4UC4A

Crystal structure of hybrid tudor domain of human lysine demethylase kdm4b
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
109
structure length
109
Chain Sequence
b'AVSLGQVVITKNRNGLYYRCRVIGAASQTCYEVNFDDGSYSDNLYPESITSRDCVQLGPPSEGELVELRWTDGNLYKAKFISSVTSHIYQVEFEDGSQLTVKRGDIFTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 4B
publication title Reader domain specificity and lysine demethylase-4 family function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Replication
total genus 20
structure length 109
sequence length 109
chains with identical sequence B
ec nomenclature ec 1.14.11.-:
pdb deposition date 2014-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18104 Tudor_2 Jumonji domain-containing protein 2A Tudor domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.140 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4uc4A01
3.10.330.70 Alpha Beta Roll Vcp-like ATPase; Chain A, domain 2 Vcp-like ATPase; Chain A, domain 2 4uc4A02
3OYAA 1XNIA 4II1A 3L2UA 3OB9A 4QQDA 4E7KA 3LLRA 4A4FA 4HCZA 2RHZA 1WGSA 2E5QA 3OYMA 4E7JA 3OYNA 2K3XA 5IN1A 3UWNA 5IAYA 4ZTFA 2LRQA 2QQRA 3M9QA 2EQKA 2M16A 3OYCA 3FC3A 1WJQA 2QQSA 2R57A 3OYGA 2G3RA 4A4EA 2L8DA 4BDYA 2RJEA 3L2VA 5CIUA 3S3NA 3H8ZA 3O8VA 4PLLA 5FRNA 2R5MA 4BDZA 3SD4A 4IKFA 3P8DA 3L2RA 3FLGA 5KCHA 2IG0A 3OYDA 1RI0A 2VYTA 3KUFA 2GFUA 3L42A 3NTIA 4CRIA 5KE3A 3L2QA 4C5EA 2DAQA 1WJRA 4IURA 2EFIA 2BUDA 1OZ2A 3C4SA 3MEUA 3OYHA 4BE0A 2LVMA 2RJDA 2RJCA 3E9GA 3FDRA 2X4XA 3OA6A 2M1HA 5J39A 2X4YA 3OS1A 3LX7A 3S3MA 1MHNA 2M0OA 3MP8A 4IUTA 2P0KA 3OYJA 4FL6A 5KH6A 4B9WA 4A4HA 4EDUA 5KE2A 3OYKA 1OZ3A 4LD6A 3F70A 2EKOA 2MWPA 2WACA 4NS5A 1SSFA 2RI3A 3Q1JA 3OQ5A 3OY9A 3OYBA 2RI2A 4QQGA 5FROA 4Z02A 3OYFA 3ASKA 3MEWA 4PLIA 4X34A 4E7IA 4PL6A 3OS0A 3LGFA 3MO8A 5D6YA 3PMIA 5J26A 4RG2A 3META 5FRMA 2MWOA 2JZ2A 3MP1A 2FHDA 2EQUA 1WJSA 2LDMA 3UT1A 3LYIA 4C5HA 4E7LA 3OMCA 4GY5A 2RHUA 5D6WA 2RO0A 3H6ZA 3CEYA 3QJ6A 2LTOA 2RJFA 2GF7A 2X35A 3QBYA 3ZEHA 3DB4A 2RHIA 4IUPA 4QQ6A 3FEOA 4N4IA 4E7HA 2R5AA 4OVAA 2XDPA 3LGLA 4UC4A 1G5VA 2R58A 5C0MA 4QVZA 1KHCA 3PNWC 2LCCA 3DLMA 2K3YA 2O4XA 4FU6A 4BE1A 4BACA 4QW2A 3OS2A 2PQWA 4N4GA 4BD3A 2HQEA 3L2WA 2GFAA 4IUVA 3P8HA 2RI5A 2F5KA 3OYIA 4ZTJA 3ME9A 5M9OA 3DB3A 3MEAA 1OI1A 2CKKA 3EAEA 2JTFA 3MEVA 3QIIA 4Q5WA 3LH0A 4N4HA 4B9XA 1H3ZA 4A4GA 4IUQA 5D6XA 2L3RA 3NTKA 2D9TA 1OYXA 3PMTA 3S6WA 5C6SA 3OYEA 2O4XB 3E9FA 5KCOA 2E6NA 3OYLA 4BE2A 4C5IA 3MP6A 2BKDN 2YRVA 2EQMA 3PFSA 1N27A 2XK0A 2DIQA 3BDLA 3OMGA 4IUUA 4C5GA 2EQJA 2RHYA 2HQXA 3GOXA 3NTHA 2BIVA 2B8AA 2X4WA 3S3OA 2RHXA 2L89A 3QKJA 2DIGA 4L59A 2NLUA
chains in the Genus database with same CATH superfamily
4BY6B 3CC2Q 4LD9K 2B86A 3JCMX 1YCYA 2ZPIB 2P0QA 2CUBA 3QO3A 2I2LA 1H3HA 2JTMA 4A4KA 3CC7T 3JCMJ 4M78A 4J9FA 2C0OA 2YUOA 5AYFA 3SWNC 3HSBA 1Z9QA 3JCMW 1YI2T 4HT8A 3P8DA 2K2VA 1RADB 2XD0A 4KRTA 2FRWA 2GFUA 3MPUB 4FW2A 2DAQA 5GAN3 2DERA 2KQWA 4DBQA 4EMKA 3URGA 1TOVA 2QG9B 1IRXA 1I8FA 3LX7A 3HRSA 4C92C 4PJOC 1QQJA 3M0SA 1S72T 5CVIA 1EZZB 1R77A 2EKOA 3VYGA 2CSIA 4JS4A 2A37A 5GAN7 2ZPGB 4ANJA 1Y96A 4OB1B 1VOMA 5FTMA 1OX9A 1WJSA 2LDMA 4C5HA 1W2BS 2DRKA 4AG2C 4Z89A 1RAFB 2EBPA 3EFOB 3CCUQ 1TS9A 1NLPC 2OTLA 1QCFA 1Y0MA 4KGZB 1ABQA 1MV0B 4BD3A 1YJ9Q 3A8LB 5GANe 2KDSA 4WCIA 4ZNXA 5LJ5j 3MEAA 4M7DF 4CC2A 2V8KA 3I35A 3LWHA 2XICA 2DILA 3BDUA 3M59A 3BQBA 2YUPA 1AOJA 1BYMA 2V8IA 2Y90A 4ELZC 1VQKT 3TSZA 3E2UA 4M78C 1AVZC 4OP0A 4M7DG 2DIGA 1AEYA 2NLUA 1YCSB 5GAN6 3EH1A 3OW2P 1IGQA 1D0XA 3EFRA 1VQOT 2DYIA 1LPLA 1RACB 2SEMA 4OMOA 2RA2A 1W6XA 4EMKC 1M3AA 3HTRA 3L1AA 4PJJA 3CCRQ 4DOWA 3S3NA 3AHUA 4PLLA 3M0QA 2DD4A 3L2RA 3GP8A 2CP3A 3KUFA 1QVPA 4PFPA 2QASA 1Y57A 2KY9A 2DL3A 1I81A 4OMFB 1FWZA 4C0ZA 3CD6T 2Y4YA 4HXJA 2Q18X 4J9DA 3X25B 4M7DE 4LDVA 1PKSA 1S72Q 3F70A 4OMPA 2E12A 1JJ2A 4PJNA 1BIAA 2RI2A 1YITT 1G3SA 1NYFA 3MEWA 1U3OA 