4UC4A

Crystal structure of hybrid tudor domain of human lysine demethylase kdm4b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
AVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
molecule keywords Lysine-specific demethylase 4B
total genus 20
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4uc4A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4uc4A02
3L2VA 3OYNA 2LRQA 5IN1A 4ZTFA 5KCOA 2R57A 1XNIA 4OVAA 4CRIA 3LGFA 5D6XA 5KE2A 3QBYA 2X35A 2IG0A 3LX7A 3PFSA 4E7JA 4EDUA 3L2UA 3ASKA 1OZ3A 5C0MA 2LTOA 1WGSA 1OYXA 1WJRA 3OS2A 4BE1A 4HCZA 3H8ZA 3OMCA 4QVZA 3LYIA 4IUVA 3M9QA 2HQEA 3OQ5A 4B9XA 2JTFA 2LCCA 5J39A 3S3OA 3DB4A 3QKJA 2O4XA 2EKOA 2F5KA 5KCHA 3FC3A 4ZTJA 1KHCA 2RI2A 3OYJA 2RJFA 2JZ2A 4E7IA 2RHXA 3PNWC 4L59A 4BE2A 3S3NA 3OB9A 2DIQA 4C5GA 4C5IA 3ZEHA 3OYAA 3MP8A 4E7LA 3UWNA 3GOXA 2RI5A 1OZ2A 2RJEA 2E6NA 3DLMA 3LLRA 4NS5A 2D9TA 2VYTA 4X34A 4QQDA 5D6YA 1RI0A 3E9GA 5FROA 4B9WA 3PMIA 4E7KA 2RHYA 3L42A 4PLLA 3ME9A 3L2WA 3FLGA 2X4WA 2M1HA 4A4FA 3OYDA 2WACA 1WJSA 4Q5WA 4BD3A 4C5EA 5CIUA 3OYEA 1OI1A 3OYBA 2HQXA 2EFIA 3FDRA 2FHDA 2RHUA 2EQMA 3S6WA 3SD4A 3Q1JA 5D6WA 4II1A 2QQSA 4E7HA 2X4YA 2L89A 3MEVA 3LH0A 4PLIA 2RHZA 2BIVA 2EQJA 4BDZA 2RI3A 4A4GA 1H3ZA 2RJCA 2M16A 2R58A 3S3MA 5KE3A 5J26A 2RHIA 3OYCA 2XK0A 3OYGA 2QQRA 4LD6A 3MEAA 3MEWA 3OY9A 2BKDN 2EQUA 4UC4A 2M0OA 4GY5A 2GFUA 4BACA 4RG2A 4BE0A 3EAEA 4A4EA 5FRMA 3BDLA 3OYMA 3L2RA 2LVMA 3CEYA 3H6ZA 3C4SA 1WJQA 3OMGA 4N4HA 4IKFA 5IAYA 5M9OA 4IUPA 4FL6A 4N4GA 4IURA 2R5AA 1N27A 3OYKA 3OA6A 2EQKA 3QJ6A 4PL6A 4A4HA 3P8DA 2DIGA 2RJDA 3O8VA 2DAQA 2K3YA 4Z02A 3NTHA 5KH6A 2O4XB 3DB3A 4IUUA 3L2QA 2BUDA 2K3XA 3MO8A 3MEUA 4QQGA 2XDPA 4QW2A 5C6SA 4BDYA 3OYIA 2LDMA 2L8DA 2B8AA 4C5HA 2E5QA 3MP6A 4FU6A 2MWOA 4IUQA 3LGLA 1G5VA 2PQWA 2X4XA 3OYFA 3UT1A 4N4IA 3OS1A 2RO0A 1SSFA 3OS0A 3E9FA 3NTIA 2GF7A 3MP1A 3P8HA 2CKKA 3FEOA 3F70A 4IUTA 2NLUA 3PMTA 2GFAA 3QIIA 1MHNA 3META 3OYLA 2G3RA 5FRNA 3NTKA 3OYHA 4QQ6A 2L3RA 2P0KA 2R5MA 2YRVA 2MWPA 3KUFA
chains in the Genus database with same CATH superfamily
1E7OA 1ZA2B 1XNIA 2KEAA 2YUNA 1H8KA 1U3OA 1WHHA 5CR2A 5DYIA 3EG9A 5A0GA 4C8QE 4M7DB 2F69A 2W10A 2YRCA 4M78E 5GAOn 4L59A 3C94A 3I55Q 2V8JA 4CC3A 4OGCA 3UDCA 2YUQA 2E6ZA 4ZN1A 3JSCA 3CCST 2DL8A 2Y90A 1JJ2P 3V8JA 1HD3A 2V8KA 1OI1A 4DEYA 2AKKA 2E64A 4II1A 1S3SA 1VQ4Q 2KAFA 3M57A 3LH0A 1N8RR 2EPDA 2DILA 1K8AU 1VQ8T 5LJ5f 2GTJA 1D0YA 2D0QB 2DTOA 1QVFP 2ZCFB 1MMDA 2JN0A 3QDRB 1Y57A 4ORZA 3JCMJ 3JB9G 2LP5A 5GMKj 7AT1B 5CQYA 3M0RA 4A4EA 1VQ7A 2LCLA 4K11A 4L6V5 5IAYA 2EJ9A 1ARKA 4PJJA 1E6HA 4XTYA 4J9BA 5KYYB 1YI2T 4A4HA 1K0XA 3OW2S 3AHUA 3L2QA 1LPLA 3MEUA 4IUQA 2JOYA 1RUWA 3CCJA 2CP2A 1X43A 4RTVA 2W0ZA 3FEOA 3F70A 4IUTA 1QVPA 1UGQB 2RH2A 4BI8B 3EGXB 2H8HA 2I0NA 3CCMQ 5C1BA 1J3TA 1SG5A 3CCVQ 5IN1A 3VUZA 1KC8R 5DM7R 2JTEA 4ATOA 1M4ZA 4A54A 4J6XA 4HVWA 1YJWA 2VXFA 2DD5A 5FTJA 4C8QB 3O5ZA 2LX9A 5ECAA 4ZTJA 1X69A 4C5IA 1R0CB 4FCYA 1VQMQ 1M2VB 2VYTA 4C0DC 3E9GA 2GQVA 1K8AC 3PMIA 1KQSA 4RCCA 1YJ9T 3L42A 2EJFA 1WXTA 3TCJA 2CYZB 3G71Q 2CP5A 3M0PA 1U8RA 3QJYA 5GAN3 3HRSA 4BDZA 1VQ4A 2VXEA 1KQSP 3GF5A 2YLBA 4EPCA 2PNIA 5IXBA 3MEAA 2F2XA 3MEWA 4HT8A 3CC7T 1KD1C 1WDXA 2JS0A 2GFUA 3GNGA 3OYMA 1W2BS 3JCMd 3CC2Q 1E32A 3BDUA 4PJOC 5GAMh 2LJ0A 3CCEA 3CCLA 3THKA 3QYHB 4OMQA 1W4SA 5LJ3h 1Q82U 4F7UG 4E6RA 2QA4A 3EHQA 3E19A 4AT1B 2JV2A 2RPNA 2RD1A 2XU8A 3TQ7P 3M59A 1KQSS 4XAXB 3P8HA 1V29B 2E4HA 4KUDK 2O88A 5CVIA 4BUGA 2ROLA 5GAN8 1AVZC 3G6ET 4KO8A 2ED1A 5KE3A 8ATCB 2ABLA 3TIWA 4F17A 4BI3A 1K0SA 5I2MA 2FG0A 1QVGA 1ZSZA 3EFOA 2H3EB 3LGFA 3GIBA 2D1XA 1YWOA 2DZ9A 2WSEE 4IUVA 5GAN6 4OMLA 3QKJA 2MM2A 3FC3A 1KHCA 2RJFA 2A36A 1VQMT 1UTIA 1VQ6T 2RHXA 4A63B 3CC4Q 2YRDA 1RAHB 4M7AB 3UWNA 2RK2A 1MGQA 1CZ4A 2PWYA 1RI0A 1GFCA 1B3QA 1YNZA 1FWZA 2DXUA 2DFUA 2JT4A 2F2VA 1UB4A 2HBWA 2PUOB 2HQXA 5FU6B 2ENMA 2L5QA 1M1KC 1YFNA 4JRQA 4OB0B 4BB7A 2OTLA 2X4JA 2XKOC 4RTYA 3RR6A 2EYZA 4XTZA 4M7AD 4A4GA 3EFOB 4OP0A 3QHSA 2ZPGB 3SB2A 1MV0B 3RUXA 2VKNA 4UC4A 4ESRA 1TS9A 1G8XA 2VGMA 3RERA 2JUFA 3FRNA 2DL7A 1G2BA 1QCSA 4IIOA 1I5LA 2YLCA 3H0HA 2R5AA 5GAN2 5CKEA 2RQRA 2RJDA 3CBMA 4M77C 1RI9A 2O4XB 2CGHA 2K3XA 2XDPA 1D1CA 1JU5C 1YJNQ 2Q19X 4AG2C 3OS1A 4Y28E 2CUDA 3ZL7C 5HKCA 3EGXA 4J83A 2EGCA 2E3HA 1M9SA 1ABQA 1QVGP 1R0BG 3M4YA 3OYHA 3JCMg 1G3TA 1JJ2S 4O5VA 3GNFB 1VQOA 1BU1A 4ZTFA 4E47A 1TUDA 4KLNA 3WVDB 5KE2A 1Q81R 1WHLA 2O9SA 2VC8A 1JXMA 1S1NA 3HRTA 3H8ZA 3CQTA 1VQ6Q 3X28B 1I81A 4M7DC 4WTOB 4B9XA 1YITA 2M9UA 4B6MA 1VQOQ 3HU2A 4F16A 2YXYA 3G4SQ 1NLOC 1SRMA 5EC7A 1D3BA 2QQ9A 2KR3A 3I56Q 1TU0B 1M2OA 3QYGB 2RI5A 3CCUQ 3LLRA 5LJ3g 2QGGA 2JXBA 4B9WA 2AKLA 2LT4A 1AHJB 3FPTA 1M27C 5A2QE 1GBRA 1D1AA 4HCKA 3OYEA 2NUPA 2DXBA 2KXCA 1B34A 2F1LA 4RUGA 1M1KU 2X4YA 1P92A 2M16A 2RA2A 5GANf 1TXQA 3HRUA 1VQLQ 5C18A 2OTLQ 1PCXA 4PFOA 2ZAEA 1NEBA 1FX7A 4BACA 4EIKA 1QW1A 2YT6A 1VQMA 5CO7A 2D8JA 4N4HA 4JJCA 3JB9I 4ZGDB 3FIFA 1W2BA 1IO6A 2EGEA 1CSKA 2L3PA 1YJNT 1WA7A 3E1SA 1I8FA 1V76A 2AHJB 2BZYA 2KBTA 2LJ3A 3ULRB 3MJXA 2COWA 4QQGA 3V7SA 5C6SA 2FB7A 2LDMA 2OJ2A 1BIAA 3NGPA 4M75F 1WNLA 2GF7A 1N9RA 1RL2A 1AD5A 1XOVA 2HD0A 2L0AA 2LW6A 3CC2A 3N5BB 1T3LA 2OI3A 4KGVB 6AT1B 3CXCP 1GRIA 4QQ6A 4F7UA 1Q82C 3R6OA 3KUFA 2E1HA 1Q81C 3BY7A 2COZA 4R55A 1M5Q1 3NMZC 1VA7A 1X27A 3QBYA 3MKDA 1D1BA 1H92A 1OZ3A 1ZSZB 3CXCA 2DK3A 1K9MR 1Q86R 3LYIA 4E7SA 2JTFA 2F5KA 2ZPBB 4M75A 1WQ7A 2JZ2A 1PG5B 5CQXA 4XK8E 5CK9A 1IHWA 4LDWA 5KYYA 3M5AA 3H0IA 1OZ2A 3DLMA 1ZC1A 1KD1U 2KRSA 3L2WA 2E12A 1OU8A 1QKWA 3OYBA 1I5OB 2HNIA 2K7AA 1VQ9A 1Q7YC 2AK5A 1BCMA 1BKBA 3MEVA 1B07A 2DE0X 2MIOA 2COYA 4FYXB 1GFDA 1VQPT 1B34B 1VQ5A 4C8QF 1UECA 3QXEB 1VYTA 3IQLA 1WHJA 1TSFA 3EAEA 1ABOA 4C92G 3M4GA 4FW2A 1JJ2A 1JXOA 4J9EA 4M75C 2E41A 4M7DF 1M90R 1IGUA 3O8VA 4ELZC 1ZUYA 5KH6A 2HKQB 5GAN7 1I4K1 1WIEA 1MUZA 1NLPC 4BDYA 2PJHB 2LNHB 2LQKA 1UFFA 2XICA 5KYUA 4KH0B 4KULA 3VYGA 3PIOA 3CCET 4LDVA 3G4SA 3I5SA 1YIJT 1F1BB 2GFAA 5GAMe 2D6FA 3QPHA 4EMHA 1OX9A 5FWBA 1RADB 3MB5A 2RQWA 1U1SA 1MNEA 2J05A 1S72T 4XQ3A 2LX7A 2K5LA 4R0KA 3REBB 1SPKA 5D7UA 5KYWB 2VV5A 5DLOA 3QC8A 2IG0A 5LJ5j 2XMFA 5CKDA 4KT0E 4Y91A 9ATCB 3CD6T 5IXFA 1YJNA 1U5SA 3T9NA 5L8RE 2KT1A 1WZOA 2HCKA 4KODA 3OQ5A 2E3IA 4JS4A 5J39A 1YCSB 2O4XA 4Z8AA 1QWFA 1VQ9Q 2KI7A 4OMMA 1JRIA 3ZEHA 4PKCC 3M0QA 3PT9A 1MNDA 3REAB 4GLKA 1ACMB 1K4US 2Y4YA 3ME9A 2VVKA 2X4WA 4A4FA 3OYDA 1LCKA 3A8GB 3CBPA 1YP5A 2A0FB 2FPFA 4FT2A 1JO8A 2DKGA 4XU0A 5D6WA 4JLGA 2J7IA 4ZGEB 2VB6A 3RESA 2HL3A 1GBQA 2O01E 4FSXA 2RHZA 3CMET 1QCFA 2RJCA 2EYXA 1RACB 2DPPB 1VQNA 3QQ7A 2RHIA 2VGNA 1I0CA 4LD6A 3D7SB 1YI2Q 3SFMA 2CZ1B 4RG2A 1G83A 1N5ZA 3VV0A 3R6NA 1SSHA 2DRKA 2DEUA 4IURA 3HSBA 1VQNT 4M78D 3KFVA 4MZMA 2BE7D 4RKUE 2YDLA 3H0FA 4M77B 1TTHB 2P4TA 3NTHA 3A1PA 4OMPA 1WHGA 2C0TA 3JCMc 4DOVA 1JQQA 2MAMA 3MP6A 2PQWA 3OYFA 3HKSA 1CZ5A 2QK0A 5FU7B 3V8KA 1WFWA 2CKKA 4M7AF 1KJWA 2DO3A 1M1KR 1YJWT 2D8HA 3ZGZA 1C0MA 1VQ5T 2KMTA 4EMGA 4MMKA 