMc 4ZGJB 1VUBA 2PQWA 5GANe 3LGAA 2GCXA 4NL3A 2RJDA 1M90U 3OA6A 3V8LA 3L2WA 2X4YA 2LX9A 3RESA 3F70A 1I81A 5GAN7 2BKDN 3FJPA 1N27A 3BDLA 1QDNA 1YITT 3OYCA 3JCMg 3LLRA 2HQEA 2JTMA 2QA4A 1M1KC 1P92A 1VQKA 1MGQA 3QBYA 3CCJT 3G7ZA 3LH0A 2XG8D 3PFSA 2K2VA 2Q19X 2RJCA 1Q7YC 3OYLA 2Q1CX 5CQXA 2CZ1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QQD A;  2L3R A;  2O4X B;  2F5K A;  3UT1 A;  2L89 A;  4N4H A;  4BE1 A;  2LRQ A;  4QQ6 A;  3LX7 A;  3L2Q A;  1WJQ A;  2RHI A;  1KHC A;  2R58 A;  2LVM A;  2DIQ A;  5KE2 A;  4IUT A;  4GY5 A;  5D6W A;  2GF7 A;  3OYD A;  3DB4 A;  3PMI A;  3OMG A;  5FRO A;  2M1H A;  1OYX A;  4IUV A;  3EAE A;  2RI3 A;  2RJF A;  4HCZ A;  2M16 A;  2BIV A;  4QVZ A;  5D6Y A;  3H8Z A;  4N4I A;  3FEO A;  4II1 A;  3O8V A;  4A4H A;  4BD3 A;  4NS5 A;  4C5I A;  3L2V A;  3MEV A;  1G5V A;  2XK0 A;  2LTO A;  4FU6 A;  2RO0 A;  2EQU A;  3ME9 A;  2X35 A;  4BE0 A;  4UC4 A;  3P8H A;  4L59 A;  3OQ5 A;  3S3M A;  2RHU A;  5KCH A;  2QQS A;  3UWN A;  4Q5W A;  4CRI A;  5KCO A;  3MEU A;  1XNI A;  2CKK A;  2IG0 A;  2L8D A;  3E9G A;  3MP8 A;  4PL6 A;  3KUF A;  4A4F A;  3OS0 A;  2DAQ A;  3OYG A;  2R5M A;  5CIU A;  3OYF A;  4IUP A;  5IAY A;  2DIG A;  2R57 A;  4IKF A;  4EDU A;  3OS1 A;  4IUU A;  4PLI A;  5M9O A;  1OZ2 A;  2GFA A;  4ZTJ A;  2VYT A;  3OYJ A;  2K3Y A;  2RHX A;  3OS2 A;  3S3N A;  4C5G A;  2EQJ A;  3MET A;  3NTI A;  4C5H A;  3L2U A;  1H3Z A;  2G3R A;  3MP6 A;  5IN1 A;  2K3X A;  4OVA A;  4X34 A;  4QW2 A;  3MEW A;  4E7H A;  4A4E A;  3MO8 A;  4B9X A;  4B9W A;  2WAC A;  2RJE A;  3OYK A;  3L2R A;  1RI0 A;  5FRM A;  5D6X A;  2HQX A;  3LYI A;  3PNW C;  2QQR A;  3C4S A;  3DB3 A;  2MWO A;  3OYN A;  3MP1 A;  3ASK A;  2BUD A;  3M9Q A;  4E7K A;  3S3O A;  4C5E A;  3NTH A;  3Q1J A;  3FDR A;  3E9F A;  4ZTF A;  2M0O A;  3OB9 A;  3LGL A;  2O4X A;  3OMC A;  4E7L A;  2EQM A;  3QII A;  3SD4 A;  2X4X A;  2LDM A;  2MWP A;  1MHN A;  3P8D A;  3OYB A;  1OZ3 A;  2EKO A;  3OYM A;  3H6Z A;  4BDZ A;  1SSF A;  4BE2 A;  2EQK A;  2FHD A;  3OYI A;  2R5A A;  3QKJ A;  2XDP A;  4PLL A;  5FRN A;  4FL6 A;  4Z02 A;  4N4G A;  1OI1 A;  4IUR A;  2RHZ A;  2RHY A;  4RG2 A;  2RI5 A;  2E6N A;  3ZEH A;  2P0K A;  3PMT A;  3CEY A;  3LGF A;  3OY9 A;  3FC3 A;  4BDY A;  3QJ6 A;  5J39 A;  1WGS A;  2GFU A;  2YRV A;  4IUQ A;  2RI2 A;  2X4W A;  3FLG A;  3OYA A;  2JZ2 A;  2E5Q A;  3OYH A;  3DLM A;  3L42 A;  2B8A A;  5KH6 A;  3GOX A;  1WJR A;  2PQW A;  5C0M A;  2RJD A;  4A4G A;  3OA6 A;  3L2W A;  2X4Y A;  3F70 A;  2D9T A;  4E7J A;  4E7I A;  2BKD N;  1N27 A;  2LCC A;  3BDL A;  3S6W A;  2NLU A;  5J26 A;  3OYC A;  4LD6 A;  3MEA A;  1WJS A;  2EFI A;  3LLR A;  2HQE A;  3NTK A;  3QBY A;  3LH0 A;  3PFS A;  2RJC A;  2JTF A;  4QQG A;  5KE3 A;  3OYL A;  4BAC A;  3OYE A;  5C6S A; 
#chains in the Genus database with same CATH topology
 2ZPG B;  1WXT A;  2MCN A;  1WJQ A;  3QDR B;  2LVM A;  1EFN A;  4BUG A;  2D1X A;  3QXE B;  5GAM f;  1VQP Q;  4KDL A;  1JBM A;  4M77 C;  1G3S A;  2CP0 A;  2CRE A;  4FU6 A;  2RO0 A;  4EMK C;  3M0T A;  2HSP A;  3DLL A;  4FT4 A;  2V8K A;  5KYX B;  3MB5 A;  5D7U A;  1CSK A;  1JJ2 A;  1WHM A;  1X6O A;  1M8M A;  2A0F B;  4Q5W A;  3UA6 A;  3MP8 A;  1G3Y A;  4IUP A;  4WCI A;  2DL8 A;  3A8L B;  2WSC E;  2D8J A;  1YJW Q;  2JMC A;  3S3N A;  3QQ7 A;  3LWI A;  2CGH A;  2EQJ A;  1S72 T;  2EJ9 A;  4J8O A;  2LNH B;  1VQP T;  1ZSZ C;  4VUB A;  4MZM A;  1YFN A;  4J9G A;  2NUP A;  1KC8 U;  3OYK A;  3CME Q;  4DA4 A;  1M1K U;  5L23 A;  4JRP A;  2LW6 A;  3NTH A;  2MM2 A;  1H3H A;  3FDR A;  1BI3 A;  1M8V A;  3OB9 A;  3I5R A;  2ZZD A;  2DJQ A;  4N0A C;  3H6Z A;  5CD1 A;  2LCL A;  1YHQ T;  1RAD B;  2VVK A;  5CAI A;  1GXI E;  3LGF A;  1GFC A;  2CP6 A;  4LXC A;  3ZJT A;  2GFU A;  3QJY A;  1HYO A;  1QP2 A;  2JZ2 A;  2DER A;  2EKH A;  3VS5 A;  2QQ9 A;  3TVT A;  4E7Z A;  2DRM A;  1WPY A;  4E7J A;  1AWW A;  2LCC A;  1BKB A;  4J9I A;  5LJ3 g;  2AZS A;  3HL8 A;  1ZUY A;  4F04 B;  2HNI A;  2FZK B;  4RTX A;  4AMC A;  2MIO A;  4HVW A;  1I5O B;  4BE1 A;  1SKU B;  2LRQ A;  5DM7 R;  1N8R U;  2ESW A;  4FW1 A;  4C8Q G;  1KHC A;  3G71 T;  4GY5 A;  1UUE A;  2PNI