2J6FA 4PLIA 4MZPA 5GMKl 2MWOA 3TIWA 4FM4B 4JLIA 1VQNA 4FT4A 5D6WA 3CCLT 1E6HA 4AG1C 3ULRB 1PG5B 1QKWA 4IUPA 5FTKA 2KMTA 5L23A 1YP5A 2J05A 3DLMA 4XTWA 4M75A 2HDAA 1W2BP 3H0FA 2ROLA 4PJOE 3OYIA 2NWMA 3RBBB 1M1KU 4OMLA 2G6FX 2GQIA 1H3ZA 4QKUA 1I1JA 2ZPHB 5HKCA 2CUDA 1LCKA 2A0FB 2CS7A 4ARCA 4FCYA 3CCJT 2QA4T 4IIMA 3C0CA 3QWYA 3LLRA 4XTYA 1MNEA 3UDCA 3OBWA 3OBYA 3OYNA 3UWNA 2IIMA 2LRQA 2RQVA 5KYWB 3G6ET 1BB9A 6AT1B 2QQBA 1YJNT 2XG8D 3M0RA 1B07A 1QWEA 1WHLA 1U5SA 2LZ6B 2KXCA 3VS0A 1O75A 1IREB 2BZYA 2PWYA 2KK4A 1NYGA 1GL5A 2OTLQ 4MZTA 2EFIA 2CREA 4PNOA 3FDRA 1CZ5A 1G2BA 5LJ3j 4C0DB 4RKUE 1C6VX 2M1HA 2X4YA 1X6GA 2Z0WA 1SRLA 4KODA 2FO0A 4AFZC 1PD0A 3HP9A 1OZ3A 4LD6A 3JCMQ 5I21A 1ZUUA 1N8RC 1EX4A 1YHQA 4Z88A 1VQ6A 3OYFA 1PHTA 1QCOA 2O9VA 5GMKh 3EGXA 5D6YA 5FRMA 3MP1A 4A54A 4M75C 1PSFA 2FPDA 1UHFA 1UGSB 2WSEE 1KD1U 2DM1A 2Y4XA 2RQTA 1UGRB 3QQ8A 3E19A 1Q7YU 2DXTA 4J9CA 3CPWS 1B34B 4XTZA 5A0GA 1KFZA 2MIOA 3M0TA 1HD3A 5FU6B 4BI4A 3FB9A 3OS2A 1VQ7A 1D3BA 4IUVA 2F5KA 4ESRA 2JM8A 5FTNA 1EIFA 1H641 2HL5C 4EPCA 2P4RA 2O88A 3DKMA 4XAXB 3R6OA 4M7AD 2EQJA 3QDFA 4J83A 1SSHA 1M1KC 1NJIU 5KYNA 3PE0A 2L89A 3CCJQ 1AWWA 2GTOA 2JMCA 3FPTA 3A8HB 1M1KR 4J9BA 3JV3A 1WHKA 4PK4A 1PCXA 1K73U 2L8DA 2L0AA 1ZA2B 4BDZA 1VQNQ 5FU7B 1NPRA 3QHSA 2NUTB 3GF5A 2DTIA 3C95A 3JAME 3I9QA 3U23A 2DJZA 2YUJA 1SHGA 3OYHA 3JCMf 3E9GA 2ED1A 3I56A 1NPPA 1QW1A 2CP6A 1VIEA 2ZPFB 3EGUA 3RDVA 4A4HA 4F7UF 1ZA1B 1M8VA 4M7AA 1SSFA 2JN0A 1M90C 2LP5A 3X20B 4ZN3A 1M90R 5CCBA 1UDLA 1R7RA 4E7LA 3LHDA 3PVQA 4RTUA 4F7UG 4E7ZA 1RL2A 4V2SA 3GIBA 1SRMA 5I2SA 4MDWA 2ECZA 1PM3A 4OVAA 1D1CA 2DL4A 5KYXB 4QVZA 3KXTA 2M02A 2GQVA 2K3YA 2WSCE 4FU6A 1OPLA 2QAZA 2W0ZA 1KQSS 5FWCA 3MEVA 4OB0B 4N4HA 3CPWP 1Q7YC 5CO7A 1D0YA 2CP2A 3OYLA 1BI2A 1AHJB 1Q7YR 1I5LA 4K11A 3OMGA 5CQXA 2YSQA 4RCCA 4DA4A 2OI3A 3NTHA 1QVGS 2PVGB 3C94A 2H3EB 1OULA 2CYZB 3A98A 1WLPB 2J6KA 2COWA 1WZOA 1YHQQ 4J7FA 1R8OB 1VQ6Q 3ZJTA 1OEBA 4DBHA 2DL7A 2G3RA 2L3QA 1JU5C 2EAYA 4WTOB 1I5OB 1NJIC 3G71A 3H8ZA 2OTJA 5LJ3f 3SD4A 1QMCA 5ECAA 4F17A 2LT4A 2P0PA 1I4K1 4PKCC 5LJ5g 1NJIR 3RR6A 3J80E 1GBRA 1T0HA 2DTOA 8AT1B 2ROTA 5IXFA 1K8AU 2RJDA 1UHCA 3FJPA 4KULA 1WXTA 2HKQB 1AZGB 3R6NA 1W2BA 1R0CB 4LDXA 2J06A 2O01E 2MWPA 3L2ZA 4M7DA 1AWJA 1ZSZB 3LGFA 1GBQA 2HEQA 3LW5E 5I2MA 1Q86C 4KO8A 3RNJA 2COYA 2DA9A 1ARKA 2EGAA 3MB5A 3EG3A 2HSPA 1Q86R 4N4IA 2JOYA 1PRMC 3J7AF 2YXYA 3OYYA 4AFQC 4RG8A 4X1VA 3TEEA 2MYSA 2HQEA 3L2WA 2KRSA 4E2FB 3CC7A 5GAOq 4YTLA 2XI9A 2JTEA 4IUQA 1YI2A 2J6OA 2CT3A 4JZ3A 4D6WA 2CP0A 2ZZDA 5GAOr 4NL3A 3TCJA 1KQSP 2YRVA 4TVRA 3I55T 3OSSC 3PVLA 4KGVB 3I56Q 2E3IA 2FYKA 5HY6A 2FL7A 2RHXA 2JM9A 1HYOA 2HBPA 1RAEB 7AT1B 2E70A 1PNJA 3NMZC 1G3TA 2BZ8A 2DMOA 4FT2A 4C8QB 1IHVA 3REBB 5IN1A 1KQ2A 1QVGP 1WJQA 1RAIB 3OW2S 5IHIA 3QJYA 2P84A 5IT9E 3CXCS 1C1AA 4M7AG 3HFOA 3L42A 2KI7A 1BK2A 1VQPT 4OF1A 3CCQT 2DZCA 2C0IA 1RLQC 4M7DC 5KYUB 4KH1B 1FX7A 2QGFB 5GAMd 3NPFA 1CKBA 3HHTB 4AMCA 1X2KA 3LH5A 4CC7A 3OYKA 4JRIA 1TUDA 4XTXA 2FZKB 4NS5A 2RI3A 5GANd 1VQMT 2D0NA 3MO8A 3VS2A 3META 2GTJA 1VQKA 4B6MA 2QK0A 2RHIA 2LJ3A 1TUGB 4M7AE 2DLPA 2EGCA 4KGXB 2EYZA 3E1SA 2O4XA 2L5QA 2RPNA 1VQOA 5CQYA 1WYXA 5EC7A 5EPPA 1T3LA 3JCMe 3QPHA 5LJ3g 1MMAA 2DFUA 3DB3A 4M77B 2VGMA 4QQ6A 3G71Q 3EGDA 2OTJQ 2HD0A 5GJWB 5C6SA 2KROA 3CCET 5GAMe 1VQ9T 2QQAA 4HCKA 1WPYA 2YT6A 1N27A 3BDLA 1Y07A 4QVDA 3EFSA 5KYYB 2CZ7B 3QYGB 4FYVB 1G83A 2EYXA 5HCKA 2EIFA 1QVFS 3CD6A 4PFOA 1GXIE 1EFNA 4FSXA 4RTZA 2PZ1A 4BI3A 3EHQA 2EWNA 2EYWA 3EH2A 3OB9A 2E5QA 3GBQA 4FYYB 4E7JA 4ZTFA 2SRCA 4FIBA 2DXCA 1YITA 4N0AA 2BTTA 4A4EA 4F14A 4D8KA 4KLNA 5CKHA 1MMGA 3IQLA 4OGEA 1D1AA 3CCLA 1B34A 2E64A 3NTIA 3P8BB 4JJBA 2BUDA 3BE3A 1OOTA 3MKDA 1OQKA 3CXCP 3CC7Q 5FTJA 2VXEA 5KH6A 1WIEA 4B9WA 2CP5A 2LQKA 3SWNB 1AT1B 1LOJA 1YI2Q 1MMNA 3OS0A 3UPUA 3CPWA 5A2QE 4LN2A 2FHDA 2EQUA 1S1NA 3M58A 4GY5A 4A63B 2AZVA 4JLGA 2LNVA 2X35A 