4UC4A

Crystal structure of hybrid tudor domain of human lysine demethylase kdm4b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
AVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4B
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 20
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4uc4A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4uc4A02
5FRNA 1N27A 2M1HA 2MWPA 3MEWA 3MEVA 3E9GA 4BDYA 3UT1A 3OYMA 2WACA 3OYEA 3OQ5A 2LVMA 4QVZA 3MP6A 4N4IA 3OB9A 5J26A 3OS0A 2LDMA 3P8HA 1MHNA 3PFSA 3QBYA 2G3RA 2P0KA 2RI3A 4BE2A 3P8DA 2BIVA 3NTIA 4B9WA 3OYFA 3OA6A 3DLMA 4LD6A 3MEUA 5C6SA 4E7KA 2EKOA 5FROA 4L59A 2X4XA 2E6NA 4B9XA 1SSFA 5D6WA 4BE0A 3H6ZA 2RJCA 3L2QA 3PNWC 3DB4A 4PLIA 4C5HA 2QQSA 2LTOA 3M9QA 5M9OA 2RHZA 3CEYA 4C5EA 4IUQA 2DIGA 4Q5WA 5IN1A 3SD4A 2O4XA 2XDPA 2BKDN 3DB3A 2D9TA 1H3ZA 5KCOA 2PQWA 3LH0A 4QW2A 3S3NA 2DIQA 4IUPA 4UC4A 1G5VA 3OY9A 4IUUA 2RHUA 2EQKA 3GOXA 2NLUA 3S6WA 4OVAA 3KUFA 3ME9A 3L2WA 5IAYA 3F70A 3OS1A 2IG0A 2HQEA 3QIIA 4N4GA 3OYIA 2F5KA 3OYAA 4E7LA 4IUTA 3S3MA 3META 2RJDA 4PLLA 3UWNA 2L3RA 2LRQA 3OMCA 2RJEA 4A4GA 2JZ2A 3LGFA 2B8AA 3PMTA 4QQDA 3ZEHA 4QQGA 4X34A 2YRVA 2RJFA 4IURA 5KE2A 4A4EA 2EFIA 3FLGA 4C5IA 3NTHA 5CIUA 3EAEA 4ZTJA 3OYGA 3LGLA 2FHDA 2RO0A 2HQXA 2L89A 2LCCA 3LYIA 3FEOA 3OYLA 2DAQA 2VYTA 3FDRA 2RI5A 4BACA 4BE1A 4E7IA 1WGSA 3MEAA 3OMGA 3L2RA 4BDZA 3OYBA 2X4YA 2M16A 3PMIA 3Q1JA 2JTFA 4NS5A 3NTKA 3OS2A 4IKFA 3BDLA 3QKJA 2RHXA 2X35A 2GF7A 5KH6A 3L42A 4EDUA 2K3YA 3QJ6A 2RI2A 3O8VA 3MP8A 3OYJA 4A4FA 5FRMA 2XK0A 4PL6A 2EQJA 3MP1A 4A4HA 5KE3A 3FC3A 2R5MA 4E7HA 4BD3A 4FL6A 4Z02A 2RHIA 1WJRA 3H8ZA 3OYCA 1OZ2A 2EQMA 3E9FA 2L8DA 3LX7A 3OYKA 3C4SA 2R58A 5C0MA 4RG2A 3OYDA 2M0OA 3LLRA 5D6YA 3OYHA 3L2UA 1WJSA 2MWOA 4GY5A 3ASKA 5D6XA 3L2VA 1WJQA 1OYXA 2BUDA 2RHYA 2X4WA 5KCHA 2GFAA 2QQRA 4E7JA 2EQUA 4QQ6A 2O4XB 2K3XA 3MO8A 1RI0A 1KHCA 4FU6A 4N4HA 2GFUA 3OYNA 1OZ3A 4IUVA 1OI1A 3S3OA 2E5QA 2R57A 4CRIA 2CKKA 1XNIA 4II1A 5J39A 2R5AA 4ZTFA 4HCZA 4C5GA
chains in the Genus database with same CATH superfamily
1YN8A 3VS7A 2WACA 5EPPA 1NEGA 4M77E 1MMDA 4HVUA 1RAFB 2EIFA 3CQTA 4V2SA 5LJ5h 4Y28E 2G3RA 2F2VA 3OYFA 5EG2A 4BI3A 1VQLA 1CSKA 2LTOA 3QQ7A 2KXCA 5IXFA 3MHXA 3CCVA 2K79A 4A54A 1QKXA 3M4YA 4XAXB 2PQWA 3LH0A 4J9HA 3C94A 2GTOA 4MDWA 1V1CA 2RA2A 4KRTA 4M7AB 3OS1A 4PJMA 1OQKA 1SRMA 5IT9E 2RK2A 3NMZC 1UB4A 2MI6A 4OB2B 4M7AC 3VUBA 2RJEA 1WPYA 5GMKm 2KAFA 2AZVA 2H3EB 2QEXQ 4PJOD 2FEIA 4FSXA 3R6NA 3EG3A 4AT1B 1K9AA 5FTLA 2L89A 5CVIA 2DAQA 2V8IA 2JM8A 3M58A 3L2RA 3LH5A 1DJ7B 2F2XA 4NS5A 4XU2A 4NL3A 1HD3A 5KH6A 1WLPB 1M8MA 2YUNA 1VQ8A 1E6HA 2P4RA 4XTVA 5GAMd 1VQNT 1M27C 5KE3A 1EFNA 4Z02A 5KYXB 2E5KA 2KEAA 2L3QA 2SRCA 3OYKA 3C4SA 4M77D 3OW2P 1M4ZA 3M59A 3OYDA 1VQLQ 4ANJA 2YLCA 2OI3A 1D09B 3BDUA 4JLGA 2RHYA 1U5SA 3CCVQ 5GJWB 4RCCA 3AHUA 2KYBA 4FU6A 4NL2A 4RUGA 2LQKA 3JCMW 4IUVA 1U06A 1OI1A 1WHLA 4J8OA 2BE7D 2DERA 3EGUA 1VQ6A 1X01A 3EFSA 4ZTFA 3GPLA 2RPNA 2ED1A 2JS2A 1Q7YU 2K7AA 2ZPFB 1QCSA 2LVMA 1PM3A 4P5NA 2CT4A 3PFSA 1T0JA 2ENMA 2CP5A 2J6KA 2VXFA 2DRMA 4C0DB 1M90R 4JPBW 1PD1A 3VRZA 1JO8A 3VS4A 2GCXA 2NUTB 4C0DC 1TTHB 4C8QA 2KY9A 3BW1A 3JCMP 2O31A 2XDDA 2DXTA 5IHNA 2DIQA 1VQ8Q 5AT1B 1U1SA 1LCKA 2DRKA 3FPTA 3QZ5B 1QVGA 1H641 1D1CA 3CCJT 1W1FA 1N8RC 2CSQA 2XKOC 4FYVB 3KXTA 5LJ5d 3CCST 2DYBA 1W2BP 1UFFA 1WQ7A 1Z9ZA 3QYGB 1EX4A 1FYNA 3NGPA 2DF6A 1Q86U 4M7DG 3G1JA 3FEOA 5FTMA 4AG1C 2RNAA 1WGSA 2LP5A 4LN2A 2RHXA 3EFOA 1B3QA 2DTHA 2IPOB 2XK0A 3QHSA 2XICA 1BCMA 1T3LA 1NM7A 3E9FA 1J3TA 3LX7A 1VQKA 2C0OA 4ZGDB 1UJYA 2Q19X 2QQAA 4E7SA 2QA4A 4F7UE 5GAN7 1Q82U 1QVPA 4LDUA 4AG2C 3I55Q 2OTLA 2O4XB 2E65A 5IHIA 2DJQA 1LVKA 3CCQT 2JNGA 3QWZA 4ARIA 1M1KU 2FPFA 4BI4A 2ROTA 1I07A 5A2QE 3BFMA 1YJWQ 3LGAA 3P8HA 3QWXX 1KC8U 3R6OA 1IREB 2RI3A 3H9NA 1WHJA 1VYVA 1MUZA 2OAWA 4FYYB 2Y4XA 3PNWC 5DYGA 4JRIA 3JB9I 1IO6A 2DIGA 3JCMh 1KG1A 2HL3A 1GCQA 4KH1B 3BQBA 4MDXA 2BTTA 1GFCA 2RH2A 4EMKB 3A98A 3OY9A 2DO3A 1KQSP 3G7ZA 2EWNA 3SDZA 5GMKl 3KUFA 2KVQG 4EMKC 3OW2A 1K73U 1ARKA 2YVLA 1VQMA 1VQOQ 3N5BB 4JS4A 3JB9G 1MV3A 1ZX6A 2YT6A 4PFOA 1VQ6T 2OTLQ 2E3HA 1YI2T 2ED0A 3CCEA 1PKSA 3FLGA 1MMAA 2K5LA 2DZ9A 5DLOA 3CPFA 3IQLA 4M78F 3QO3A 2DILA 1I4K1 2YRDA 1YHQA 3OYBA 1JJ2S 2FPDA 2DVEA 1SHGA 1C1AA 3ZBDA 4LDWA 1KD1U 3G4SA 1JEGA 2E1HA 4PL6A 3MP1A 4M7AA 2K3BA 2RHIA 5GAMf 3V8LA 3EGDB 1HK9A 1S72A 1AZEA 2K9GA 2P0PA 1PNJA 2W0ZA 2ZPEB 4GBQA 1S1NA 1YJ9A 1Q7YC 1N9RA 2EYQA 1PWTA 2ZCFB 1C0MA 2RM4A 2DBMA 1HSQA 1AOJA 3MEWA 4OB1B 4L5GA 1G3WA 1SKUB 4X9CA 7AT1B 3L1AA 3OYEA 5I2MA 1QKWA 3VV0A 1W2BA 1YWPA 1WHGA 1CZ4A 4J9FA 3VKIA 1KQ2A 1WIEA 3CC2A 2KQWA 4XTZA 5CAIA 4ORZA 5KYXA 2ECZA 4LD9K 2EYWA 5FROA 4C8QG 4DBHA 2RJCA 3GP8A 1VQ4A 1NG2A 2ZPHB 3HRUA 1D3BB 3EG9B 1UE9A 4XK8E 2HKNA 5IN1A 4M75E 3SD4A 2C06A 2HQHA 1TG0A 2PZ1A 3E1SA 3CCLQ 1VQKT 1ZBJA 1G5VA 1Y07A 2QA4T 1NYGA 5FWCA 1Q86C 2L3RA 3CCUT 3I56A 4EMHA 2DE0X 2O01E 4FM4B 3PIOA 3VS1A 4JUVA 5CO7A 3RESA 2RJFA 4IURA 1YJ9Q 5LJ5f 4DBRA 2NUTA 2ZGWA 4M78B 2K2MA 2X9HA 2XIDA 3JCMd 4JRPA 3M55A 2NWMA 4M78C 4JRQA 2JTFA 4OP0A 4B6MA 2LCLA 4JZ3A 2KSSA 3G6ET 1PRMC 1QCNA 2RI2A 3FRNA 3M0RA 1ZA1B 3MP8A 2EGAA 4ELYC 1X27A 4PFZA 2CP6A 1IXDA 1Q82C 2K57A 3SWNB 4XTYA 4C0GA 3LHDA 2RB6A 1D0ZA 3SWNC 5D6YA 1VQ4Q 3L2UA 1Y0MA 5LJ3g 1M1GA 2WSFE 8ATCB 1TUGB 2BUDA 2D1XA 3QJYA 5GANg 4IIMA 4HT9A 1RI0A 4OMLA 1KQSA 3S3OA 4DQ2A 1XOVA 4JJDA 1VQMT 3OW2S 2DL8A 4BE1A 2VGMA 5FRNA 4M75D 2L5QA 1D1BA 1B7TA 2QDYB 3CD6Q 2MPXC 4BI8B 3CCET 1YITT 1AVZC 1RAAB 1WHHA 2DBKA 5HY6A 4BE2A 1ZSGA 1FWZA 5GAN5 2PU9B 2OJ2A 3VS2A 4Y92A 4L59A 3AT1B 1SSFA 1RAGB 4A53A 2EJ9A 4RMOA 1QLYA 3OSSC 2DKGA 3OYYA 1OPLA 4EIKA 1QP2A 1WX6A 3G4ST 2FPEA 2O4XA 1YJNA 4MMKA 1NLOC 1BI3A 1K73C 4ZN1A 2HMAA 2D0QB 1UHCA 1S72T 2NLUA 4D6WA 2ZZDA 3CMET 1VQPA 1BI0A 2E64A 2JV2A 1X6OA 2FZKB 3UWNA 2DJZA 3CC7A 1VQNA 2MM2A 2JOYA 4J9DA 3FJPA 3CBMA 1C6VX 5CIUA 3EAEA 1X6GA 5CCAA 5IXBA 2HQXA 3OYLA 1KD1C 5C18A 4LDVA 3EHRA 4ESRA 3MEAA 1TH7A 2X4YA 1W2BS 3CC2T 3NTKA 3OS2A 5GMKi 1QCFA 4RTYA 1ZA2B 4EMKA 3QJ6A 1NJIU 1IHWA 4OMQA 4M7AG 1PG5B 2O9SA 4OMNA 1M8VA 2NUZA 2EQMA 2L8DA 1UEBA 4RG2A 1FMWA 1K9MC 1IRXA 1VQ5T 1GCPA 1KQ1A 3O5ZA 3HU3A 3JCMJ 2Z0WA 1HJDA 5AYFA 1Y96A 4R56A 4FCYA 2K3XA 2DL7A 1K1ZA 1SSHA 5CKBA 4XTUA 3OYNA 1MNEA 4PJOF 2LW6A 4FT4A 4XU0A 3VU3C 3I56T 2KMTA 4BDYA 3M0TA 3OYMA 6AT1B 1X2KA 2XHCA 1YCSB 3EGDA 3CCSA 5CD1A 3GIBA 3HP9A 3M9QA 4AFQC 1RAIB 4M77F 1PSFA 1OU8A 1W70A 5FTNA 2GNCA 1G83A 4WCIA 1VQ7A 1E7OA 5GAN8 3UA6A 1K0SA 2J05A 4N4GA 3LW5E 2DXUA 2NUPB 2VWFA 3JCMb 1K8AR 1BB9A 4JRKA 2JZ2A 1EZZB 3HFOA 1JXOA 1UDLA 5HCKA 2YRVA 3SEMA 1KQSS 2GGRA 2BZXA 4J6WA 3OYGA 3CF2A 4C0FA 3I5SA 1D3BA 3EG9A 1YWOA 4E7IA 5B6CA 5GJVB 4MZTA 4J5YA 3OS5A 1OEBA 1UJ0A 3V7SA 4HVVA 3CCQA 2X35A 4RTTA 2NYSA 3JCMf 2PVOB 2DEUA 4HCBA 2KNBB 1I9GA 2DFUA 2YDLA 5GAOl 2R5MA 1WJRA 3CCJQ 1WLFA 4FIBA 3CCSQ 1YJNT 1KHIA 2CH4W 4OMPA 3T9NA 1M3BA 2MOXA 5KCHA 2GFAA 2FZGB 3M5AA 3MO8A 4E2FB 2VV5A 