A;  9ATC B;  3V7S A;  1CZ4 A;  4C0D C;  3EAE A;  1UGR B;  4A4H A;  1WLP B;  2COY A;  4FM4 B;  5GAN 8;  3HRT A;  1QLY A;  3JCM f;  3TSZ A;  4UC4 A;  2CP3 A;  2V8I A;  1FXX A;  1NYF A;  4L59 A;  2P84 A;  4RMO A;  4M7A C;  3UWN A;  5KCO A;  4PL6 A;  4JRI A;  8ATC B;  1Y96 A;  2JOY A;  1BI1 A;  2R57 A;  2YRD A;  2CP7 A;  3PTA A;  1X6G A;  3ZGZ A;  2RHX A;  3M57 A;  1K9M C;  2AZV A;  1OOT A;  5GMK h;  5LJ3 j;  4C5G A;  3MET A;  1OU9 A;  3NFC A;  2K7A A;  3R6O A;  2QDL A;  3MO8 A;  1QCN A;  2COZ A;  5KYU B;  5EQJ B;  2BZX A;  3CCQ T;  2CZ0 B;  3OYN A;  1MNE A;  1X6B A;  1FWZ A;  3FJ5 A;  4C5E A;  3CCV A;  2F5T X;  2CUB A;  1NJI U;  1UDL A;  3AHU A;  3CCR A;  1VQM T;  1NPR A;  2XI9 A;  1YIJ A;  2RK2 A;  4FL6 A;  4Z02 A;  4C92 E;  3CXC P;  1ZC1 A;  2VB6 A;  3V7R A;  5CK9 A;  1I0C A;  3CBO A;  3HSB A;  3CPW A;  7AT1 B;  4NOY A;  5GAM e;  1G3T A;  4DQ2 A;  5LJ3 h;  1WZO A;  3CCJ Q;  3GF5 A;  2OAW A;  2P0P A;  1UJY A;  3JCM W;  1VQ5 T;  1VQ7 Q;  3S6W A;  2JUF A;  4OB2 B;  1M3A A;  2G6F X;  1DJ7 B;  1OQK A;  2JTF A;  1C1A A;  3JCM e;  2LQK A;  3TRE A;  1UJ0 A;  1SHG A;  2DZ9 A;  2NYS A;  2B86 A;  2QA4 Q;  1ZLM A;  1E6G A;  5GAM h;  2QA4 T;  4IUT A;  3CCJ A;  2GNC A;  2E5K A;  2WSF E;  3VV0 A;  2DD4 A;  1XQH A;  3H8Z A;  3L2V A;  1N9R A;  1C0M A;  1W2B P;  3X24 B;  1Q7Y R;  1CR5 A;  2YWW A;  1Y96 B;  2QQS A;  4JZ4 A;  4C92 B;  2E12 A;  3CCR T;  2BZY A;  4ZN3 A;  3J7A F;  1KSW A;  3PT9 A;  4M78 C;  4HKE A;  5A0D A;  2L5Q A;  4JJC A;  2ZPE B;  1BI2 A;  1V1C A;  2DF6 A;  1M5Q 1;  2QEX T;  2BE7 D;  3ULR B;  2AKL A;  2JVV A;  2RM4 A;  3SWN C;  4M75 G;  2W0Z A;  2DVE A;  3FB9 A;  3QZ9 B;  1N8R C;  1G2B A;  2JNG A;  5LJ5 h;  4OP0 A;  4ME7 A;  2P4R A;  2M0O A;  5IHN A;  4BI8 B;  4E7L A;  2H3E B;  2K79 A;  2CT3 A;  2ZPB B;  5FTJ A;  1KQ1 A;  5KYY B;  2X3X D;  1OI1 A;  1KHI A;  1NEG A;  4F7U B;  1D0Y A;  1Y7X A;  4M75 C;  3SDZ A;  1OX9 A;  1SRL A;  3CCS T;  2YRV A;  3G4S T;  2RI2 A;  4ELY C;  3PVL A;  2ROL A;  5I11 A;  2VV5 A;  1YHQ Q;  3JV3 A;  3KFV A;  1M1F A;  2D9T A;  2QAZ A;  2FL7 A;  2RA2 A;  2QQB A;  4LD6 A;  1QQJ A;  1K4U S;  1M2V A;  3CXC A;  1LVK A;  4RV0 A;  4P5N A;  3OYE A;  1OEB A;  1VQ7 T;  1NEB A;  3UT1 A;  2L89 A;  4N4H A;  1Q82 C;  4J7F A;  1O9S A;  4J9B A;  2KT8 A;  2DIQ A;  2JT4 A;  2DJZ A;  5D6W A;  2A3L A;  5GLF A;  4BB7 A;  1Q82 R;  1GRI A;  3O8V A;  1IRE B;  3CCE T;  1T3S A;  3G71 A;  3X20 B;  2DTH A;  2X35 A;  2QG9 B;  3PVQ A;  1I4K 1;  2JXB A;  4E7S A;  2RHU A;  1GCP A;  3E19 A;  3MKD A;  1JQQ A;  3EG9 B;  3TEE A;  1K8A U;  1JRI A;  2KR3 A;  4XTZ A;  2DIG A;  4N0A A;  1PRM C;  2OI3 A;  3I9Q A;  5DLQ E;  2CP2 A;  1QCF A;  3G6E Q;  3A8O B;  1H3Z A;  1MMN A;  3CCM T;  1E7O A;  3UF4 A;  2OTJ Q;  1PWT A;  3PGG A;  2DYI A;  3M4Y A;  4XU3 A;  4C92 G;  2KSS A;  4M4Z A;  3DB3 A;  2AK5 A;  4XU2 A;  2ZGW A;  4MDX A;  1Z9Q A;  3EFR A;  3OBW A;  5KYY A;  5GAO n;  5GAN g;  2CZ7 B;  1SSF A;  1UGV A;  1B34 A;  2XD0 A;  1WXB A;  1KD1 U;  4J7I A;  2CP5 A;  4RTU A;  3RMQ A;  4KT0 E;  3QJ6 A;  2E6Z A;  2KT1 A;  1VQM A;  2QXF A;  3OYH A;  1S3S A;  4LD9 K;  1VUB A;  2DNU A;  4J9H A;  5GAN e;  2FRW A;  2LX9 A;  2AIR B;  3F70 A;  1I81 A;  4DBF A;  1QDN A;  3CMA Q;  1YIT T;  3EHQ A;  2JTM A;  1P92 A;  2EYW A;  3QBY A;  2XG8 D;  2Q1C X;  5CQX A;  4QQD A;  4AQ7 A;  1S1N A;  2HKQ B;  4M78 E;  1FX7 A;  4KO8 A;  1MND A;  1QCO A;  1TU0 B;  5I2M A;  5GAN f;  2DA9 A;  3A8G B;  2J6K A;  4AFZ C;  1QWE A;  1UGP B;  1XJW B;  3CCM A;  4FCY A;  2M1H A;  4LDW A;  4JS4 A;  3GLX A;  4QVZ A;  3FEO A;  4C5I A;  3EH1 A;  3CME T;  2BTT A;  2ABL A;  2KEA A;  3M59 A;  1XNI A;  3E9G A;  3NMZ C;  3VS1 A;  3OYG A;  5CIU A;  4M75 F;  1OPL A;  3QUI A;  3OS1 A;  4PLI A;  3CC7 A;  1VQ4 A;  3AT1 B;  2F2W A;  3JCM P;  1QVF P;  1K9A A;  2L0A A;  4R0K A;  1QWF A;  3QG1 A;  1VQ8 T;  3C94 A;  4CQN A;  2LX7 A;  5GAO l;  2Z0W A;  5GJW B;  2EVR A;  3MEW A;  2HDA A;  1M9S A;  2RJE A;  3ZL7 C;  5FRM A;  3LYI A;  2EPD A;  4M77 B;  2LCS A;  4RTY A;  1Q82 U;  2MWO A;  3MP1 A;  4EMK B;  4PJM A;  1VQL A;  4L5G A;  1UGQ B;  3Q1J A;  2QDY B;  1YJW