4JRKA 1VQLT 1NYGA 4FYYB 2YRVA 1M2VA 3JRZA 3EG9B 3HU3A 4J6WA 3CD6Q 4OVAA 3SHWA 3JCMV 4FYVB 1U1TA 3L2UA 1OPLA 3EGUA 1AWXA 4XTUA 5IT9E 1WGSA 2V1QA 4BI4A 2LZ6B 1M3AA 1RLPC 4GBQA 3DB4A 4QT7A 5FW9A 5J3BA 3NFCA 3ZFJA 4R56A 5GAN4 4Z89A 1RAGB 1X01A 2CH4A 4JDSA 2E6NA 3I9QA 4PJOF 1YN8A 1WX6A 2KROA 1RLQC 3QWZA 1D3BB 2HSEB 3CC7A 3L2VA 4BD3A 1M3CA 4QKUA 2DETA 2KY9A 1TOVA 4E2FB 2RQUA 5ERGB 1ZUKA 4NL3A 2AIRB 2BIVA 1YHQA 5GAMd 3OYGA 2DTHA 1W2BP 5FLXE 4OGEA 2SRCA 2YUOA 4AFSC 2LNVA 1Y96A 3UF4A 3ZJUA 2DL5A 3RKXA 1Y7XA 4PFPA 1BI2A 5I22A 1PKTA 4Z88A 3L1AA 2F5TX 4ZNXA 3CCSQ 4F7UE 4M4ZA 4FSSA 5GANe 3FPUA 2PU9B 1UUEA 2E5QA 5FTNA 2EGAA 2VWFA 4M77A 4FT4A 1HSQA 2K5IA 1W6XA 2BZ8A 4KBMB 1X6OA 1VIFA 5EPPA 2XD0A 4LUDA 3VS4A 4J7IA 2J6OA 5DYGA 2Q1AX 2CZ0B 2M02A 1GXIE 5KCOA 4J7FA 4PJOD 2WSCE 4ANJA 4F7UB 2HBPA 2GTOA 2K57A 3CC4T 4BE1A 4QVZA 5CCBA 3QQ8A 1VYVA 2K2MA 1QCOA 2O31A 5HK3A 1EZZB 3HP9A 1KC8C 2EYQA 3X24B 3MP8A 3JB9H 2CP6A 4HVVA 2FVUA 4N0AA 5FROA 4E7KA 2LCSA 4HVUA 1O9SA 4PLLA 4C8QC 4WF2A 2WACA 4Q5WA 1VQLA 2MOXA 2FRYA 4C5EA 5KYXA 4DBFA 5LJ3j 2PUKB 4J9GA 2PVDB 2KE9A 3CCVT 1XJWB 4X9DA 3V8LA 4XTVA 3S3MA 2MPXC 1PHTA 3EFRA 3JCMQ 2XK0A 2IPOB 2P0QA 4JRIA 4F04B 1AWWA 2BKDN 2DYBA 3JCMh 3BQBA 4KDLA 4OB2B 4M7AE 4NOYA 2F2WA 3H6ZA 4PJLA 3C4SA 3CCQA 1VQ9T 3CPWA 2DMOA 3RKWA 4M78F 1WHKA 4NL2A 4M75B 3OA6A 2DAQA 1WXBA 2K3YA 2A3LA 4A53A 2A08A 4IUUA 4QW2A 4CC7A 2FZKB 1OU9A 4C5HA 3QSUA 3X26B 1FYNA 1N6AA 3CBOA 2DYIA 5HCKA 5GLFA 4VUBA 4C92E 2WSFE 3UA6A 1FMWA 2EW3A 3SWNA 4ARCA 4X9CA 1BI1A 5CKBA 1KHIA 3HFOA 1JB0E 1OYXA 1O75A 4CC2A 2KDSA 4M77D 5LJ5d 4QVDA 2ZPHB 1VQKQ 4J5YA 1Q86U 2YVLA 5KCHA 1T3SA 2EKOA 2DX1A 2MCNA 4BE2A 3GOXA 2HQHA 5LJ5h 5GAOm 2NUTB 5LL6S 2JM9A 4OMFB 1NZ9A 2M1HA 2Q1CX 1SF9A 3FDRA 2JNGA 5IHNA 4FYWB 4JS5A 1M90U 2L3SA 3HPWA 2QQSA 3TVTA 3LWHA 5LJ3e 2RF0A 1R7RA 4M7AC 2EQJA 2P0PA 1H3ZA 3INZA 4JZ3A 2PVOB 3EGDA 1YI2A 4KRTA 2FO0A 1MV3A 3CMAA 4J8OA 2CDTA 3P8BB 1PWTA 1WHMA 4WCIA 2M0OA 1AEYA 3HL8A 4XU1A 5KYNA 4J6YA 4M7DA 2MI6A 4J9HA 4D8DA 2ECZA 2XDBA 4LDUA 1WI7A 1VQ8A 2G6FX 3CMEA 2K5FA 3CPWP 1QDNA 4C8QD 1YJ9Q 3RMQA 2MMPA 4M7DE 1VQ7T 2JW4A 2B8AA 1M8MA 4JPBW 1VQ6A 5CCAA 1LOJA 1Y0MA 1QQJA 2RO0A 1PD0A 1SRLA 2P84A 3RBBB 5I21A 2FL7A 1QP3A 3G7ZA 3PVLA 1QVGS 3I56A 2C06A 4C8QG 3QO3A 1FXXA 4XU2A 2RMOA 2V8IA 4PJNA 2DLPA 2GGRA 1KQ2A 3EGDB 3VUBA 2ATCB 5FU7C 1K76A 2SEMA 2DBKA 2LMJA 1X75C 2QEXQ 5C0MA 1N8RU 2DXTA 3I55T 2GQIA 3M9QA 2CSIA 3S3OA 3CXCS 2K3BA 4P5NA 1GCPA 2KXDA 4M78C 4E7IA 3EG1A 3TU4K 4AG1C 3CCLQ 1TUCA 1TH7A 1W1FA 2P4RA 3A8LB 5GANh 2QEXA 3EH2A 1ZBXA 3CPWS 2RHYA 3FJ5A 2DJQA 1I1JA 4ELYC 1K73R 4C0ZA 2EFIA 2XI9A 2DF6A 3RKYA 5GAOl 3OSVA 4C92B 3DLLA 4BY6B 1KIKA 1KG1A 2KGTA 1VQPQ 2L89A 1VIEA 2K9GA 4J9IA 5FTLA 2AZVA 2X3XD 2QI2A 2QDLA 5AT1B 2HSPA 2HMAA 3L2RA 4M75E 3OMGA 1Z9ZA 4AFUC 1WQWA 2O9VA 4N4GA 4HT9A 4HCCA 4E7ZA 1RABB 3M53A 2X51A 1AT1B 2DJZA 1K8AR 4Z02A 2DVEA 2E70A 4D6WA 4MDWA 3VU3C 3C95A 2CP0A 3LGLA 1JBMA 1PC0A 3J81E 1SSFA 2C0IA 3EH1A 2IVWA 2OTJQ 2HL5C 1IREB 2CP7A 2QA4T 3SDZA 4M7AA 4C92D 4DBQA 3LGAA 1OPKA 2K4YA 5LJ3d 2RQTA 4RMOA 3OYNA 2QTVA 1WXUA 3G71T 4J9CA 1VUBA 4CRIA 5DY9A 3OW2A 5GAMg 2FZCB 3LX7A 1O54A 3EFSA 2JTMA 4E7JA 3X25B 4EDUA 3ASKA 1ZSZC 4O6JA 2KSSA 3OS2A 3JCMP 4RTUA 5GJVB 2HQEA 3A8MB 2JMCA 8AT1B 1ZHIA 4V2SA 1BBZA 2RI2A 1GCQC 3S3NA 2DIQA 2EIFA 1NE8A 1HK9A 4M7AG 3MCAB 4MDXA 2NUPB 3VRZA 3BFMA 1Q82R 2K79A 1QLYA 3CCSA 3M0UA 1V1CA 1KQ1A 2LJ1A 2OTJA 5GMKe 1ZBJA 2ROTA 3HHTB 1HXDA 1D0ZA 3FB9A 3S6WA 2RHUA 1KK7A 1IXDA 4KGZB 2YUPA 2A37A 4KDIA 4OB1B 1PRMC 4PLIA 2NUZA 3GP8A 3M56A 3CC2T 1UJYA 3CCQQ 2XHCA 3J7AF 2BZXA 2AZSA 4EMKC 4LDYA 4EMKB 5GAOr 2DBMA 1AOJA 2FEIA 2J06A 2QQBA 4M75D 4OB3B 3CCUT 4M77E 4EMKA 2M51A 1YWPA 2X3WD 5EQJB 4LNPA 2NUTA 4JJBA 1NJIR 4RTXA 5LJ5e 3ER0A 2PTKA 4FU6A 4M77G 1VQ5Q 2J6FA 4N4IA 3E9FA 5GANg 3MP1A 5GMKh 1IHVA 4KH1B 2QGFB 2DA9A 1YIJA 3PMTA 3NHNA 1Q7YU 1BK2A 5KYXB 1QVFA 3META 2RNAA 2DERA 2GBQA 2DZCA 5FWCA 3QUIA 4JJNK 2LRQA 4J9FA 1NPRA 2B86A 2R57A 1QP2A 2X35A 1K1ZA 2KQWA 3PFSA 2MF2A 4DA4A 2E10A 1AZGB 1BIBA 3GBQA 4M7DG 2LTOA 4MZTA 3OMCA 3JCMb 1IGQA 1ZLMA 4DBHA 1SHFA 2JS2A 4JRPA 4KUIA 3JAME 5I2SA 2KYBA 4XTWA 2XDDA 3VS1A 2RK1A 2B25A 1OOTA 1NG2A 2EQIA 4HKEA 2RQVA 4C0DB 4M7DD 3EHRA 4QQDA 1H3HA 1YBYA 1YJ9A 3I5RA 1VYUA 4ZGJB 3WXMB 1FMKA 3JB9J 3G6EA 1LVKA 5CIUA 2FPEA 4PJOE 1Y71A 3BE3A 1W70A 2VASA 2VUBA 1HJDA 2DRMA 2QAZA 2MM0A 4F14A 1UEBA 2PVGB 4LDXA 1NJIC 4MMLA 3EG0A 3C0CA 1C1AA 2DD4A 2NWMA 2XIDA 1AWJA 2RN8A 3CCRA 3JV3A 3BDLA 1VQ8Q 3OBWA 4M75G 4IKFA 2V1RA 3UPUA 5CCXA 2CREA 4FL6A 3CCLT 1PSFA 2LC4A 2DEQA 1UJ0A 1X6GA 4PL6A 1Q81U 1QKXA 2KT8A 1NEGA 3TREA 1H641 2HKNA 3CMAQ 4M78A 1OQKA 3DB3A 3CCRT 2YHTA 1PRLC 2L8DA 4XTXA 2MWOA 3JCMW 1G5VA 2X4XA 1NM7A 3VKIA 3OS0A 3SWNC 2NYSA 3NTIA 4OMNA 5GMKl 3SWNB 1YHQQ 2QASA 1OEBA 5GAOq 4HXJA 3NTKA 2KYMA 2EBPA 2R5MA 1D0XA 4KGXB 3VS2A 1BYMA 3G71A 1CR5A 1DJ7B 3CCUA 2EYWA 1WLPB 1K73U 3A8HB 2X9HA 2V26A 3E2UA 1WJRA 3VS5A 3I56T 1PNJA 1Q86C 4TVRA 5FU6C 2QG9B 4M78B 1PSEA 3VS7A 2DTIA 1NYFA 3PNWC 3CCVA 3OB9A 1SHGA 2BE9B 1M1FA 2LQ8A 3M0SA 1CKBA 1C6VX 4X1VA 1YJWQ 5GJWB 2OTJT 2QA4Q 2FRWA 3JB9F 3OBYA 2DL4A 4ME7A 3OW2P 3Q1JA 3QZ9B 4BY6C 2OTLT 2QEXT 3U23A 2JJ9A 1M8VA 2CS7A 3SEMA 3RMSA 2RM4A 3DKMA 5HY6A 2EVRA 1NPPA 1UG1A 2OX7A 3OY9A 2IIMA 3L2ZA 1XTDA 3LHDA 4GY5A 1N8RC 1UDLA 1D09B 1QVFS 2CZ6B 3CC7Q 3TEEA 4LE9A 4RTZA 1BCOA 2QXFA 1RAFB 1TWBA 2LQWA 1ZSGA 3OYKA 3TSWA 3M0TA 3MHXA 1EX4A 2QYZA 4ZN3A 5KYUB 2DIGA 4C92A 3ZJTA 1G3WA 4FIBA 5GMKi 1WPYA 3OYIA 4C92F 1BB9A 3UT1A 1MMAA 1GL5A 3H41A 3UATA 2Q18X 5A0DA 3QG1A 4JLIA 1FMVA 5LJ5g 3RIRA 4Y92A 2NLUA 4HA8A 4LXCA 2YSQA 3ZJVA 1Y07A 3CD6A 3HTRA 1OULA 3OYLA 1RAIB 2L3RA 2P0KA 4PJMA 1K9AA 3WVEB 2JM8A 1AZEA 2ED0A 1KC8U 1VOMA 2ZPEB 2A7YA 2ZZDA 1PM3A 1BI0A 4YTLA 4HCZA 3CC4A 2BTTA 5GANd 5CAIA 2YWWA 2OAUA 1OV3A 1Y96B 5GAOp 2E65A 1LJOA 5LJ3f 2K2VA 5IHKA 3OYJA 3GLXA 2EYYA 2C0OA 4M77F 1T0HA 4JZ4A 4PNOA 4E7LA 5KYWA 4AQ7A 4NS5A 2K6DA 5D6YA 3OSSC 3FLGA 4CC4B 5L23A 3J80E 5GANj 3QWXX 1PD1A 1YITQ 3URGA 2GNCA 4D8KA 4LN2A 5GAMj 3CCEQ 3QWYA 2R58A 5HK0A 4DEXA 5J26A 3OYCA 5GAN5 1M30A 2DM1A 2EQUA 2JVVA 4PK4A 3NPFA 1UGVA 5FRMA 3CEYA 1ZUUA 5M9OA 4IUPA 2I2LA 4C0GA 4CI0C 4RV0A 2HAXA 1RAAB 3P8DA 4QVCA 3VS0A 1E6GA 4DQ2A 4C0FA 2RB6A 3CPFA 4L5GA 5IH2A 2KNBB 2HDAA 1S72Q 2KRMA 5IHIA 4M78G 3JB9D 1QMCA 3PE0A 3QIIA 1LNXA 4F7UF 3KBGA 2EJGA 5FRNA 2G3RA 4RG8A 2L3QA 4AFQC 2M0YA 2MWPA 2HEQA 4RTTA 1VQ4T 4FM4B 5FTMA 2EAYA 4GLMA 3VS6A 1KFZA 3PIPA 5AYFA 3LH5A 4PJOG 1TG0A 4PJOA 4IIMA 3QDFA 4HCBA 1K9MC 2A28A 1UGPB 2LCCA 3H9NA 5GAMf 3CCRQ 4CQNA 1SEMA 1ZX6A 1WLFA 1YCYA 2JMAA 2D0NA 2RJEA 3G4ST 1AWOA 3JCMe 4X34A 3TSZA 1YHQT 2KK4A 1X2KA 2DNUA 4JJDA 3UA7A 3CMEQ 3CCMA 4JUVA 1YITT 1BI3A 3EG2A 4DBRA 2CZ7B 1KSWA 4OMOA 4A4KA 3QZ5B 4PJOB 1YIJQ 3AT1B 2RI3A 3EG3A 2CUBA 3MPUB 1TUGB 3CCJQ 2XG8D 2MK5A 3OYYA 2QQRA 3CCMT 2DXCA 4RCBA 1VQNQ 3V7RA 3VS3A 5I11A 3FPRA 1QWEA 2FPDA 5FTKA 4BE0A 2PZ1A 2FZGB 3C12A 2Z0WA 