3REAB 3DB4A 1N6AA 3RIRA 3CCJA 1AWXA 2QA4A 1M9SA 2RQWA 2PTKA 2XDPA 4HA8A 4LUEA 3ZBDA 3JCMb 1V29B 3CMEA 3NFCA 2E41A 4C92B 4PJOB 5IXBA 1BU1A 1I07A 2PQWA 2RNAA 4NOYA 1VYVA 4C0DC 3G6EA 1WFWA 2C0TA 2VWFA 3H0IA 3M54A 1YJNA 1OI1A 2JTFA 2ZCFB 1VQ4T 2K5FA 8ATCB 4RTYA 3S6WA 2H3JA 3CCEQ 3UF4A 2OAWA 1VQ9Q 2EQMA 2L3SA 2PNIA 4IIOA 3UA7A 3HRTA 1PD1A 5GAN4 3CC4A 3ZFJA 1H8KA 2OJ2A 4N0AC 1YN8A 3T9NA 4RTWA 2EJFA 4HCZA 4F7UA 1C0MA 2CH4W 1KC8U 1E32A 3H9NA 1QWFA 2R57A 2DL8A 4XU0A 1QVFP 5CKFA 4BDYA 4IKFA 1NE8A 5KCHA 2K6DA 1TUCA 3G4ST 1VQKQ 1JB0E 1QCSA 2JXBA 3C4SA 1NM7A 2QI2A 2J7IA 4M78B 3PT9A 1AZEA 4HKEA 2DYBA 2YUQA 3TSWA 3CMET 2D6FA 2X4XA 1PSEA 1VQOQ 1U06A 1R0BG 4XK8E 3MP8A 3BW1A 3OYJA 2YVLA 2ABLA 3CCVA 1NEGA 2KBTA 1IHWA 1BCOA 2KRMA 1BKBA 1O9SA 4BB7A 4EMKB 1K9MU 4KT0E 1HK9A 5FROA 2KVQG 2EVRA 2XMFA 1NEBA 2RK1A 1LVKA 4JS5A 2JZ2A 1W1FA 2RQUA 3CC4T 4CI0C 3GLXA 1WLFA 4KUDK 3CD6Q 2DX1A 3FEOA 1M2VA 1NBEB 2YWWA 3X24B 3RERA 4HVWA 1QDNA 5IH2A 3EG0A 3HFNA 3SEMA 2EPDA 2GFAA 1YITQ 1RLPC 1VQLT 2HSEB 1IO6A 4HT9A 1U8RA 3EAEA 3LH0A 4Y91A 1FMVA 5C1BA 2EJGA 3CCLQ 4L6V5 2W10A 5IHKA 1QKXA 5CD1A 3ZGZA 2YDLA 5DM7R 4HCCA 2MM0A 5LJ5f 1ABOA 3CCST 4JJDA 2A28A 3QKJA 3CCVT 5DLQE 2LX9A 1ZUKA 2LJ0A 4LDUA 1VQ8T 2CP7A 1ZSZA 2HNIA 3V8LA 2FPEA 1UG1A 2LX7A 2DBMA 4C8QD 2K2MA 2KAFA 2MM2A 4MDXA 2RJEA 1M5Q1 1WA7A 3M0UA 3QXEB 2GGRA 3PIOA 3N5BB 3V8JA 1BCMA 1KG1A 5KE3A 3D7SB 1WQWA 4ZGEB 3PTAA 2QA4Q 1YNZA 4Y28E 2M9UA 2CSQA 3CMEQ 4BI8B 5GAOn 3SFMA 3OS1A 3S3MA 1AWOA 2ZAEA 2XIDA 3G6EQ 5KE2A 4X9CA 4JJCA 1YJNQ 1KHIA 4QT7A 4GLMA 4MZMA 3OYBA 4C0FA 2KGTA 3ASKA 3QWXX 4E7IA 3EG9B 4XU2A 5AT1B 4CC4B 5J26A 4RG2A 4R0KA 1D0ZA 3FRNA 2KNBB 1E7OA 2LW6A 3CC4Q 2ZPBB 2P4TA 3QBYA 2EGEA 3H41A 3LGLA 2VVKA 5GLFA 3RKWA 1CKAA 4JJNK 1K4US 2LMJA 1CR5A 1X43A 1YJWT 1JXMA 3ZJUA 1KJWA 2MMPA 5CCXA 4A4GA 4M77D 4CC3A 3JCMP 4M75B 3VUZA 2BKDN 3JB9I 2D8JA 3JCMc 2F5TX 2PVDB 9ATCB 1HSQA 4LXCA 4DBRA 3OW2A 3QC8A 3VRZA 2DJQA 3CCVQ 3OYAA 3UATA 1VYUA 1TWBA 2FB7A 1KD1C 2HL3A 3RMQA 1SEMA 2AKKA 5LL6S 5B6CA 2K3XA 2QQRA 1JBMA 1KD1R 2M16A 3RUXA 2LCSA 2JS0A 5CIUA 2R5MA 2LJ1A 2RQRA 2V1RA 4F7UE 3CMAA 2JW4A 5FTLA 1OZ2A 1Q81U 4AT1B 3M55A 3M56A 4AFSC 2AKLA 4E6RA 2X4JA 3TVTA 2M0OA 3WVEB 2D0QB 2CZ6B 3QG1A 1F1BB 3VS6A 5GMKe 3EFOA 1BI3A 3DLLA 4DOVA 4J8OA 5EQJB 3HU1A 2BZXA 2K9GA 4PL6A 1JJ2P 3A8MB 1ZLMA 1M27C 1YIJT 2QXFA 2Q19X 3EHRA 4JDSA 4ARIA 4M7AC 3I55A 1KIKA 1SF9A 2I0NA 1K73C 1ZBJA 2D1XA 1OV3A 4RTTA 4ZN1A 1MGQA 3BY7A 2KR3A 3QQ7A 1K73R 1SHFA 1B7TA 3EGXB 4BUGA 1RAGB 2FZGB 4BY6C 4BE1A 3CCMT 5GAMh 4BACA 3CC2T 3P8HA 4C92D 1N9RA 4PJOD 3RMSA 2PUOB 4F16A 4GBQA 1K0SA 3VJPA 4LNPA 2L3PA 3TU4K 3NGPA 4FYXB 2YRDA 5GANh 2LT1A 2EW3A 4BE2A 1X01A 2MI6A 2O31A 3CMAT 4PJMA 1WXBA 1VQPA 1D3BB 4KDLA 2DIQA 2RD1A 2GNCA 4NL2A 3MCAB 3CCQA 2OX7A 4CQNA 1VUBA 4RMOA 3QUIA 1UEBA 1X2QA 4II1A 2Q1CX 4J9HA 2VXFA 2DETA 1SG5A 5CKEA 1VQMA 1JQQA 5DYGA 5FRNA 1M3BA 3JSCA 4J5YA 2MF2A 4C8QF 2JUFA 2NYSA 3CCUT 2H8HA 4M78D 2CT4A 5LJ5e 1UB4A 3JB9D 4RUGA 1RABB 1ZQ1A 4FL6A 4C8QG 2YLCA 4JUVA 3JCMd 3OQ5A 1YJ9T 1Y7XA 1FMKA 1YWPA 1W70A 4X34A 2V8JA 3X26B 2QGGA 4XU1A 2FVUA 3CCEA 1M1FA 1BBZA 1FYNA 5IHNA 1VQ9A 1Q95G 1IGUA 5FWBA 4J6XA 3LYIA 2F2WA 2MOXA 3H6ZA 2RJFA 1Z9ZA 2F2VA 2CZ0B 1CZ4A 3GNFB 2R5AA 3QYHB 2QQ9A 1G5VA 3GPLA 5DLOA 3TREA 2LCCA 5A0LA 2YLBA 3ZJVA 1VQ5A 4ELYC 1JRIA 3BFMA 4WF2A 4N4GA 2AZSA 1K8AC 2ATCB 1GRIA 3HU3A 5M9OA 1QCNA 4L5GA 1UJYA 1K8AR 4C8QE 2KXDA 3VU3C 2X51A 1WI7A 4M4ZA 3NTKA 2EJ9A 2D9TA 3JCMV 2DO3A 3OS5A 2COZA 2IPOB 2QDYB 3CCRT 3CMAQ 3PFSA 1X27A 2MAMA 5KYWA 2M51A 4J6WA 4M77F 2JV2A 5GJVB 3JB9H 1K9AA 5DY9A 2RMOA 2E6ZA 2K4YA 2CDTA 1T3SA 1XNIA 4Y92A 2MCNA 2AHJB 4A4FA 5FLXE 2KT8A 4C0GA 1V76A 4EIKA 2AK5A 1D1BA 2EQKA 2K79A 3OYCA 4M77G 1M8MA 2DXUA 1M3CA 1J3TA 3O8VA 2JJ9A 3I55Q 3X28B 4DBFA 2VASA 2VYTA 3L2QA 1Q82U 1GFDA 3EG1A 1WJRA 4IURA 2HZYA 5CKBA 2CGHA 1G3WA 1VQ5T 5LJ3d 5J39A 4R55A 2DZ9A 4IUTA 