A;  4ARC A;  4M7D F;  3CC2 A;  1VIE A;  4AT1 B;  2EQK A;  1VYT A;  3C0C A;  4PJO A;  2XDP A;  1S72 Q;  1YBY A;  1BCO A;  4YTL A;  2M02 A;  3VS2 A;  3OBY A;  5KYU A;  1WJR A;  5GAM j;  1I8F A;  1ZSZ B;  1D0Z A;  4A4G A;  5GMK m;  4E7I A;  2J7I A;  1VYV A;  1UG1 A;  1UTI A;  1FMV A;  3VRY A;  4M77 E;  1YJN A;  3REA B;  4LDX A;  1WX6 A;  1VQ8 A;  1D1B A;  2ECZ A;  2QTX A;  1MMG A;  1UEB A;  1EIF A;  2GF7 A;  4JJB A;  1GBQ A;  1LCK A;  3G71 Q;  4OMM A;  3JCM J;  1G83 A;  1SF9 A;  4D6W A;  5HCK A;  1VQ7 A;  3ZJV A;  1ZQ1 A;  4HCZ A;  1O54 A;  2V1R A;  4JZ3 A;  1PRL C;  3HHT B;  2OTL A;  4M7A A;  3IQL A;  4M75 D;  2EQU A;  1U1S A;  1VQN Q;  1EZZ B;  1QVF A;  1WQW A;  3P8H A;  1X27 A;  4HVV A;  5DLO A;  4FYV B;  3S3M A;  4JS5 A;  2P4T A;  1OV3 A;  3CCE A;  2R5M A;  5IAY A;  2DX1 A;  3BFM A;  1WHH A;  3U23 A;  4ESR A;  4R55 A;  1RAE B;  2LJ3 A;  4JRQ A;  2CYZ B;  3G1J A;  3OS2 A;  1PKS A;  3VYG A;  2DD5 A;  5LJ5 d;  3HRU A;  3NTI A;  4XQ3 A;  2AHJ B;  4X9C A;  4AFS C;  3JRZ A;  2HAX A;  2F69 A;  5DYI A;  3M0U A;  3CMA A;  3L2R A;  3PNW C;  3TQ7 P;  3EG3 A;  3S3O A;  2DO3 A;  2O9V A;  3MPU B;  1YJN T;  3MCA B;  3L2Z A;  2X4X A;  1OZ3 A;  4FW2 A;  2YRC A;  2L3P A;  3OYI A;  3CC4 T;  1AZE A;  1GCQ C;  2HBP A;  4RG8 A;  3CCU T;  4JPB W;  4PJL A;  1LOJ A;  3FC3 A;  2KY9 A;  2IPO B;  1YIJ Q;  4X1V A;  4J9C A;  5LJ3 f;  3QWZ A;  1MMA A;  1TUD A;  4XTW A;  4A53 A;  4DBH A;  1WFW A;  2VC8 A;  1NJI C;  4HT9 A;  1W2B A;  1W2B S;  2RD1 A;  3QC8 A;  2L3R A;  5CCB A;  1PNJ A;  3ZBD A;  1YN8 A;  4IIM A;  3L1A A;  4Z88 A;  3LWH A;  1WQ7 A;  3QO3 A;  1JJ2 S;  1KQ2 A;  4M7A D;  1ZUK A;  1ACM B;  4JDS A;  1R77 A;  1KD1 R;  2MMP A;  4XTU A;  2M16 A;  3CMA T;  1IO6 A;  5D6Y A;  4LNP A;  1KK7 A;  4BD3 A;  1ZBX A;  4PJO C;  1WLF A;  2XK0 A;  4KGV B;  4J9D A;  3CD6 T;  2YUO A;  4PJO F;  4DEX A;  5LJ5 g;  2ROT A;  4XAX B;  1AZG B;  2Q1A X;  3P8B B;  1IZ6 A;  3MEU A;  2L8D A;  1W70 A;  3OYF A;  1VQN T;  2QAS A;  1Y0M A;  4EDU A;  4IUU A;  5M9O A;  2DBK A;  4ZTJ A;  1VQM Q;  1H92 A;  1AEY A;  2RK1 A;  4C8Q C;  2DL3 A;  4RKU E;  1O75 A;  5FLX E;  3ZFJ A;  4DOW A;  3CCL Q;  2D8H A;  2DL7 A;  4OGE A;  2QQA A;  2BZ8 A;  2RQR A;  4CC4 B;  2E1H A;  1U1T A;  2HQX A;  2HMA A;  3E9F A;  1YJ9 A;  2O4X A;  3OMC A;  1JO8 A;  4M75 A;  1M90 C;  3SB2 A;  2MWP A;  2X3W D;  3P8D A;  1HK9 A;  2X9H A;  2O88 A;  3INZ A;  3NGP A;  5IHI A;  4O6J A;  3T9N A;  3EG1 A;  1AWO A;  2GQV A;  4M78 B;  3EHR A;  2RHZ A;  1SRM A;  2RHY A;  1CKB A;  5LJ5 j;  1TTH B;  1J3T A;  4M78 F;  3GNG A;  1RI9 A;  5CO7 A;  1M1G A;  1D09 B;  5FWB A;  2WSE E;  3CQT A;  3DLM A;  2B8A A;  3H0H A;  3O5Z A;  4EPC A;  2OJ2 A;  1ARK A;  2EYQ A;  1Q86 U;  3JCM V;  4PFP A;  5L8R E;  5IXF A;  1OU8 A;  1WJS A;  4KUL A;  5FU6 B;  2CSQ A;  2NUP B;  3OYY A;  1TSF A;  2EYX A;  4J6X A;  2F5K A;  2DL4 A;  3RKW A;  5HY6 A;  1ABQ A;  1K0X A;  4PK4 A;  1QKX A;  2ZPH B;  5C1B A;  3I55 T;  1IRX A;  1UFF A;  2OTJ T;  2RH2 A;  1BU1 A;  2KK4 A;  2IVW A;  4FYW B;  4PJJ A;  1OYX A;  1RLP C;  4JLG A;  1TWB A;  2RJF A;  4KOD A;  3KBG A;  3FPU A;  4FYY B;  4PNO A;  4MZP A;  4Y28 E;  2F2V A;  4C0G A;  3I5S A;  4C8Q E;  3GP8 A;  2JJ9 A;  1K1Z A;  1NBE B;  3M4G A;  4HVU A;  3J80 E;  2OTL T;  1RUW A;  3KUF A;  3EGD A;  1VQL Q;  4F17 A;  4J9F A;  1NE8 A;  2VYT A;  2E3H A;  1PC0 A;  2D6F A;  2MAM A;  3QDF A;  2PVO B;  4F7U A;  3H0F A;  4WF2 A;  3URG A;  1NLP C;  2L3Q A;  2J05 A;  4B9X A;  3JAM E;  2WAC A;  1H64 1;  1K73 R;  1LPL A;  1M2V B;  2MI6 A;  3JB9 J;  2F1L A;  2QEX Q;  1I1J A;  4LUD A;  5CVI A;  3NHN A;  1Q7Y U;  1I5L A;  2FO0 A;  1Q81 R;  3OW2 A;  4JJN K;  3EFS A;  1QVG A;  6AT1 B;  1HXD A;  3QKJ A;  3JCM h;  2HL5 C;  4KH1 B;  2P0K A;  1WHG A;  4AG1 C;  3X26 B;  5J39 A;  1NYG A;  4PFO A;  5GAO r;  4RUG A;  3LGA A;  4NL3 A;  2RJD A;  2OTL Q;  3V8L A;  1YP5 A;  2X4Y A;  2BKD N;  3FJP A;  3OYC A;  4CC7 A;  3EFO A;  1T0J A;  1WHJ A;  3G7Z A;  3LH0 A;  2K2V A;  3VU3 C;  1M90 R;  1SG5 A;  1RLQ C;  1G3W A;  2R58 A;  3FIF A;  3QWX X;  2VAS A;  4BY6 C;  1PD1 A;  3A1P A;  3I55 Q;  5A0L A;  