1VYTA 2K5IA 4AFUC 1OZ3A 2DL4A 1VQPT 4M78A 4PJOB 5GAN3 4FT2A 3CC7T 1R77A 2M1HA 4PJOC 4CC7A 3MEVA 4J6XA 1M3AA 2YHTA 4Y91A 4FSSA 1Y71A 3UPUA 5EQJB 1UTIA 1NLPC 2DD5A 1TXQA 1F1BB 2EKHA 3HHTB 1OULA 3SWNA 3TEEA 2BIVA 1SHFA 3OA6A 1M90U 2O88A 2JJ9A 2EKOA 4MZMA 4B9XA 4BE0A 2MYSA 1UHFA 2RMOA 3BY7A 4KDIA 2XMFA 3SFMA 4M77B 2X51A 3THKA 1YI2A 3OSVA 2H8HA 3A8GB 3DB3A 2D9TA 4O6JA 4M77C 3CCQQ 2X3WD 5KCOA 1ZUKA 1JBMA 3HRSA 4HA8A 2LZ6B 3ME9A 3L2WA 1Z9QA 2IG0A 8AT1B 2ESWA 4D8DA 3S3MA 3META 3E2UA 1BYMA 1G3SA 2EYZA 3NTHA 2OX7A 3G71T 2ABLA 4XTWA 1NE8A 3CPWP 2LCCA 2VUBA 1NJIC 2DETA 1BIAA 5EC7A 3Q1JA 5LJ3e 3WXMB 1MMGA 1SRLA 4C0ZA 1SPKA 5GANe 3BE3A 2O2OA 5FRMA 4J9BA 5FWBA 1Q81C 4FL6A 3E19A 1AWWA 1WXBA 1VQ6Q 1VQ7T 5D6XA 3VS6A 1YI2Q 1BI1A 3EGXB 3ZJTA 2CSIA 4E7JA 2QEXT 1KJWA 1VA7A 4QQ6A 2DXBA 1KHCA 1CKBA 1CKAA 2A08A 1AWOA 1N9SA 1QQJA 1XTDA 2QASA 1WI7A 2R57A 2W10A 2KRNA 4M7DE 1MMNA 2ZAEA 4F7UF 1QCOA 2YRCA 3EFRA 1WXTA 3HRTA 2YSQA 5IH2A 5ECAA 3DLMA 1TU0B 1VIFA 1WHMA 3RMSA 1AZGB 5LJ3j 3TCJA 3CCUA 4A4KA 3L2QA 1QDNA 3DB4A 4AS1A 5GANj 1PRLC 4KUIA 3M56A 3CMAA 1UECA 1VQ9T 1W4SA 4E6RA 1I0CA 1H3ZA 4GLMA 4HCCA 3QWYA 3RMQA 4IUPA 4J7IA 2EQKA 4LXCA 2COYA 2CUDA 4CC2A 3EHQA 2HQEA 3G6EA 3OYAA 5KYNA 2YUQA 4DBFA 2CT3A 4DEYA 4JS5A 3UDCA 2EFIA 4OMFB 1NPPA 1U3OA 4Z88A 2HAXA 3PMIA 3FPUA 2JXBA 1VQKQ 3J7AF 2Q1AX 1YIJA 2QA4Q 4KLNA 1M1KR 3UA7A 5GAMj 3QDRB 2CH4A 5FLXE 4M7DD 3H8ZA 1NBEB 1BIBA 2HD0A 1WYXA 2L0AA 3CCUQ 1AWXA 4QVDA 2NUPA 1YITA 1IGUA 2L3PA 1KC8R 1JXMA 2MWOA 1BU1A 3KFVA 1OYXA 2LQNA 2EYYA 2DTOA 2KI7A 4E7ZA 4M78G 5L23A 3RERA 2CP7A 5CR2A 5A0DA 4J7FA 1PCXA 2CKKA 4QVCA 4C92F 5HK0A 3RKYA 3E9GA 4F7UB 3FIFA 1M90C 3G6EQ 1WXUA 3FJ5A 4BY6B 1HXDA 3CC4A 2DTIA 5HK3A 3CMEA 1GXIE 4BY6C 2JN0A 3CPWA 2HNIA 1PC0A 5D6WA 2DVJA 1K9MU 3UATA 4DA4A 1QVGS 2COWA 1XJWB 2QQSA 5HKCA 5GLFA 1SEMA 2LX9A 1B34B 3I55T 2RQWA 4JJCA 1VQMQ 1V76A 4QW2A 4JJNK 1H8KA 2E10A 1QWFA 1OOTA 3CCEQ 4ZGJB 2RJDA 4DBQA 1YJWT 4M75F 4AQ7A 3J80E 5DY9A 4J83A 2QTXA 1YHQQ 3TQ7P 1KIKA 3P8BB 4F04B 5KE2A 2EAYA 5GAN4 4ZTJA 2DL5A 3LGLA 1FMKA 2RD1A 1VQ5A 2RO0A 2MAMA 4M77A 3G4SQ 3ZL7C 3LWHA 2M16A 4WTOB 3BDLA 3QKJA 4C8QE 2GF7A 1SG5A 3V8KA 1S72Q 2KT1A 3OYJA 3JB9D 5GAN6 3JCMX 1TWBA 3FC3A 3JCMQ 1O54A 4J9CA 2C0IA 5CKFA 2FYKA 1M9SA 2JUFA 3OYCA 4J9EA 2WSCE 4LUEA 1YBYA 5I22A 3CMAT 2EVRA 4OMMA 3LLRA 5FTJA 1M5Q1 2P84A 2LX7A 2RK1A 1D0XA 3NFCA 1AWJA 1NPRA 2AK5A 2EGEA 5KYWB 3QYHB 1RLPC 4CRIA 3PIPA 5J39A 4C92B 3CC2Q 4KBMB 1N27A 2EPDA 4PFPA 1ABOA 4OF1A 3UT1A 4C92C 2GTJA 4RTVA 3TIWA 2CZ0B 2P0KA 4JZ4A 5CQXA 2GQVA 5GAOm 2AIRB 2PVDB 4E7KA 5ERGB 1UG1A 1VQ5Q 2YUJA 5M9OA 3CEYA 2L2PA 1YIJT 2VASA 3EGXA 1RUWA 2A28A 4R55A 3PTAA 1LNXA 2XDPA 1RLQC 4UC4A 5J3BA 4J6YA 2RHUA 3I56Q 1HYOA 3SB2A 5I11A 4NOYA 2IVWA 4C8QD 3M0SA 1V29B 4LUDA 4M75B 5I21A 2CDTA 3HKSA 2FVUA 2ZPIB 3PMTA 3TVTA 4M75C 4X34A 5LJ3h 2F1LA 3CCRA 3EG1A 3WVDB 3CXCP 4YTLA 5GANh 3LYIA 3REBB 4RCBA 4QT7A 3U23A 3CC4T 4LDXA 3OMGA 2Q18X 5GAMg 2E41A 1BKBA 2MMPA 1PKTA 2FB7A 5L8RE 2P4TA 2C0TA 2I2LA 4KULA 5A0LA 2A7YA 4PKCC 2CYZB 2QQ9A 2DZCA 1WDXA 1VIEA 2KK4A 3VJPA 2AKLA 4KDLA 1T0HA 4JLIA 4N0AC 3REAB 2MWPA 3OBYA 2M51A 3QQ8A 4XTXA 4ME7A 3JB9H 3MP6A 1WHKA 5J26A 4RTUA 3INZA 1Q81U 2CZ7B 4KODA 1MV0B 2OTJT 3A8OB 1YJNQ 2D8HA 2J7IA 2YLBA 2DX1A 4M7AE 2PWYA 1JJ2P 1A0NB 1YFNA 2DA9A 1QP3A 4PJOG 3G71A 1VQPQ 4ARCA 1AEYA 3JV3A 2ZPBB 3CC7Q 1ABQA 1VQNQ 2EQIA 1BK2A 1K76A 2KDSA 2J06A 1M2VB 4F7UA 5LJ5g 3CD6T 1G2BA 4DEXA 5FW9A 4VUBA 3ZFJA 1K8AU 2BE9B 2DD4A 4HXJA 2E4HA 4BUGA 1GL5A 1TS9A 2MCNA 5GAOr 2VVKA 3KBGA 1N8RR 4M77G 4ZGEB 2VYTA 2DLPA 3EG2A 2EBPA 2QG9B 5FU6B 2QEXA 4OB3B 3L2ZA 1B34A 1OX8A 2CP0A 1R7RA 2XU8A 5FU6C 2K3YA 3H0IA 1GCQC 2YUPA 2JW4A 1R0CB 4ELZC 1GBQA 3RBBB 1WJSA 2M9UA 2AHJB 1UGSB 4FYXB 3RIRA 3G71Q 5LJ3d 5GAOn 1D0YA 3V7RA 4M7AD 5GANd 1XNIA 2KRMA 2FL7A 1FXXA 1GRIA 1VQ9A 2JM9A 2YWWA 1W6XA 2M02A 3OB9A 3OS0A 3CCRT 4EMGA 2JT4A 3NTIA 1Y7XA 3CXCA 1E32A 3MCAB 4R0KA 3A8HB 3A1PA 1QWEA 1VQ7Q 5GAOp 2Y4YA 4WF2A 2MIOA 3X24B 2HZYA 2KXDA 4IUQA 3M0PA 3PVQA 5D7UA 1G8XA 5KYWA 1ZUUA 2RQVA 1JU5C 3TREA 1OU9A 4C92A 2D8JA 3HL8A 3VS5A 4OVAA 5IAYA 3F70A 4Z89A 2E12A 3C12A 4XQ3A 2F5KA 3CBPA 4PLLA 1VUBA 2BZ8A 2X3XD 5KYUB 2QDLA 4QQGA 5IHKA 1X6BA 2CZ6B 2MM0A 3CCMT 1BBZA 2FHDA 3PGGA 3H0HA 5GMKe 3FDRA 3TSWA 4KGXB 3JRZA 3VYGA 3I35A 1VQ9Q 3VS3A 1QVFP 2JS0A 2Y90A 4D8KA 2RQUA 2EGCA 1UUEA 2KR3A 3O8VA 3I9QA 3SHWA 1WQWA 3X25B 4AMCA 1ZBXA 5CKHA 3A8LB 1AD5A 2F69A 1ACMB 4M75A 1JJ2A 4M4ZA 4GY5A 3ASKA 1LJOA 1IGQA 1X69A 1K0XA 2PNIA 4CQNA 2BZYA 2FG0A 2X4JA 4Z8AA 3X28B 2FRWA 3QSUA 2J6FA 4C5GA 2E6ZA 2CGHA 3I55A 3QUIA 1JRIA 1QW1A 1Q7YR 2XDBA 2KRSA 2KBTA 1EIFA 1X43A 1WNLA 5GMKj 1FMVA 3V7CA 4B9WA 1MNDA 4EPCA 1YJWA 1ZUYA 1P92A 1Q95G 4PLIA 4M7DF 2K5FA 3M57A 1M2OA 4RTXA 3GNGA 3QPHA 3M53A 4DOWA 1UGQB 4N0AA 4IUUA 1K8AC 4F7UG 2F5TX 1WZOA 2JMAA 3X20B 3RNJA 2CUBA 4GLKA 3H0FA 4RTWA 2O9VA 2HL5C 2FO0A 3VYHB 4XU1A 3UF4A 2EJGA 4ZN3A 1GFDA 5GAMe 5GAN2 4A4GA 1VQLT 3CBOA 2VB6A 1T3SA 2B8AA 3ZEHA 5GAOq 2J6OA 4A63B 2VC8A 3QZ9B 3CCVT 1Q86R 2KYMA 2QYZA 5FU7B 3JCMg 1VQOA 3QG1A 2RQTA 5FU7C 3MJXA 2RN8A 3GNFB 3FB9A 4FYWB 3J81E 3M0UA 3JAME 4LNPA 2VKNA 4PJNA 4DOVA 2COZA 3HTRA 4A4FA 3CXCS 1ZLMA 2EQJA 1VOMA 4RG8A 1WFWA 1M2VA 2HSPA 2MK5A 2ROLA 5CCXA 3JSCA 1NEBA 4BB7A 2K6DA 2AT1B 3X26B 5CCBA 2V8JA 2F2WA 3NHNA 4CC4B 1RABB 3MPUB 1WA7A 1WJQA 4TVRA 1Q82R 5C1BA 3RKXA 1ZHIA 3V8JA 5I2SA 1RADB 1G3YA 2AZSA 2LT1A 5LJ3f 1VQ8T 1JQQA 4HCZA 1UGVA 4X9DA 2A36A 3QC8A 3ULRB 4PK4A 5GANf 3DKMA 2HDAA 4FW2A 3QBYA 2PUOB 5A0GA 4KT0E 1ZSZB 4E47A 3P8DA 3RR6A 1UGRB 2HKQB 4AFSC 3CMAQ 3MEUA 3M54A 3JB9F 3MKDA 1ZSZC 2DL3A 2E6NA 4HT8A 2EW3A 2MF2A 2DYIA 4M7DB 5LJ5e 3PT9A 5LL6S 4C5HA 3C0CA 4C5EA 1QVFA 4Q5WA 1LPLA 4M7DC 2D0NA 5CKEA 3JB9J 1Y96B 3RUXA 2LQ8A 4C92G 3HSBA 3OBWA 3LWIA 3VS0A 1M30A 4O5VA 2M0YA 3PVLA 4J9GA 3A5ZB 3RKWA 4M78E 3QIIA 1K73R 2YUOA 4IUTA 1OV3A 3CCLA 4ATOA 2PJHB 3H41A 2V26A 2LNHB 5KYYB 2Q1DX 5FTKA 4QQDA 4FW1A 4K11A 4OGCA 2LMJA 2IIMA 4CC3A 4A4EA 4C92E 1U1TA 2SEMA 1Y57A 2EYXA 2KT8A 2JTMA 3MB5A 2KE9A 4PJOA 1YIJQ 2JMCA 1QMCA 4BACA 1X75C 1TOVA 4BDZA 4IKFA 1M1FA 2QQBA 1CZ5A 1YCYA 2DK3A 3L42A 4F17A 2LT4A 4JJBA 1YITQ 2FRYA 1KD1R 4RTZA 5LJ5j 5DM7R 4HCKA 4A4HA 1MGQA 3GF5A 3QDFA 4M75G 1YNZA 2JTEA 2R58A 5C0MA 1H92A 1R0BG 2JVVA 2G6FX 4KGZB 2A37A 5KYUA 3VUZA 2HBWA 4C8QF 2OTJA 2Q1CX 2OAUA 2GQIA 1E6GA 1NYFA 2EQUA 3D7SB 4N4HA 2GFUA 1K9MR 2E3IA 3CC4Q 5CQYA 1I5OB 4II1A 3CMEQ 2DPPB 2I0NA 1K4US 3TSZA 2HEQA 1KFZA 1RAHB 1I8FA 2CREA 1VQOT 2LC4A 3CD6A 4M78D 2QI2A 4JDSA 3QXEB 2OTLT 2CZ1B 3H6ZA 3HU1A 4OB0B 2RHZA 1GBRA 2FZCB 4KH0B 4C92D 2XD0A 4PJLA 1IHVA 2CP3A 1BI2A 3ZJUA 3TU4K 1I5LA 1RACB 2PUKB 2WSEE 5DLQE 1YP5A 1O9SA 3OYIA 3HPWA 4E7LA 3FPRA 4AFZC 2LRQA 5GMKh 4ZNXA 3LGFA 1AT1B 2OTJQ 4PJJA 2LCSA 4QKUA 1X2QA 2KGTA 5DYIA 1JB0E 2DEQA 2RQRA 2QGGA 1N6AA 2VGNA 2A0FB 3I5RA 4LDYA 1LOJA 3DLLA 1M1KC 2CS7A 3ZGZA 3EH2A 1I81A 2AKKA 1H3HA 2GBQA 1TUDA 1TUCA 2YXYA 1RAEB 1KC8C 1N5ZA 3HU2A 