2P0KA 2HBWA 4OGCA 1CSKA 2DPPB 2WACA 3Q1JA 1IZ6A 2F69A 3VS7A 2RN8A 5DYIA 2E10A 1VQ4A 2FPFA 3QZ5B 2DEUA 3CBPA 3H0HA 1XOVA 1JO8A 4OB2B 5FW9A 4M77E 1KQ1A 1VQPQ 4EMGA 3CCQQ 1VIFA 2HMAA 1NZ9A 1N9SA 4ME7A 4M7DB 5C0MA 3PNWC 5GAN8 4JPBW 1ZBXA 2CZ1B 2OAUA 4LE9A 3VV0A 2LCLA 3A8GB 2MPXC 1WQ7A 1VQMQ 2AT1B 5GAOm 3VS1A 1SKUB 1V1CA 2KE9A 2ENMA 5KCOA 3G4SA 3VKIA 4C92F 1OX8A 4PJOF 5LJ3e 3PIPA 2D8HA 4M75D 3ER0A 5CCAA 4E7SA 2B8AA 3V7CA 2OTLT 2A08A 2VKNA 3S3OA 1N8RU 2DE0X 2C06A 2B25A 2RH2A 1IXDA 2O2OA 3FPRA 5GAN5 4E7KA 4C92G 1X69A 1X6OA 3EG9A 1PKTA 4PJOG 2NUTA 4AFUC 2EYQA 3OYMA 3PGGA 2HCKA 5IAYA 3M9QA 2E3HA 4QVCA 5I11A 3OYGA 3RESA 4Z8AA 3A8OB 2DNUA 2HQHA 1UE9A 2EKHA 1QP3A 2FRYA 2KYBA 4CRIA 3HPWA 4FYWB 5J3BA 2KEAA 3I5SA 3THKA 1WHGA 3GNGA 5GAMj 2NUPB 1VQ5Q 1DJ7B 1UFFA 1GCPA 4MMKA 5FU6C 1W4SA 1VQLA 1Q82C 1YBYA 3TQ7P 2DBKA 5GANj 4C92E 4M78F 2JNGA 1U1TA 5KYXA 1Q82R 4LUDA 3C12A 2AIRB 3JB9F 1TU0B 4ZGJB 3J81E 3V8KA 1NG2A 3KBGA 1WHJA 2RO0A 1KK7A 4GLKA 3VS3A 3CCSA 3ZEHA 4KUIA 4M78G 2HAXA 2DL5A 3I5RA 1BIBA 1RAHB 4VUBA 2R58A 3JB9G 3SHWA 2JS2A 1H92A 1VQ8A 3QWZA 1UGQB 2LQWA 3M4GA 4RTVA 2X3WD 1P92A 4XU3A 1RI9A 2GBQA 2F1LA 1A0NB 5D6XA 2L3RA 1KQSA 2O4XB 3E9FA 2E6NA 3G7ZA 4J9GA 5FU7C 4OMMA 4XTUA 2QTXA 3NHNA 2PVOB 1VQNT 4OMQA 3HRUA 2XK0A 3CQTA 1K1ZA 2FZCB 1WNLA 4RTXA 2BIVA 1Y96B 2CH4A 3EGDB 1M90U 1WX6A 2QEXA 3M5AA 4M78E 4XTVA 1ZC1A 3FPUA 1XJWB 1QVGA 1WGSA 2DD5A 1VQ4Q 1XQHA 3FC3A 1GCQA 1QP2A 3M4YA 2RK2A 2K5LA 1UTIA 3WVDB 5GAN2 3FLGA 2IVWA 1MUZA 3EG2A 2IG0A 5CR2A 1N8RR 4C5EA 2XHCA 3CBMA 4LDYA 1QLYA 3MJXA 1ACMB 2PJHB 3AT1B 2ZPEB 3OA6A 3CF2A 4OMNA 1ZSGA 1G3YA 3V7RA 3VRYA 1XTDA 1RAAB 2V26A 1YJWA 1TTHB 5GMKi 1WHHA 3RKXA 3OY9A 1ZHIA 2K5IA 2KYMA 2F2XA 3HU2A 3G4SQ 1HJDA 3SB2A 1KC8C 3VUBA 1UJ0A 3M0PA 4RCBA 2KT1A 1KC8R 1JJ2S 4XQ3A 2QEXT 4J9EA 2DXBA 4DEYA 3WXMB 5ERGB 1K76A 1JEGA 3MHXA 2WSFE 2RI5A 2NUZA 5C18A 3G1JA 4LDWA 3A1PA 4ZTJA 2VUBA 2YHTA 4AS1A 1YHQT 2V1QA 1LNXA 2CKKA 3VS5A 1VQ6T 2LQ8A 1OYXA 3PMTA 2JT4A 1S3SA 4F04B 4C8QA 2L2PA 2LNHB 2LC4A 4C5IA 4JZ4A 1K9MC 4O6JA 1X6BA 2FG0A 1RUWA 4DEXA 4P5NA 1MNDA 2HQXA 2FEIA 3HKSA 2BE7D 2K3BA 1K9MR 2DVJA 1GCQC 1VYTA 1MV3A 4KDIA 1OPKA 3UA6A 3L2UA 4QQDA 1VQLQ 1E6GA 4M75F 2RHZA 1K0XA 1TSFA 4RV0A 1M4ZA 2XU8A 1VQ7T 5GMKm 1Q86U 2KSSA 2QDLA 2QQSA 3V7SA 5KYUA 1OU8A 1U1SA 2XKOC 1YIJA 3ZL7C 1ZSZC 1HXDA 5LJ5h 5GAMf 2DK3A 4M75G 2Q1AX 4PJLA 3OYDA 1G8XA 4F7UB 1GFCA 3CCSQ 4HCBA 1M2OA 2E5KA 1IB8A 1WHMA 1PC0A 3MEUA 2DF6A 4BE0A 4JRQA 3RKYA 2RJCA 3LGAA 3CXCA 5GANf 2VV5A 1VQ8Q 2E1HA 1JXOA 3M53A 4A53A 2O9SA 2PU9B 3CCMA 1MHNA 1LJOA 4ZGDB 3CC2A 4O5VA 2QYZA 5CKDA 2XDDA 4D8DA 4QQGA 1YFNA 2E65A 3FIFA 1UECA 2M0YA 3PMIA 4PFZA 2E4HA 1MMDA 4FW1A 4AQ7A 3CEYA 3M57A 3OSVA 3QJ6A 2LTOA 4M77A 1PWTA 2GF7A 4KBMB 4M75E 1X75C 4MMLA 2QEXQ 3I56T 2RF0A 1SPKA 4M7DD 2JMAA 2KRNA 2X9HA 4ATOA 4X9DA 3HL8A 4C8QC 2JVVA 3ME9A 5KYYA 1WXUA 4ORZA 1M2VB 4FSSA 3JCMh 2XDBA 3OYEA 3VS4A 5D7UA 1KSWA 2YUNA 4HVUA 2DTHA 1B3QA 1UGVA 2VB6A 3CCUA 2ZGWA 1D09B 2X4WA 2VGNA 4JRKA 5A0DA 3QZ9B 1YJWQ 3VYHB 5LJ5d 2GCXA 1WDXA 1QVFA 1YJ9A 1VQ7Q 1UGPB 4J7IA 5L8RE 3O5ZA 2A7YA 3FJ5A 2MK5A 1N5ZA 5CAIA 3L2VA 3CBOA 1TG0A 1ZUYA 1FMWA 5GAOl 4JRPA 1RI0A 3JRZA 2EQIA 3SWNA 5I22A 2ESWA 2HKNA 2ED0A 2Q1DX 2LVMA 1FXXA 1YWOA 2K7AA 3LWIA 2EYYA 4J9IA 4DQ2A 2X3XD 4EDUA 5CK9A 1O54A 4HVVA 1TXQA 4E47A 3JB9J 4M77C 4Z02A 1BI1A 2BE9B 4OB3B 5EG2A 3G71T 4C92A 3CCRA 4PJOA 2DKGA 2OTJT 2A3LA 1UUEA 2DRMA 3UT1A 3OMCA 2RHUA 5GAOp 3JCMg 3QSUA 1TH7A 2DVEA 1PRLC 4E7HA 5HK0A 1M30A 4EMHA 1M1GA 4UC4A 4R56A 2A36A 2YRCA 1KHCA 1ZX6A 1OU9A 5LJ3h 4QW2A 3SDZA 1Q81C 5GAMg 3A5ZB 3CPFA 1S72A 4M7AF 1YIJQ 4Q5WA 4B9XA 3QIIA 1Q81R 1I9GA 2K57A 3KFVA 1NLOC 3INZA 5GMKj 2VC8A 1BI0A 2LQNA 4M7AB 2RM4A 1T0JA 1AD5A 5GANg 1VA7A 4J6YA 2DEQA 2NUPA 3MP6A 4KH0B 1Y71A 2RB6A 2QTVA 4IUUA 5HK3A 2PUKB 4C5GA 2RHYA 3GOXA 1I0CA 4L59A 3CCMQ 3QDRB
chains in the Genus database with same CATH topology