1D3B B;  2HCK A;  3VJP A;  4II1 A;  2KQW A;  3MEV A;  1QCS A;  4JRK A;  3LW5 E;  4XU0 A;  3ME9 A;  1XOV A;  2Q18 X;  3FRN A;  1OUL A;  2O01 E;  1YNZ A;  5KCH A;  5FW9 A;  2O31 A;  3FPT A;  4ZGE B;  4OB0 B;  2KRN A;  3QYH B;  3R6N A;  2EWN A;  4KBM B;  1NG2 A;  1S72 A;  2KDS A;  4O5V A;  1YIJ T;  2LT4 A;  1IGU A;  2EW3 A;  4M77 D;  1KC8 R;  2RQT A;  2ED0 A;  1SPK A;  2GBQ A;  3I35 A;  3JB9 F;  1VQ6 Q;  3QQ8 A;  4X34 A;  1RAH B;  4C8Q F;  3OW2 P;  5FU7 B;  5GAN 5;  2EQI A;  2VKN A;  4B9W A;  1YCS B;  1QVG P;  3ZJU A;  1Q81 C;  1RAA B;  1RAG B;  2QQR A;  2ENM A;  2YVL A;  3JB9 I;  4C8Q D;  3NPF A;  4ELZ C;  1IXD A;  3M55 A;  2JS0 A;  1HD3 A;  3I56 T;  2J6F A;  3VKI A;  4LDV A;  1K8A R;  5FRN A;  3CD6 Q;  5GAN 6;  3D7S B;  1ZA2 B;  4M7D A;  1BIB A;  2V1Q A;  2SEM A;  1QKW A;  4BDY A;  2PVD B;  2X4W A;  3FLG A;  2AT1 B;  2FRY A;  2GTJ A;  2VXF A;  4Y91 A;  4ZNX A;  1U8R A;  2HD0 A;  5GAO p;  2A36 A;  2PVG B;  3SEM A;  2LZ6 B;  4M78 D;  4XU1 A;  3CBM A;  1E32 A;  1VQ9 Q;  1RAB B;  2YUQ A;  2HQH A;  2KXD A;  3CCR Q;  1KG1 A;  3I56 Q;  2JW4 A;  3VS4 A;  3L2Q A;  5GMK e;  2RHI A;  2DLP A;  2Y4Y A;  4NL2 A;  2QYZ A;  1Q81 U;  3C95 A;  2DFU A;  4C92 D;  4M7D C;  1KJW A;  2DMO A;  4HXJ A;  4AG2 C;  4GLM A;  4JLI A;  2ZPF B;  3QYG B;  3RBB B;  2ZPI B;  4NS5 A;  3E2U A;  4ZGD B;  2LTO A;  4M77 A;  4BE0 A;  2LNV A;  4AS1 A;  2E70 A;  5GAN d;  1MUZ A;  2XU8 A;  4PJN A;  5EG2 A;  2LMJ A;  3CCS Q;  1YJN Q;  4EMK A;  3OS0 A;  1WHL A;  2K3B A;  2OX7 A;  4XTX A;  4MZT A;  2L3S A;  1N6A A;  3CCS A;  1B07 A;  5I21 A;  3PIO A;  4M7D G;  2JV2 A;  4PJO E;  1EX4 A;  5GAN h;  2FG0 A;  1UHC A;  3VS3 A;  3JB9 H;  1VQO T;  5GMK l;  3E1S A;  2HEQ A;  1VIF A;  1VOM A;  1JU5 C;  4ZTF A;  3LGL A;  4DBQ A;  1UGS B;  1MHN A;  1LJO A;  2ZCF B;  3CCQ A;  4RTW A;  2EIF A;  1FMW A;  3CCV T;  1PD0 A;  2CT4 A;  1AWX A;  2LQW A;  2RI5 A;  2E6N A;  1U3O A;  1D0X A;  2DXU A;  2CSI A;  2DZC A;  3HRS A;  5GAM d;  1VQK T;  2A08 A;  3REB B;  1VQP A;  2NUZ A;  2CH4 W;  1BK2 A;  1IB8 A;  1VQK Q;  3HFN A;  3RKX A;  2NLU A;  2DRK A;  2EFI A;  1X01 A;  2MK5 A;  2DET A;  4BAC A;  2JTE A;  3M5A A;  5HK3 A;  2NUT A;  2LT1 A;  2J6O A;  2A37 A;  4J5Y A;  3X25 B;  5IH2 A;  2M0Y A;  2EBP A;  1SSH A;  4EMG A;  2LP5 A;  3LHD A;  2EYY A;  1B34 B;  3EGU A;  3HP9 A;  1G5V A;  1VQ5 Q;  1T0H A;  4JUV A;  1K0S A;  3DKM A;  3JCM d;  4WTO B;  3HU3 A;  3JB9 G;  1NZ9 A;  3M0P A;  5KYW A;  2PUK B;  4CRI A;  2E41 A;  2FPD A;  2IG0 A;  2K9G A;  1KIK A;  4A4F A;  2DAQ A;  1KC8 C;  1K9M U;  4IKF A;  5ERG B;  2QEX A;  5ECA A;  5KYN A;  2AKK A;  3MHX A;  3A8M B;  1RAC B;  2HSE B;  4J83 A;  5GJV B;  1IHV A;  1SHF A;  3JB9 D;  1NPP A;  4HA8 A;  3THK A;  1K73 U;  3GNF B;  3RNJ A;  4HT8 A;  1YIT A;  4M75 E;  1M2O A;  4PJO B;  3ASK A;  4ORZ A;  4E7K A;  3TU4 K;  3SD4 A;  2EQM A;  2LDM A;  4LN2 A;  1PCX A;  3VS7 A;  1UB4 A;  1KQS A;  2LJ1 A;  2R5A A;  4PLL A;  3RKY A;  1R7R A;  4OMP A;  3RUX A;  2JM8 A;  4XTV A;  4OGC A;  4OMN A;  1WDX A;  1M4Z A;  4AFQ C;  2QGG A;  4C8Q B;  2KXC A;  2JM9 A;  4IUQ A;  1G8X A;  3QZ5 B;  1NM7 A;  5CKD A;  3PIP A;  1F1B B;  2RF0 A;  3CME A;  2YHT A;  4XTY A;  3SWN A;  1YI2 A;  5CCA A;  2JMA A;  3CC2 Q;  5J26 A;  3VUZ A;  4DBR A;  2E3I A;  3G4S A;  3VS0 A;  4KGZ B;  2XIC A;  2OAU A;  2IIM A;  5C6S A;  2GQI A;  2KYM A;  1B7T A;  3TIW A;  1AOJ A;  2D0Q B;  1QVG S;  1KQS S;  3OYD A;  1PSE A;  3PMI A;  4KGX B;  4AFU C;  5GAM g;  3OMG A;  2EYZ A;  4FIB A;  2C0I A;  2BIV A;  1PG5 B;  3BDU A;  2K5F A;  3EH2 A;  1R0B G;  2C0O A;  1ZHI A;  1M27 C;  3PE0 A;  4OMQ A;  3H9N A;  2DXB A;  2DTO A;  2H3J A;  3A5Z B;  4PJO G;  1H8K A;  2DBM A;  1YJW T;  2X51 A;  3VYH B;  5FU6 C;  1QVP A;  5IT9 E;  4QKU A;  1X69 A;  4PFZ A;  3SFM A;  2HKN A;  4ANJ A;  1ZUU A;  5EPP A;  2DK3 A;  1VQO Q;  1ZA1 B;  3HPW A;  2FPE A;  1BI0 A;  1I07 A;  2DL5 A;  2PUO B;  1D3B A;  1Q95 G;  5CKH A;  4E47 A;  1BCM A;  5IHK A;  2C0T A;  1GBR A;  1XTD A;  3H41 A;  4GLK A;  1ZBJ A;  2BUD A;  4CI0 C;  4FYX B;  4J6Y A;  5CR2 A;  1Q86 C;  3VS6 A;  3JSC A;  2VGN A;  1GL5 A;  3EG9 A;  