4E7HA 1NZ9A 3EG0A 4BD3A 2HSEB 2LJ1A 1D1AA 1QVFS 4CI0C 2M0OA 2A3LA 1SF9A 2ZPGB 2HBPA 3M0QA 4C8QB 2EJFA 2QTVA 1IB8A 2X4WA 1YHQT 4C8QC 4F16A 2DNUA 2E5QA 2ATCB 3CCLT 3HFNA 2R5AA 3CPWS 1AHJB 1KSWA 4OMOA 1PSEA 3OQ5A 4QVZA 4N4IA 2LNVA 2VXEA 2LDMA 1MHNA 2KROA 2K4YA 1PHTA 4XU3A 5CK9A 3GBQA 3M4GA 1IZ6A 1O75A 2HCKA 4LD6A 1RL2A 5C6SA 2X4XA 4KGVB 1YJ9T 2E70A 2D6FA 2DM1A 4F14A 1UGPB 1S3SA 3CCMA 2BKDN 2PVGB 1RI9A 3EFOB 3S3NA 2RF0A 3URGA 2LJ3A 4HKEA 1B07A 2L3SA 5GAMh 2V1RA 3C95A 3GOXA 3S6WA 1ZQ1A 2H3JA 3VRYA 2CP2A 2P0QA 3JCMe 4KO8A 4M7AF 3JCMV 4X1VA 3CCRQ 4RV0A 1VYUA 4RKUE 4HVWA 3JCMc 1FX7A 3OMCA 1R8OB 1ZSZA 2K2VA 2QGFB 1VQ4T 1XQHA 3A8MB 4LE9A 1I1JA 3ZJVA 3NPFA 1CR5A 4J9IA 1N8RU 4C5IA 4M7DA 4OGEA 3RDVA 2RI5A 3WVEB 2PTKA 4MZPA 4MMLA 1TSFA 2DMOA 4PNOA 4EDUA 1ZC1A 1NJIR 2B25A 1PD0A 2V1QA 4IIOA 2QK0A 9ATCB 2XG8D 1KK7A 4PJOE 3PE0A 4KUDK 1OZ2A 3GLXA 1QVGP 5CKDA 3ER0A 1OX9A 2B86A 1U8RA 3OYHA 4L6V5 2QAZA 5KYYA 2LJ0A 2QXFA 1BCOA 3L2VA 1Q81R 3CCMQ 2DXCA 3CCJA 3EH1A 2QQRA 1OPKA 2V8KA 1M3CA 2LQWA 2XI9A 1G3TA
chains in the Genus database with same CATH topology
2VGMA 2E6ZA 5FRNA 4M75D 2L5QA 4C92F 2CGHA 3RKYA 5HK0A 3I55A 2QDYB 3QUIA 1JRIA 3E9GA 4F7UB 1QW1A 3FIFA 2WACA 1M90C 5EPPA 2XDBA 4BI8B 4M77E 4BY6B 1HXDA 3CC4A 2EIFA 3CCET 4V2SA 1YITT 5LJ5h 4Y28E 2DTIA 1EIFA 2G3RA 5HY6A 5HK3A 1WNLA 3CMEA 1GXIE 5GMKj 4BE2A 4BY6C 3V7CA 4B9WA 3OYFA 5EG2A 1FWZA 2JN0A 5GAN5 2PU9B 4BI3A 3CPWA 4EPCA 2HNIA 4L59A 1YJWA 1SSFA 5D6WA 1K9MU 4A53A 1P92A 2EJ9A 4PLIA 4DA4A 1VQLA 4RMOA 1QVGS 4M7DF 2QQSA 2LTOA 5HKCA 3OSSC 3QQ7A 2DKGA 3OYYA 5GLFA 2K5FA 3M57A 3MHXA 1QP2A 3G4ST 3CCVA 3GNGA 1YJNA 2O4XA 3QPHA 2LX9A 1B34B 3I55T 4MMKA 3M53A 1BI3A 4A54A 1UGQB 4N0AA 3M4YA 4XAXB 4DOWA 4ZN1A 1K73C 2PQWA 2D0QB 3LH0A 4QW2A 4JJNK 4IUUA 1S72T 4F7UG 2F5TX 1K8AC 2NLUA 4D6WA 3C94A 2ZZDA 3X20B 3CMET 4MDWA 2RA2A 4M7AB 2E10A 3OS1A 1VQPA 1BI0A 4GLKA 2E64A 4ZGJB 5IT9E 2JV2A 2RK2A 1UB4A 1X6OA 2MI6A 2RJDA 3VYHB 3UWNA 2MM2A 2DJZA 3CC7A 4OB2B 4XU1A 4M75F 2EJGA 2JOYA 3VUBA 4ZN3A 3J80E 2RJEA 4J83A 1WPYA 5DY9A 4A4GA 3FJPA 3CBOA 5GAMe 2KAFA 5GMKm 2B8AA 5GAN2 3ZEHA 5GAOq 2QTXA 4PJOD 3P8BB 4FSXA 5KE2A 2VC8A 3CBMA 2EAYA 3QZ9B 3CCVT 5GAN4 5CIUA 3EAEA 4ZTJA 3LGLA 2RD1A 5FU7B 2RO0A 5CCAA 3JCMg 1YJWT 2HQXA 2L89A 1VQOA 1VQ5A 5CVIA 3OYLA 2DAQA 3QG1A 1KD1C 4LDVA 2V8IA 2MAMA 5C18A 4M77A 3M58A 4BE1A 3LWHA 3MEAA 3L2RA 5FU7C 1DJ7B 1TH7A 2X4YA 2M16A 3GNFB 4NS5A 1W2BS 3CC2T 3NTKA 3OS2A 5GMKi 3FB9A 3BDLA 3QKJA 4XU2A 4C8QE 4NL3A 3J81E 2GF7A 3JAME 5KH6A 3V8KA 4EMKA 3QJ6A 1NJIU 3OYJA 3JB9D 1VQ8A 4DOVA 4M7AG 3CXCS 4A4FA 4XTVA 5GAN6 5GAMd 3JCMX 1VQNT 2EQJA 4RG8A 5KE3A 3JCMQ 3FC3A 5CKFA 1O54A 2FYKA 1M9SA 1M8VA 5CCXA 2JUFA 3JSCA 4Z02A 3OYCA 2EQMA 4BB7A 3OYKA 2L8DA 2WSCE 3C4SA 3X26B 5CCBA 1YBYA 2V8JA 4M77D 1UEBA 3CMAT 1VQLT 1M4ZA 3M59A 4RG2A 3OYDA 1K9MC 3LLRA 2YLCA 1VQ5T 5FTJA 1M5Q1 2RK1A 1KQ1A 3HU3A 3BDUA 1WJQA 4JLGA 4TVRA 2RHYA 3NFCA 3JCMJ 5C1BA 3RKXA 5AYFA 4RCCA 1NPRA 1Y96A 4R56A 3AHUA 2K3XA 1ZHIA 4FU6A 4NL2A 5CKBA 2LQKA 4XTUA 3V8JA 4IUVA 5I2SA 1OI1A 3OYNA 4J8OA 3JCMW 1G3YA 3QYHB 1VQ6A 1X01A 4PJOF 3EFSA 2LT1A 4CRIA 3PIPA 5LJ3f 4FT4A 1VQ8T 4XU0A 5J39A 4C92B 4HCZA 3GPLA 4ZTFA 2LW6A 3VU3C 4KBMB 1N27A 4X9DA 3I56T 2KMTA 4OF1A 4BDYA 3UT1A 5GANf 3OYMA 1Q7YU 3DKMA 3QC8A 2ZPFB 4C92C 1QCSA 2LVMA 4P5NA 3PFSA 2PUOB 3QBYA 5A0GA 3TIWA 2CZ0B 4KT0E 2P0KA 5CQXA 4E47A 3P8DA 2GQVA 5GAOm 2XHCA 1UGRB 2VXFA 3MEUA 4C0DB 2PVDB 4E7KA 3M54A 3JB9F 5ERGB 2E6NA 4HT8A 2MF2A 2YUJA 3CCSA 2GCXA 5CD1A 4M7DB 5LJ5e 3GIBA 4C0DC 3PT9A 3HP9A 5LL6S 4C5HA 4C8QA 3M9QA 5M9OA 3CEYA 4C5EA 1YIJT 1QVFA 2KY9A 3BW1A 4M77F 4Q5WA 1PSFA 4R55A 3PTAA 1LNXA 5CKEA 3JCMP 1Y96B 2XDPA 3JB9J 4M7DC 2XDDA 5FTNA 3RUXA 2DXTA 2LQ8A 4C92G 1VQ7A 2DIQA 5GAN8 4UC4A 3HSBA 1U1SA 3OBWA 3LWIA 5J3BA 4J6YA 2RHUA 3FPTA 4O5VA 3QZ5B 3SB2A 1QVGA 3A5ZB 3RKWA 1H641 4NOYA 2IVWA 4M78E 3QIIA 4C8QD 4N4GA 1V29B 3CCJT 4IUTA 3LW5E 2DXUA 2XKOC 1N8RC 4M75B 3CCLA 4ATOA 5I21A 3KXTA 2PJHB 3JCMb 5LJ5d 3CCST 3HKSA 2FVUA 2Q1DX 4JRKA 2JZ2A 2ZPIB 3HFOA 5FTKA 4QQDA 3PMTA 1WQ7A 3QYGB 4OGCA 4M75C 4X34A 2YRVA 1KQSS 5LJ3h 1Q86U 4M7DG 4A4EA 4C92E 3CCRA 1U1TA 4J6WA 3WVDB 3OYGA 3CF2A 2JTMA 4YTLA 3MB5A 5GANh 4PJOA 3LYIA 3FEOA 4C0FA 5FTMA 1D3BA 4RCBA 3CC4T 4LDXA 4BACA 5B6CA 4E7IA 1WGSA 1X75C 3OMGA 4MZTA 4BDZA 4J5YA 2Q18X 3OS5A 3V7SA 4IKFA 5GAMg 1M1FA 2QQBA 2E41A 2RHXA 3CCQA 1BKBA 1YCYA 2MMPA 2X35A 1CZ5A 2DK3A 2DTHA 2FB7A 2LT4A 3L42A 5L8RE 2P4TA 3JCMf 2PVOB 4HCBA 2XK0A 3QHSA 2I2LA 5LJ5j 2XICA 5DM7R 4A4HA 1I9GA 1MGQA 2R5MA 4KULA 5GAOl 3GF5A 1WJRA 4M75G 5A0LA 3E9FA 1WLFA 3LX7A 2R58A 5C0MA 4FIBA 1VQKA 4ZGDB 2Q19X 1YJNT 1KHIA 2JVVA 4M7AC 2QQAA 3T9NA 2QA4A 2A7YA 4PKCC 2CYZB 4F7UE 2QQ9A 3VUZA 5GAN7 1Q82U 4C8QF 2OTJA 5KCHA 2Q1CX 2DZCA 1QVPA 2GFAA 2OAUA 4LDUA 2OTLA 1VIEA 3M5AA 2EQUA 2O4XB 2E65A 3MO8A 2VV5A 2KK4A 4N4HA 2GFUA 3VJPA 2K5IA 1OZ3A 1VQPT 1VQNA 4M78A 3CCQT 4PJOB 5CQYA 2JNGA 3QWZA 5GAN3 4ARIA 1M1KU 4KDLA 4FT2A 4II1A 4JLIA 3CC7T 2DPPB 4N0AC 2MWPA 2M1HA 4BI4A 4PJOC 3OBYA 3MEVA 4J6XA 2YHTA 4Y91A 3QQ8A 1Y71A 3UPUA 5A2QE 5EQJB 4XTXA 4ME7A 3JB9H 3BFMA 3MP6A 2DD5A 5J26A 3LGAA 3HHTB 3P8HA 1I8FA 1KC8U 3R6OA 1IREB 2RI3A 1VQOT 3INZA 2LC4A 3SWNA 2BIVA 3TEEA 1Q81U 2CZ7B 3CD6A 4KODA 4M78D 3OA6A 1M90U 2OTJT 2QI2A 3A8OB 4JDSA 2EKOA 3QXEB 2OTLT 2CZ1B 4MZMA 4B9XA 2YLBA 4BE0A 3H6ZA 2Y4XA 3BY7A 3PNWC 3HU1A 4JRIA 5DYGA 4M7AE 4KDIA 2PWYA 4OB0B 2RHZA 3SFMA 3JB9I 4M77B 1QP3A 1YI2A 2DIGA 3JCMh 1KG1A 3OSVA 4PJOG 4C92D 3G71A 2XD0A 3BQBA 4MDXA 3A8GB 3DB3A 2D9TA 4O6JA 4M77C 4ARCA 5KCOA 1BI2A 2ZPBB 2RH2A 4EMKB 1JBMA 3ZJUA 3TU4K 3OY9A 3HRSA 1I5LA 2DO3A 3G7ZA 2EWNA 2KDSA 3SDZA 4HA8A 5GMKl 2PUKB 3KUFA 2WSEE 3ME9A 3L2WA 2KVQG 5DLQE 4EMKC 4F7UA 5LJ5g 3OW2A 2IG0A 1K73U 1O9SA 3OYIA 3CD6T 2YVLA 3HPWA 4E7LA 3FPRA 3S3MA 1VQMA 3META 4VUBA 3ZFJA 1K8AU 2LRQA 5GMKh 2DD4A 3N5BB 4JS4A 3JB9G 1BYMA 3LGFA 4BUGA 1VQ6T 1YI2T 1G3SA 5GAOr 3CCEA 3FLGA 5DYIA 1JB0E 2DEQA 3KBGA 3NTHA 2K5LA 3G71T 4XTWA 1NE8A 2DZ9A 1N6AA 4M77G 2VGNA 3CPFA 4ZGEB 5DLOA 2LCCA 2VUBA 1NJIC 2VYTA 4M78F 4LDYA 3DLLA 1LOJA 1BIAA 3QO3A 1M1KC 1I4K1 2CS7A 5FU6B 4OB3B 3L2ZA 2QEXA 3OYBA 1YHQA 3ZGZA 3Q1JA 1JJ2S 1B34A 1I81A 5LJ3e 2DVEA 1R7RA 2XU8A 3WXMB 3ZBDA 4LDWA 5FU6C 2K3YA 4C0ZA 1KD1U 5GANe 1KC8C 3G4SA 5FRMA 3HU2A 2E1HA 4PL6A 3MP1A 4ELZC 1Q81C 4E7HA 1NZ9A 4FL6A 4BD3A 2RHIA 4M7AA 3E19A 5GAMf 3V8LA 1HK9A 1QVFS 4CI0C 1S72A 2M0OA 2A3LA 2ZPGB 1WJSA 2HBPA 2M9UA 4C8QB 2P0PA 1VQ7T 5D6XA 2EJFA 2X4WA 2AHJB 2ZPEB 1BI1A 3ZJTA 1UGSB 3RIRA 2QEXT 4E7JA 1YHQT 4QQ6A 5LJ3d 1YJ9A 2DXBA 4C8QC 1Q7YC 1KHCA 1N9RA 2EYQA 5GAOn 3V7RA 1N9SA 2ZCFB 1XTDA 2E5QA 5GANd 4M7AD 2R57A 1XNIA 3CCLT 3HFNA 2RM4A 2R5AA 3CPWS 1AHJB 1FXXA 2FL7A 3MEWA 4OB1B 4L5GA 1VQ9A 4M7DE 1G3WA 4X9CA 1PSEA 3L1AA 4F7UF 3OYEA 3OQ5A 4QVZA 2LNVA 2VXEA 3OB9A 4N4IA 5I2MA 3EFRA 2LDMA 3VV0A 3OS0A 1MHNA 4EMGA 3CCRT 1W2BA 1CZ4A 4AQ7A 3HRTA 2K4YA 3VKIA 1KQ2A 4XU3A 5CK9A 3M4GA 1IZ6A 3CC2A 2KQWA 4XTZA 3NTIA 