5DLQE 4BY6B 2LX9A 4LD9K 3FPRA 3JCMX 1YCYA 2ZPIB 5GAN5 4E7KA 4LDUA 4C92G 2P0QA 1X6OA 4PJOG 1VQ8T 2HNIA 2EYQA 3QO3A 3PGGA 2I2LA 1R8OB 4J7FA 3V8LA 3OYMA 5IAYA 2JTMA 4A4KA 3CC7T 4C8QD 2KAFA 3M9QA 4M78A 3JCMJ 3ZJTA 5AYFA 3SWNC 4QVCA 4MDXA 2MM2A 3OYGA 3RESA 3HSBA 2G3RA 3QQ8A 2EAYA 3A8OB 2RJEA 3JCMW 1M5Q1 1NJIC 3G71A 3H8ZA 3QXEB 1QP3A 2OTJA 5LJ3f 3SD4A 1YI2T 3P8DA 2K2VA 4HT8A 3PIOA 2LT4A 3N5BB 3V8JA 2XD0A 1KG1A 2P0PA 1I4K1 4PKCC 5LJ5g 1Q7YU 5KE3A 4CRIA 2GFUA 3HPWA 3J80E 1WQWA 2DAQA 2DTOA 5J3BA 4ZGEB 5GAN3 3PTAA 2KQWA 4Y28E 4EMKA 2M9UA 1K8AU 3URGA 2RJDA 3GNGA 3FJPA 5GAMj 4BI8B 5GAOn 1DJ7B 4KULA 3SFMA 3OS1A 1I8FA 3LX7A 3S3MA 3HRSA 4MMKA 2XIDA 4C92C 4PJOC 5FU6C 4X9CA 5KE2A 1S72T 5CVIA 1W2BA 1W4SA 1VQLA 1Q82C 1YBYA 4LDXA 1KHIA 2O01E 2EKOA 2MWPA 3VYGA 3L2ZA 4M7DA 5GANj 4MZMA 4C92E 4M78F 2JNGA 4C0FA 3OYBA 4JS4A 1U1TA 3ASKA 4E7IA 4XU2A 3C12A 3LGFA 3JB9F 5GAN7 2ZPGB 4ZGJB 3J81E 3LW5E 5I2MA 5J26A 4RG2A 3V8KA 1Y96A 4OB1B 5FTMA 1Q86C 3KBGA 1WJSA 2LDMA 3FRNA 4C5HA 1W2BS 4KO8A 2LW6A 2RO0A 4GLKA 2ZPBB 3CCSA 2P4TA 3QBYA 3ZEHA 3MB5A 4KUIA 2OTLA 4M78G 4N4IA 2HAXA 2JOYA 1BIBA 3LGLA 4VUBA 3J7AF 2R58A 3JB9G 3OYYA 4RG8A 5GLFA 1VQ8A 3RKWA 3QWZA 4JJNK 1UGQB 3M4GA 4BD3A 3TEEA 2HQEA 3L2WA 3CC7A 1CR5A 3A8LB 5GANe 2KDSA 5GAOq 1P92A 4XU3A 4YTLA 1YJWT 3ZJUA 2XI9A 5LJ5j 3MEAA 4M7DF 2MMPA 5CCXA 4A4GA 2V8KA 4IUQA 4M77D 5D6XA 2L3RA 3LWHA 3JCMP 1YI2A 2XICA 1KQSA 2O4XB 3E9FA 4D6WA 2E6NA 3G7ZA 2ZZDA 4M75B 3BDUA 5FU7C 3M59A 4XTUA 2QTXA 3BQBA 3VUZA 5GAOr 4NL3A 2PVOB 2BKDN 2YRVA 4TVRA 3TCJA 1VQNT 1BYMA 3HRUA 3I55T 3OSSC 2XK0A 3JB9I 2V8IA 2Y90A 3JCMc 2F5TX 2PVDB 4ELZC 1WNLA 1VQKT 2BIVA 1Y96B 2FYKA 4M78C 4OP0A 2FL7A 5HY6A 4M7DG 3OW2A 3QC8A 2RHXA 2DIGA 1M90U 2HBPA 2NLUA 2E70A 5GAN6 3OYAA 2QEXA 1G3TA 2FB7A 3M5AA 4M78E 4XTVA 1KD1C 4FT2A 4C8QB 1QVGA 1ZC1A 3EFRA 3FPUA 3RMQA 1WGSA 2DD5A 1VQOT 5B6CA 5LL6S 2K3XA 5IN1A 1KQ2A 2QQRA 1JBMA 2RA2A 2M16A 3RUXA 1XQHA 3FC3A 1WJQA 3M4YA 1QP2A 4EMKC 3OW2S 2RK2A 3L1AA 2K5LA 4DOWA 5CIUA 3WVDB 3S3NA 3QJYA 4PLLA 5GAN2 2R5MA 5IT9E 3AHUA 2DD4A 3L2RA 3FLGA 3GP8A 3CXCS 2IVWA 4M7AG 2IG0A 3HFOA 3L42A 3KUFA 5CR2A 4C5EA 2XHCA 3CBMA 4F7UE 4LDYA 1QVPA 3CMAA 1VQPT 5FTLA 1OZ2A 2KY9A 2PJHB 4OF1A 2ZPEB 2DZCA 3CCQT 1I81A 1Q81U 4OMFB 3M55A 4M7DC 3M56A 1FWZA 5LJ5f 3OA6A 1FX7A 4C0ZA 5GAMd 3CD6T 3CF2A 2X4JA 2M0OA 2Y4YA 2Q18X 1G3YA 3HHTB 3X25B 3WVEB 2D0QB 4M7DE 3V7RA 2CZ6B 3QG1A 4LDVA 5GMKe 1XTDA 4JRIA 3OYKA 1BI3A 3F70A 4XTXA 5GMKi 2E12A 4NS5A 4DOVA 3DLLA 2RI3A 3RKXA 3OY9A 1BIAA 1JJ2A 1ZHIA 4J8OA 2RI2A 2K5IA 5GANd 1G3SA 1YITT 3HU1A 5EQJB 3HU2A 3MEWA 4PLIA 4PL6A 3A8MB 1VQMT 3MO8A 4MZPA 2QXFA 1YIJT 2Q19X 3META 3SB2A 2MWOA 3VUBA 5GMKl 1KC8C 3TIWA 4JDSA 4FM4B 4JLIA 4ARIA 1VQNA 4M7AC 3I55A 4FT4A 4RCBA 5D6WA 3CCLT 1K73C 1JJ2S 1VQKA 2RHIA 4IUPA 5FTKA 4XQ3A 4ZN1A 2QEXT 4M7AE 2KMTA 1MGQA 3BY7A 2DXBA 3QQ7A 3WXMB 3DLMA 3E1SA 4XTWA 2O4XA 4BUGA 2L5QA 3MHXA 5ERGB 4BY6C 4BE1A 4M75A 2WSFE 5GAMh 3CCMT 5CQYA 4BACA 1VQOA 4PJOE 5EPPA 3JCMe 3CC2T 3QPHA 5LJ3g 3P8HA 2RI5A 4C92D 1N9RA 4LDWA 3OYIA 3RMSA 4PJOD 4ZTJA 5C18A 2VUBA 2PUOB 3DB3A 2YHTA 4M77B 1M1KU 4AS1A 1YHQT 2VGMA 1LNXA 4QQ6A 3VJPA 2CKKA 1H3ZA 2HD0A 1VQ6T 3TU4K 2LQ8A 2ZPHB 5GANh 1OYXA 3PMTA 5C6SA 1S3SA 2LT1A 3CCET 5HKCA 4BE2A 1X01A 2MI6A 4C8QA 5GAMe 4C5IA 2LC4A 1VQ9T 3CMAT 2QQAA 2CS7A 1WPYA 1K9MC 4O6JA 1VQPA 1D3BB 4KDLA 1N27A 3BDLA 2DIQA 1Y07A 4ARCA 2RD1A 4NL2A 3CCQA 3MCAB 4P5NA 4QVDA 2HQXA 3EFSA 1VUBA 4CQNA 3HKSA 4RMOA 2CZ7B 3QYGB 3CCJT 2QA4T 2EIFA 1QVFS 3QUIA 3CD6A 1UEBA 4KDIA 1GXIE 4FSXA 4II1A 2Q1CX 4BI3A 2EWNA 3L2UA 3OB9A 4QQDA 3LLRA 4M75F 4XTYA 2RHZA 2E5QA 3UDCA 3OBWA 4RV0A 3OBYA 1M4ZA 2VXFA 2XU8A 3OYNA 3UWNA 4E7JA 4ZTFA 5GMKm 1VQ7T 2LRQA 2DXCA 4FIBA 3G6ET 1Q86U 1YITA 4N0AA 2KSSA 5CKEA 2QQBA 2QQSA 3V7SA 4A4EA 2XG8D 1YJNT 1VQMA 1U1SA 2XKOC 1YIJA 4KLNA 5CKHA 5DYGA 1HXDA 5FRNA 5LJ5h 5GAMf 4OGEA 1O75A 2DK3A 3JSCA 