3I35A 1CKAA 1N9SA 2EQKA 3QJ6A 2QTXA 3PGGA 1KD1R 2Q1DX 2DVJA 2ESWA 3MO8A 3CF2A 3FJPA 1Q95G 1NJIU 3VJPA 1G3SA 3JCMX 4N0AC 4C8QA 5CKHA 2QDYB 1OX8A 1K73C 1X6BA 1S72A 1M1GA 1R8OB 2ZPIB 2OAWA 1JEGA 2MYSA 3JCMf 2CP3A 3HFNA 2O2OA 3OS5A 5D6XA 2ZGWA 4RTWA 4AMCA 4MZPA 1UHFA 2CT3A 4FW1A 3VYHB 3ZBDA 1U06A 3CMAT 3I55A 1G3YA 4LD9K 1M3BA 2LT1A 1NBEB 1K9MU 4AFZC 4OF1A 1SKUB 1VQ7Q 2LQNA 4C5GA 1UGSB 3OYAA 1XQHA 2KVQG 2QQAA 1QCNA 2DL3A 3V7CA 4LUEA 2EWNA 2D9TA 2ZPFB 5GMKm 3LW5E 3VRYA 1ZQ1A 4ARIA 1RAEB 4PFZA 4J9DA 1WJSA 3RNJA 5B6CA 2FHDA 2EQMA 3SD4A 2YUJA 4E7HA 1PKSA 1A0NB 3CCJT 1IZ6A 3CCQT 1R77A 1UHCA 1Z9QA 5DLQE 4DOWA 5A0LA 1IB8A 3GPLA 3A8OB 2KRNA 2J6KA 3PVQA 4AS1A 3G1JA 3G6EQ 1MMGA 2FYKA 1VQKT 3A98A 1WYXA 1IRXA 5EG2A 1EFNA 1M90C 2LVMA 1B7TA 1WJQA 4C92C 3LWIA 3KXTA 3M58A 2AT1B 1GCQA 1N27A 4XU3A 2CSQA 1I07A 2HZYA 1T0JA 1X2QA 2CH4W 1UGRB 1VQKA 1VQPA 1I9GA 3A5ZB 2BUDA 1ZA1B 3HU1A 1VQOT 2GCXA 2EKHA 5CD1A 3PTAA 1HYOA 1UE9A 3BW1A 1Q7YR 2Y4XA 2E5KA 3M55A 1EIFA 5CKFA 3M54A 1MHNA 3RDVA 1MMNA 3X20B 2CT4A 2L2PA 2H3JA
chains in the Genus database with same CATH topology
1BYMA 3BY7A 3G71A 1CR5A 4R55A 1BI1A 1M5Q1 1XNIA 5CKBA 1DJ7B 3QBYA 1KHIA 3CCUA 3HFOA 1JB0E 1OZ3A 1K73U 3A8HB 3CXCA 2DK3A 5CR2A 1OYXA 1WJRA 3I56T 1O75A 5DYIA 2KDSA 1Q86C 3LYIA 4M77D 5LJ5d 5A0GA 4QVDA 2ZPHB 4TVRA 4C8QE 4M7DB 2JTFA 4J5YA 1Q86U 2YVLA 5FU6C 2F69A 5KCHA 4M78B 2EKOA 1PSEA 2F5KA 2ZPBB 4M75A 1WQ7A 2JZ2A 4M78E 2DTIA 4XK8E 5CQXA 5CK9A 3PNWC 3C94A 4L59A 4LDWA 5GAOn 3CCVA 3OB9A 4BE2A 2V8JA 4OGCA 3UDCA 3M5AA 3GOXA 1OZ2A 1M1FA 5LJ5h 2LQ8A 5GAOm 3DLMA 5LL6S 1ZC1A 2E6ZA 4ZN1A 1KD1U 3JSCA 3CCST 2Y90A 2OTJT 3V8JA 4OMFB 3L2WA 1NZ9A 2E12A 2M1HA 3OBYA 3JB9F 2Q1CX 2V8KA 1OI1A 3OYBA 3FDRA 4ME7A 2JNGA 2HNIA 3Q1JA 4JS5A 3QZ9B 2E64A 4II1A 4BY6C 3HPWA 1Q7YC 2QQSA 1M90U 1VQ9A 2OTLT 1S3SA 2KAFA 1BKBA 3M57A 3LWHA 3MEVA 5LJ3e 3LH0A 1R7RA 4M7AC 2EQJA 2P0PA 2QEXT 1H3ZA 3INZA 1K8AU 1VQ8T 2PVOB 5LJ5f 2CS7A 1M8VA 3RMSA 2D0QB 2DTOA 1YI2A 2RM4A 1B34B 3DKMA 5HY6A 1VQPT 3CMAA 2ZCFB 1NPPA 4C8QF 1VQ5A 2JN0A 3QXEB 3QDRB 4J8OA 3OY9A 3L2ZA 1XTDA 3P8BB 3LHDA 3JCMJ 3JB9G 3LGAA 2M0OA 5GMKj 3HL8A 4GY5A 4XU1A 1N8RC 3EAEA 4J6YA 5CQYA 4A4EA 4C92G 1VQ7A 1QVFS 2MI6A 2CZ6B 4M7DA 3M4GA 2LCLA 4L6V5 3TEEA 5IAYA 2XDBA 2EJ9A 1JJ2A 2QXFA 4LDUA 1VQ8A 4M75C 2E41A 4XTYA 3OYKA 1YI2T 4M7DF 3CMEA 3MHXA 4A4HA 4ZN3A 2K5FA 2DIGA 3O8VA 4C92A 4ELZC 4C8QD 3OW2S 1QDNA 3RMQA 3AHUA 3ZJTA 5KH6A 5GAN7 1I4K1 1G3WA 2MMPA 4FIBA 3L2QA 5GMKi 4M7DE 3MEUA 2PJHB 4BDYA 1VQ7T 1WPYA 2LQKA 3OYIA 2B8AA 4IUQA 2JOYA 2XICA 4C92F 1VQ6A 3UT1A 4KULA 5CCAA 1LOJA 1N8RU 2RO0A 3VYGA 3CCJA 3PIOA 2Q18X 5A0DA 3QG1A 5I21A 4JLIA 3FEOA 2FL7A 4LDVA 3F70A 5LJ5g 1QP3A 3G7ZA 4IUTA 3RIRA 3G4SA 2NLUA 1YIJT 4HA8A 3ZJVA 1QVPA 1QVGS 3I56A 1UGQB 2GFAA 2RH2A 3QPHA 4EMHA 5GAMe 1Y07A 4BI8B 2C06A 2D6FA 4C8QG 3QO3A 3CD6A 3MB5A 1FXXA 3OYLA 1U1SA 4XU2A 1S72T 4XQ3A 2L3RA 2P0KA 2K5LA 2V8IA 5C1BA 3WVEB 1KQ2A 5IN1A 3VUZA 3VUBA 2VV5A 5DM7R 5FU7C 5DLOA 4ATOA 3QC8A 1M4ZA 2IG0A 5LJ5j 1KC8U 1X75C 4A54A 4J6XA 2ZPEB 2A7YA 5CKDA 4KT0E 4Y91A 5C0MA 3CD6T 2ZZDA 1YJWA 2DXTA 2VXFA 1YJNA 1Q81C 3I55T 1BI0A 4YTLA 3T9NA 5L8RE 4HCZA 3CC4A 2DD5A 5GANd 4C8QB 5CAIA 5FTJA 2OAUA 2LX9A 3M9QA 4KODA 1Y96B 3OQ5A 5GAOp 2E65A 3CXCS 1LJOA 5J39A 5LJ3f 2K2VA 4JS4A 3S3OA 4P5NA 2O4XA 4ZTJA 3OYJA 3GLXA 4M78C 4M77F 4E7IA 3TU4K 1JRIA 4C5IA 3ZEHA 1TH7A 4PKCC 4PNOA 4E7LA 3A8LB 5GANh 2QEXA 3PT9A 1ZBXA 4GLKA 2VYTA 4NS5A 4AQ7A 3CPWS 4C0DC 5D6YA 3E9GA 2GQVA 1K8AC 3PMIA 1KQSA 2RHYA 3OSSC 4RCCA 1YJ9T 2Y4YA 3L42A 3ME9A 3FLGA 2X4WA 4A4FA 4ELYC 3OYDA 3A8GB 3CBPA 2EJFA 4C0ZA 2EFIA 2XI9A 3TCJA 3RKYA 2CYZB 3J80E 5GAOl 3OSVA 4FT2A 2DKGA 4XU0A 5D6WA 4C92B 4JLGA 4ZGEB 3DLLA 3RESA 4BY6B 5GANj 1U8RA 1KG1A 2O01E 3QJYA 4FSXA 2L89A 3URGA 5GAN3 3HRSA 2RHZA 1VIEA 3CMET 4BDZA 5GAMj 1VQ4A 2RJCA 2VXEA 2R58A 5HK0A 1VQNA 2DPPB 3GF5A 2YLBA 5J26A 3QQ7A 2RHIA 2VGNA 3OYCA 5FTLA 4EPCA 4LD6A 5GAN5 3MEAA 3MEWA 2EQUA 4HT8A 2QI2A 3CC7T 2JVVA 1KD1C 3SFMA 2GFUA 2CZ1B 4RG2A 3GNGA 5FRMA 3OYMA 3L2RA 1W2BS 4M75E 3JCMd 3CEYA 3BDUA 3VV0A 1E32A 3OMGA 1WQWA 5M9OA 4PJOC 5GAMh 4IUPA 3CCEA 2I2LA 4IURA 4N4GA 4C0GA 4CI0C 3CCLA 4HCCA 4M78D 1VQNT 3HSBA 3QYHB 4RV0A 2HAXA 4MZMA 1W4SA 4RKUE 3M53A 3P8DA 4QVCA 5LJ3h 2DJZA 1Q82U 4M77B 4F7UG 4DQ2A 4Z02A 2P4TA 2DVEA 3NTHA 4C0FA 2QA4A 2E70A 4D6WA 4MDWA 3JCMc 3E19A 3VU3C 4DOVA 2JV2A 2MAMA 3C95A 2RB6A 2RD1A 2XU8A 3CPFA 4L5GA 3MP6A 3LGLA 3M59A 2PQWA 1KQSS 3OYFA 1JBMA 3HKSA 1CZ5A 3J81E 5FU7B 1SSFA 4XAXB 3P8HA 3V8KA 2CKKA 4M7AF 1V29B 2DO3A 2IVWA 4M78G 1YJWT 3ZGZA 3JB9D 4KUDK 1IREB 2QA4T 3SDZA 5CVIA 3QIIA 1VQ5T 4M7AA 2KMTA 1LNXA 4BUGA 3KBGA 2EJGA 4C92D 4EMGA 2G3RA 4F7UF 4MMKA 5FRNA 2K4YA 4JRKA 5GAN8 5LJ3d 4RG8A 3G6ET 1VQLT 4KO8A 2YRVA 2MWPA 5KE3A 3TIWA 4RMOA 3OYNA 3JRZA 1VQ4T 3HU3A 4BI3A 4FM4B 5FTMA 2EAYA 5I2MA 4J6WA 3G71T 1QVGA 1VUBA 4OVAA 4CRIA 3LGFA 5DY9A 3OW2A 3JCMV 3GIBA 3PIPA 5AYFA 5GAMg 1U1TA 3LX7A 1O54A 3EFSA 2JTMA 4E7JA 3X25B 4PJOG 4EDUA 3L2UA 3ASKA 4XTUA 4PJOA 5IT9E 1WGSA 4O6JA 2KSSA 3OS2A 2DZ9A 2WSEE 4BI4A 3JCMP 4HCBA 1K9MC 4IUVA 5GAN6 2HQEA 3A8MB 1UGPB 2LCCA 3DB4A 1ZHIA 3QKJA 5GAMf 3FC3A 5J3BA 4V2SA 2MM2A 1KHCA 2RI2A 2RJFA 3NFCA 3ZFJA 1VQMT 1VQ6T 2RHXA 4R56A 3S3NA 5GAN4 4CQNA 2DIQA 2EIFA 1WLFA 1NE8A 1X01A 1YCYA 4M7AB 1HK9A 3UWNA 2RK2A 4M7AG 2RJEA 1MGQA 3MCAB 4JDSA 3G4ST 4MDXA 2E6NA 3BFMA 3JCMe 4X34A 4PJOF 1CZ4A 3CCSA 1YHQT 1RI0A 2PWYA 2KK4A 3QWZA 1D3BB 2DXUA 1FWZA 2OTJA 1KQ1A 5GMKe 3CC7A 1UB4A 3L2VA 3CCMA 3HHTB 4JUVA 4BD3A 2PUOB 1YITT 1HXDA 2HQXA 3FB9A 2L5QA 5FU6B 2RHUA 3S6WA 1BI3A 1M1KC 2KY9A 2CZ7B 4JRQA 4KDIA 4OB0B 4A4KA 3QZ5B 4BB7A 4PJOB 4OB1B 2OTLA 4PLIA 2X4JA 2XKOC 5ERGB 4NL3A 4XTZA 2BIVA 4M7AD 2RI3A 4A4GA 1YHQA 3GP8A 3M56A 5GAMd 3CC2T 4OP0A 3QHSA 2ZPGB 2XG8D 3SB2A 3OYYA 3OYGA 2QQRA 3RUXA 3CCMT 2DXCA 4RCBA 2XHCA 3V7RA 3J7AF 4UC4A 2DTHA 3FPRA 2VGMA 5FTKA 4EMKC 5FLXE 4OGEA 4BE0A 3RERA 4LDYA 4EMKB 2LNVA 2JUFA 3FRNA 3C12A 5GAOr 1Y96A 1QCSA 1I5LA 2QQBA 4M75D 3ZJUA 2YLCA 4OB3B 3RKXA 5GAN2 2R5AA 4M77E 3CCUT 1N9SA 5CKEA 1Y7XA 4EMKA 4ARIA 2EQKA 3QJ6A 2QTXA 3PGGA 1BI2A 2Q1DX 2RJDA 3L1AA 2F5TX 5EQJB 3CBMA 4M77C 2O4XB 2CGHA 4F7UE 2K3XA 3MO8A 5LJ5e 2XDPA 5GANe 3ER0A 3FPUA 2Q19X 2PU9B 3CF2A 2E5QA 3FJPA 5FTNA 1NJIU 4FU6A 4M77G 3VJPA 1G3SA 4M77A 4N4IA 3OS1A 4FT4A 4Y28E 2K5IA 3E9FA 4N0AC 5HKCA 3JCMX 5GANg 3MP1A 5GMKh 4J83A 4C8QA 1M9SA 4KBMB 5CKHA 2QDYB 3PMTA 1YIJA 1Q7YU 1X6OA 1K73C 1VIFA 1QVFA 5EPPA 3META 2XD0A 3M4YA 1S72A 3OYHA 3JCMg 1G3TA 1M1GA 4J7IA 1JJ2S 2DZCA 1R8OB 3QUIA 2ZPIB 3GNFB 4O5VA 1VQOA 4JJNK 2Q1AX 5DYGA 2LRQA 4ZTFA 3JCMf 2CZ0B 1GXIE 4E47A 5KCOA 1NPRA 2R57A 3CCET 4KLNA 1QP2A 3WVDB 3HFNA 4J7FA 3OS5A 5D6XA 5KE2A 2WSCE 2X35A 4PJOD 2KQWA 2ZGWA 3PFSA 2MF2A 4DA4A 2E10A 4F7UB 1BIBA 2VC8A 4M7DG 2HBPA 4MZPA 3HRTA 2E1HA 3VYHB 3ZBDA 2K57A 3CC4T 2LTOA 4MZTA 4BE1A 3CMAT 3I55A 3H8ZA 3OMCA 4QVZA 3JCMb 5CCBA 3QQ8A 3X28B 1I81A 4M7DC 1G3YA 4LD9K 2LT1A 4JRPA 4B9XA 1YITA 4KUIA 