1O75A 1Y7XA 5CAIA 3DLMA 4LD6A 4LD9K 3CXCA 1RL2A 5C6SA 1VIFA 1E32A 3RMSA 3MCAB 3A8HB 5FROA 2X4XA 5LJ3j 3TCJA 4C8QG 3CCUA 1YJ9T 2E70A 4A4KA 2RJCA 3L2QA 2D6FA 5GAOp 2Y4YA 3DB4A 3GP8A 1VQ4A 4WF2A 1QDNA 4AS1A 5GANj 2ZPHB 1UGPB 1D3BB 3HRUA 3X24B 4XK8E 1S3SA 4IUQA 3M56A 4KUIA 5IN1A 4M75E 3CMAA 3CCMA 3SD4A 2C06A 2BKDN 1VQ9T 1W4SA 1H3ZA 2PVGB 3E1SA 4HCCA 3RMQA 3S3NA 1VQKT 4IUPA 3URGA 4HKEA 3TREA 1G5VA 5GAMh 4J7IA 4C92A 3C95A 3HL8A 1Y07A 2EQKA 3GOXA 2QA4T 3S6WA 1ZQ1A 2H3JA 4OVAA 2P0QA 3JCMe 5IAYA 4KO8A 3F70A 2E12A 2HQEA 4M7AF 3C12A 4XQ3A 2F5KA 3JCMV 1Q86C 3G6EA 3OYAA 5FTLA 4RV0A 3CBPA 4PLLA 2L3RA 4RKUE 3CCUT 3JCMc 1FX7A 3OMCA 1R8OB 1VUBA 2K2VA 3I56A 1VQ4T 4EMHA 2O01E 1XQHA 3A8MB 4FM4B 3PIOA 4QQGA 4JS5A 4JUVA 5CO7A 3RESA 2RJFA 4IURA 3ZJVA 2CZ6B 1CR5A 5LJ5f 2MM0A 3UDCA 3CCMT 2EFIA 1N8RU 4C5IA 2FHDA 4M7DA 3PGGA 2ZGWA 4M78B 4OGEA 5GMKe 4OMFB 3FDRA 1NPPA 2RI5A 3JRZA 3VYGA 3WVEB 2XIDA 2HAXA 3JCMd 4JRPA 3M55A 4JRQA 4M78C 3PMIA 3FPUA 2JTFA 4MZPA 4OP0A 4MMLA 2LCLA 2Y90A 4PNOA 2KSSA 3G6ET 4EDUA 3J7AF 1ZC1A 2Q1AX 2RI2A 3FRNA 3O8VA 3MP8A 1YIJA 2B25A 4KLNA 4ELYC 5GAMj 3QDRB 1WQWA 1Q82C 2K57A 2XG8D 3SWNB 3X25B 5FLXE 4M7DD 3H8ZA 1ZBXA 4PJOE 5CKHA 1OZ2A 3A8LB 1BIBA 3GLXA 4XTYA 4C0GA 4KUDK 2HD0A 5CKDA 2F69A 3ER0A 3LHDA 4QVDA 4M75A 1YITA 1JJ2A 2RB6A 3SWNC 1U8RA 5D6YA 3OYHA 4L6V5 3L2UA 2MWOA 2WSFE 1M1GA 3ASKA 4GY5A 2QXFA 1LJOA 5LJ3g 3L2VA 1OYXA 2BUDA 2DXCA 2DTOA 3CCJA 2QQRA 3QJYA 5GANg 4CQNA 4M78G 3RERA 2V8KA 4HT9A 1RI0A 2X4JA 5CR2A 1KQSA 3X28B 2XI9A 3S3OA 5A0DA 4DQ2A 1G3TA 4J7FA 1XOVA 1VQMT 3QSUA 2CKKA 3OW2S 4QVCA 4C5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FRN A;  1N27 A;  2M1H A;  2MWP A;  3MEW A;  3MEV A;  3E9G A;  4BDY A;  3UT1 A;  3OYM A;  2WAC A;  3OYE A;  3OQ5 A;  2LVM A;  4QVZ A;  3MP6 A;  4N4I A;  3OB9 A;  5J26 A;  3OS0 A;  2LDM A;  3P8H A;  1MHN A;  3PFS A;  3QBY A;  2G3R A;  2P0K A;  2RI3 A;  4BE2 A;  3P8D A;  2BIV A;  3NTI A;  4B9W A;  3OYF A;  3OA6 A;  3DLM A;  4LD6 A;  3MEU A;  5C6S A;  4E7K A;  2EKO A;  5FRO A;  4L59 A;  2X4X A;  2E6N A;  4B9X A;  1SSF A;  5D6W A;  4BE0 A;  3H6Z A;  2RJC A;  3L2Q A;  3PNW C;  3DB4 A;  4PLI A;  4C5H A;  2QQS A;  2LTO A;  3M9Q A;  5M9O A;  2RHZ A;  3CEY A;  4C5E A;  4IUQ A;  2DIG A;  4Q5W A;  5IN1 A;  3SD4 A;  2O4X A;  2XDP A;  2BKD N;  3DB3 A;  2D9T A;  1H3Z A;  5KCO A;  2PQW A;  3LH0 A;  4QW2 A;  3S3N A;  2DIQ A;  4IUP A;  4UC4 A;  1G5V A;  3OY9 A;  4IUU A;  2RHU A;  2EQK A;  3GOX A;  2NLU A;  3S6W A;  4OVA A;  3KUF A;  3ME9 A;  3L2W A;  5IAY A;  3F70 A;  3OS1 A;  2IG0 A;  2HQE A;  3QII A;  4N4G A;  3OYI A;  2F5K A;  3OYA A;  4E7L A;  4IUT A;  3S3M A;  3MET A;  2RJD A;  4PLL A;  3UWN A;  2L3R A;  2LRQ A;  3OMC A;  2RJE A;  4A4G A;  2JZ2 A;  3LGF A;  2B8A A;  3PMT A;  4QQD A;  3ZEH A;  4QQG A;  4X34 A;  2YRV A;  2RJF A;  4IUR A;  5KE2 A;  4A4E A;  2EFI A;  3FLG A;  4C5I A;  3NTH A;  5CIU A;  3EAE A;  4ZTJ A;  3OYG A;  3LGL A;  2FHD A;  2RO0 A;  2HQX A;  2L89 A;  2LCC A;  3LYI A;  3FEO A;  3OYL A;  2DAQ A;  2VYT A;  3FDR A;  2RI5 A;  4BAC A;  4BE1 A;  4E7I A;  1WGS A;  3MEA A;  3OMG A;  3L2R A;  4BDZ A;  3OYB A;  2X4Y A;  2M16 A;  3PMI A;  3Q1J A;  2JTF A;  4NS5 A;  3NTK A;  3OS2 A;  4IKF A;  3BDL A;  3QKJ A;  2RHX A;  2X35 A;  2GF7 A;  5KH6 A;  3L42 A;  4EDU A;  2K3Y A;  3QJ6 A;  2RI2 A;  3O8V A;  3MP8 A;  3OYJ A;  4A4F A;  5FRM A;  2XK0 A;  4PL6 A;  2EQJ A;  3MP1 A;  4A4H A;  5KE3 A;  3FC3 A;  2R5M A;  4E7H A;  4BD3 A;  4FL6 A;  4Z02 A;  2RHI A;  1WJR A;  3H8Z A;  3OYC A;  1OZ2 A;  2EQM A;  3E9F A;  2L8D A;  3LX7 A;  3OYK A;  3C4S A;  2R58 A;  5C0M A;  4RG2 A;  3OYD A;  2M0O A;  3LLR A;  5D6Y A;  3OYH A;  3L2U A;  1WJS A;  2MWO A;  4GY5 A;  3ASK A;  5D6X A;  3L2V A;  1WJQ A;  1OYX A;  2BUD A;  2RHY A;  2X4W A;  5KCH A;  2GFA A;  2QQR A;  4E7J A;  2EQU A;  4QQ6 A;  2O4X B;  2K3X A;  3MO8 A;  1RI0 A;  1KHC A;  4FU6 A;  4N4H A;  2GFU A;  3OYN A;  1OZ3 A;  4IUV A;  1OI1 A;  3S3O A;  2E5Q A;  2R57 A;  4CRI A;  2CKK A;  1XNI A;  4II1 A;  5J39 A;  2R5A A;  4ZTF A;  4HCZ A;  4C5G A; 
#chains in the Genus database with same CATH topology
 1YN8 A;  3VS7 A;  2WAC A;  5EPP A;  1NEG A;  4M77 E;  1MMD A;  4HVU A;  1RAF B;  2EIF A;  3CQT A;  4V2S A;  5LJ5 h;  4Y28 E;  2G3R A;  2F2V A;  3OYF A;  5EG2 A;  4BI3 A;  1VQL A;  1CSK A;  2LTO A;  3QQ7 A;  2KXC A;  5IXF A;  3MHX A;  3CCV A;  2K79 A;  4A54 A;  1QKX A;  3M4Y A;  4XAX B;  2PQW A;  3LH0 A;  4J9H A;  3C94 A;  2GTO A;  4MDW A;  1V1C A;  2RA2 A;  4KRT A;  4M7A B;  3OS1 A;  4PJM A;  1OQK A;  1SRM A;  5IT9 E;  2RK2 A;  3NMZ C;  1UB4 A;  2MI6 A;  4OB2 B;  4M7A C;  3VUB A;  2RJE A;  1WPY A;  5GMK m;  2KAF A;  2AZV A;  2H3E B;  2QEX Q;  4PJO D;  2FEI A;  4FSX A;  3R6N A;  3EG3 A;  4AT1 B;  1K9A A;  5FTL A;  2L89 A;  5CVI A;  2DAQ A;  2V8I A;  2JM8 A;  3M58 A;  3L2R A;  3LH5 A;  1DJ7 B;  2F2X A;  4NS5 A;  4XU2 A;  4NL3 A;  1HD3 A;  5KH6 A;  1WLP B;  1M8M A;  2YUN A;  1VQ8 A;  1E6H A;  2P4R A;  4XTV A;  5GAM d;  1VQN T;  1M27 C;  5KE3 A;  1EFN A;  4Z02 A;  5KYX B;  2E5K A;  2KEA A;  2L3Q A;  2SRC A;  3OYK A;  3C4S A;  4M77 D;  3OW2 P;  1M4Z A;  3M59 A;  3OYD A;  1VQL Q;  4ANJ A;  2YLC A;  2OI3 A;  1D09 B;  3BDU A;  4JLG A;  2RHY A;  1U5S A;  3CCV Q;  5GJW B;  4RCC A;  3AHU A;  2KYB A;  4FU6 A;  4NL2 A;  4RUG A;  2LQK A;  3JCM W;  4IUV A;  1U06 A;  1OI1 A;  1WHL A;  4J8O A;  2BE7 D;  2DER A;  3EGU A;  1VQ6 A;  1X01 A;  3EFS A;  4ZTF A;  3GPL A;  2RPN A;  2ED1 A;  2JS2 A;  1Q7Y U;  2K7A A;  2ZPF B;  1QCS A;  2LVM A;  1PM3 A;  4P5N A;  2CT4 A;  3PFS A;  1T0J A;  2ENM A;  2CP5 A;  2J6K A;  2VXF A;  2DRM A;  4C0D B;  1M90 R;  4JPB W;  1PD1 A;  3VRZ A;  1JO8 A;  3VS4 A;  2GCX A;  2NUT B;  4C0D C;  1TTH B;  4C8Q A;  2KY9 A;  3BW1 A;  3JCM P;  2O31 A;  2XDD A;  2DXT A;  5IHN A;  2DIQ A;  1VQ8 Q;  5AT1 B;  1U1S A;  1LCK A;  2DRK A;  3FPT A;  3QZ5 B;  1QVG A;  1H64 1;  1D1C A;  3CCJ T;  1W1F A;  1N8R C;  2CSQ A;  2XKO C;  4FYV B;  3KXT A;  5LJ5 d;  3CCS T;  2DYB A;  1W2B P;  1UFF A;  1WQ7 A;  1Z9Z A;  3QYG B;  1EX4 A;  1FYN A;  3NGP A;  2DF6 A;  1Q86 U;  4M7D G;  3G1J A;  3FEO A;  5FTM A;  4AG1 C;  2RNA A;  1WGS A;  2LP5 A;  4LN2 A;  2RHX A;  3EFO A;  1B3Q A;  2DTH A;  2IPO B;  2XK0 A;  3QHS A;  2XIC A;  1BCM A;  1T3L A;  1NM7 A;  3E9F A;  1J3T A;  3LX7 A;  1VQK A;  2C0O A;  4ZGD B;  1UJY A;  2Q19 X;  2QQA A;  4E7S A;  2QA4 A;  4F7U E;  5GAN 7;  1Q82 U;  1QVP A;  4LDU A;  4AG2 C;  3I55 Q;  2OTL A;  2O4X B;  2E65 A;  5IHI A;  2DJQ A;  1LVK A;  3CCQ T;  2JNG A;  3QWZ A;  4ARI A;  1M1K U;  2FPF A;  4BI4 A;  2ROT A;  1I07 A;  5A2Q E;  3BFM A;  1YJW Q;  3LGA A;  3P8H A;  3QWX X;  1KC8 U;  3R6O A;  1IRE B;  2RI3 A;  3H9N A;  1WHJ A;  1VYV A;  1MUZ A;  2OAW A;  4FYY B;  2Y4X A;  3PNW C;  5DYG A;  4JRI A;  3JB9 I;  1IO6 A;  2DIG A;  3JCM h;  1KG1 A;  2HL3 A;  1GCQ A;  4KH1 B;  3BQB A;  4MDX A;  