1VQO A;  1ZSG A;  1YWO A;  4RTT A;  1WHK A;  2YXY A;  2EKO A;  4KDI A;  3X28 B;  4F16 A;  4D8K A;  2FHD A;  1M1K R;  4N4G A;  2RPN A;  3ZEH A;  2V8J A;  3PMT A;  2ATC B;  2YT6 A;  4HCC A;  3V8J A;  2DVJ A;  2E5Q A;  2PTK A;  2RB6 A;  4QT7 A;  3JCM c;  4ZGJ B;  1YWP A;  2DE0 X;  3OA6 A;  3RES A;  5GAN 7;  1OPK A;  1N27 A;  2NWM A;  3LLR A;  1VQK A;  1FMK A;  4IIO A;  2RMO A;  2Q19 X;  3BE3 A;  2RJC A;  1A0N B;  2FZC B;  4ARI A;  3J81 E;  4A54 A;  1KD1 C;  3CXC S;  4V2S A;  1IHW A;  5B6C A;  2YUP A;  2KGT A;  1N9S A;  3BW1 A;  2CDT A;  3OSV A;  2SRC A;  3G4S Q;  3WVD B;  2VGM A;  4DEY A;  3H0I A;  1RAF B;  1TUG B;  4N4I A;  3CCM Q;  2ZAE A;  4PKC C;  5I2S A;  4R56 A;  3RER A;  1NJI R;  2W10 A;  1IGQ A;  5AYF A;  1X75 C;  3CCU Q;  3GPL A;  1K76 A;  2JS2 A;  2P0Q A;  4KH0 B;  3FPR A;  3RIR A;  4ATO A;  4M77 G;  4OMO A;  3M58 A;  5HKC A;  3UA7 A;  1Y71 A;  3M0Q A;  2GGR A;  1K8A C;  4C5H A;  1MV3 A;  3EG0 A;  3RDV A;  1VQL T;  4BY6 B;  5GMK i;  4QW2 A;  1VQ4 T;  3CC7 T;  2O9S A;  5GAO q;  2KRM A;  4X9D A;  3HFO A;  4Y92 A;  3C4S A;  2PU9 B;  2DPP B;  3V7C A;  1N5Z A;  1Q86 R;  2Y90 A;  2FB7 A;  3JCM X;  2EGE A;  1M30 A;  4Z8A A;  1AT1 B;  5CQY A;  3OYM A;  3CCV Q;  4BDZ A;  1YI2 Q;  2X4J A;  4F7U E;  2YLB A;  2B25 A;  1JB0 E;  1Z9Z A;  4IUR A;  3HKS A;  4C0D B;  3UDC A;  1UE9 A;  4C0Z A;  1BBZ A;  2KMT A;  4RCC A;  2DM1 A;  3CC2 T;  4MML A;  2QTV A;  2JN0 A;  2K4Y A;  1JEG A;  2Y4X A;  4M7A F;  2E4H A;  1HJD A;  5GAN 3;  5FTM A;  5FU7 C;  3JCM b;  5GAN 2;  4M7A B;  3MEA A;  2PJH B;  4C8Q A;  4A63 B;  1AHJ B;  4KUD K;  2O2O A;  4HCB A;  1VQN A;  4JJD A;  4KLN A;  1YI2 T;  2O4X B;  4QQ6 A;  1B3Q A;  4MDW A;  1CKA A;  1YCY A;  4F7U G;  2RQW A;  4DOV A;  4LDY A;  1R0C B;  1U5S A;  2MPX C;  1UEC A;  5FRO A;  5GAO m;  2RI3 A;  4L6V 5;  4M78 A;  5FTL A;  3C12 A;  1HSQ A;  2EGC A;  1MMD A;  3CPW S;  3A8H B;  3CCL T;  1U06 A;  4FSX A;  5LJ3 d;  1VQ9 T;  5DYG A;  3M0S A;  1WI7 A;  4J6W A;  5FTK A;  2RNA A;  2VUB A;  1X2K A;  2QI2 A;  5FWC A;  1AD5 A;  1QVF S;  3CPW P;  5KYX A;  1SEM A;  4E6R A;  1QP3 A;  1X2Q A;  3OYJ A;  2MYS A;  2Q1D X;  1PHT A;  2DEU A;  1TH7 A;  4OVA A;  1WYX A;  2FPF A;  4M7D B;  2EJF A;  2EAY A;  3WXM B;  2CUD A;  3EGX A;  3CBP A;  2M9U A;  2PZ1 A;  3CC4 A;  1VQ4 Q;  3CC7 Q;  1M3B A;  2CZ6 B;  1M3C A;  1OX8 A;  1X43 A;  4EIK A;  5CKE A;  2RQV A;  1VQ8 Q;  3I55 A;  3BY7 A;  2A7Y A;  1RAI B;  3HTR A;  2BE9 B;  4BI4 A;  4E2F B;  4RG2 A;  3CEY A;  4MMK A;  1YIT Q;  3RR6 A;  3M56 A;  2KE9 A;  2YSQ A;  1KFZ A;  2XMF A;  2KNB B;  3OYA A;  2XKO C;  1QW1 A;  5AT1 B;  3UPU A;  5KH6 A;  1TOV A;  2DKG A;  3CCU A;  3EGX B;  4C92 C;  1V76 A;  3RMS A;  1I9G A;  1CZ5 A;  2YUN A;  3JCM Q;  4C92 F;  4QQG A;  4QVC A;  2KRO A;  5GMK j;  5LJ5 f;  3GBQ A;  3LX7 A;  4XK8 E;  1PSF A;  5KE2 A;  1KQS P;  4OB3 B;  4CC2 A;  3TCJ A;  4OF1 A;  4A4K A;  1JXM A;  2H8H A;  4M77 F;  3OW2 S;  2J06 A;  4OMF B;  3SWN B;  1VA7 A;  4ZN1 A;  1AVZ C;  3V8K A;  2KVQ G;  2LC4 A;  2XHC A;  3EG2 A;  3HU1 A;  4TVR A;  2CH4 A;  4M7D D;  5EC7 A;  1PKT A;  4KUI A;  1MV0 B;  1W4S A;  4F7U F;  1LNX A;  3A98 A;  1FYN A;  4J9E A;  4OB1 B;  3CD6 A;  5A0G A;  2KRS A;  3ER0 A;  4BI3 A;  1OZ2 A;  4PJO D;  5LJ3 e;  2MM0 A;  2ED1 A;  4M75 B;  3EFO B;  2K3Y A;  1ZSZ A;  4M7D E;  1YJ9 Q;  2LQ8 A;  3L2U A;  2E10 A;  2G3R A;  1TUC A;  2K3X A;  1V29 B;  2MOX A;  3OS5 A;  4HCK A;  2K5L A;  2YLC A;  2HL3 A;  2HBW A;  4RTV A;  4A4E A;  3G6E A;  1ZX6 A;  2L2P A;  1RI0 A;  5D6X A;  3CPF A;  2M51 A;  4KRT A;  4EMH A;  1YHQ A;  3WVE B;  2RQU A;  3M9Q A;  3CCQ Q;  3CCE Q;  5LL6 S;  4M7A G;  1N8R R;  3KXT A;  3QII A;  3M54 A;  3CF2 A;  3OYB A;  2KI7 A;  2FZG B;  4CC3 A;  2K5I A;  2V26 A;  1YJ9 T;  2PWY A;  5J3B A;  1AWJ A;  2FEI A;  5CKB A;  4M78 G;  1TG0 A;  2YUJ A;  5LJ5 e;  2QGF B;  1UHF A;  2E65 A;  3GOX A;  5C0M A;  1BYM A;  1W1F A;  5GAN 4;  3BQB A;  5GAN j;  5C18 A;  3QSU A;  3NTK A;  2E64 A;  2XID A;  1WIE A;  2A28 A;  3M53 A;  5KE3 A;  1D1C A;  1GFD A;  5KYW B;  4M7A E;  5CKF A;  1JXO A;  3VUB A;  2GTO A;  4LDU A;  4B6M A;  3QHS