2M9UA 1K9MU 3HU2A 5HK3A 3JAME 4OF1A 5I2SA 4XTWA 1D3BA 2XDDA 2QQ9A 2RK1A 1UGSB 3HP9A 4C5GA 3OYAA 1KC8C 2EYQA 3X24B 2B25A 3MP8A 3JB9H 1XQHA 2KVQG 2QQAA 2RI5A 3QYGB 4HKEA 3V7CA 2FVUA 4C0DB 3LLRA 2EWNA 2D9TA 2ZPFB 4M7DD 4QQDA 5LJ3g 4N0AA 5FROA 1YBYA 4B9WA 5GMKm 2LT4A 1AHJB 3LW5E 4E7KA 4ZGJB 1ZQ1A 3WXMB 1YJ9A 3FPTA 1O9SA 5A2QE 4PLLA 4C8QC 3JB9J 4WF2A 2WACA 1WJSA 4Q5WA 3G6EA 4C5EA 5CIUA 3OYEA 1VQLA 5LJ3j 5B6CA 2FHDA 2EQMA 2DXBA 1Y71A 3SD4A 4PJOE 2YUJA 2PUKB 1B34A 2PVDB 2VUBA 1M1KU 4E7HA 3CCVT 3CCJT 2X4YA 1IZ6A 3CCQT 4X9DA 1P92A 5DLQE 3V8LA 4XTVA 4DOWA 5A0LA 2MM0A 3GPLA 2M16A 3A8OB 2RA2A 1UEBA 3S3MA 2PVGB 5GANf 4LDXA 3EFRA 1NJIC 4MMLA 4AS1A 3HRUA 3JCMQ 2XK0A 2P0QA 4JRIA 5C18A 2FYKA 2DD4A 2BKDN 2XIDA 3JCMh 1VQKT 3BQBA 4KDLA 4OB2B 5EG2A 4M7AE 1M90C 1FX7A 4NOYA 4BACA 3CCRA 1QW1A 3BDLA 3OBWA 2LVMA 4M75G 5CO7A 3H6ZA 1VQMA 3C4SA 1WJQA 4N4HA 4C92C 3CPWA 3CCQA 1VQ9T 4IKFA 3UPUA 4HT9A 3LWIA 5CCXA 3JB9I 4FL6A 4ZGDB 3M58A 1PSFA 3KXTA 3CCLT 2LC4A 3FIFA 4M78F 3RKWA 2DEQA 1N27A 4XU3A 4NL2A 4M75B 3OA6A 1W2BA 4PL6A 1Q81U 1YJNT 1UGRB 2DAQA 3TREA 1H641 1VQKA 2K3YA 3E1SA 2A3LA 1I8FA 1VQPA 1I9GA 2AHJB 4A53A 4M78A 3A5ZB 3DB3A 4IUUA 2BUDA 4QQGA 4QW2A 3V7SA 5C6SA 3CCRT 2YHTA 3HU1A 2FB7A 2L8DA 2LDMA 4C5HA 1VQOT 3QSUA 4XTXA 3X26B 1BIAA 2MWOA 1N6AA 3JCMW 1G5VA 2GCXA 3CBOA 2X4XA 5CD1A 3PTAA 4M75F 5GLFA 3VKIA 1WNLA 4VUBA 3SWNC 3OS0A 3NTIA 2GF7A 1N9RA 3BW1A 1RL2A 3SWNB 2Y4XA 5GMKl 1XOVA 2HD0A 4C92E 2WSFE 5GAOq 2LW6A 3M55A 3CC2A 3N5BB 1EIFA 5CKFA 3M54A 1MHNA 3SWNA 3NTKA 4ARCA 4QQ6A 4F7UA 2R5MA 3X20B 1Q82C 3R6OA 3KUFA 4X9CA 2H3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L2V A;  3OYN A;  2LRQ A;  5IN1 A;  4ZTF A;  5KCO A;  2R57 A;  1XNI A;  4OVA A;  4CRI A;  3LGF A;  5D6X A;  5KE2 A;  3QBY A;  2X35 A;  2IG0 A;  3LX7 A;  3PFS A;  4E7J A;  4EDU A;  3L2U A;  3ASK A;  1OZ3 A;  5C0M A;  2LTO A;  1WGS A;  1OYX A;  1WJR A;  3OS2 A;  4BE1 A;  4HCZ A;  3H8Z A;  3OMC A;  4QVZ A;  3LYI A;  4IUV A;  3M9Q A;  2HQE A;  3OQ5 A;  4B9X A;  2JTF A;  2LCC A;  5J39 A;  3S3O A;  3DB4 A;  3QKJ A;  2O4X A;  2EKO A;  2F5K A;  5KCH A;  3FC3 A;  4ZTJ A;  1KHC A;  2RI2 A;  3OYJ A;  2RJF A;  2JZ2 A;  4E7I A;  2RHX A;  3PNW C;  4L59 A;  4BE2 A;  3S3N A;  3OB9 A;  2DIQ A;  4C5G A;  4C5I A;  3ZEH A;  3OYA A;  3MP8 A;  4E7L A;  3UWN A;  3GOX A;  2RI5 A;  1OZ2 A;  2RJE A;  2E6N A;  3DLM A;  3LLR A;  4NS5 A;  2D9T A;  2VYT A;  4X34 A;  4QQD A;  5D6Y A;  1RI0 A;  3E9G A;  5FRO A;  4B9W A;  3PMI A;  4E7K A;  2RHY A;  3L42 A;  4PLL A;  3ME9 A;  3L2W A;  3FLG A;  2X4W A;  2M1H A;  4A4F A;  3OYD A;  2WAC A;  1WJS A;  4Q5W A;  4BD3 A;  4C5E A;  5CIU A;  3OYE A;  1OI1 A;  3OYB A;  2HQX A;  2EFI A;  3FDR A;  2FHD A;  2RHU A;  2EQM A;  3S6W A;  3SD4 A;  3Q1J A;  5D6W A;  4II1 A;  2QQS A;  4E7H A;  2X4Y A;  2L89 A;  3MEV A;  3LH0 A;  4PLI A;  2RHZ A;  2BIV A;  2EQJ A;  4BDZ A;  2RI3 A;  4A4G A;  1H3Z A;  2RJC A;  2M16 A;  2R58 A;  3S3M A;  5KE3 A;  5J26 A;  2RHI A;  3OYC A;  2XK0 A;  3OYG A;  2QQR A;  4LD6 A;  3MEA A;  3MEW A;  3OY9 A;  2BKD N;  2EQU A;  4UC4 A;  2M0O A;  4GY5 A;  2GFU A;  4BAC A;  4RG2 A;  4BE0 A;  3EAE A;  4A4E A;  5FRM A;  3BDL A;  3OYM A;  3L2R A;  2LVM A;  3CEY A;  3H6Z A;  3C4S A;  1WJQ A;  3OMG A;  4N4H A;  4IKF A;  5IAY A;  5M9O A;  4IUP A;  4FL6 A;  4N4G A;  4IUR A;  2R5A A;  1N27 A;  3OYK A;  3OA6 A;  2EQK A;  3QJ6 A;  4PL6 A;  4A4H A;  3P8D A;  2DIG A;  2RJD A;  3O8V A;  2DAQ A;  2K3Y A;  4Z02 A;  3NTH A;  5KH6 A;  2O4X B;  3DB3 A;  4IUU A;  3L2Q A;  2BUD A;  2K3X A;  3MO8 A;  3MEU A;  4QQG A;  2XDP A;  4QW2 A;  5C6S A;  4BDY A;  3OYI A;  2LDM A;  2L8D A;  2B8A A;  4C5H A;  2E5Q A;  3MP6 A;  4FU6 A;  2MWO A;  4IUQ A;  3LGL A;  1G5V A;  2PQW A;  2X4X A;  3OYF A;  3UT1 A;  4N4I A;  3OS1 A;  2RO0 A;  1SSF A;  3OS0 A;  3E9F A;  3NTI A;  2GF7 A;  3MP1 A;  3P8H A;  2CKK A;  3FEO A;  3F70 A;  4IUT A;  2NLU A;  3PMT A;  2GFA A;  3QII A;  1MHN A;  3MET A;  3OYL A;  2G3R A;  5FRN A;  3NTK A;  3OYH A;  4QQ6 A;  2L3R A;  2P0K A;  2R5M A;  2YRV A;  2MWP A;  3KUF A; 
#chains in the Genus database with same CATH topology
 1E7O A;  1ZA2 B;  1XNI A;  2KEA A;  2YUN A;  1H8K A;  1U3O A;  1WHH A;  5CR2 A;  5DYI A;  3EG9 A;  5A0G A;  4C8Q E;  4M7D B;  2F69 A;  2W10 A;  2YRC A;  4M78 E;  5GAO n;  4L59 A;  3C94 A;  3I55 Q;  2V8J A;  4CC3 A;  4OGC A;  3UDC A;  2YUQ A;  2E6Z A;  4ZN1 A;  3JSC A;  3CCS T;  2DL8 A;  2Y90 A;  1JJ2 P;  3V8J A;  1HD3 A;  2V8K A;  1OI1 A;  4DEY A;  2AKK A;  2E64 A;  4II1 A;  1S3S A;  1VQ4 Q;  2KAF A;  3M57 A;  3LH0 A;  1N8R R;  2EPD A;  2DIL A;  1K8A U;  1VQ8 T;  5LJ5 f;  2GTJ A;  1D0Y A;  2D0Q B;  2DTO A;  1QVF P;  2ZCF B;  1MMD A;  2JN0 A;  3QDR B;  1Y57 A;  4ORZ A;  3JCM J;  3JB9 G;  2LP5 A;  5GMK j;  7AT1 B;  5CQY A;  3M0R A;  4A4E A;  1VQ7 A;  2LCL A;  4K11 A;  4L6V 5;  5IAY A;  2EJ9 A;  1ARK A;  4PJJ A;  1E6H A;  4XTY A;  4J9B A;  5KYY B;  1YI2 T;  4A4H A;  1K0X A;  3OW2 S;  3AHU A;  3L2Q A;  1LPL A;  3MEU A;  4IUQ A;  2JOY A;  1RUW A;  3CCJ A;  2CP2 A;  1X43 A;  4RTV A;  2W0Z A;  3FEO A;  3F70 A;  4IUT A;  1QVP A;  1UGQ B;  2RH2 A;  4BI8 B;  3EGX B;  2H8H A;  2I0N A;  3CCM Q;  5C1B A;  1J3T A;  1SG5 A;  3CCV Q;  5IN1 A;  3VUZ A;  1KC8 R;  5DM7 R;  2JTE A;  4ATO A;  1M4Z A;  4A54 A;  4J6X A;  4HVW A;  1YJW A;  2VXF A;  2DD5 A;  5FTJ A;  4C8Q B;  3O5Z A;  2LX9 A;  5ECA A;  4ZTJ A;  1X69 A;  4C5I A;  1R0C B;  4FCY A;  1VQM Q;  1M2V B;  2VYT A;  4C0D C;  3E9G A;  2GQV A;  1K8A C;  3PMI A;  1KQS A;  4RCC A;  1YJ9 T;  3L42 A;  2EJF A;  1WXT A;  3TCJ A;  2CYZ B;  3G71 Q;  2CP5 A;  3M0P A;  1U8R A;  3QJY A;  5GAN 3;  3HRS A;  4BDZ A;  1VQ4 A;  2VXE A;  1KQS P;  3GF5 A;  2YLB A;  4EPC A;  2PNI A;  5IXB A;  3MEA A;  2F2X A;  3MEW A;  4HT8 A;  3CC7 T;  1KD1 C;  1WDX A;  2JS0 A;  2GFU A;  3GNG A;  3OYM A;  1W2B S;  3JCM d;  3CC2 Q;  1E32 A;  3BDU A;  4PJO C;  5GAM h;  2LJ0 A;  3CCE A;  3CCL A;  3THK A;  3QYH B;  4OMQ A;  1W4S A;  5LJ3 h;  1Q82 U;  4F7U G;  4E6R A;  2QA4 A;  3EHQ A;  3E19 A;  4AT1 B;  2JV2 A;  2RPN A;  2RD1 A;  2XU8 A;  3TQ7 P;  3M59 A;  1KQS S;  4XAX B;  3P8H A;  1V29 B;  2E4H A;  4KUD K;  2O88 A;  5CVI A;  4BUG A;  2ROL A;  5GAN 8;  1AVZ C;  3G6E T;  4KO8 A;  2ED1 A;  5KE3 A;  8ATC B;  2ABL A;  3TIW A;  4F17 A;  4BI3 A;  1K0S A;  5I2M A;  2FG0 A;  1QVG A;  1ZSZ A;  3EFO A;  2H3E B;  3LGF A;  3GIB A;  2D1X A;  1YWO A;  2DZ9 A;  2WSE E;  4IUV A;  5GAN 6;  4OML A;  3QKJ A;  2MM2 A;  3FC3 A;  1KHC A;  2RJF A;  2A36 A;  1VQM T;  1UTI A;  1VQ6 T;  2RHX A;  4A63 B;  3CC4 Q;  2YRD A;  1RAH B;  4M7A B;  3UWN A;  2RK2 A;  1MGQ A;  1CZ4 A;  2PWY A;  1RI0 A;  1GFC A;  1B3Q A;  1YNZ A;  1FWZ A;  2DXU A;  2DFU A;  2JT4 A;  2F2V A;  1UB4 A;  2HBW A;  2PUO B;  2HQX A;  5FU6 B;  2ENM A;  2L5Q A;  1M1K C;  1YFN A;  4JRQ A;  4OB0 B;  4BB7 A;  2OTL A;  2X4J A;  2XKO C;  4RTY A;  3RR6 A;  