2BTT A;  1GFC A;  2RH2 A;  4EMK B;  3A98 A;  3OY9 A;  2DO3 A;  1KQS P;  3G7Z A;  2EWN A;  3SDZ A;  5GMK l;  3KUF A;  2KVQ G;  4EMK C;  3OW2 A;  1K73 U;  1ARK A;  2YVL A;  1VQM A;  1VQO Q;  3N5B B;  4JS4 A;  3JB9 G;  1MV3 A;  1ZX6 A;  2YT6 A;  4PFO A;  1VQ6 T;  2OTL Q;  2E3H A;  1YI2 T;  2ED0 A;  3CCE A;  1PKS A;  3FLG A;  1MMA A;  2K5L A;  2DZ9 A;  5DLO A;  3CPF A;  3IQL A;  4M78 F;  3QO3 A;  2DIL A;  1I4K 1;  2YRD A;  1YHQ A;  3OYB A;  1JJ2 S;  2FPD A;  2DVE A;  1SHG A;  1C1A A;  3ZBD A;  4LDW A;  1KD1 U;  3G4S A;  1JEG A;  2E1H A;  4PL6 A;  3MP1 A;  4M7A A;  2K3B A;  2RHI A;  5GAM f;  3V8L A;  3EGD B;  1HK9 A;  1S72 A;  1AZE A;  2K9G A;  2P0P A;  1PNJ A;  2W0Z A;  2ZPE B;  4GBQ A;  1S1N A;  1YJ9 A;  1Q7Y C;  1N9R A;  2EYQ A;  1PWT A;  2ZCF B;  1C0M A;  2RM4 A;  2DBM A;  1HSQ A;  1AOJ A;  3MEW A;  4OB1 B;  4L5G A;  1G3W A;  1SKU B;  4X9C A;  7AT1 B;  3L1A A;  3OYE A;  5I2M A;  1QKW A;  3VV0 A;  1W2B A;  1YWP A;  1WHG A;  1CZ4 A;  4J9F A;  3VKI A;  1KQ2 A;  1WIE A;  3CC2 A;  2KQW A;  4XTZ A;  5CAI A;  4ORZ A;  5KYX A;  2ECZ A;  4LD9 K;  2EYW A;  5FRO A;  4C8Q G;  4DBH A;  2RJC A;  3GP8 A;  1VQ4 A;  1NG2 A;  2ZPH B;  3HRU A;  1D3B B;  3EG9 B;  1UE9 A;  4XK8 E;  2HKN A;  5IN1 A;  4M75 E;  3SD4 A;  2C06 A;  2HQH A;  1TG0 A;  2PZ1 A;  3E1S A;  3CCL Q;  1VQK T;  1ZBJ A;  1G5V A;  1Y07 A;  2QA4 T;  1NYG A;  5FWC A;  1Q86 C;  2L3R A;  3CCU T;  3I56 A;  4EMH A;  2DE0 X;  2O01 E;  4FM4 B;  3PIO A;  3VS1 A;  4JUV A;  5CO7 A;  3RES A;  2RJF A;  4IUR A;  1YJ9 Q;  5LJ5 f;  4DBR A;  2NUT A;  2ZGW A;  4M78 B;  2K2M A;  2X9H A;  2XID A;  3JCM d;  4JRP A;  3M55 A;  2NWM A;  4M78 C;  4JRQ A;  2JTF A;  4OP0 A;  4B6M A;  2LCL A;  4JZ3 A;  2KSS A;  3G6E T;  1PRM C;  1QCN A;  2RI2 A;  3FRN A;  3M0R A;  1ZA1 B;  3MP8 A;  2EGA A;  4ELY C;  1X27 A;  4PFZ A;  2CP6 A;  1IXD A;  1Q82 C;  2K57 A;  3SWN B;  4XTY A;  4C0G A;  3LHD A;  2RB6 A;  1D0Z A;  3SWN C;  5D6Y A;  1VQ4 Q;  3L2U A;  1Y0M A;  5LJ3 g;  1M1G A;  2WSF E;  8ATC B;  1TUG B;  2BUD A;  2D1X A;  3QJY A;  5GAN g;  4IIM A;  4HT9 A;  1RI0 A;  4OML A;  1KQS A;  3S3O A;  4DQ2 A;  1XOV A;  4JJD A;  1VQM T;  3OW2 S;  2DL8 A;  4BE1 A;  2VGM A;  5FRN A;  4M75 D;  2L5Q A;  1D1B A;  1B7T A;  2QDY B;  3CD6 Q;  2MPX C;  4BI8 B;  3CCE T;  1YIT T;  1AVZ C;  1RAA B;  1WHH A;  2DBK A;  5HY6 A;  4BE2 A;  1ZSG A;  1FWZ A;  5GAN 5;  2PU9 B;  2OJ2 A;  3VS2 A;  4Y92 A;  4L59 A;  3AT1 B;  1SSF A;  1RAG B;  4A53 A;  2EJ9 A;  4RMO A;  1QLY A;  3OSS C;  2DKG A;  3OYY A;  1OPL A;  4EIK A;  1QP2 A;  1WX6 A;  3G4S T;  2FPE A;  2O4X A;  1YJN A;  4MMK A;  1NLO C;  1BI3 A;  1K73 C;  4ZN1 A;  2HMA A;  2D0Q B;  1UHC A;  1S72 T;  2NLU A;  4D6W A;  2ZZD A;  3CME T;  1VQP A;  1BI0 A;  2E64 A;  2JV2 A;  1X6O A;  2FZK B;  3UWN A;  2DJZ A;  3CC7 A;  1VQN A;  2MM2 A;  2JOY A;  4J9D A;  3FJP A;  3CBM A;  1C6V X;  5CIU A;  3EAE A;  1X6G A;  5CCA A;  5IXB A;  2HQX A;  3OYL A;  1KD1 C;  5C18 A;  4LDV A;  3EHR A;  4ESR A;  3MEA A;  1TH7 A;  2X4Y A;  1W2B S;  3CC2 T;  3NTK A;  3OS2 A;  5GMK i;  1QCF A;  4RTY A;  1ZA2 B;  4EMK A;  3QJ6 A;  1NJI U;  1IHW A;  4OMQ A;  4M7A G;  1PG5 B;  2O9S A;  4OMN A;  1M8V A;  2NUZ A;  2EQM A;  2L8D A;  1UEB A;  4RG2 A;  1FMW A;  1K9M C;  1IRX A;  1VQ5 T;  1GCP A;  1KQ1 A;  3O5Z A;  3HU3 A;  3JCM J;  2Z0W A;  1HJD A;  5AYF A;  1Y96 A;  4R56 A;  4FCY A;  2K3X A;  2DL7 A;  1K1Z A;  1SSH A;  5CKB A;  4XTU A;  3OYN A;  1MNE A;  4PJO F;  2LW6 A;  4FT4 A;  4XU0 A;  3VU3 C;  3I56 T;  2KMT A;  4BDY A;  3M0T A;  3OYM A;  6AT1 B;  1X2K A;  2XHC A;  1YCS B;  3EGD A;  3CCS A;  5CD1 A;  3GIB A;  3HP9 A;  3M9Q A;  4AFQ C;  1RAI B;  4M77 F;  1PSF A;  1OU8 A;  1W70 A;  5FTN A;  2GNC A;  1G83 A;  4WCI A;  1VQ7 A;  1E7O A;  5GAN 8;  3UA6 A;  1K0S A;  2J05 A;  4N4G A;  3LW5 E;  2DXU A;  2NUP B;  2VWF A;  3JCM b;  1K8A R;  1BB9 A;  4JRK A;  2JZ2 A;  1EZZ B;  3HFO A;  1JXO A;  1UDL A;  5HCK A;  2YRV A;  3SEM A;  1KQS S;  2GGR A;  2BZX A;  4J6W A;  3OYG A;  3CF2 A;  4C0F A;  3I5S A;  1D3B A;  3EG9 A;  1YWO A;  4E7I A;  5B6C A;  5GJV B;  4MZT A;  4J5Y A;  3OS5 A;  1OEB A;  1UJ0 A;  3V7S A;  4HVV A;  3CCQ A;  2X35 A;  4RTT A;  2NYS A;  3JCM f;  2PVO B;  2DEU A;  4HCB A;  2KNB B;  1I9G A;  2DFU A;  2YDL A;  5GAO l;  2R5M A;  1WJR A;  3CCJ Q;  1WLF A;  4FIB A;  3CCS Q;  1YJN T;  1KHI A;  2CH4 W;  4OMP A;  3T9N A;  1M3B A;  2MOX A;  5KCH A;  2GFA A;  2FZG B;  3M5A A;  3MO8 A;  4E2F B;  2VV5 A;  1VYT A;  2K5I A;  4AFU C;  1OZ3 A;  2DL4 A;  1VQP T;  4M78 A;  4PJO B;  5GAN 3;  4FT2 A;  3CC7 T;  1R77 A;  2M1H A;  4PJO C;  4CC7 A;  3MEV A;  4J6X A;  1M3A A;  2YHT A;  4Y91 A;  4FSS A;  1Y71 A;  3UPU A;  5EQJ B;  1UTI A;  1NLP C;  2DD5 A;  1TXQ A;  1F1B B;  2EKH A;  3HHT B;  1OUL A;  3SWN A;  3TEE A;  2BIV A;  1SHF A;  3OA6 A;  1M90 U;  2O88 A;  2JJ9 A;  2EKO A;  4MZM A;  4B9X A;  4BE0 A;  2MYS A;  1UHF A;  2RMO A;  3BY7 A;  4KDI A;  2XMF A;  3SFM A;  4M77 B;  2X51 A;  3THK A;  1YI2 A;  3OSV A;  2H8H A;  3A8G B;  3DB3 A;  2D9T A;  4O6J A;  4M77 C;  3CCQ Q;  2X3W D;  5KCO A;  1ZUK A;  1JBM A;  3HRS A;  4HA8 A;  2LZ6 B;  3ME9 A;  3L2W A;  1Z9Q A;  2IG0 A;  8AT1 B;  2ESW A;  4D8D A;  3S3M A;  3MET A;  3E2U A;  1BYM A;  1G3S A;  2EYZ A;  3NTH A;  2OX7 A;  3G71 T;  2ABL A;  4XTW A;  1NE8 A;  3CPW P;  2LCC A;  2VUB A;  1NJI C;  2DET A;  1BIA A;  5EC7 A;  3Q1J A;  5LJ3 e;  3WXM B;  1MMG A;  1SRL A;  4C0Z A;  1SPK A;  5GAN e;  3BE3 A;  2O2O A;  5FRM A;  4J9B A;  5FWB A;  1Q81 C;  4FL6 A;  3E19 A;  1AWW A;  1WXB A;  1VQ6 Q;  1VQ7 T;  5D6X A;  3VS6 A;  1YI2 Q;  1BI1 A;  3EGX B;  3ZJT A;  2CSI A;  4E7J A;  2QEX T;  1KJW A;  1VA7 A;  4QQ6 A;  2DXB A;  1KHC A;  1CKB A;  1CKA A;  2A08 A;  1AWO A;  1N9S A;  1QQJ A;  1XTD A;  2QAS A;  1WI7 A;  2R57 A;  2W10 A;  2KRN A;  4M7D E;  1MMN A;  2ZAE A;  4F7U F;  1QCO A;  2YRC A;  3EFR A;  1WXT A;  3HRT A;  2YSQ A;  5IH2 A;  5ECA A;  3DLM A;  1TU0 B;  1VIF A;  1WHM A;  3RMS A;  1AZG B;  5LJ3 j;  3TCJ A;  3CCU A;  4A4K A;  3L2Q A;  1QDN A;  3DB4 A;  4AS1 A;  5GAN j;  1PRL C;  4KUI A;  3M56 A;  3CMA A;  1UEC A;  1VQ9 T;  1W4S A;  4E6R A;  1I0C A;  1H3Z A;  4GLM A;  4HCC A;  3QWY A;  3RMQ A;  4IUP A;  4J7I A;  2EQK A;  4LXC A;  2COY A;  2CUD A;  4CC2 A;  3EHQ A;  2HQE A;  3G6E A;  3OYA A;  5KYN A;  2YUQ A;  4DBF A;  2CT3 A;  4DEY A;  4JS5 A;  3UDC A;  2EFI A;  4OMF B;  1NPP A;  1U3O A;  4Z88 A;  2HAX A;  3PMI A;  3FPU A;  2JXB A;  1VQK Q;  3J7A F;  2Q1A X;  1YIJ A;  2QA4 Q;  4KLN A;  1M1K R;  3UA7 A;  5GAM j;  3QDR B;  2CH4 A;  5FLX E;  4M7D D;  3H8Z A;  1NBE B;  1BIB A;  2HD0 A;  1WYX A;  2L0A A;  3CCU Q;  1AWX A;  4QVD A;  2NUP A;  1YIT A;  1IGU A;  2L3P A;  1KC8 R;  1JXM A;  2MWO A;  1BU1 A;  3KFV A;  1OYX A;  2LQN A;  2EYY A;  2DTO A;  2KI7 A;  4E7Z A;  4M78 G;  5L23 A;  3RER A;  2CP7 A;  5CR2 A;  5A0D A;  4J7F A;  1PCX A;  2CKK