A;  5CCX A;  1ABO A;  3EGD B;  1WA7 A;  1BB9 A;  3DB4 A;  4K11 A;  1PM3 A;  1QMC A;  1K73 C;  4IUV A;  4QVD A;  3G6E T;  2K2M A;  3UAT A;  5DY9 A;  2FVU A;  2EJG A;  2OTJ A;  2VWF A;  2XDB A;  1RL2 A;  1VQ6 T;  4RCB A;  2I0N A;  8AT1 B;  3OQ5 A;  2KAF A;  2D0N A;  2NUT B;  1WNL A;  1TS9 A;  2CKK A;  4E7H A;  3I56 A;  2K6D A;  2MF2 A;  2COW A;  4D8D A;  4RTZ A;  3CCL A;  2DXC A;  1TXQ A;  1VQ9 A;  2EGA A;  2GFA A;  2LQN A;  3OSS C;  2KYB A;  2LJ0 A;  4C0F A;  2XDD A;  4C92 A;  2F2X A;  3MP6 A;  4LUE A;  5IN1 A;  3CC4 Q;  5HK0 A;  1WXU A;  4GBQ A;  4FT2 A;  1Y07 A;  5I22 A;  2I2L A;  2FYK A;  2CS7 A;  1T3L A;  3QWY A;  2DYB A;  1VYU A;  5IXB A;  1Y57 A;  3M0R A;  1C6V X;  3QPH A;  1E6H A;  2DTI A;  3SHW A;  5FTN A;  4OML A;  3HU2 A;  2DXT A;  3TSW A;  2K57 A;  2HZY A;  2RN8 A;  4LE9 A;  4BE2 A;  4F14 A;  1BIA A;  1W6X A;  3N5B B;  5A2Q E;  3LH5 A;  1K9M R;  1GCQ A;  1R8O B;  1VQ5 A;  3OY9 A;  4FSS A;  2C06 A;  1WGS A;  2DEQ A;  3VRZ A;  3GIB A;  4Z89 A;  2VXE A;  3L42 A;  2DIL A;  1VQ6 A;  2PQW A;  2GCX A;  2YDL A;  1M90 U;  3L2W A;  1D1A A;  3BDL A;  3JCM g;  1NLO C;  1JJ2 P;  2KBT A;  2HQE A;  3MJX A;  2QA4 A;  1M1K C;  1MGQ A;  3CCJ T;  3PFS A;  1Q7Y C;  3OYL A;  2CZ1 B;  2QK0 A; 
#chains in the Genus database with same CATH homology
 4QQD A;  3J81 E;  4AQ7 A;  4A54 A;  1KD1 C;  4M78 E;  1FX7 A;  3CXC S;  4KO8 A;  4V2S A;  2ZPG B;  5I2M A;  5B6C A;  1WJQ A;  1G3W A;  2R58 A;  2LVM A;  3QDR B;  5GAN f;  3FIF A;  1N9S A;  3A8G B;  3BW1 A;  4BUG A;  3OSV A;  4BY6 C;  1UGP B;  3QXE B;  5GAM f;  3WVD B;  3CCM A;  2M1H A;  5A0L A;  1D3B B;  4LDW A;  2VGM A;  4JS4 A;  4KDL A;  3GLX A;  4QVZ A;  4N4I A;  3VJP A;  3FEO A;  4II1 A;  2KQW A;  1JBM A;  4C5I A;  4M77 C;  3MEV A;  1QCS A;  1G3S A;  4FU6 A;  3LW5 E;  4JRK A;  2RO0 A;  3ME9 A;  1XOV A;  4XU0 A;  3VU3 C;  4EMK C;  4E7L A;  4PKC C;  3DLL A;  2Q18 X;  4FT4 A;  2V8K A;  3FRN A;  5I2S A;  4R56 A;  3CME T;  3RER A;  3MB5 A;  2O01 E;  5AYF A;  1X75 C;  5KCH A;  1JJ2 A;  1X6O A;  4Q5W A;  3M59 A;  3GPL A;  4ZGE B;  4OB0 B;  1XNI A;  3MP8 A;  1G3Y A;  3QYH B;  3E9G A;  2EWN A;  4KBM B;  1S72 A;  2KDS A;  5CIU A;  2P0Q A;  4M75 F;  4IUP A;  3OYG A;  4O5V A;  1YIJ T;  3FPR A;  3QUI A;  3RIR A;  2LT4 A;  4ATO A;  3OS1 A;  4M77 D;  4M77 G;  4PLI A;  3CC7 A;  1VQ4 A;  3A8L B;  3M58 A;  5HKC A;  3JCM P;  2WSC E;  3QG1 A;  1Y71 A;  3S3N A;  1VQ8 T;  3QQ7 A;  3LWI A;  2CGH A;  2EQJ A;  3C94 A;  1S72 T;  2EJ9 A;  4J8O A;  4C5H A;  5GAO l;  1VQP T;  1K8A C;  4CQN A;  3JB9 F;  3QQ8 A;  4X34 A;  4C8Q F;  4BY6 B;  5GMK i;  1VQL T;  4QW2 A;  4VUB A;  1VQ4 T;  3CC7 T;  5GAO q;  3MEW A;  4MZM A;  5FU7 B;  5GAN 5;  4B9W A;  3ZJU A;  1KC8 U;  1Q81 C;  1M9S A;  2RJE A;  3OYK A;  4X9D A;  5FRM A;  3HFO A;  3LYI A;  4DA4 A;  2QQR A;  4M77 B;  3C4S A;  2PU9 B;  2DPP B;  1M1K U;  1Q82 U;  3V7C A;  2MWO A;  3MP1 A;  2YVL A;  4EMK B;  3JB9 I;  2Y90 A;  4JRP A;  4C8Q D;  1VQL A;  2FB7 A;  4L5G A;  3NTH A;  4ELZ C;  1UGQ B;  3Q1J A;  3FDR A;  3JCM X;  1BI3 A;  1M8V A;  2MM2 A;  2QDY B;  3OB9 A;  1YJW A;  4ARC A;  2ZZD A;  4M7D F;  3M55 A;  3CC2 A;  4N0A C;  5CQY A;  1VIE A;  3OYM A;  3H6Z A;  4BDZ A;  3I56 T;  3VKI A;  2EQK A;  5CD1 A;  2X4J A;  4LDV A;  2LCL A;  1YHQ T;  4F7U E;  2YLB A;  4PJO A;  2B25 A;  2XDP A;  5FRN A;  1JB0 E;  4IUR A;  5GAN 6;  3HKS A;  5CAI A;  1YBY A;  4M7D A;  1GXI E;  1BIB A;  4C0D B;  3UDC A;  4C0Z A;  3LGF A;  4BDY A;  4YTL A;  2KMT A;  4RCC A;  3CC2 T;  3ZJT A;  2GFU A;  2PVD B;  3QJY A;  4MML A;  2X4W A;  2JN0 A;  1QP2 A;  2JZ2 A;  2K4Y A;  2Y4X A;  3FLG A;  3OBY A;  2QQ9 A;  4M7A F;  5GAN 3;  1WJR A;  5GAM j;  1I8F A;  2VXF A;  4Y91 A;  4A4G A;  5GMK m;  5FU7 C;  5FTM A;  1U8R A;  2HD0 A;  1WPY A;  5GAO p;  3JCM b;  2PVG B;  5GAN 2;  4E7J A;  4E7I A;  2LCC A;  4M7A B;  1BKB A;  5LJ3 g;  4M78 D;  4XU1 A;  3MEA A;  3CBM A;  1E32 A;  3HL8 A;  4C8Q A;  2PJH B;  4KUD K;  1AHJ B;  4HCB A;  2HNI A;  1VQN A;  4M77 E;  4KLN A;  1YJN A;  1KG1 A;  1YI2 T;  2LW6 A;  2O4X B;  4LDX A;  4BE1 A;  5DM7 R;  2LRQ A;  4QQ6 A;  1N8R U;  4C8Q G;  