2EYZ A;  4XTZ A;  4M7A D;  4A4G A;  3EFO B;  4OP0 A;  3QHS A;  2ZPG B;  3SB2 A;  1MV0 B;  3RUX A;  2VKN A;  4UC4 A;  4ESR A;  1TS9 A;  1G8X A;  2VGM A;  3RER A;  2JUF A;  3FRN A;  2DL7 A;  1G2B A;  1QCS A;  4IIO A;  1I5L A;  2YLC A;  3H0H A;  2R5A A;  5GAN 2;  5CKE A;  2RQR A;  2RJD A;  3CBM A;  4M77 C;  1RI9 A;  2O4X B;  2CGH A;  2K3X A;  2XDP A;  1D1C A;  1JU5 C;  1YJN Q;  2Q19 X;  4AG2 C;  3OS1 A;  4Y28 E;  2CUD A;  3ZL7 C;  5HKC A;  3EGX A;  4J83 A;  2EGC A;  2E3H A;  1M9S A;  1ABQ A;  1QVG P;  1R0B G;  3M4Y A;  3OYH A;  3JCM g;  1G3T A;  1JJ2 S;  4O5V A;  3GNF B;  1VQO A;  1BU1 A;  4ZTF A;  4E47 A;  1TUD A;  4KLN A;  3WVD B;  5KE2 A;  1Q81 R;  1WHL A;  2O9S A;  2VC8 A;  1JXM A;  1S1N A;  3HRT A;  3H8Z A;  3CQT A;  1VQ6 Q;  3X28 B;  1I81 A;  4M7D C;  4WTO B;  4B9X A;  1YIT A;  2M9U A;  4B6M A;  1VQO Q;  3HU2 A;  4F16 A;  2YXY A;  3G4S Q;  1NLO C;  1SRM A;  5EC7 A;  1D3B A;  2QQ9 A;  2KR3 A;  3I56 Q;  1TU0 B;  1M2O A;  3QYG B;  2RI5 A;  3CCU Q;  3LLR A;  5LJ3 g;  2QGG A;  2JXB A;  4B9W A;  2AKL A;  2LT4 A;  1AHJ B;  3FPT A;  1M27 C;  5A2Q E;  1GBR A;  1D1A A;  4HCK A;  3OYE A;  2NUP A;  2DXB A;  2KXC A;  1B34 A;  2F1L A;  4RUG A;  1M1K U;  2X4Y A;  1P92 A;  2M16 A;  2RA2 A;  5GAN f;  1TXQ A;  3HRU A;  1VQL Q;  5C18 A;  2OTL Q;  1PCX A;  4PFO A;  2ZAE A;  1NEB A;  1FX7 A;  4BAC A;  4EIK A;  1QW1 A;  2YT6 A;  1VQM A;  5CO7 A;  2D8J A;  4N4H A;  4JJC A;  3JB9 I;  4ZGD B;  3FIF A;  1W2B A;  1IO6 A;  2EGE A;  1CSK A;  2L3P A;  1YJN T;  1WA7 A;  3E1S A;  1I8F A;  1V76 A;  2AHJ B;  2BZY A;  2KBT A;  2LJ3 A;  3ULR B;  3MJX A;  2COW A;  4QQG A;  3V7S A;  5C6S A;  2FB7 A;  2LDM A;  2OJ2 A;  1BIA A;  3NGP A;  4M75 F;  1WNL A;  2GF7 A;  1N9R A;  1RL2 A;  1AD5 A;  1XOV A;  2HD0 A;  2L0A A;  2LW6 A;  3CC2 A;  3N5B B;  1T3L A;  2OI3 A;  4KGV B;  6AT1 B;  3CXC P;  1GRI A;  4QQ6 A;  4F7U A;  1Q82 C;  3R6O A;  3KUF A;  2E1H A;  1Q81 C;  3BY7 A;  2COZ A;  4R55 A;  1M5Q 1;  3NMZ C;  1VA7 A;  1X27 A;  3QBY A;  3MKD A;  1D1B A;  1H92 A;  1OZ3 A;  1ZSZ B;  3CXC A;  2DK3 A;  1K9M R;  1Q86 R;  3LYI A;  4E7S A;  2JTF A;  2F5K A;  2ZPB B;  4M75 A;  1WQ7 A;  2JZ2 A;  1PG5 B;  5CQX A;  4XK8 E;  5CK9 A;  1IHW A;  4LDW A;  5KYY A;  3M5A A;  3H0I A;  1OZ2 A;  3DLM A;  1ZC1 A;  1KD1 U;  2KRS A;  3L2W A;  2E12 A;  1OU8 A;  1QKW A;  3OYB A;  1I5O B;  2HNI A;  2K7A A;  1VQ9 A;  1Q7Y C;  2AK5 A;  1BCM A;  1BKB A;  3MEV A;  1B07 A;  2DE0 X;  2MIO A;  2COY A;  4FYX B;  1GFD A;  1VQP T;  1B34 B;  1VQ5 A;  4C8Q F;  1UEC A;  3QXE B;  1VYT A;  3IQL A;  1WHJ A;  1TSF A;  3EAE A;  1ABO A;  4C92 G;  3M4G A;  4FW2 A;  1JJ2 A;  1JXO A;  4J9E A;  4M75 C;  2E41 A;  4M7D F;  1M90 R;  1IGU A;  3O8V A;  4ELZ C;  1ZUY A;  5KH6 A;  2HKQ B;  5GAN 7;  1I4K 1;  1WIE A;  1MUZ A;  1NLP C;  4BDY A;  2PJH B;  2LNH B;  2LQK A;  1UFF A;  2XIC A;  5KYU A;  4KH0 B;  4KUL A;  3VYG A;  3PIO A;  3CCE T;  4LDV A;  3G4S A;  3I5S A;  1YIJ T;  1F1B B;  2GFA A;  5GAM e;  2D6F A;  3QPH A;  4EMH A;  1OX9 A;  5FWB A;  1RAD B;  3MB5 A;  2RQW A;  1U1S A;  1MNE A;  2J05 A;  1S72 T;  4XQ3 A;  2LX7 A;  2K5L A;  4R0K A;  3REB B;  1SPK A;  5D7U A;  5KYW B;  2VV5 A;  5DLO A;  3QC8 A;  2IG0 A;  5LJ5 j;  2XMF A;  5CKD A;  4KT0 E;  4Y91 A;  9ATC B;  3CD6 T;  5IXF A;  1YJN A;  1U5S A;  3T9N A;  5L8R E;  2KT1 A;  1WZO A;  2HCK A;  4KOD A;  3OQ5 A;  2E3I A;  4JS4 A;  5J39 A;  1YCS B;  2O4X A;  4Z8A A;  1QWF A;  1VQ9 Q;  2KI7 A;  4OMM A;  1JRI A;  3ZEH A;  4PKC C;  3M0Q A;  3PT9 A;  1MND A;  3REA B;  4GLK A;  1ACM B;  1K4U S;  2Y4Y A;  3ME9 A;  2VVK A;  2X4W A;  4A4F A;  3OYD A;  1LCK A;  3A8G B;  3CBP A;  1YP5 A;  2A0F B;  2FPF A;  4FT2 A;  1JO8 A;  2DKG A;  4XU0 A;  5D6W A;  4JLG A;  2J7I A;  4ZGE B;  2VB6 A;  3RES A;  2HL3 A;  1GBQ A;  2O01 E;  4FSX A;  2RHZ A;  3CME T;  1QCF A;  2RJC A;  2EYX A;  1RAC B;  2DPP B;  1VQN A;  3QQ7 A;  2RHI A;  2VGN A;  1I0C A;  4LD6 A;  3D7S B;  1YI2 Q;  3SFM A;  2CZ1 B;  4RG2 A;  1G83 A;  1N5Z A;  3VV0 A;  3R6N A;  1SSH A;  2DRK A;  2DEU A;  4IUR A;  3HSB A;  1VQN T;  4M78 D;  3KFV A;  4MZM A;  2BE7 D;  4RKU E;  2YDL A;  3H0F A;  4M77 B;  1TTH B;  2P4T A;  3NTH A;  3A1P A;  4OMP A;  1WHG A;  2C0T A;  3JCM c;  4DOV A;  1JQQ A;  2MAM A;  3MP6 A;  2PQW A;  3OYF A;  3HKS A;  1CZ5 A;  2QK0 A;  5FU7 B;  3V8K A;  1WFW A;  2CKK A;  4M7A F;  1KJW A;  2DO3 A;  1M1K R;  1YJW T;  2D8H A;  3ZGZ A;  1C0M A;  1VQ5 T;  2KMT A;  4EMG A;  4MMK A;  4JRK A;  1VQL T;  1NYG A;  4FYY B;  2YRV A;  1M2V A;  3JRZ A;  3EG9 B;  3HU3 A;  4J6W A;  3CD6 Q;  4OVA A;  3SHW A;  3JCM V;  4FYV B;  1U1T A;  3L2U A;  1OPL A;  3EGU A;  1AWX A;  4XTU A;  5IT9 E;  1WGS A;  2V1Q A;  4BI4 A;  2LZ6 B;  1M3A A;  1RLP C;  4GBQ A;  3DB4 A;  4QT7 A;  5FW9 A;  5J3B A;  3NFC A;  3ZFJ A;  4R56 A;  5GAN 4;  4Z89 A;  1RAG B;  1X01 A;  2CH4 A;  4JDS A;  2E6N A;  3I9Q A;  4PJO F;  1YN8 A;  1WX6 A;  2KRO A;  1RLQ C;  3QWZ A;  1D3B B;  2HSE B;  3CC7 A;  3L2V A;  4BD3 A;  1M3C A;  4QKU A;  2DET A;  2KY9 A;  1TOV A;  4E2F B;  2RQU A;  5ERG B;  1ZUK A;  4NL3 A;  2AIR B;  2BIV A;  1YHQ A;  5GAM d;  3OYG A;  2DTH A;  1W2B P;  5FLX E;  4OGE A;  2SRC A;  2YUO A;  4AFS C;  2LNV A;  1Y96 A;  3UF4 A;  3ZJU A;  2DL5 A;  3RKX A;  1Y7X A;  4PFP A;  1BI2 A;  5I22 A;  1PKT A;  4Z88 A;  3L1A A;  2F5T X;  4ZNX A;  3CCS Q;  4F7U E;  4M4Z A;  4FSS A;  5GAN e;  3FPU A;  2PU9 B;  1UUE A;  2E5Q A;  5FTN A;  2EGA A;  2VWF A;  4M77 A;  4FT4 A;  1HSQ A;  2K5I A;  1W6X A;  2BZ8 A;  4KBM B;  1X6O A;  1VIF A;  5EPP A;  2XD0 A;  4LUD A;  3VS4 A;  4J7I A;  2J6O A;  5DYG A;  2Q1A X;  2CZ0 B;  2M02 A;  1GXI E;  5KCO A;  4J7F A;  4PJO D;  2WSC E;  4ANJ A;  4F7U B;  2HBP A;  2GTO A;  2K57 A;  3CC4 T;  4BE1 A;  4QVZ A;  5CCB A;  3QQ8 A;  1VYV A;  2K2M A;  1QCO A;  2O31 A;  5HK3 A;  1EZZ B;  3HP9 A;  1KC8 C;  2EYQ A;  3X24 B;  3MP8 A;  3JB9 H;  2CP6 A;  4HVV A;  2FVU A;  4N0A A;  5FRO A;  4E7K A;  2LCS A;  4HVU A;  1O9S A;  4PLL A;  4C8Q C;  4WF2 A;  2WAC A;  4Q5W A;  1VQL A;  2MOX A;  2FRY A;  4C5E A;  5KYX A;  4DBF A;  5LJ3 j;  2PUK B;  4J9G A;  2PVD B;  2KE9 A;  3CCV T;  1XJW B;  4X9D A;  3V8L A;  4XTV A;  3S3M A;  2MPX C;  1PHT A;  3EFR A;  3JCM Q;  2XK0 A;  2IPO B;  2P0Q A;  4JRI A;  4F04 B;  1AWW A;  2BKD N;  2DYB A;  3JCM h;  3BQB A;  4KDL A;  4OB2 B;  4M7A E;  4NOY A;  2F2W A;  3H6Z A;  4PJL A;  3C4S A;  3CCQ A;  1VQ9 T;  3CPW A;  2DMO A;  3RKW A;  4M78 F;  1WHK A;  4NL2 A;  4M75 B;  3OA6 A;  2DAQ A;  1WXB A;  2K3Y A;  2A3L A;  4A53 A;  2A08 A;  4IUU A;  4QW2 A;  4CC7 A;  2FZK B;  1OU9 A;  4C5H A;  3QSU A;  3X26 B;  1FYN A;  1N6A A;  3CBO A;  2DYI A;  5HCK A;  5GLF A;  4VUB A;  4C92 E;  2WSF E;  3UA6 A;  1FMW A;  2EW3 A;  3SWN A;  4ARC A;  4X9C A;  1BI1 A;  5CKB A;  1KHI A;  3HFO A;  1JB0 E;  1OYX A;  1O75 A;  4CC2 A;  2KDS A;  4M77 D;  5LJ5 d;  4QVD A;  2ZPH B;  1VQK Q;  