4J5YA 4M75G 1IREB 2Q1AX 3OYDA 3CCLA 2MF2A 1B34A 2E64A 2KK4A 3NTIA 2JUFA 4C8QF 4F7UB 4HCBA 4MZTA 3P8BB 2EFIA 2BUDA 3MEUA 4BE0A 4JRQA 4PNOA 3RKYA 2RJCA 3FDRA 3CXCA 3CCUT 3LGAA 1CZ5A 5LJ3j 5GANf 2VV5A 4RKUE 4C0DB 2E1HA 2M1HA 4M78D 3M53A 2X4YA 4A53A 5LJ5e 2PU9B 3CCMA 1MHNA 1UB4A 3JB9D 1ZQ1A 4KODA 1LJOA 2VXEA 4FL6A 4ZGDB 4B9WA 5KH6A 3CC2A 3HP9A 2YLCA 4C8QG 4JUVA 1OZ3A 4LD6A 4O5VA 5I21A 3JCMQ 1N8RC 2LQKA 3SWNB 5CKDA 1YHQA 3JCMd 3OQ5A 2XDDA 1YJ9T 1Y7XA 1LOJA 4QQGA 1VQ6A 3OYFA 4X34A 3FIFA 2E65A 2V8JA 3X26B 3OS0A 3UPUA 5GMKh 3CPWA 5D6YA 4XU1A 2FVUA 3PMIA 1M1FA 5A2QE 3CCEA 5FRMA 1YJWA 1VQ9A 3MP1A 2FHDA 4A54A 2EQUA 1PSFA 4M75C 3LYIA 4J6XA 3M58A 4GY5A 3H6ZA 1UGSB 2WSEE 3CEYA 3M57A 1KD1U 4AQ7A 3OSVA 2Y4XA 3QJ6A 2RJFA 2LNVA 2GF7A 2LTOA 2X35A 4JLGA 1UGRB 1N6AA 2CZ0B 3DB4A 3RIRA 3CCJA 3E19A 1CZ4A 4KBMB 1M9SA 3GNFB 2DXTA 2R5AA 4M75E 1X75C 2QQ9A 2XDPA 3QYHB 4MMLA 3GPLA 1G5VA 3I56T 5DLOA 2PWYA 3CPWS 1B34B 4HA8A 4XTZA 2LCCA 3TREA 1V29B 2YLBA 3ZBDA 5A0GA 5A0LA 3JCMb 3NFCA 3CMEA 4M7DD 2E41A 4C92B 4ELYC 1VQ5A 4X9DA 4ATOA 5FU6B 4PJOB 1JRIA 3BFMA 3FB9A 3HL8A 2PQWA 4N4GA 4NOYA 4WF2A 4BI4A 3OS2A 4C8QC 1K8AC 1VQ7A 1D3BA 4IUVA 4C0DC 2JVVA 3G6EA 2F5KA 3ZJVA 3HU3A 3ME9A 5M9OA 3M54A 5FTNA 1EIFA 1YJNA 1OI1A 2JTFA 4L5GA 2ZCFB 4C8QE 3VU3C 1VQ4T 2K5FA 3JCMh 1H641 3NTKA 4EPCA 2EJ9A 2XDBA 2D9TA 3JCMV 3OYEA 3S6WA 2H3JA 2DO3A 3OS5A 2QDYB 3CCRT 3DKMA 4XAXB 2DTHA 3R6OA 2EQMA 3PFSA 4M7AD 2MAMA 3HRTA 2EQJA 4M77A 4J6WA 5GAN4 3CCUA 2ZGWA 4J83A 4M77F 3CC4A 2JV2A 3ZFJA 1NJIU 1M1KC 3JB9H 4N0AC 2X4WA 2VGNA 2L89A 5DY9A 2K4YA 2E6ZA 1XNIA 4JRKA 5A0DA 3T9NA 3QZ9B 3A8HB 3FPTA 2AHJB 4A4FA 2EJFA 5FLXE 4HCZA 4F7UA 3VYHB 4C0GA 5LJ5d 2GCXA 5DYIA 1KC8U 1QVFA 1YJ9A 1E32A 1UGPB 4J7IA 2EQKA 3OYCA 4M77G 2R57A 5L8RE 4XU0A 2A7YA 2DXUA 1K73U 2L8DA 5CKFA 4BDYA 5CAIA 3L2VA 3O8VA 4BDZA 4IKFA 5FU7B 1NE8A 1NPRA 3CBOA 3X28B 3CCVT 3QHSA 5KCHA 4JRPA 5GAOl 3L2QA 1RI0A 2VYTA 3GF5A 3G4ST 1Q82U 2DTIA 1JB0E 3C95A 3JRZA 1WJRA 3JAME 2DJZA 4IURA 1QCSA 3SWNA 2YUJA 3C4SA 2QI2A 4M78B 3OYHA 5CKBA 3PT9A 4HKEA 2Q1DX 2LVMA 1FXXA 3JCMf 3CMET 3E9GA 3I56A 2CGHA 2X4XA 1G3WA 1PSEA 1NPPA 1QW1A 3LWIA 1VQ5T 2D6FA 5LJ3d 5J39A 4R55A 4DQ2A 1VIEA 2DZ9A 2ZPFB 4XK8E 4IUTA 3MP8A 3BW1A 2P0KA 3OYJA 2YVLA 3CCVA 4OGCA 4A4HA 2DPPB 4EDUA 5CK9A 1O54A 4F7UF 1BKBA 1M8VA 2WACA 4M7AA 1SSFA 2JN0A 3Q1JA 1IZ6A 1O9SA 2F69A 4BB7A 4EMKB 3PIPA 1M90C 2E10A 4E47A 3JB9J 4KT0E 1HK9A 4M77C 1K9MU 1VQ4A 5FROA 4Z02A 3QZ5B 1BI1A 3CBPA 2KVQG 3X20B 2RK1A 4ZN3A 4OB3B 5EG2A 1XOVA 3G71T 4C92A 4OB2B 3CCRA 4JS5A 2DKGA 2JZ2A 4PJOA 4M77E 1KQ1A 2OTJT 2A3LA 5CCBA 1R7RA 4E7LA 3UT1A 4EMGA 3OMCA 3LHDA 2RHUA 5GAOp 3CC4T 1VIFA 4F7UG 5FTJA 4CI0C 3JCMg 1NZ9A 1RL2A 3GLXA 1WLFA 3QSUA 1N9SA 4KUDK 4ME7A 3GIBA 5I2SA 4V2SA 1TH7A 4MDWA 4M7DB 2DVEA 3FEOA 4E7HA 4OVAA 5HK0A 4EMHA 4R56A 1M1GA 4UC4A 3X24B 5C0MA 4QVZA 3RERA 3KXTA 1KHCA 3PNWC 5GAN8 1QDNA 2GQVA 2K3YA 2WSCE 3HFNA 4FU6A 1ZBXA 5LJ3h 4QW2A 2CZ1B 3SDZA 2OAUA 2GFAA 3VV0A 5GAMg 1Q81C 2LCLA 3A5ZB 1KQSS 3A8GB 1VQLT 1WQ7A 3CPFA 1S72A 4HT9A 4M7AF 5GAOm 1U8RA 3MEVA 3EAEA 4Q5WA 4B9XA 3QIIA 4OB0B 3LH0A 4N4HA 1I9GA 2K57A 1Q7YC 4Y91A 2QA4A 3INZA 5CO7A 2VC8A 5GMKj 5C1BA 2EJGA 1BI0A 4L6V5 5KCOA 4M7AB 3OYLA 2RM4A 3G4SA 3VKIA 4C92F 5GANg 4PJOF 4J6YA 1BI2A 2DEQA 1AHJB 3MP6A 5LJ3e 5CD1A 1Y71A 1I5LA 3ZGZA 2RB6A 5DM7R 2MM0A 4HCCA 3OMGA 4IUUA 4M75D 3ER0A 4RCCA 5CQXA 5CCAA 2PUKB 4C5GA 5HK3A 4DA4A 2RHYA 3GOXA 3NTHA 1QVGS 3CCST 2PVGB 2B8AA 3V7CA 3C94A 2OTLT 3S3OA 2CYZB 3QKJA 4L59A 1N8RU 2C06A 2B25A 3QDRB 2RH2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OYA A;  1XNI A;  4II1 A;  3L2U A;  3OB9 A;  4QQD A;  4E7K A;  3LLR A;  4A4F A;  4HCZ A;  2RHZ A;  1WGS A;  2E5Q A;  3OYM A;  4E7J A;  3OYN A;  2K3X A;  5IN1 A;  3UWN A;  5IAY A;  4ZTF A;  2LRQ A;  2QQR A;  3M9Q A;  2EQK A;  2M16 A;  3OYC A;  3FC3 A;  1WJQ A;  2QQS A;  2R57 A;  3OYG A;  2G3R A;  