1VQ8 A;  2QTX A;  4MDW A;  5GMK e;  3L2Q A;  1KHC A;  2RHI A;  2Y4Y A;  1UEB A;  4NL2 A;  3G71 T;  1YCY A;  4F7U G;  4DOV A;  4GY5 A;  1EIF A;  3C95 A;  2GF7 A;  4LDY A;  1Q81 U;  4C92 D;  4M7D C;  4M7A G;  3V7S A;  3JCM J;  5FRO A;  4D6W A;  3ZJV A;  5GAO m;  1VQ7 A;  1CZ4 A;  4C0D C;  1ZQ1 A;  2RI3 A;  3EAE A;  1UGR B;  4HCZ A;  4JLI A;  1O54 A;  4L6V 5;  4A4H A;  4M78 A;  3HHT B;  2ZPF B;  3QYG B;  5FTL A;  2ZPI B;  4NS5 A;  4FM4 B;  2OTL A;  5GAN 8;  4M7A A;  4ZGD B;  2LTO A;  3HRT A;  3C12 A;  4M75 D;  2EQU A;  1U1S A;  3CPW S;  3A8H B;  4M77 A;  3JCM f;  3CCL T;  4BE0 A;  4UC4 A;  1QVF A;  1WQW A;  3P8H A;  4FSX A;  2LNV A;  2V8I A;  5LJ3 d;  1VQ9 T;  1FXX A;  5DYG A;  4AS1 A;  2E70 A;  4L59 A;  5GAN d;  5DLO A;  3S3M A;  2XU8 A;  5EG2 A;  4RMO A;  2P4T A;  4JS5 A;  4M7A C;  3UWN A;  4J6W A;  5KCO A;  4EMK A;  5FTK A;  4PL6 A;  4JRI A;  3OS0 A;  3CCE A;  1Y96 A;  2R5M A;  2VUB A;  2JOY A;  5IAY A;  2QI2 A;  1BI1 A;  2R57 A;  3BFM A;  4R55 A;  3PTA A;  1QVF S;  4XTX A;  4MZT A;  3OYJ A;  4JRQ A;  2CYZ B;  1QP3 A;  1N6A A;  3ZGZ A;  2RHX A;  3M57 A;  3OS2 A;  3CCS A;  1K9M C;  5GMK h;  5LJ3 j;  3VYG A;  5I21 A;  2DD5 A;  4C5G A;  3HRU A;  3MET A;  3NTI A;  5LJ5 d;  3PIO A;  2Q1D X;  4XQ3 A;  4M7D G;  1TH7 A;  2JV2 A;  2AHJ B;  4PJO E;  4OVA A;  4M7D B;  4X9C A;  3JRZ A;  5GAN h;  2EJF A;  3NFC A;  2EAY A;  2HAX A;  3R6O A;  3JB9 H;  3WXM B;  2F69 A;  5DYI A;  3MO8 A;  3CMA A;  3L2R A;  1VQO T;  3PNW C;  5EQJ B;  5GMK l;  3E1S A;  3CCQ T;  3CBP A;  2CZ0 B;  1VIF A;  2M9U A;  3OYN A;  3CC4 A;  3S3O A;  1FWZ A;  2DO3 A;  4C5E A;  3CCV A;  2CZ6 B;  1YJN T;  4ZTF A;  3MCA B;  2F5T X;  3LGL A;  3L2Z A;  1NJI U;  2X4X A;  1UGS B;  5CKE A;  3AHU A;  1MHN A;  3CCR A;  1LJO A;  1OZ3 A;  2ZCF B;  1VQM T;  3I55 A;  3CCQ A;  3BY7 A;  2A7Y A;  3FPT A;  1NPR A;  2EIF A;  3OYI A;  3CC4 T;  2XI9 A;  1YIJ A;  2RK2 A;  4FL6 A;  4Z02 A;  3CCV T;  4BI4 A;  4C92 E;  1ZC1 A;  4RG2 A;  2RI5 A;  2HBP A;  2E6N A;  3V7R A;  5CK9 A;  3CBO A;  3HSB A;  3CEY A;  4MMK A;  4RG8 A;  3CPW A;  2DXU A;  3M56 A;  1LOJ A;  3FC3 A;  2KY9 A;  3CCU T;  2DZC A;  4NOY A;  3HRS A;  5GAM e;  5GAM d;  1G3T A;  2XKO C;  1QW1 A;  3OYA A;  1VQK T;  3UPU A;  1VQP A;  4ARI A;  4DQ2 A;  5LJ3 h;  5KH6 A;  3GF5 A;  3HFN A;  2P0P A;  3RKX A;  3JCM W;  1VQ5 T;  3CCU A;  2DKG A;  3S6W A;  4C92 C;  5LJ3 f;  2NLU A;  2JUF A;  3RMS A;  4A53 A;  4XTW A;  4OB2 B;  1I9G A;  2EFI A;  3QWZ A;  1X01 A;  1CZ5 A;  2VC8 A;  3JCM Q;  1DJ7 B;  1NJI C;  4C92 F;  4HT9 A;  2JTF A;  4QQG A;  3JCM e;  2LQK A;  4BAC A;  3TRE A;  2RD1 A;  4QVC A;  1W2B S;  3M5A A;  5GMK j;  2DZ9 A;  5HK3 A;  2L3R A;  5LJ5 f;  3QC8 A;  2LT1 A;  5CCB A;  3LX7 A;  4J5Y A;  3X25 B;  4XK8 E;  3ZBD A;  5GAM h;  1PSF A;  5KE2 A;  3L1A A;  2QA4 T;  4IUT A;  3LWH A;  4OB3 B;  4EMG A;  3TCJ A;  3CCJ A;  1WQ7 A;  3QO3 A;  4OF1 A;  1JJ2 S;  1KQ2 A;  4M7A D;  2WSF E;  3VV0 A;  4A4K A;  2DD4 A;  4M77 F;  3OW2 S;  1W2B A;  4JDS A;  1XQH A;  2MMP A;  4XTU A;  4OMF B;  2M16 A;  3CMA T;  3SWN B;  5D6Y A;  3LHD A;  3H8Z A;  4ZN1 A;  4BD3 A;  3L2V A;  1B34 B;  1ZBX A;  4PJO C;  3HP9 A;  1G5V A;  2XK0 A;  1WLF A;  4JUV A;  3V8K A;  1N9R A;  3DKM A;  2KVQ G;  2LC4 A;  2XHC A;  3JCM d;  3X24 B;  3CD6 T;  4PJO F;  1CR5 A;  3HU3 A;  5LJ5 g;  3JB9 G;  1NZ9 A;  3HU1 A;  1Y96 B;  4TVR A;  4XAX B;  2Q1A X;  3P8B B;  4M7D D;  1IZ6 A;  2PUK B;  2QQS A;  4C92 B;  4CRI A;  2E12 A;  2E41 A;  2L8D A;  3MEU A;  2IG0 A;  4KUI A;  1W4S A;  4A4F A;  3CCR T;  4ZN3 A;  4F7U F;  1LNX A;  2DAQ A;  3OYF A;  1KC8 C;  3PT9 A;  1VQN T;  3J7A F;  4OB1 B;  1K9M U;  4M78 C;  4IKF A;  3CD6 A;  4EDU A;  5A0G A;  2QEX A;  4IUU A;  5ERG B;  3ER0 A;  4HKE A;  4BI3 A;  1OZ2 A;  5M9O A;  5LJ3 e;  4ZTJ A;  4PJO D;  2MM0 A;  4M75 B;  3MHX A;  5A0D A;  3A8M B;  2RK1 A;  4J83 A;  2K3Y A;  4C8Q C;  2L5Q A;  4M7D E;  2LQ8 A;  3L2U A;  2ZPE B;  4RKU E;  1BI2 A;  1O75 A;  2E10 A;  2G3R A;  3ZFJ A;  2K3X A;  1V29 B;  3OS5 A;  5FLX E;  4DOW A;  1NPP A;  4HA8 A;  3JB9 D;  1M5Q 1;  2K5L A;  4OGE A;  2YLC A;  2QEX T;  1K73 U;  2QQA A;  