4J5Y A;  1Q86 U;  2YVL A;  5KCH A;  1T3S A;  2EKO A;  2DX1 A;  2MCN A;  4BE2 A;  3GOX A;  2HQH A;  5LJ5 h;  5GAO m;  2NUT B;  5LL6 S;  2JM9 A;  4OMF B;  1NZ9 A;  2M1H A;  2Q1C X;  1SF9 A;  3FDR A;  2JNG A;  5IHN A;  4FYW B;  4JS5 A;  1M90 U;  2L3S A;  3HPW A;  2QQS A;  3TVT A;  3LWH A;  5LJ3 e;  2RF0 A;  1R7R A;  4M7A C;  2EQJ A;  2P0P A;  1H3Z A;  3INZ A;  4JZ3 A;  2PVO B;  3EGD A;  1YI2 A;  4KRT A;  2FO0 A;  1MV3 A;  3CMA A;  4J8O A;  2CDT A;  3P8B B;  1PWT A;  1WHM A;  4WCI A;  2M0O A;  1AEY A;  3HL8 A;  4XU1 A;  5KYN A;  4J6Y A;  4M7D A;  2MI6 A;  4J9H A;  4D8D A;  2ECZ A;  2XDB A;  4LDU A;  1WI7 A;  1VQ8 A;  2G6F X;  3CME A;  2K5F A;  3CPW P;  1QDN A;  4C8Q D;  1YJ9 Q;  3RMQ A;  2MMP A;  4M7D E;  1VQ7 T;  2JW4 A;  2B8A A;  1M8M A;  4JPB W;  1VQ6 A;  5CCA A;  1LOJ A;  1Y0M A;  1QQJ A;  2RO0 A;  1PD0 A;  1SRL A;  2P84 A;  3RBB B;  5I21 A;  2FL7 A;  1QP3 A;  3G7Z A;  3PVL A;  1QVG S;  3I56 A;  2C06 A;  4C8Q G;  3QO3 A;  1FXX A;  4XU2 A;  2RMO A;  2V8I A;  4PJN A;  2DLP A;  2GGR A;  1KQ2 A;  3EGD B;  3VUB A;  2ATC B;  5FU7 C;  1K76 A;  2SEM A;  2DBK A;  2LMJ A;  1X75 C;  2QEX Q;  5C0M A;  1N8R U;  2DXT A;  3I55 T;  2GQI A;  3M9Q A;  2CSI A;  3S3O A;  3CXC S;  2K3B A;  4P5N A;  1GCP A;  2KXD A;  4M78 C;  4E7I A;  3EG1 A;  3TU4 K;  4AG1 C;  3CCL Q;  1TUC A;  1TH7 A;  1W1F A;  2P4R A;  3A8L B;  5GAN h;  2QEX A;  3EH2 A;  1ZBX A;  3CPW S;  2RHY A;  3FJ5 A;  2DJQ A;  1I1J A;  4ELY C;  1K73 R;  4C0Z A;  2EFI A;  2XI9 A;  2DF6 A;  3RKY A;  5GAO l;  3OSV A;  4C92 B;  3DLL A;  4BY6 B;  1KIK A;  1KG1 A;  2KGT A;  1VQP Q;  2L89 A;  1VIE A;  2K9G A;  4J9I A;  5FTL A;  2AZV A;  2X3X D;  2QI2 A;  2QDL A;  5AT1 B;  2HSP A;  2HMA A;  3L2R A;  4M75 E;  3OMG A;  1Z9Z A;  4AFU C;  1WQW A;  2O9V A;  4N4G A;  4HT9 A;  4HCC A;  4E7Z A;  1RAB B;  3M53 A;  2X51 A;  1AT1 B;  2DJZ A;  1K8A R;  4Z02 A;  2DVE A;  2E70 A;  4D6W A;  4MDW A;  3VU3 C;  3C95 A;  2CP0 A;  3LGL A;  1JBM A;  1PC0 A;  3J81 E;  1SSF A;  2C0I A;  3EH1 A;  2IVW A;  2OTJ Q;  2HL5 C;  1IRE B;  2CP7 A;  2QA4 T;  3SDZ A;  4M7A A;  4C92 D;  4DBQ A;  3LGA A;  1OPK A;  2K4Y A;  5LJ3 d;  2RQT A;  4RMO A;  3OYN A;  2QTV A;  1WXU A;  3G71 T;  4J9C A;  1VUB A;  4CRI A;  5DY9 A;  3OW2 A;  5GAM g;  2FZC B;  3LX7 A;  1O54 A;  3EFS A;  2JTM A;  4E7J A;  3X25 B;  4EDU A;  3ASK A;  1ZSZ C;  4O6J A;  2KSS A;  3OS2 A;  3JCM P;  4RTU A;  5GJV B;  2HQE A;  3A8M B;  2JMC A;  8AT1 B;  1ZHI A;  4V2S A;  1BBZ A;  2RI2 A;  1GCQ C;  3S3N A;  2DIQ A;  2EIF A;  1NE8 A;  1HK9 A;  4M7A G;  3MCA B;  4MDX A;  2NUP B;  3VRZ A;  3BFM A;  1Q82 R;  2K79 A;  1QLY A;  3CCS A;  3M0U A;  1V1C A;  1KQ1 A;  2LJ1 A;  2OTJ A;  5GMK e;  1ZBJ A;  2ROT A;  3HHT B;  1HXD A;  1D0Z A;  3FB9 A;  3S6W A;  2RHU A;  1KK7 A;  1IXD A;  4KGZ B;  2YUP A;  2A37 A;  4KDI A;  4OB1 B;  1PRM C;  4PLI A;  2NUZ A;  3GP8 A;  3M56 A;  3CC2 T;  1UJY A;  3CCQ Q;  2XHC A;  3J7A F;  2BZX A;  2AZS A;  4EMK C;  4LDY A;  4EMK B;  5GAO r;  2DBM A;  1AOJ A;  2FEI A;  2J06 A;  2QQB A;  4M75 D;  4OB3 B;  3CCU T;  4M77 E;  4EMK A;  2M51 A;  1YWP A;  2X3W D;  5EQJ B;  4LNP A;  2NUT A;  4JJB A;  1NJI R;  4RTX A;  5LJ5 e;  3ER0 A;  2PTK A;  4FU6 A;  4M77 G;  1VQ5 Q;  2J6F A;  4N4I A;  3E9F A;  5GAN g;  3MP1 A;  5GMK h;  1IHV A;  4KH1 B;  2QGF B;  2DA9 A;  1YIJ A;  3PMT A;  3NHN A;  1Q7Y U;  1BK2 A;  5KYX B;  1QVF A;  3MET A;  2RNA A;  2DER A;  2GBQ A;  2DZC A;  5FWC A;  3QUI A;  4JJN K;  2LRQ A;  4J9F A;  1NPR A;  2B86 A;  2R57 A;  1QP2 A;  2X35 A;  1K1Z A;  2KQW A;  3PFS A;  2MF2 A;  4DA4 A;  2E10 A;  1AZG B;  1BIB A;  3GBQ A;  4M7D G;  2LTO A;  4MZT A;  3OMC A;  3JCM b;  1IGQ A;  1ZLM A;  4DBH A;  1SHF A;  2JS2 A;  4JRP A;  4KUI A;  3JAM E;  5I2S A;  2KYB A;  4XTW A;  2XDD A;  3VS1 A;  2RK1 A;  2B25 A;  1OOT A;  1NG2 A;  2EQI A;  4HKE A;  2RQV A;  4C0D B;  4M7D D;  3EHR A;  4QQD A;  1H3H A;  1YBY A;  1YJ9 A;  3I5R A;  1VYU A;  4ZGJ B;  3WXM B;  1FMK A;  3JB9 J;  3G6E A;  1LVK A;  5CIU A;  2FPE A;  4PJO E;  1Y71 A;  3BE3 A;  1W70 A;  2VAS A;  2VUB A;  1HJD A;  2DRM A;  2QAZ A;  2MM0 A;  4F14 A;  1UEB A;  2PVG B;  4LDX A;  1NJI C;  4MML A;  3EG0 A;  3C0C A;  1C1A A;  2DD4 A;  2NWM A;  2XID A;  1AWJ A;  2RN8 A;  3CCR A;  3JV3 A;  3BDL A;  1VQ8 Q;  3OBW A;  4M75 G;  4IKF A;  2V1R A;  3UPU A;  5CCX A;  2CRE A;  4FL6 A;  3CCL T;  1PSF A;  2LC4 A;  2DEQ A;  1UJ0 A;  1X6G A;  4PL6 A;  1Q81 U;  1QKX A;  2KT8 A;  1NEG A;  3TRE A;  1H64 1;  2HKN A;  3CMA Q;  4M78 A;  1OQK A;  3DB3 A;  3CCR T;  2YHT A;  1PRL C;  2L8D A;  4XTX A;  2MWO A;  3JCM W;  1G5V A;  2X4X A;  1NM7 A;  3VKI A;  3OS0 A;  3SWN C;  2NYS A;  3NTI A;  4OMN A;  5GMK l;  3SWN B;  1YHQ Q;  2QAS A;  1OEB A;  5GAO q;  4HXJ A;  3NTK A;  2KYM A;  2EBP A;  2R5M A;  1D0X A;  4KGX B;  3VS2 A;  1BYM A;  3G71 A;  1CR5 A;  1DJ7 B;  3CCU A;  2EYW A;  1WLP B;  1K73 U;  3A8H B;  2X9H A;  2V26 A;  3E2U A;  1WJR A;  3VS5 A;  3I56 T;  1PNJ A;  1Q86 C;  4TVR A;  5FU6 C;  2QG9 B;  4M78 B;  1PSE A;  3VS7 A;  2DTI A;  1NYF A;  3PNW C;  3CCV A;  3OB9 A;  1SHG A;  2BE9 B;  1M1F A;  2LQ8 A;  3M0S A;  1CKB A;  1C6V X;  4X1V A;  1YJW Q;  5GJW B;  2OTJ T;  2QA4 Q;  2FRW A;  3JB9 F;  3OBY A;  2DL4 A;  4ME7 A;  3OW2 P;  3Q1J A;  3QZ9 B;  4BY6 C;  2OTL T;  2QEX T;  3U23 A;  2JJ9 A;  1M8V A;  2CS7 A;  3SEM A;  3RMS A;  2RM4 A;  3DKM A;  5HY6 A;  2EVR A;  1NPP A;  1UG1 A;  2OX7 A;  3OY9 A;  2IIM A;  3L2Z A;  1XTD A;  3LHD A;  4GY5 A;  1N8R C;  1UDL A;  1D09 B;  1QVF S;  2CZ6 B;  3CC7 Q;  3TEE A;  4LE9 A;  4RTZ A;  1BCO A;  2QXF A;  1RAF B;  1TWB A;  2LQW A;  1ZSG A;  3OYK A;  3TSW A;  3M0T A;  3MHX A;  1EX4 A;  2QYZ A;  4ZN3 A;  5KYU B;  2DIG A;  4C92 A;  3ZJT A;  1G3W A;  4FIB A;  5GMK i;  1WPY A;  3OYI A;  4C92 F;  1BB9 A;  3UT1 A;  1MMA A;  1GL5 A;  3H41 A;  3UAT A;  2Q18 X;  5A0D A;  3QG1 A;  4JLI A;  1FMV A;  5LJ5 g;  3RIR A;  4Y92 A;  2NLU A;  4HA8 A;  4LXC A;  2YSQ A;  3ZJV A;  1Y07 A;  3CD6 A;  3HTR A;  1OUL A;  3OYL A;  1RAI B;  2L3R A;  2P0K A;  4PJM A;  1K9A A;  3WVE B;  2JM8 A;  1AZE A;  2ED0 A;  1KC8 U;  1VOM A;  2ZPE B;  2A7Y A;  2ZZD A;  1PM3 A;  1BI0 A;  4YTL A;  4HCZ A;  3CC4 A;  2BTT A;  5GAN d;  5CAI A;  2YWW A;  2OAU A;  1OV3 A;  1Y96 B;  5GAO p;  2E65 A;  1LJO A;  5LJ3 f;  2K2V A;  5IHK A;  3OYJ A;  3GLX A;  2EYY A;  2C0O A;  4M77 F;  1T0H A;  4JZ4 A;  4PNO A;  4E7L A;  5KYW A;  4AQ7 A;  4NS5 A;  2K6D A;  5D6Y A;  3OSS C;  3FLG A;  4CC4 B;  5L23 A;  3J80 E;  5GAN j;  3QWX X;  1PD1 A;  1YIT Q;  3URG A;  2GNC A;  4D8K A;  4LN2 A;  5GAM j;  3CCE Q;  3QWY A;  2R58 A;  5HK0 A;  4DEX A;  5J26 A;  3OYC A;  5GAN 5;  1M30 A;  2DM1 A;  2EQU A;  2JVV A;  4PK4 A;  3NPF A;  1UGV A;  5FRM A;  3CEY A;  1ZUU A;  5M9O A;  4IUP A;  2I2L A;  4C0G A;  4CI0 C;  4RV0 A;  2HAX A;  1RAA B;  3P8D A;  4QVC A;  3VS0 A;  1E6G A;  4DQ2 A;  4C0F A;  2RB6 A;  