A;  4QVC A;  4C92 F;  5HK0 A;  3RKY A;  3E9G A;  4F7U B;  3FIF A;  1M90 C;  3G6E Q;  1WXU A;  3FJ5 A;  4BY6 B;  1HXD A;  3CC4 A;  2DTI A;  5HK3 A;  3CME A;  1GXI E;  4BY6 C;  2JN0 A;  3CPW A;  2HNI A;  1PC0 A;  5D6W A;  2DVJ A;  1K9M U;  3UAT A;  4DA4 A;  1QVG S;  2COW A;  1XJW B;  2QQS A;  5HKC A;  5GLF A;  1SEM A;  2LX9 A;  1B34 B;  3I55 T;  2RQW A;  4JJC A;  1VQM Q;  1V76 A;  4QW2 A;  4JJN K;  1H8K A;  2E10 A;  1QWF A;  1OOT A;  3CCE Q;  4ZGJ B;  2RJD A;  4DBQ A;  1YJW T;  4M75 F;  4AQ7 A;  3J80 E;  5DY9 A;  4J83 A;  2QTX A;  1YHQ Q;  3TQ7 P;  1KIK A;  3P8B B;  4F04 B;  5KE2 A;  2EAY A;  5GAN 4;  4ZTJ A;  2DL5 A;  3LGL A;  1FMK A;  2RD1 A;  1VQ5 A;  2RO0 A;  2MAM A;  4M77 A;  3G4S Q;  3ZL7 C;  3LWH A;  2M16 A;  4WTO B;  3BDL A;  3QKJ A;  4C8Q E;  2GF7 A;  1SG5 A;  3V8K A;  1S72 Q;  2KT1 A;  3OYJ A;  3JB9 D;  5GAN 6;  3JCM X;  1TWB A;  3FC3 A;  3JCM Q;  1O54 A;  4J9C A;  2C0I A;  5CKF A;  2FYK A;  1M9S A;  2JUF A;  3OYC A;  4J9E A;  2WSC E;  4LUE A;  1YBY A;  5I22 A;  3CMA T;  2EVR A;  4OMM A;  3LLR A;  5FTJ A;  1M5Q 1;  2P84 A;  2LX7 A;  2RK1 A;  1D0X A;  3NFC A;  1AWJ A;  1NPR A;  2AK5 A;  2EGE A;  5KYW B;  3QYH B;  1RLP C;  4CRI A;  3PIP A;  5J39 A;  4C92 B;  3CC2 Q;  4KBM B;  1N27 A;  2EPD A;  4PFP A;  1ABO A;  4OF1 A;  3UT1 A;  4C92 C;  2GTJ A;  4RTV A;  3TIW A;  2CZ0 B;  2P0K A;  4JZ4 A;  5CQX A;  2GQV A;  5GAO m;  2AIR B;  2PVD B;  4E7K A;  5ERG B;  1UG1 A;  1VQ5 Q;  2YUJ A;  5M9O A;  3CEY A;  2L2P A;  1YIJ T;  2VAS A;  3EGX A;  1RUW A;  2A28 A;  4R55 A;  3PTA A;  1LNX A;  2XDP A;  1RLQ C;  4UC4 A;  5J3B A;  4J6Y A;  2RHU A;  3I56 Q;  1HYO A;  3SB2 A;  5I11 A;  4NOY A;  2IVW A;  4C8Q D;  3M0S A;  1V29 B;  4LUD A;  4M75 B;  5I21 A;  2CDT A;  3HKS A;  2FVU A;  2ZPI B;  3PMT A;  3TVT A;  4M75 C;  4X34 A;  5LJ3 h;  2F1L A;  3CCR A;  3EG1 A;  3WVD B;  3CXC P;  4YTL A;  5GAN h;  3LYI A;  3REB B;  4RCB A;  4QT7 A;  3U23 A;  3CC4 T;  4LDX A;  3OMG A;  2Q18 X;  5GAM g;  2E41 A;  1BKB A;  2MMP A;  1PKT A;  2FB7 A;  5L8R E;  2P4T A;  2C0T A;  2I2L A;  4KUL A;  5A0L A;  2A7Y A;  4PKC C;  2CYZ B;  2QQ9 A;  2DZC A;  1WDX A;  1VIE A;  2KK4 A;  3VJP A;  2AKL A;  4KDL A;  1T0H A;  4JLI A;  4N0A C;  3REA B;  2MWP A;  3OBY A;  2M51 A;  3QQ8 A;  4XTX A;  4ME7 A;  3JB9 H;  3MP6 A;  1WHK A;  5J26 A;  4RTU A;  3INZ A;  1Q81 U;  2CZ7 B;  4KOD A;  1MV0 B;  2OTJ T;  3A8O B;  1YJN Q;  2D8H A;  2J7I A;  2YLB A;  2DX1 A;  4M7A E;  2PWY A;  1JJ2 P;  1A0N B;  1YFN A;  2DA9 A;  1QP3 A;  4PJO G;  3G71 A;  1VQP Q;  4ARC A;  1AEY A;  3JV3 A;  2ZPB B;  3CC7 Q;  1ABQ A;  1VQN Q;  2EQI A;  1BK2 A;  1K76 A;  2KDS A;  2J06 A;  1M2V B;  4F7U A;  5LJ5 g;  3CD6 T;  1G2B A;  4DEX A;  5FW9 A;  4VUB A;  3ZFJ A;  1K8A U;  2BE9 B;  2DD4 A;  4HXJ A;  2E4H A;  4BUG A;  1GL5 A;  1TS9 A;  2MCN A;  5GAO r;  2VVK A;  3KBG A;  1N8R R;  4M77 G;  4ZGE B;  2VYT A;  2DLP A;  3EG2 A;  2EBP A;  2QG9 B;  5FU6 B;  2QEX A;  4OB3 B;  3L2Z A;  1B34 A;  1OX8 A;  2CP0 A;  1R7R A;  2XU8 A;  5FU6 C;  2K3Y A;  3H0I A;  1GCQ C;  2YUP A;  2JW4 A;  1R0C B;  4ELZ C;  1GBQ A;  3RBB B;  1WJS A;  2M9U A;  2AHJ B;  1UGS B;  4FYX B;  3RIR A;  3G71 Q;  5LJ3 d;  5GAO n;  1D0Y A;  3V7R A;  4M7A D;  5GAN d;  1XNI A;  2KRM A;  2FL7 A;  1FXX A;  1GRI A;  1VQ9 A;  2JM9 A;  2YWW A;  1W6X A;  2M02 A;  3OB9 A;  3OS0 A;  3CCR T;  4EMG A;  2JT4 A;  3NTI A;  1Y7X A;  3CXC A;  1E32 A;  3MCA B;  4R0K A;  3A8H B;  3A1P A;  1QWE A;  1VQ7 Q;  5GAO p;  2Y4Y A;  4WF2 A;  2MIO A;  3X24 B;  2HZY A;  2KXD A;  4IUQ A;  3M0P A;  3PVQ A;  5D7U A;  1G8X A;  5KYW A;  1ZUU A;  2RQV A;  1JU5 C;  3TRE A;  1OU9 A;  4C92 A;  2D8J A;  3HL8 A;  3VS5 A;  4OVA A;  5IAY A;  3F70 A;  4Z89 A;  2E12 A;  3C12 A;  4XQ3 A;  2F5K A;  3CBP A;  4PLL A;  1VUB A;  2BZ8 A;  2X3X D;  5KYU B;  2QDL A;  4QQG A;  5IHK A;  1X6B A;  2CZ6 B;  2MM0 A;  3CCM T;  1BBZ A;  2FHD A;  3PGG A;  3H0H A;  5GMK e;  3FDR A;  3TSW A;  4KGX B;  3JRZ A;  3VYG A;  3I35 A;  1VQ9 Q;  3VS3 A;  1QVF P;  2JS0 A;  2Y90 A;  4D8K A;  2RQU A;  2EGC A;  1UUE A;  2KR3 A;  3O8V A;  3I9Q A;  3SHW A;  1WQW A;  3X25 B;  4AMC A;  1ZBX A;  5CKH A;  3A8L B;  1AD5 A;  2F69 A;  1ACM B;  4M75 A;  1JJ2 A;  4M4Z A;  4GY5 A;  3ASK A;  1LJO A;  1IGQ A;  1X69 A;  1K0X A;  2PNI A;  4CQN A;  2BZY A;  2FG0 A;  2X4J A;  4Z8A A;  3X28 B;  2FRW A;  3QSU A;  2J6F A;  4C5G A;  2E6Z A;  2CGH A;  3I55 A;  3QUI A;  1JRI A;  1QW1 A;  1Q7Y R;  2XDB A;  2KRS A;  2KBT A;  1EIF A;  1X43 A;  1WNL A;  5GMK j;  1FMV A;  3V7C A;  4B9W A;  1MND A;  4EPC A;  1YJW A;  1ZUY A;  1P92 A;  1Q95 G;  4PLI A;  4M7D F;  2K5F A;  3M57 A;  1M2O A;  4RTX A;  3GNG A;  3QPH A;  3M53 A;  4DOW A;  1UGQ B;  4N0A A;  4IUU A;  1K8A C;  4F7U G;  2F5T X;  1WZO A;  2JMA A;  3X20 B;  3RNJ A;  2CUB A;  4GLK A;  3H0F A;  4RTW A;  2O9V A;  2HL5 C;  2FO0 A;  3VYH B;  4XU1 A;  3UF4 A;  2EJG A;  4ZN3 A;  1GFD A;  5GAM e;  5GAN 2;  4A4G A;  1VQL T;  3CBO A;  2VB6 A;  1T3S A;  2B8A A;  3ZEH A;  5GAO q;  2J6O A;  4A63 B;  2VC8 A;  3QZ9 B;  3CCV T;  1Q86 R;  2KYM A;  2QYZ A;  5FU7 B;  3JCM g;  1VQO A;  3QG1 A;  2RQT A;  5FU7 C;  3MJX A;  2RN8 A;  3GNF B;  3FB9 A;  4FYW B;  3J81 E;  3M0U A;  3JAM E;  4LNP A;  2VKN A;  4PJN A;  4DOV A;  2COZ A;  3HTR A;  4A4F A;  3CXC S;  1ZLM A;  2EQJ A;  1VOM A;  4RG8 A;  1WFW A;  1M2V A;  2HSP A;  2MK5 A;  2ROL A;  5CCX A;  3JSC A;  1NEB A;  4BB7 A;  2K6D A;  2AT1 B;  3X26 B;  5CCB A;  2V8J A;  2F2W A;  3NHN A;  4CC4 B;  1RAB B;  3MPU B;  1WA7 A;  1WJQ A;  4TVR A;  1Q82 R;  5C1B A;  3RKX A;  1ZHI A;  3V8J A;  5I2S A;  1RAD B;  1G3Y A;  2AZS A;  2LT1 A;  5LJ3 f;  1VQ8 T;  1JQQ A;  4HCZ A;  1UGV A;  4X9D A;  2A36 A;  3QC8 A;  3ULR B;  4PK4 A;  5GAN f;  3DKM A;  2HDA A;  4FW2 A;  3QBY A;  2PUO B;  5A0G A;  4KT0 E;  1ZSZ B;  4E47 A;  3P8D A;  3RR6 A;  1UGR B;  2HKQ B;  4AFS C;  3CMA Q;  3MEU A;  3M54 A;  3JB9 F;  3MKD A;  1ZSZ C;  2DL3 A;  2E6N A;  4HT8 A;  2EW3 A;  2MF2 A;  2DYI A;  4M7D B;  5LJ5 e;  3PT9 A;  5LL6 S;  4C5H A;  3C0C A;  4C5E A;  1QVF A;  4Q5W A;  1LPL A;  4M7D C;  2D0N A;  5CKE A;  3JB9 J;  1Y96 B;  3RUX A;  2LQ8 A;  4C92 G;  3HSB A;  3OBW A;  3LWI A;  3VS0 A;  1M30 A;  4O5V A;  2M0Y A;  3PVL A;  4J9G A;  3A5Z B;  3RKW A;  4M78 E;  3QII A;  1K73 R;  2YUO A;  4IUT A;  1OV3 A;  3CCL A;  4ATO A;  2PJH B;  3H41 A;  2V26 A;  2LNH B;  5KYY B;  2Q1D X;  5FTK A;  4QQD A;  4FW1 A;  4K11 A;  4OGC A;  2LMJ A;  2IIM A;  4CC3 A;  4A4E A;  4C92 E;  1U1T A;  2SEM A;  1Y57 A;  2EYX A;  2KT8 A;  2JTM A;  3MB5 A;  2KE9 A;  4PJO A;  1YIJ Q;  2JMC A;  1QMC A;  4BAC A;  1X75 C;  1TOV A;  4BDZ A;  4IKF A;  1M1F A;  2QQB A;  1CZ5 A;  1YCY A;  2DK3 A;  3L42 A;  4F17 A;  2LT4 A;  4JJB A;  1YIT Q;  2FRY A;  1KD1 R;  4RTZ A;  5LJ5 j;  5DM7 R;  4HCK A;  4A4H A;  1MGQ A;  3GF5 A;  3QDF A;  4M75 G;  1YNZ A;  2JTE A;  2R58 A;  5C0M A;  1H92 