3GNF B;  4A4E A;  3G6E A;  2JVV A;  2E1H A;  2RM4 A;  3SWN C;  4M75 G;  4HT8 A;  1YIT A;  1RI0 A;  2DVE A;  1U1T A;  5D6X A;  2HQX A;  3CPF A;  3FB9 A;  3QZ9 B;  4M75 E;  4PJO B;  1N8R C;  4EMH A;  2JNG A;  5LJ5 h;  1YHQ A;  3ASK A;  4OP0 A;  3WVE B;  3M9Q A;  4ME7 A;  4E7K A;  3E9F A;  1YJ9 A;  2M0O A;  3TU4 K;  4BI8 B;  2O4X A;  3OMC A;  5LL6 S;  4M75 A;  3KXT A;  2EQM A;  3QII A;  3SD4 A;  3SB2 A;  2LDM A;  2MWP A;  3M54 A;  1M90 C;  3P8D A;  1HK9 A;  3OYB A;  3CF2 A;  1UB4 A;  2ZPB B;  5FTJ A;  1KQS A;  1KQ1 A;  3INZ A;  4O6J A;  3T9N A;  2R5A A;  4PLL A;  3RKY A;  2GQV A;  4M78 B;  1R7R A;  2K5I A;  1OI1 A;  1KHI A;  2RHZ A;  3RUX A;  1YJ9 T;  2PWY A;  2RHY A;  4XTV A;  4OGC A;  4F7U B;  1Y7X A;  4M75 C;  5J3B A;  5LJ5 j;  3SDZ A;  1M4Z A;  4C8Q B;  4M78 F;  3CCS T;  2YRV A;  3GNG A;  5CKB A;  3G4S T;  4IUQ A;  2RI2 A;  4M78 G;  5CO7 A;  4ELY C;  2YUJ A;  3QZ5 B;  5LJ5 e;  1M1G A;  2E65 A;  2WSE E;  3DLM A;  5CKD A;  3PIP A;  2B8A A;  2VV5 A;  3GOX A;  4EPC A;  5C0M A;  3CME A;  1BYM A;  2YHT A;  4XTY A;  3SWN A;  1YI2 A;  5CCA A;  5GAN 4;  1M1F A;  2D9T A;  2EYQ A;  1Q86 U;  3BQB A;  2FL7 A;  3JCM V;  5GAN j;  2RA2 A;  5C18 A;  5J26 A;  5L8R E;  3VUZ A;  3G4S A;  2QQB A;  4LD6 A;  1WJS A;  3QSU A;  3NTK A;  4KUL A;  5FU6 B;  3OYY A;  2E64 A;  2XID A;  3CXC A;  4RV0 A;  4P5N A;  3M53 A;  5KE3 A;  2XIC A;  4J6X A;  4M7A E;  2OAU A;  3OYE A;  5C6S A;  1VQ7 T;  5CKF A;  2F5K A;  3UT1 A;  3VUB A;  4LDU A;  2L89 A;  4N4H A;  5HY6 A;  3RKW A;  3TIW A;  1Q82 C;  3QHS A;  5CCX A;  4J7F A;  1O9S A;  2ZPH B;  2D0Q B;  2DIQ A;  3I55 T;  5C1B A;  1QVG S;  2OTJ T;  2DJZ A;  5D6W A;  2RH2 A;  3OYD A;  1KQS S;  3DB4 A;  2A3L A;  2KK4 A;  5GLF A;  4BB7 A;  1PSE A;  3PMI A;  1K73 C;  5GAM g;  3OMG A;  2IVW A;  4FIB A;  1OYX A;  4IUV A;  4JLG A;  4QVD A;  2RJF A;  3G6E T;  4KOD A;  3KBG A;  2BIV A;  5DY9 A;  3FPU A;  2FVU A;  3O8V A;  3BDU A;  2K5F A;  2EJG A;  4PNO A;  1IRE B;  4MZP A;  1ZHI A;  3G71 A;  3CCE T;  2OTJ A;  3X20 B;  2DTH A;  1RL2 A;  2XDB A;  2X35 A;  4Y28 E;  1VQ6 T;  4RCB A;  4C0G A;  4C8Q E;  3GP8 A;  1I4K 1;  2KAF A;  3OQ5 A;  2DXB A;  1WNL A;  2DTO A;  2H3J A;  3A5Z B;  2RHU A;  4PJO G;  1YJW T;  3M4G A;  2CKK A;  3E19 A;  3J80 E;  2OTL T;  4E7H A;  3I56 A;  3KUF A;  2MF2 A;  3VYH B;  5FU6 C;  3TEE A;  1K8A U;  1QVP A;  5IT9 E;  1JRI A;  3CCL A;  4XTZ A;  2DIG A;  2DXC A;  4N0A A;  3SFM A;  1VQ9 A;  2GFA A;  1NE8 A;  3OSS C;  2VYT A;  4C0F A;  5DLQ E;  5EPP A;  2XDD A;  2DK3 A;  2D6F A;  3HPW A;  4C92 A;  2MAM A;  3A8O B;  1H3Z A;  3MP6 A;  1BI0 A;  5IN1 A;  2PVO B;  4F7U A;  4WF2 A;  3URG A;  5HK0 A;  3CCM T;  2PUO B;  4FT2 A;  1D3B A;  1Y07 A;  3PGG A;  5CKH A;  4B9X A;  4E47 A;  3JAM E;  2WAC A;  2FYK A;  2I2L A;  2CS7 A;  3M4Y A;  4XU3 A;  4C92 G;  1H64 1;  2KSS A;  1XTD A;  3DB3 A;  4GLK A;  2MI6 A;  4CI0 C;  2BUD A;  3JB9 J;  4J6Y A;  4XU2 A;  2ZGW A;  3QPH A;  5CVI A;  5CR2 A;  1Q86 C;  4MDX A;  3EFR A;  2DTI A;  1Q7Y U;  1I5L A;  5FTN A;  3JSC A;  2VGN A;  3OBW A;  5GAO n;  4JJN K;  3OW2 A;  3HU2 A;  2DXT A;  1VQO A;  3EFS A;  5GAN g;  2EKO A;  1QVG A;  2CZ7 B;  2K57 A;  4KDI A;  1SSF A;  3X28 B;  4BE2 A;  1HXD A;  1BIA A;  1B34 A;  2FHD A;  2XD0 A;  3N5B B;  3QKJ A;  5A2Q E;  4N4G A;  3JCM h;  1KD1 U;  4J7I A;  3ZEH A;  2P0K A;  1R8O B;  2V8J A;  3PMT A;  3X26 B;  1VQ5 A;  3RMQ A;  3OY9 A;  4HCC A;  4KT0 E;  3QJ6 A;  2E6Z A;  3V8J A;  5J39 A;  2C06 A;  1WGS A;  1VQM A;  2QXF A;  2DEQ A;  2E5Q A;  3OYH A;  5GAO r;  2RB6 A;  3GIB A;  1S3S A;  2VXE A;  3L42 A;  4LD9 K;  1VQ6 A;  3JCM c;  4ZGJ B;  1VUB A;  2PQW A;  5GAN e;  3LGA A;  2GCX A;  4NL3 A;  2RJD A;  1M90 U;  3OA6 A;  3V8L A;  3L2W A;  2X4Y A;  2LX9 A;  3RES A;  3F70 A;  1I81 A;  5GAN 7;  2BKD N;  3FJP A;  1N27 A;  3BDL A;  1QDN A;  1YIT T;  3OYC A;  3JCM g;  3LLR A;  2HQE A;  2JTM A;  2QA4 A;  1M1K C;  1P92 A;  1VQK A;  1MGQ A;  3QBY A;  3CCJ T;  3G7Z A;  3LH0 A;  2XG8 D;  3PFS A;  2K2V A;  2Q19 X;  2RJC A;  1Q7Y C;  3OYL A;  2Q1C X;  5CQX A;  2CZ1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...