3CPF A;  4L5G A;  5IH2 A;  2KNB B;  2HDA A;  1S72 Q;  2KRM A;  5IHI A;  4M78 G;  3JB9 D;  1QMC A;  3PE0 A;  3QII A;  1LNX A;  4F7U F;  3KBG A;  2EJG A;  5FRN A;  2G3R A;  4RG8 A;  2L3Q A;  4AFQ C;  2M0Y A;  2MWP A;  2HEQ A;  4RTT A;  1VQ4 T;  4FM4 B;  5FTM A;  2EAY A;  4GLM A;  3VS6 A;  1KFZ A;  3PIP A;  5AYF A;  3LH5 A;  4PJO G;  1TG0 A;  4PJO A;  4IIM A;  3QDF A;  4HCB A;  1K9M C;  2A28 A;  1UGP B;  2LCC A;  3H9N A;  5GAM f;  3CCR Q;  4CQN A;  1SEM A;  1ZX6 A;  1WLF A;  1YCY A;  2JMA A;  2D0N A;  2RJE A;  3G4S T;  1AWO A;  3JCM e;  4X34 A;  3TSZ A;  1YHQ T;  2KK4 A;  1X2K A;  2DNU A;  4JJD A;  3UA7 A;  3CME Q;  3CCM A;  4JUV A;  1YIT T;  1BI3 A;  3EG2 A;  4DBR A;  2CZ7 B;  1KSW A;  4OMO A;  4A4K A;  3QZ5 B;  4PJO B;  1YIJ Q;  3AT1 B;  2RI3 A;  3EG3 A;  2CUB A;  3MPU B;  1TUG B;  3CCJ Q;  2XG8 D;  2MK5 A;  3OYY A;  2QQR A;  3CCM T;  2DXC A;  4RCB A;  1VQN Q;  3V7R A;  3VS3 A;  5I11 A;  3FPR A;  1QWE A;  2FPD A;  5FTK A;  4BE0 A;  2PZ1 A;  2FZG B;  3C12 A;  2Z0W A;  3I35 A;  1CKA A;  1N9S A;  2EQK A;  3QJ6 A;  2QTX A;  3PGG A;  1KD1 R;  2Q1D X;  2DVJ A;  2ESW A;  3MO8 A;  3CF2 A;  3FJP A;  1Q95 G;  1NJI U;  3VJP A;  1G3S A;  3JCM X;  4N0A C;  4C8Q A;  5CKH A;  2QDY B;  1OX8 A;  1K73 C;  1X6B A;  1S72 A;  1M1G A;  1R8O B;  2ZPI B;  2OAW A;  1JEG A;  2MYS A;  3JCM f;  2CP3 A;  3HFN A;  2O2O A;  3OS5 A;  5D6X A;  2ZGW A;  4RTW A;  4AMC A;  4MZP A;  1UHF A;  2CT3 A;  4FW1 A;  3VYH B;  3ZBD A;  1U06 A;  3CMA T;  3I55 A;  1G3Y A;  4LD9 K;  1M3B A;  2LT1 A;  1NBE B;  1K9M U;  4AFZ C;  4OF1 A;  1SKU B;  1VQ7 Q;  2LQN A;  4C5G A;  1UGS B;  3OYA A;  1XQH A;  2KVQ G;  2QQA A;  1QCN A;  2DL3 A;  3V7C A;  4LUE A;  2EWN A;  2D9T A;  2ZPF B;  5GMK m;  3LW5 E;  3VRY A;  1ZQ1 A;  4ARI A;  1RAE B;  4PFZ A;  4J9D A;  1WJS A;  3RNJ A;  5B6C A;  2FHD A;  2EQM A;  3SD4 A;  2YUJ A;  4E7H A;  1PKS A;  1A0N B;  3CCJ T;  1IZ6 A;  3CCQ T;  1R77 A;  1UHC A;  1Z9Q A;  5DLQ E;  4DOW A;  5A0L A;  1IB8 A;  3GPL A;  3A8O B;  2KRN A;  2J6K A;  3PVQ A;  4AS1 A;  3G1J A;  3G6E Q;  1MMG A;  2FYK A;  1VQK T;  3A98 A;  1WYX A;  1IRX A;  5EG2 A;  1EFN A;  1M90 C;  2LVM A;  1B7T A;  1WJQ A;  4C92 C;  3LWI A;  3KXT A;  3M58 A;  2AT1 B;  1GCQ A;  1N27 A;  4XU3 A;  2CSQ A;  1I07 A;  2HZY A;  1T0J A;  1X2Q A;  2CH4 W;  1UGR B;  1VQK A;  1VQP A;  1I9G A;  3A5Z B;  2BUD A;  1ZA1 B;  3HU1 A;  1VQO T;  2GCX A;  2EKH A;  5CD1 A;  3PTA A;  1HYO A;  1UE9 A;  3BW1 A;  1Q7Y R;  2Y4X A;  2E5K A;  3M55 A;  1EIF A;  5CKF A;  3M54 A;  1MHN A;  3RDV A;  1MMN A;  3X20 B;  2CT4 A;  2L2P A;  2H3J A; 
#chains in the Genus database with same CATH homology
 1BYM A;  3BY7 A;  3G71 A;  1CR5 A;  4R55 A;  1BI1 A;  1M5Q 1;  1XNI A;  5CKB A;  1DJ7 B;  3QBY A;  1KHI A;  3CCU A;  3HFO A;  1JB0 E;  1OZ3 A;  1K73 U;  3A8H B;  3CXC A;  2DK3 A;  5CR2 A;  1OYX A;  1WJR A;  3I56 T;  1O75 A;  5DYI A;  2KDS A;  1Q86 C;  3LYI A;  4M77 D;  5LJ5 d;  5A0G A;  4QVD A;  2ZPH B;  4TVR A;  4C8Q E;  4M7D B;  2JTF A;  4J5Y A;  1Q86 U;  2YVL A;  5FU6 C;  2F69 A;  5KCH A;  4M78 B;  2EKO A;  1PSE A;  2F5K A;  2ZPB B;  4M75 A;  1WQ7 A;  2JZ2 A;  4M78 E;  2DTI A;  4XK8 E;  5CQX A;  5CK9 A;  3PNW C;  3C94 A;  4L59 A;  4LDW A;  5GAO n;  3CCV A;  3OB9 A;  4BE2 A;  2V8J A;  4OGC A;  3UDC A;  3M5A A;  3GOX A;  1OZ2 A;  1M1F A;  5LJ5 h;  2LQ8 A;  5GAO m;  3DLM A;  5LL6 S;  1ZC1 A;  2E6Z A;  4ZN1 A;  1KD1 U;  3JSC A;  3CCS T;  2Y90 A;  2OTJ T;  3V8J A;  4OMF B;  3L2W A;  1NZ9 A;  2E12 A;  2M1H A;  3OBY A;  3JB9 F;  2Q1C X;  2V8K A;  1OI1 A;  3OYB A;  3FDR A;  4ME7 A;  2JNG A;  2HNI A;  3Q1J A;  4JS5 A;  3QZ9 B;  2E64 A;  4II1 A;  4BY6 C;  3HPW A;  1Q7Y C;  2QQS A;  1M90 U;  1VQ9 A;  2OTL T;  1S3S A;  2KAF A;  1BKB A;  3M57 A;  3LWH A;  3MEV A;  5LJ3 e;  3LH0 A;  1R7R A;  4M7A C;  2EQJ A;  2P0P A;  2QEX T;  1H3Z A;  3INZ A;  1K8A U;  1VQ8 T;  2PVO B;  5LJ5 f;  2CS7 A;  1M8V A;  3RMS A;  2D0Q B;  2DTO A;  1YI2 A;  2RM4 A;  1B34 B;  3DKM A;  5HY6 A;  1VQP T;  3CMA A;  2ZCF B;  1NPP A;  4C8Q F;  1VQ5 A;  2JN0 A;  3QXE B;  3QDR B;  4J8O A;  3OY9 A;  3L2Z A;  1XTD A;  3P8B B;  3LHD A;  3JCM J;  3JB9 G;  3LGA A;  2M0O A;  5GMK j;  3HL8 A;  4GY5 A;  4XU1 A;  1N8R C;  3EAE A;  4J6Y A;  5CQY A;  4A4E A;  4C92 G;  1VQ7 A;  1QVF S;  2MI6 A;  2CZ6 B;  4M7D A;  3M4G A;  2LCL A;  4L6V 5;  3TEE A;  5IAY A;  2XDB A;  2EJ9 A;  1JJ2 A;  2QXF A;  4LDU A;  1VQ8 A;  4M75 C;  2E41 A;  4XTY A;  3OYK A;  1YI2 T;  4M7D F;  3CME A;  3MHX A;  4A4H A;  4ZN3 A;  2K5F A;  2DIG A;  3O8V A;  4C92 A;  4ELZ C;  4C8Q D;  3OW2 S;  1QDN A;  3RMQ A;  3AHU A;  3ZJT A;  5KH6 A;  5GAN 7;  1I4K 1;  1G3W A;  2MMP A;  4FIB A;  3L2Q A;  5GMK i;  4M7D E;  3MEU A;  2PJH B;  4BDY A;  1VQ7 T;  1WPY A;  2LQK A;  3OYI A;  2B8A A;  4IUQ A;  2JOY A;  2XIC A;  4C92 F;  1VQ6 A;  3UT1 A;  4KUL A;  5CCA A;  1LOJ A;  1N8R U;  2RO0 A;  3VYG A;  3CCJ A;  3PIO A;  2Q18 X;  5A0D A;  3QG1 A;  5I21 A;  4JLI A;  3FEO A;  2FL7 A;  4LDV A;  3F70 A;  5LJ5 g;  1QP3 A;  3G7Z A;  4IUT A;  3RIR A;  3G4S A;  2NLU A;  1YIJ T;  4HA8 A;  3ZJV A;  1QVP A;  1QVG S;  3I56 A;  1UGQ B;  2GFA A;  2RH2 A;  3QPH A;  4EMH A;  5GAM e;  1Y07 A;  4BI8 B;  2C06 A;  2D6F A;  4C8Q G;  3QO3 A;  3CD6 A;  3MB5 A;  1FXX A;  3OYL A;  1U1S A;  4XU2 A;  1S72 T;  4XQ3 A;  2L3R A;  2P0K A;  2K5L A;  2V8I A;  5C1B A;  3WVE B;  1KQ2 A;  5IN1 A;  3VUZ A;  3VUB A;  2VV5 A;  5DM7 R;  5FU7 C;  5DLO A;  4ATO A;  3QC8 A;  1M4Z A;  2IG0 A;  5LJ5 j;  1KC8 U;  1X75 C;  4A54 A;  4J6X A;  2ZPE B;  2A7Y A;  5CKD A;  4KT0 E;  4Y91 A;  5C0M A;  3CD6 T;  2ZZD A;  1YJW A;  2DXT A;  2VXF A;  1YJN A;  1Q81 C;  3I55 T;  1BI0 A;  4YTL A;  3T9N A;  5L8R E;  4HCZ A;  3CC4 A;  2DD5 A;  5GAN d;  4C8Q B;  5CAI A;  5FTJ A;  2OAU A;  2LX9 A;  3M9Q A;  4KOD A;  1Y96 B;  3OQ5 A;  5GAO p;  2E65 A;  3CXC S;  1LJO A;  5J39 A;  5LJ3 f;  2K2V A;  4JS4 A;  3S3O A;  4P5N A;  2O4X A;  4ZTJ A;  3OYJ A;  3GLX A;  4M78 C;  4M77 F;  4E7I A;  3TU4 K;  1JRI A;  4C5I A;  3ZEH A;  1TH7 A;  4PKC C;  4PNO A;  4E7L A;  3A8L B;  5GAN h;  2QEX A;  3PT9 A;  1ZBX A;  4GLK A;  2VYT A;  4NS5 A;  4AQ7 A;  3CPW S;  4C0D C;  5D6Y A;  3E9G A;  2GQV A;  1K8A C;  3PMI A;  1KQS A;  2RHY A;  3OSS C;  4RCC A;  1YJ9 T;  2Y4Y A;  3L42 A;  3ME9 A;  3FLG A;  2X4W A;  4A4F A;  4ELY C;  3OYD A;  3A8G B;  3CBP A;  2EJF A;  4C0Z A;  2EFI A;  2XI9 A;  3TCJ A;  3RKY A;  2CYZ B;  3J80 E;  5GAO l;  3OSV A;  4FT2 A;  2DKG A;  4XU0 A;  5D6W A;  4C92 B;  4JLG A;  4ZGE B;  3DLL A;  3RES A;  4BY6 B;  5GAN j;  1U8R A;  1KG1 A;  2O01 E;  3QJY A;  4FSX A;  2L89 A;  3URG A;  5GAN 3;  3HRS A;  2RHZ A;  1VIE A;  3CME T;  4BDZ A;  5GAM j;  1VQ4 A;  2RJC A;  2VXE A;  2R58 A;  5HK0 A;  1VQN A;  2DPP B;  3GF5 A;  2YLB A;  5J26 A;  3QQ7 A;  2RHI A;  2VGN A;  3OYC A;  5FTL A;  4EPC A;  4LD6 A;  5GAN 5;  3MEA A;  3MEW A;  2EQU A;  4HT8 