A;  1R0B G;  2JVV A;  2G6F X;  4KGZ B;  2A37 A;  5KYU A;  3VUZ A;  2HBW A;  4C8Q F;  2OTJ A;  2Q1C X;  2OAU A;  2GQI A;  1E6G A;  1NYF A;  2EQU A;  3D7S B;  4N4H A;  2GFU A;  1K9M R;  2E3I A;  3CC4 Q;  5CQY A;  1I5O B;  4II1 A;  3CME Q;  2DPP B;  2I0N A;  1K4U S;  3TSZ A;  2HEQ A;  1KFZ A;  1RAH B;  1I8F A;  2CRE A;  1VQO T;  2LC4 A;  3CD6 A;  4M78 D;  2QI2 A;  4JDS A;  3QXE B;  2OTL T;  2CZ1 B;  3H6Z A;  3HU1 A;  4OB0 B;  2RHZ A;  1GBR A;  2FZC B;  4KH0 B;  4C92 D;  2XD0 A;  4PJL A;  1IHV A;  2CP3 A;  1BI2 A;  3ZJU A;  3TU4 K;  1I5L A;  1RAC B;  2PUK B;  2WSE E;  5DLQ E;  1YP5 A;  1O9S A;  3OYI A;  3HPW A;  4E7L A;  3FPR A;  4AFZ C;  2LRQ A;  5GMK h;  4ZNX A;  3LGF A;  1AT1 B;  2OTJ Q;  4PJJ A;  2LCS A;  4QKU A;  1X2Q A;  2KGT A;  5DYI A;  1JB0 E;  2DEQ A;  2RQR A;  2QGG A;  1N6A A;  2VGN A;  2A0F B;  3I5R A;  4LDY A;  1LOJ A;  3DLL A;  1M1K C;  2CS7 A;  3ZGZ A;  3EH2 A;  1I81 A;  2AKK A;  1H3H A;  2GBQ A;  1TUD A;  1TUC A;  2YXY A;  1RAE B;  1KC8 C;  1N5Z A;  3HU2 A;  4E7H A;  1NZ9 A;  3EG0 A;  4BD3 A;  2HSE B;  2LJ1 A;  1D1A A;  1QVF S;  4CI0 C;  2M0O A;  2A3L A;  1SF9 A;  2ZPG B;  2HBP A;  3M0Q A;  4C8Q B;  2EJF A;  2QTV A;  1IB8 A;  2X4W A;  1YHQ T;  4C8Q C;  4F16 A;  2DNU A;  2E5Q A;  2ATC B;  3CCL T;  3HFN A;  2R5A A;  3CPW S;  1AHJ B;  1KSW A;  4OMO A;  1PSE A;  3OQ5 A;  4QVZ A;  4N4I A;  2LNV A;  2VXE A;  2LDM A;  1MHN A;  2KRO A;  2K4Y A;  1PHT A;  4XU3 A;  5CK9 A;  3GBQ A;  3M4G A;  1IZ6 A;  1O75 A;  2HCK A;  4LD6 A;  1RL2 A;  5C6S A;  2X4X A;  4KGV B;  1YJ9 T;  2E70 A;  2D6F A;  2DM1 A;  4F14 A;  1UGP B;  1S3S A;  3CCM A;  2BKD N;  2PVG B;  1RI9 A;  3EFO B;  3S3N A;  2RF0 A;  3URG A;  2LJ3 A;  4HKE A;  1B07 A;  2L3S A;  5GAM h;  2V1R A;  3C95 A;  3GOX A;  3S6W A;  1ZQ1 A;  2H3J A;  3VRY A;  2CP2 A;  2P0Q A;  3JCM e;  4KO8 A;  4M7A F;  3JCM V;  4X1V A;  3CCR Q;  4RV0 A;  1VYU A;  4RKU E;  4HVW A;  3JCM c;  1FX7 A;  3OMC A;  1R8O B;  1ZSZ A;  2K2V A;  2QGF B;  1VQ4 T;  1XQH A;  3A8M B;  4LE9 A;  1I1J A;  3ZJV A;  3NPF A;  1CR5 A;  4J9I A;  1N8R U;  4C5I A;  4M7D A;  4OGE A;  3RDV A;  2RI5 A;  3WVE B;  2PTK A;  4MZP A;  4MML A;  1TSF A;  2DMO A;  4PNO A;  4EDU A;  1ZC1 A;  1NJI R;  2B25 A;  1PD0 A;  2V1Q A;  4IIO A;  2QK0 A;  9ATC B;  2XG8 D;  1KK7 A;  4PJO E;  3PE0 A;  4KUD K;  1OZ2 A;  3GLX A;  1QVG P;  5CKD A;  3ER0 A;  1OX9 A;  2B86 A;  1U8R A;  3OYH A;  4L6V 5;  2QAZ A;  5KYY A;  2LJ0 A;  2QXF A;  1BCO A;  3L2V A;  1Q81 R;  3CCM Q;  2DXC A;  3CCJ A;  3EH1 A;  2QQR A;  1OPK A;  2V8K A;  1M3C A;  2LQW A;  2XI9 A;  1G3T A; 
#chains in the Genus database with same CATH homology
 2VGM A;  2E6Z A;  5FRN A;  4M75 D;  2L5Q A;  4C92 F;  2CGH A;  3RKY A;  5HK0 A;  3I55 A;  2QDY B;  3QUI A;  1JRI A;  3E9G A;  4F7U B;  1QW1 A;  3FIF A;  2WAC A;  1M90 C;  5EPP A;  2XDB A;  4BI8 B;  4M77 E;  4BY6 B;  1HXD A;  3CC4 A;  2EIF A;  3CCE T;  4V2S A;  1YIT T;  5LJ5 h;  4Y28 E;  2DTI A;  1EIF A;  2G3R A;  5HY6 A;  5HK3 A;  1WNL A;  3CME A;  1GXI E;  5GMK j;  4BE2 A;  4BY6 C;  3V7C A;  4B9W A;  3OYF A;  5EG2 A;  1FWZ A;  2JN0 A;  5GAN 5;  2PU9 B;  4BI3 A;  3CPW A;  4EPC A;  2HNI A;  4L59 A;  1YJW A;  1SSF A;  5D6W A;  1K9M U;  4A53 A;  1P92 A;  2EJ9 A;  4PLI A;  4DA4 A;  1VQL A;  4RMO A;  1QVG S;  4M7D F;  2QQS A;  2LTO A;  5HKC A;  3OSS C;  3QQ7 A;  2DKG A;  3OYY A;  5GLF A;  2K5F A;  3M57 A;  3MHX A;  1QP2 A;  3G4S T;  3CCV A;  3GNG A;  1YJN A;  2O4X A;  3QPH A;  2LX9 A;  1B34 B;  3I55 T;  4MMK A;  3M53 A;  1BI3 A;  4A54 A;  1UGQ B;  4N0A A;  3M4Y A;  4XAX B;  4DOW A;  4ZN1 A;  1K73 C;  2PQW A;  2D0Q B;  3LH0 A;  4QW2 A;  4JJN K;  4IUU A;  1S72 T;  4F7U G;  2F5T X;  1K8A C;  2NLU A;  4D6W A;  3C94 A;  2ZZD A;  3X20 B;  3CME T;  4MDW A;  2RA2 A;  4M7A B;  2E10 A;  3OS1 A;  1VQP A;  1BI0 A;  4GLK A;  2E64 A;  4ZGJ B;  5IT9 E;  2JV2 A;  2RK2 A;  1UB4 A;  1X6O A;  2MI6 A;  2RJD A;  3VYH B;  3UWN A;  2MM2 A;  2DJZ A;  3CC7 A;  4OB2 B;  4XU1 A;  4M75 F;  2EJG A;  2JOY A;  3VUB A;  4ZN3 A;  3J80 E;  2RJE A;  4J83 A;  1WPY A;  5DY9 A;  4A4G A;  3FJP A;  3CBO A;  5GAM e;  2KAF A;  5GMK m;  2B8A A;  5GAN 2;  3ZEH A;  5GAO q;  2QTX A;  4PJO D;  3P8B B;  4FSX A;  5KE2 A;  2VC8 A;  3CBM A;  2EAY A;  3QZ9 B;  3CCV T;  5GAN 4;  5CIU A;  3EAE A;  4ZTJ A;  3LGL A;  2RD1 A;  5FU7 B;  2RO0 A;  5CCA A;  3JCM g;  1YJW T;  2HQX A;  2L89 A;  1VQO A;  1VQ5 A;  5CVI A;  3OYL A;  2DAQ A;  3QG1 A;  1KD1 C;  4LDV A;  2V8I A;  2MAM A;  5C18 A;  4M77 A;  3M58 A;  4BE1 A;  3LWH A;  3MEA A;  3L2R A;  5FU7 C;  1DJ7 B;  1TH7 A;  2X4Y A;  2M16 A;  3GNF B;  4NS5 A;  1W2B S;  3CC2 T;  3NTK A;  3OS2 A;  5GMK i;  3FB9 A;  3BDL A;  3QKJ A;  4XU2 A;  4C8Q E;  4NL3 A;  3J81 E;  2GF7 A;  3JAM E;  5KH6 A;  3V8K A;  4EMK A;  3QJ6 A;  1NJI U;  3OYJ A;  3JB9 D;  1VQ8 A;  4DOV A;  4M7A G;  3CXC S;  4A4F A;  4XTV A;  5GAN 6;  5GAM d;  3JCM X;  1VQN T;  2EQJ A;  4RG8 A;  5KE3 A;  3JCM Q;  3FC3 A;  5CKF A;  1O54 A;  2FYK A;  1M9S A;  1M8V A;  5CCX A;  2JUF A;  3JSC A;  4Z02 A;  3OYC A;  2EQM A;  4BB7 A;  3OYK A;  2L8D A;  2WSC E;  3C4S A;  3X26 B;  5CCB A;  1YBY A;  2V8J A;  4M77 D;  1UEB A;  3CMA T;  1VQL T;  1M4Z A;  3M59 A;  4RG2 A;  3OYD A;  1K9M C;  3LLR A;  2YLC A;  1VQ5 T;  5FTJ A;  1M5Q 1;  2RK1 A;  1KQ1 A;  3HU3 A;  3BDU A;  1WJQ A;  4JLG A;  4TVR A;  2RHY A;  3NFC A;  3JCM J;  5C1B A;  3RKX A;  5AYF A;  4RCC A;  1NPR A;  1Y96 A;  4R56 A;  3AHU A;  2K3X A;  1ZHI A;  4FU6 A;  4NL2 A;  5CKB A;  2LQK A;  4XTU A;  3V8J A;  4IUV A;  5I2S A;  1OI1 A;  3OYN A;  4J8O A;  3JCM W;  1G3Y A;  3QYH B;  1VQ6 A;  1X01 A;  4PJO F;  3EFS A;  2LT1 A;  4CRI A;  3PIP A;  5LJ3 f;  4FT4 A;  1VQ8 T;  4XU0 A;  5J39 A;  4C92 B;  4HCZ A;  3GPL A;  4ZTF A;  2LW6 A;  3VU3 C;  4KBM B;  1N27 A;  4X9D A;  3I56 T;  2KMT A;  4OF1 A;  4BDY A;  3UT1 A;  5GAN f;  3OYM A;  1Q7Y U;  3DKM A;  3QC8 A;  2ZPF B;  4C92 C;  1QCS A;  2LVM A;  4P5N A;  3PFS A;  2PUO B;  3QBY A;  5A0G A;  3TIW A;  2CZ0 B;  4KT0 E;  2P0K A;  5CQX A;  4E47 A;  3P8D A;  2GQV A;  5GAO m;  2XHC A;  1UGR B;  2VXF A;  3MEU A;  4C0D B;  2PVD B;  4E7K A;  3M54 A;  3JB9 F;  5ERG B;  2E6N A;  4HT8 A;  2MF2 A;  2YUJ A;  3CCS A;  2GCX A;  5CD1 A;  4M7D B;  5LJ5 e;  3GIB A;  4C0D C;  3PT9 A;  3HP9 A;  5LL6 S;  4C5H A;  4C8Q A;  3M9Q A;  5M9O A;  3CEY A;  4C5E A;  1YIJ T;  1QVF A;  2KY9 A;  3BW1 A;  4M77 F;  4Q5W A;  1PSF A;  4R55 A;  3PTA A;  1LNX A;  5CKE A;  3JCM P;  1Y96 B;  2XDP A;  3JB9 J;  4M7D C;  2XDD A;  5FTN A;  3RUX A;  2DXT A;  2LQ8 A;  4C92 G;  1VQ7 A;  2DIQ A;  5GAN 8;  4UC4 A;  3HSB A;  1U1S A;  3OBW A;  3LWI A;  5J3B A;  4J6Y A;  2RHU A;  3FPT A;  4O5V A;  3QZ5 B;  3SB2 A;  1QVG A;  3A5Z B;  3RKW A;  1H64 1;  4NOY A;  2IVW A;  4M78 E;  3QII A;  4C8Q D;  4N4G A;  1V29 B;  3CCJ T;  4IUT A;  3LW5 E;  2DXU A;  2XKO C;  1N8R C;  4M75 B;  3CCL A;  4ATO