4A4E A;  2L8D A;  4BDY A;  2RJE A;  3L2V A;  5CIU A;  3S3N A;  3H8Z A;  3O8V A;  4PLL A;  5FRN A;  2R5M A;  4BDZ A;  3SD4 A;  4IKF A;  3P8D A;  3L2R A;  3FLG A;  5KCH A;  2IG0 A;  3OYD A;  1RI0 A;  2VYT A;  3KUF A;  2GFU A;  3L42 A;  3NTI A;  4CRI A;  5KE3 A;  3L2Q A;  4C5E A;  2DAQ A;  1WJR A;  4IUR A;  2EFI A;  2BUD A;  1OZ2 A;  3C4S A;  3MEU A;  3OYH A;  4BE0 A;  2LVM A;  2RJD A;  2RJC A;  3E9G A;  3FDR A;  2X4X A;  3OA6 A;  2M1H A;  5J39 A;  2X4Y A;  3OS1 A;  3LX7 A;  3S3M A;  1MHN A;  2M0O A;  3MP8 A;  4IUT A;  2P0K A;  3OYJ A;  4FL6 A;  5KH6 A;  4B9W A;  4A4H A;  4EDU A;  5KE2 A;  3OYK A;  1OZ3 A;  4LD6 A;  3F70 A;  2EKO A;  2MWP A;  2WAC A;  4NS5 A;  1SSF A;  2RI3 A;  3Q1J A;  3OQ5 A;  3OY9 A;  3OYB A;  2RI2 A;  4QQG A;  5FRO A;  4Z02 A;  3OYF A;  3ASK A;  3MEW A;  4PLI A;  4X34 A;  4E7I A;  4PL6 A;  3OS0 A;  3LGF A;  3MO8 A;  5D6Y A;  3PMI A;  5J26 A;  4RG2 A;  3MET A;  5FRM A;  2MWO A;  2JZ2 A;  3MP1 A;  2FHD A;  2EQU A;  1WJS A;  2LDM A;  3UT1 A;  3LYI A;  4C5H A;  4E7L A;  3OMC A;  4GY5 A;  2RHU A;  5D6W A;  2RO0 A;  3H6Z A;  3CEY A;  3QJ6 A;  2LTO A;  2RJF A;  2GF7 A;  2X35 A;  3QBY A;  3ZEH A;  3DB4 A;  2RHI A;  4IUP A;  4QQ6 A;  3FEO A;  4N4I A;  4E7H A;  2R5A A;  4OVA A;  2XDP A;  3LGL A;  4UC4 A;  1G5V A;  2R58 A;  5C0M A;  4QVZ A;  1KHC A;  3PNW C;  2LCC A;  3DLM A;  2K3Y A;  2O4X A;  4FU6 A;  4BE1 A;  4BAC A;  4QW2 A;  3OS2 A;  2PQW A;  4N4G A;  4BD3 A;  2HQE A;  3L2W A;  2GFA A;  4IUV A;  3P8H A;  2RI5 A;  2F5K A;  3OYI A;  4ZTJ A;  3ME9 A;  5M9O A;  3DB3 A;  3MEA A;  1OI1 A;  2CKK A;  3EAE A;  2JTF A;  3MEV A;  3QII A;  4Q5W A;  3LH0 A;  4N4H A;  4B9X A;  1H3Z A;  4A4G A;  4IUQ A;  5D6X A;  2L3R A;  3NTK A;  2D9T A;  1OYX A;  3PMT A;  3S6W A;  5C6S A;  3OYE A;  2O4X B;  3E9F A;  5KCO A;  2E6N A;  3OYL A;  4BE2 A;  4C5I A;  3MP6 A;  2BKD N;  2YRV A;  2EQM A;  3PFS A;  1N27 A;  2XK0 A;  2DIQ A;  3BDL A;  3OMG A;  4IUU A;  4C5G A;  2EQJ A;  2RHY A;  2HQX A;  3GOX A;  3NTH A;  2BIV A;  2B8A A;  2X4W A;  3S3O A;  2RHX A;  2L89 A;  3QKJ A;  2DIG A;  4L59 A;  2NLU A; 
#chains in the Genus database with same CATH topology
 4BY6 B;  3CC2 Q;  4LD9 K;  2B86 A;  3JCM X;  1YCY A;  2ZPI B;  2P0Q A;  2CUB A;  3QO3 A;  2I2L A;  1H3H A;  2JTM A;  4A4K A;  3CC7 T;  3JCM J;  4M78 A;  4J9F A;  2C0O A;  2YUO A;  5AYF A;  3SWN C;  3HSB A;  1Z9Q A;  3JCM W;  1YI2 T;  4HT8 A;  3P8D A;  2K2V A;  1RAD B;  2XD0 A;  4KRT A;  2FRW A;  2GFU A;  3MPU B;  4FW2 A;  2DAQ A;  5GAN 3;  2DER A;  2KQW A;  4DBQ A;  4EMK A;  3URG A;  1TOV A;  2QG9 B;  1IRX A;  1I8F A;  3LX7 A;  3HRS A;  4C92 C;  4PJO C;  1QQJ A;  3M0S A;  1S72 T;  5CVI A;  1EZZ B;  1R77 A;  2EKO A;  3VYG A;  2CSI A;  4JS4 A;  2A37 A;  5GAN 7;  2ZPG B;  4ANJ A;  1Y96 A;  4OB1 B;  1VOM A;  5FTM A;  1OX9 A;  1WJS A;  2LDM A;  4C5H A;  1W2B S;  2DRK A;  4AG2 C;  4Z89 A;  1RAF B;  2EBP A;  3EFO B;  3CCU Q;  1TS9 A;  1NLP C;  2OTL A;  1QCF A;  1Y0M A;  4KGZ B;  1ABQ A;  1MV0 B;  4BD3 A;  1YJ9 Q;  3A8L B;  5GAN e;  2KDS A;  4WCI A;  4ZNX A;  5LJ5 j;  3MEA A;  4M7D F;  4CC2 A;  2V8K A;  3I35 A;  3LWH A;  2XIC A;  2DIL A;  3BDU A;  3M59 A;  3BQB A;  2YUP A;  1AOJ A;  1BYM A;  2V8I A;  2Y90 A;  4ELZ C;  1VQK T;  3TSZ A;  3E2U A;  4M78 C;  1AVZ C;  4OP0 A;  4M7D G;  2DIG A;  1AEY A;  2NLU A;  1YCS B;  5GAN 6;  3EH1 A;  3OW2 P;  1IGQ A;  1D0X A;  3EFR A;  1VQO T;  2DYI A;  1LPL A;  1RAC B;  2SEM A;  4OMO A;  2RA2 A;  1W6X A;  4EMK C;  1M3A A;  3HTR A;  3L1A A;  4PJJ A;  3CCR Q;  4DOW A;  3S3N A;  3AHU A;  4PLL A;  3M0Q A;  2DD4 A;  3L2R A;  3GP8 A;  2CP3 A;  3KUF A;  1QVP A;  4PFP A;  2QAS A;  1Y57 A;  2KY9 A;  2DL3 A;  1I81 A;  4OMF B;  1FWZ A;  4C0Z A;  3CD6 T;  2Y4Y A;  4HXJ A;  2Q18 X;  4J9D A;  3X25 B;  4M7D E;  4LDV A;  1PKS A;  1S72 Q;  3F70 A;  4OMP A;  2E12 A;  1JJ2 A;  4PJN A;  