A;  2QI2 A;  3CC7 T;  2JVV A;  1KD1 C;  3SFM A;  2GFU A;  2CZ1 B;  4RG2 A;  3GNG A;  5FRM A;  3OYM A;  3L2R A;  1W2B S;  4M75 E;  3JCM d;  3CEY A;  3BDU A;  3VV0 A;  1E32 A;  3OMG A;  1WQW A;  5M9O A;  4PJO C;  5GAM h;  4IUP A;  3CCE A;  2I2L A;  4IUR A;  4N4G A;  4C0G A;  4CI0 C;  3CCL A;  4HCC A;  4M78 D;  1VQN T;  3HSB A;  3QYH B;  4RV0 A;  2HAX A;  4MZM A;  1W4S A;  4RKU E;  3M53 A;  3P8D A;  4QVC A;  5LJ3 h;  2DJZ A;  1Q82 U;  4M77 B;  4F7U G;  4DQ2 A;  4Z02 A;  2P4T A;  2DVE A;  3NTH A;  4C0F A;  2QA4 A;  2E70 A;  4D6W A;  4MDW A;  3JCM c;  3E19 A;  3VU3 C;  4DOV A;  2JV2 A;  2MAM A;  3C95 A;  2RB6 A;  2RD1 A;  2XU8 A;  3CPF A;  4L5G A;  3MP6 A;  3LGL A;  3M59 A;  2PQW A;  1KQS S;  3OYF A;  1JBM A;  3HKS A;  1CZ5 A;  3J81 E;  5FU7 B;  1SSF A;  4XAX B;  3P8H A;  3V8K A;  2CKK A;  4M7A F;  1V29 B;  2DO3 A;  2IVW A;  4M78 G;  1YJW T;  3ZGZ A;  3JB9 D;  4KUD K;  1IRE B;  2QA4 T;  3SDZ A;  5CVI A;  3QII A;  1VQ5 T;  4M7A A;  2KMT A;  1LNX A;  4BUG A;  3KBG A;  2EJG A;  4C92 D;  4EMG A;  2G3R A;  4F7U F;  4MMK A;  5FRN A;  2K4Y A;  4JRK A;  5GAN 8;  5LJ3 d;  4RG8 A;  3G6E T;  1VQL T;  4KO8 A;  2YRV A;  2MWP A;  5KE3 A;  3TIW A;  4RMO A;  3OYN A;  3JRZ A;  1VQ4 T;  3HU3 A;  4BI3 A;  4FM4 B;  5FTM A;  2EAY A;  5I2M A;  4J6W A;  3G71 T;  1QVG A;  1VUB A;  4OVA A;  4CRI A;  3LGF A;  5DY9 A;  3OW2 A;  3JCM V;  3GIB A;  3PIP A;  5AYF A;  5GAM g;  1U1T A;  3LX7 A;  1O54 A;  3EFS A;  2JTM A;  4E7J A;  3X25 B;  4PJO G;  4EDU A;  3L2U A;  3ASK A;  4XTU A;  4PJO A;  5IT9 E;  1WGS A;  4O6J A;  2KSS A;  3OS2 A;  2DZ9 A;  2WSE E;  4BI4 A;  3JCM P;  4HCB A;  1K9M C;  4IUV A;  5GAN 6;  2HQE A;  3A8M B;  1UGP B;  2LCC A;  3DB4 A;  1ZHI A;  3QKJ A;  5GAM f;  3FC3 A;  5J3B A;  4V2S A;  2MM2 A;  1KHC A;  2RI2 A;  2RJF A;  3NFC A;  3ZFJ A;  1VQM T;  1VQ6 T;  2RHX A;  4R56 A;  3S3N A;  5GAN 4;  4CQN A;  2DIQ A;  2EIF A;  1WLF A;  1NE8 A;  1X01 A;  1YCY A;  4M7A B;  1HK9 A;  3UWN A;  2RK2 A;  4M7A G;  2RJE A;  1MGQ A;  3MCA B;  4JDS A;  3G4S T;  4MDX A;  2E6N A;  3BFM A;  3JCM e;  4X34 A;  4PJO F;  1CZ4 A;  3CCS A;  1YHQ T;  1RI0 A;  2PWY A;  2KK4 A;  3QWZ A;  1D3B B;  2DXU A;  1FWZ A;  2OTJ A;  1KQ1 A;  5GMK e;  3CC7 A;  1UB4 A;  3L2V A;  3CCM A;  3HHT B;  4JUV A;  4BD3 A;  2PUO B;  1YIT T;  1HXD A;  2HQX A;  3FB9 A;  2L5Q A;  5FU6 B;  2RHU A;  3S6W A;  1BI3 A;  1M1K C;  2KY9 A;  2CZ7 B;  4JRQ A;  4KDI A;  4OB0 B;  4A4K A;  3QZ5 B;  4BB7 A;  4PJO B;  4OB1 B;  2OTL A;  4PLI A;  2X4J A;  2XKO C;  5ERG B;  4NL3 A;  4XTZ A;  2BIV A;  4M7A D;  2RI3 A;  4A4G A;  1YHQ A;  3GP8 A;  3M56 A;  5GAM d;  3CC2 T;  4OP0 A;  3QHS A;  2ZPG B;  2XG8 D;  3SB2 A;  3OYY A;  3OYG A;  2QQR A;  3RUX A;  3CCM T;  2DXC A;  4RCB A;  2XHC A;  3V7R A;  3J7A F;  4UC4 A;  2DTH A;  3FPR A;  2VGM A;  5FTK A;  4EMK C;  5FLX E;  4OGE A;  4BE0 A;  3RER A;  4LDY A;  4EMK B;  2LNV A;  2JUF A;  3FRN A;  3C12 A;  5GAO r;  1Y96 A;  1QCS A;  1I5L A;  2QQB A;  4M75 D;  3ZJU A;  2YLC A;  4OB3 B;  3RKX A;  5GAN 2;  2R5A A;  4M77 E;  3CCU T;  1N9S A;  5CKE A;  1Y7X A;  4EMK A;  4ARI A;  2EQK A;  3QJ6 A;  2QTX A;  3PGG A;  1BI2 A;  2Q1D X;  2RJD A;  3L1A A;  2F5T X;  5EQJ B;  3CBM A;  4M77 C;  2O4X B;  2CGH A;  4F7U E;  2K3X A;  3MO8 A;  5LJ5 e;  2XDP A;  5GAN e;  3ER0 A;  3FPU A;  2Q19 X;  2PU9 B;  3CF2 A;  2E5Q A;  3FJP A;  5FTN A;  1NJI U;  4FU6 A;  4M77 G;  3VJP A;  1G3S A;  4M77 A;  4N4I A;  3OS1 A;  4FT4 A;  4Y28 E;  2K5I A;  3E9F A;  4N0A C;  5HKC A;  3JCM X;  5GAN g;  3MP1 A;  5GMK h;  4J83 A;  4C8Q A;  1M9S A;  4KBM B;  5CKH A;  2QDY B;  3PMT A;  1YIJ A;  1Q7Y U;  1X6O A;  1K73 C;  1VIF A;  1QVF A;  5EPP A;  3MET A;  2XD0 A;  3M4Y A;  1S72 A;  3OYH A;  3JCM g;  1G3T A;  1M1G A;  4J7I A;  1JJ2 S;  2DZC A;  1R8O B;  3QUI A;  2ZPI B;  3GNF B;  4O5V A;  1VQO A;  4JJN K;  2Q1A X;  5DYG A;  2LRQ A;  4ZTF A;  3JCM f;  2CZ0 B;  1GXI E;  4E47 A;  5KCO A;  1NPR A;  2R57 A;  3CCE T;  4KLN A;  1QP2 A;  3WVD B;  3HFN A;  4J7F A;  3OS5 A;  5D6X A;  5KE2 A;  2WSC E;  2X35 A;  4PJO D;  2KQW A;  2ZGW A;  3PFS A;  2MF2 A;  4DA4 A;  2E10 A;  4F7U B;  1BIB A;  2VC8 A;  4M7D G;  2HBP A;  4MZP A;  3HRT A;  2E1H A;  3VYH B;  3ZBD A;  2K57 A;  3CC4 T;  2LTO A;  4MZT A;  4BE1 A;  3CMA T;  3I55 A;  3H8Z A;  3OMC A;  4QVZ A;  3JCM b;  5CCB A;  3QQ8 A;  3X28 B;  1I81 A;  4M7D C;  1G3Y A;  4LD9 K;  2LT1 A;  4JRP A;  4B9X A;  1YIT A;  4KUI A;  2M9U A;  1K9M U;  3HU2 A;  5HK3 A;  3JAM E;  4OF1 A;  5I2S A;  4XTW A;  1D3B A;  2XDD A;  2QQ9 A;  2RK1 A;  1UGS B;  3HP9 A;  4C5G A;  3OYA A;  1KC8 C;  2EYQ A;  3X24 B;  2B25 A;  3MP8 A;  3JB9 H;  1XQH A;  2KVQ G;  2QQA A;  2RI5 A;  3QYG B;  4HKE A;  3V7C A;  2FVU A;  4C0D B;  3LLR A;  2EWN A;  2D9T A;  2ZPF B;  4M7D D;  4QQD A;  5LJ3 g;  4N0A A;  5FRO A;  1YBY A;  4B9W A;  5GMK m;  2LT4 A;  1AHJ B;  3LW5 E;  4E7K A;  4ZGJ B;  1ZQ1 A;  3WXM B;  1YJ9 A;  3FPT A;  1O9S A;  5A2Q E;  4PLL A;  4C8Q C;  3JB9 J;  4WF2 A;  2WAC A;  1WJS A;  4Q5W A;  3G6E A;  4C5E A;  5CIU A;  3OYE A;  1VQL A;  5LJ3 j;  5B6C A;  2FHD A;  2EQM A;  2DXB A;  1Y71 A;  3SD4 A;  4PJO E;  2YUJ A;  2PUK B;  1B34 A;  2PVD B;  2VUB A;  1M1K U;  4E7H A;  3CCV T;  3CCJ T;  2X4Y A;  1IZ6 A;  3CCQ T;  4X9D A;  1P92 A;  5DLQ E;  3V8L A;  4XTV A;  4DOW A;  5A0L A;  2MM0 A;  3GPL A;  2M16 A;  3A8O B;  2RA2 A;  1UEB A;  3S3M A;  2PVG B;  5GAN f;  4LDX A;  3EFR A;  1NJI C;  4MML A;  4AS1 A;  3HRU A;  3JCM Q;  2XK0 A;  2P0Q A;  4JRI A;  5C18 A;  2FYK A;  2DD4 A;  2BKD N;  2XID A;  3JCM h;  1VQK T;  3BQB A;  4KDL A;  4OB2 B;  5EG2 A;  4M7A E;  1M90 C;  1FX7 A;  4NOY A;  4BAC A;  3CCR A;  1QW1 A;  3BDL A;  3OBW A;  2LVM A;  4M75 G;  5CO7 A;  3H6Z A;  1VQM A;  3C4S A;  1WJQ A;  4N4H A;  4C92 C;  3CPW A;  3CCQ A;  1VQ9 T;  4IKF A;  3UPU A;  4HT9 A;  3LWI A;  5CCX A;  3JB9 I;  4FL6 A;  4ZGD B;  3M58 A;  1PSF A;  3KXT A;  3CCL T;  2LC4 A;  3FIF A;  4M78 F;  3RKW A;  2DEQ A;  1N27 A;  4XU3 A;  4NL2 A;  4M75 B;  3OA6 A;  1W2B A;  4PL6 A;  1Q81 U;  1YJN T;  1UGR B;  2DAQ A;  3TRE A;  1H64 1;  1VQK A;  2K3Y A;  3E1S A;  2A3L A;  1I8F A;  1VQP A;  1I9G A;  2AHJ B;  4A53 A;  4M78 A;  3A5Z B;  3DB3 A;  4IUU A;  2BUD A;  4QQG A;  4QW2 A;  3V7S A;  5C6S A;  3CCR T;  2YHT A;  3HU1 A;  2FB7 A;  2L8D A;  2LDM A;  4C5H A;  1VQO T;  3QSU A;  4XTX A;  3X26 B;  1BIA A;  2MWO A;  1N6A A;  3JCM W;  1G5V A;  2GCX A;  3CBO A;  2X4X A;  5CD1 A;  3PTA A;  4M75 F;  5GLF A;  3VKI A;  1WNL A;  4VUB A;  3SWN C;  3OS0 A;  3NTI A;  2GF7 A;  1N9R A;  3BW1 A;  1RL2 A;  3SWN B;  2Y4X A;  5GMK l;  1XOV A;  2HD0 A;  4C92 E;  2WSF E;  5GAO q;  2LW6 A;  3M55 A;  3CC2 A;  3N5B B;  1EIF A;  5CKF A;  3M54 A;  1MHN A;  3SWN A;  3NTK A;  4ARC A;  4QQ6 A;  4F7U A;  2R5M A;  3X20 B;  1Q82 C;  3R6O A;  3KUF A;  4X9C A;  2H3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...