A;  5I21 A;  3KXT A;  2PJH B;  3JCM b;  5LJ5 d;  3CCS T;  3HKS A;  2FVU A;  2Q1D X;  4JRK A;  2JZ2 A;  2ZPI B;  3HFO A;  5FTK A;  4QQD A;  3PMT A;  1WQ7 A;  3QYG B;  4OGC A;  4M75 C;  4X34 A;  2YRV A;  1KQS S;  5LJ3 h;  1Q86 U;  4M7D G;  4A4E A;  4C92 E;  3CCR A;  1U1T A;  4J6W A;  3WVD B;  3OYG A;  3CF2 A;  2JTM A;  4YTL A;  3MB5 A;  5GAN h;  4PJO A;  3LYI A;  3FEO A;  4C0F A;  5FTM A;  1D3B A;  4RCB A;  3CC4 T;  4LDX A;  4BAC A;  5B6C A;  4E7I A;  1WGS A;  1X75 C;  3OMG A;  4MZT A;  4BDZ A;  4J5Y A;  2Q18 X;  3OS5 A;  3V7S A;  4IKF A;  5GAM g;  1M1F A;  2QQB A;  2E41 A;  2RHX A;  3CCQ A;  1BKB A;  1YCY A;  2MMP A;  2X35 A;  1CZ5 A;  2DK3 A;  2DTH A;  2FB7 A;  2LT4 A;  3L42 A;  5L8R E;  2P4T A;  3JCM f;  2PVO B;  4HCB A;  2XK0 A;  3QHS A;  2I2L A;  5LJ5 j;  2XIC A;  5DM7 R;  4A4H A;  1I9G A;  1MGQ A;  2R5M A;  4KUL A;  5GAO l;  3GF5 A;  1WJR A;  4M75 G;  5A0L A;  3E9F A;  1WLF A;  3LX7 A;  2R58 A;  5C0M A;  4FIB A;  1VQK A;  4ZGD B;  2Q19 X;  1YJN T;  1KHI A;  2JVV A;  4M7A C;  2QQA A;  3T9N A;  2QA4 A;  2A7Y A;  4PKC C;  2CYZ B;  4F7U E;  2QQ9 A;  3VUZ A;  5GAN 7;  1Q82 U;  4C8Q F;  2OTJ A;  5KCH A;  2Q1C X;  2DZC A;  1QVP A;  2GFA A;  2OAU A;  4LDU A;  2OTL A;  1VIE A;  3M5A A;  2EQU A;  2O4X B;  2E65 A;  3MO8 A;  2VV5 A;  2KK4 A;  4N4H A;  2GFU A;  3VJP A;  2K5I A;  1OZ3 A;  1VQP T;  1VQN A;  4M78 A;  3CCQ T;  4PJO B;  5CQY A;  2JNG A;  3QWZ A;  5GAN 3;  4ARI A;  1M1K U;  4KDL A;  4FT2 A;  4II1 A;  4JLI A;  3CC7 T;  2DPP B;  4N0A C;  2MWP A;  2M1H A;  4BI4 A;  4PJO C;  3OBY A;  3MEV A;  4J6X A;  2YHT A;  4Y91 A;  3QQ8 A;  1Y71 A;  3UPU A;  5A2Q E;  5EQJ B;  4XTX A;  4ME7 A;  3JB9 H;  3BFM A;  3MP6 A;  2DD5 A;  5J26 A;  3LGA A;  3HHT B;  3P8H A;  1I8F A;  1KC8 U;  3R6O A;  1IRE B;  2RI3 A;  1VQO T;  3INZ A;  2LC4 A;  3SWN A;  2BIV A;  3TEE A;  1Q81 U;  2CZ7 B;  3CD6 A;  4KOD A;  4M78 D;  3OA6 A;  1M90 U;  2OTJ T;  2QI2 A;  3A8O B;  4JDS A;  2EKO A;  3QXE B;  2OTL T;  2CZ1 B;  4MZM A;  4B9X A;  2YLB A;  4BE0 A;  3H6Z A;  2Y4X A;  3BY7 A;  3PNW C;  3HU1 A;  4JRI A;  5DYG A;  4M7A E;  4KDI A;  2PWY A;  4OB0 B;  2RHZ A;  3SFM A;  3JB9 I;  4M77 B;  1QP3 A;  1YI2 A;  2DIG A;  3JCM h;  1KG1 A;  3OSV A;  4PJO G;  4C92 D;  3G71 A;  2XD0 A;  3BQB A;  4MDX A;  3A8G B;  3DB3 A;  2D9T A;  4O6J A;  4M77 C;  4ARC A;  5KCO A;  1BI2 A;  2ZPB B;  2RH2 A;  4EMK B;  1JBM A;  3ZJU A;  3TU4 K;  3OY9 A;  3HRS A;  1I5L A;  2DO3 A;  3G7Z A;  2EWN A;  2KDS A;  3SDZ A;  4HA8 A;  5GMK l;  2PUK B;  3KUF A;  2WSE E;  3ME9 A;  3L2W A;  2KVQ G;  5DLQ E;  4EMK C;  4F7U A;  5LJ5 g;  3OW2 A;  2IG0 A;  1K73 U;  1O9S A;  3OYI A;  3CD6 T;  2YVL A;  3HPW A;  4E7L A;  3FPR A;  3S3M A;  1VQM A;  3MET A;  4VUB A;  3ZFJ A;  1K8A U;  2LRQ A;  5GMK h;  2DD4 A;  3N5B B;  4JS4 A;  3JB9 G;  1BYM A;  3LGF A;  4BUG A;  1VQ6 T;  1YI2 T;  1G3S A;  5GAO r;  3CCE A;  3FLG A;  5DYI A;  1JB0 E;  2DEQ A;  3KBG A;  3NTH A;  2K5L A;  3G71 T;  4XTW A;  1NE8 A;  2DZ9 A;  1N6A A;  4M77 G;  2VGN A;  3CPF A;  4ZGE B;  5DLO A;  2LCC A;  2VUB A;  1NJI C;  2VYT A;  4M78 F;  4LDY A;  3DLL A;  1LOJ A;  1BIA A;  3QO3 A;  1M1K C;  1I4K 1;  2CS7 A;  5FU6 B;  4OB3 B;  3L2Z A;  2QEX A;  3OYB A;  1YHQ A;  3ZGZ A;  3Q1J A;  1JJ2 S;  1B34 A;  1I81 A;  5LJ3 e;  2DVE A;  1R7R A;  2XU8 A;  3WXM B;  3ZBD A;  4LDW A;  5FU6 C;  2K3Y A;  4C0Z A;  1KD1 U;  5GAN e;  1KC8 C;  3G4S A;  5FRM A;  3HU2 A;  2E1H A;  4PL6 A;  3MP1 A;  4ELZ C;  1Q81 C;  4E7H A;  1NZ9 A;  4FL6 A;  4BD3 A;  2RHI A;  4M7A A;  3E19 A;  5GAM f;  3V8L A;  1HK9 A;  1QVF S;  4CI0 C;  1S72 A;  2M0O A;  2A3L A;  2ZPG B;  1WJS A;  2HBP A;  2M9U A;  4C8Q B;  2P0P A;  1VQ7 T;  5D6X A;  2EJF A;  2X4W A;  2AHJ B;  2ZPE B;  1BI1 A;  3ZJT A;  1UGS B;  3RIR A;  2QEX T;  4E7J A;  1YHQ T;  4QQ6 A;  5LJ3 d;  1YJ9 A;  2DXB A;  4C8Q C;  1Q7Y C;  1KHC A;  1N9R A;  2EYQ A;  5GAO n;  3V7R A;  1N9S A;  2ZCF B;  1XTD A;  2E5Q A;  5GAN d;  4M7A D;  2R57 A;  1XNI A;  3CCL T;  3HFN A;  2RM4 A;  2R5A A;  3CPW S;  1AHJ B;  1FXX A;  2FL7 A;  3MEW A;  4OB1 B;  4L5G A;  1VQ9 A;  4M7D E;  1G3W A;  4X9C A;  1PSE A;  3L1A A;  4F7U F;  3OYE A;  3OQ5 A;  4QVZ A;  2LNV A;  2VXE A;  3OB9 A;  4N4I A;  5I2M A;  3EFR A;  2LDM A;  3VV0 A;  3OS0 A;  1MHN A;  4EMG A;  3CCR T;  1W2B A;  1CZ4 A;  4AQ7 A;  3HRT A;  2K4Y A;  3VKI A;  1KQ2 A;  4XU3 A;  5CK9 A;  3M4G A;  1IZ6 A;  3CC2 A;  2KQW A;  4XTZ A;  3NTI A;  1O75 A;  1Y7X A;  5CAI A;  3DLM A;  4LD6 A;  4LD9 K;  3CXC A;  1RL2 A;  5C6S A;  1VIF A;  1E32 A;  3RMS A;  3MCA B;  3A8H B;  5FRO A;  2X4X A;  5LJ3 j;  3TCJ A;  4C8Q G;  3CCU A;  1YJ9 T;  2E70 A;  4A4K A;  2RJC A;  3L2Q A;  2D6F A;  5GAO p;  2Y4Y A;  3DB4 A;  3GP8 A;  1VQ4 A;  4WF2 A;  1QDN A;  4AS1 A;  5GAN j;  2ZPH B;  1UGP B;  1D3B B;  3HRU A;  3X24 B;  4XK8 E;  1S3S A;  4IUQ A;  3M56 A;  4KUI A;  5IN1 A;  4M75 E;  3CMA A;  3CCM A;  3SD4 A;  2C06 A;  2BKD N;  1VQ9 T;  1W4S A;  1H3Z A;  2PVG B;  3E1S A;  4HCC A;  3RMQ A;  3S3N A;  1VQK T;  4IUP A;  3URG A;  4HKE A;  3TRE A;  1G5V A;  5GAM h;  4J7I A;  4C92 A;  3C95 A;  3HL8 A;  1Y07 A;  2EQK A;  3GOX A;  2QA4 T;  3S6W A;  1ZQ1 A;  2H3J A;  4OVA A;  2P0Q A;  3JCM e;  5IAY A;  4KO8 A;  3F70 A;  2E12 A;  2HQE A;  4M7A F;  3C12 A;  4XQ3 A;  2F5K A;  3JCM V;  1Q86 C;  3G6E A;  3OYA A;  5FTL A;  4RV0 A;  3CBP A;  4PLL A;  2L3R A;  4RKU E;  3CCU T;  3JCM c;  1FX7 A;  3OMC A;  1R8O B;  1VUB A;  2K2V A;  3I56 A;  1VQ4 T;  4EMH A;  2O01 E;  1XQH A;  3A8M B;  4FM4 B;  3PIO A;  4QQG A;  4JS5 A;  4JUV A;  5CO7 A;  3RES A;  2RJF A;  4IUR A;  3ZJV A;  2CZ6 B;  1CR5 A;  5LJ5 f;  2MM0 A;  3UDC A;  3CCM T;  2EFI A;  1N8R U;  4C5I A;  2FHD A;  4M7D A;  3PGG A;  2ZGW A;  4M78 B;  4OGE A;  5GMK e;  4OMF B;  3FDR A;  1NPP A;  2RI5 A;  3JRZ A;  3VYG A;  3WVE B;  2XID A;  2HAX A;  3JCM d;  4JRP A;  3M55 A;  4JRQ A;  4M78 C;  3PMI A;  3FPU A;  2JTF A;  4MZP A;  4OP0 A;  4MML A;  2LCL A;  2Y90 A;  4PNO A;  2KSS A;  3G6E T;  4EDU A;  3J7A F;  1ZC1 A;  2Q1A X;  2RI2 A;  3FRN A;  3O8V A;  3MP8 A;  1YIJ A;  2B25 A;  4KLN A;  4ELY C;  5GAM j;  3QDR B;  1WQW A;  1Q82 C;  2K57 A;  2XG8 D;  3SWN B;  3X25 B;  5FLX E;  4M7D D;  3H8Z A;  1ZBX A;  4PJO E;  5CKH A;  1OZ2 A;  3A8L B;  1BIB A;  3GLX A;  4XTY A;  4C0G A;  4KUD K;  2HD0 A;  5CKD A;  2F69 A;  3ER0 A;  3LHD A;  4QVD A;  4M75 A;  1YIT A;  1JJ2 A;  2RB6 A;  3SWN C;  1U8R A;  5D6Y A;  3OYH A;  4L6V 5;  3L2U A;  2MWO A;  2WSF E;  1M1G A;  3ASK A;  4GY5 A;  2QXF A;  1LJO A;  5LJ3 g;  3L2V A;  1OYX A;  2BUD A;  2DXC A;  2DTO A;  3CCJ A;  2QQR A;  3QJY A;  5GAN g;  4CQN A;  4M78 G;  3RER A;  2V8K A;  4HT9 A;  1RI0 A;  2X4J A;  5CR2 A;  1KQS A;  3X28 B;  2XI9 A;  3S3O A;  5A0D A;  4DQ2 A;  1G3T A;  4J7F A;  1XOV A;  1VQM T;  3QSU A;  2CKK A;  3OW2 S;  4QVC A;  4C5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...