1BIA A;  2RI2 A;  1YIT T;  1G3S A;  1NYF A;  3MEW A;  1U3O A;  2J6F A;  4PLI A;  4MZP A;  5GMK l;  2MWO A;  3TIW A;  4FM4 B;  4JLI A;  1VQN A;  4FT4 A;  5D6W A;  3CCL T;  1E6H A;  4AG1 C;  3ULR B;  1PG5 B;  1QKW A;  4IUP A;  5FTK A;  2KMT A;  5L23 A;  1YP5 A;  2J05 A;  3DLM A;  4XTW A;  4M75 A;  2HDA A;  1W2B P;  3H0F A;  2ROL A;  4PJO E;  3OYI A;  2NWM A;  3RBB B;  1M1K U;  4OML A;  2G6F X;  2GQI A;  1H3Z A;  4QKU A;  1I1J A;  2ZPH B;  5HKC A;  2CUD A;  1LCK A;  2A0F B;  2CS7 A;  4ARC A;  4FCY A;  3CCJ T;  2QA4 T;  4IIM A;  3C0C A;  3QWY A;  3LLR A;  4XTY A;  1MNE A;  3UDC A;  3OBW A;  3OBY A;  3OYN A;  3UWN A;  2IIM A;  2LRQ A;  2RQV A;  5KYW B;  3G6E T;  1BB9 A;  6AT1 B;  2QQB A;  1YJN T;  2XG8 D;  3M0R A;  1B07 A;  1QWE A;  1WHL A;  1U5S A;  2LZ6 B;  2KXC A;  3VS0 A;  1O75 A;  1IRE B;  2BZY A;  2PWY A;  2KK4 A;  1NYG A;  1GL5 A;  2OTL Q;  4MZT A;  2EFI A;  2CRE A;  4PNO A;  3FDR A;  1CZ5 A;  1G2B A;  5LJ3 j;  4C0D B;  4RKU E;  1C6V X;  2M1H A;  2X4Y A;  1X6G A;  2Z0W A;  1SRL A;  4KOD A;  2FO0 A;  4AFZ C;  1PD0 A;  3HP9 A;  1OZ3 A;  4LD6 A;  3JCM Q;  5I21 A;  1ZUU A;  1N8R C;  1EX4 A;  1YHQ A;  4Z88 A;  1VQ6 A;  3OYF A;  1PHT A;  1QCO A;  2O9V A;  5GMK h;  3EGX A;  5D6Y A;  5FRM A;  3MP1 A;  4A54 A;  4M75 C;  1PSF A;  2FPD A;  1UHF A;  1UGS B;  2WSE E;  1KD1 U;  2DM1 A;  2Y4X A;  2RQT A;  1UGR B;  3QQ8 A;  3E19 A;  1Q7Y U;  2DXT A;  4J9C A;  3CPW S;  1B34 B;  4XTZ A;  5A0G A;  1KFZ A;  2MIO A;  3M0T A;  1HD3 A;  5FU6 B;  4BI4 A;  3FB9 A;  3OS2 A;  1VQ7 A;  1D3B A;  4IUV A;  2F5K A;  4ESR A;  2JM8 A;  5FTN A;  1EIF A;  1H64 1;  2HL5 C;  4EPC A;  2P4R A;  2O88 A;  3DKM A;  4XAX B;  3R6O A;  4M7A D;  2EQJ A;  3QDF A;  4J83 A;  1SSH A;  1M1K C;  1NJI U;  5KYN A;  3PE0 A;  2L89 A;  3CCJ Q;  1AWW A;  2GTO A;  2JMC A;  3FPT A;  3A8H B;  1M1K R;  4J9B A;  3JV3 A;  1WHK A;  4PK4 A;  1PCX A;  1K73 U;  2L8D A;  2L0A A;  1ZA2 B;  4BDZ A;  1VQN Q;  5FU7 B;  1NPR A;  3QHS A;  2NUT B;  3GF5 A;  2DTI A;  3C95 A;  3JAM E;  3I9Q A;  3U23 A;  2DJZ A;  2YUJ A;  1SHG A;  3OYH A;  3JCM f;  3E9G A;  2ED1 A;  3I56 A;  1NPP A;  1QW1 A;  2CP6 A;  1VIE A;  2ZPF B;  3EGU A;  3RDV A;  4A4H A;  4F7U F;  1ZA1 B;  1M8V A;  4M7A A;  1SSF A;  2JN0 A;  1M90 C;  2LP5 A;  3X20 B;  4ZN3 A;  1M90 R;  5CCB A;  1UDL A;  1R7R A;  4E7L A;  3LHD A;  3PVQ A;  4RTU A;  4F7U G;  4E7Z A;  1RL2 A;  4V2S A;  3GIB A;  1SRM A;  5I2S A;  4MDW A;  2ECZ A;  1PM3 A;  4OVA A;  1D1C A;  2DL4 A;  5KYX B;  4QVZ A;  3KXT A;  2M02 A;  2GQV A;  2K3Y A;  2WSC E;  4FU6 A;  1OPL A;  2QAZ A;  2W0Z A;  1KQS S;  5FWC A;  3MEV A;  4OB0 B;  4N4H A;  3CPW P;  1Q7Y C;  5CO7 A;  1D0Y A;  2CP2 A;  3OYL A;  1BI2 A;  1AHJ B;  1Q7Y R;  1I5L A;  4K11 A;  3OMG A;  5CQX A;  2YSQ A;  4RCC A;  4DA4 A;  2OI3 A;  3NTH A;  1QVG S;  2PVG B;  3C94 A;  2H3E B;  1OUL A;  2CYZ B;  3A98 A;  1WLP B;  2J6K A;  2COW A;  1WZO A;  1YHQ Q;  4J7F A;  1R8O B;  1VQ6 Q;  3ZJT A;  1OEB A;  4DBH A;  2DL7 A;  2G3R A;  2L3Q A;  1JU5 C;  2EAY A;  4WTO B;  1I5O B;  1NJI C;  3G71 A;  3H8Z A;  2OTJ A;  5LJ3 f;  3SD4 A;  1QMC A;  5ECA A;  4F17 A;  2LT4 A;  2P0P A;  1I4K 1;  4PKC C;  5LJ5 g;  1NJI R;  3RR6 A;  3J80 E;  1GBR A;  1T0H A;  2DTO A;  8AT1 B;  2ROT A;  5IXF A;  1K8A U;  2RJD A;  1UHC A;  3FJP A;  4KUL A;  1WXT A;  2HKQ B;  1AZG B;  3R6N A;  1W2B A;  1R0C B;  4LDX A;  2J06 A;  2O01 E;  2MWP A;  3L2Z A;  4M7D A;  1AWJ A;  1ZSZ B;  3LGF A;  1GBQ A;  2HEQ A;  3LW5 E;  5I2M A;  1Q86 C;  4KO8 A;  3RNJ A;  2COY A;  2DA9 A;  1ARK A;  2EGA A;  3MB5 A;  3EG3 A;  2HSP A;  1Q86 R;  4N4I A;  2JOY A;  1PRM C;  3J7A F;  2YXY A;  3OYY A;  4AFQ C;  4RG8 A;  4X1V A;  3TEE A;  2MYS A;  2HQE A;  3L2W A;  2KRS A;  4E2F B;  3CC7 A;  5GAO q;  4YTL A;  2XI9 A;  2JTE A;  4IUQ A;  1YI2 A;  2J6O A;  2CT3 A;  4JZ3 A;  4D6W A;  2CP0 A;  2ZZD A;  5GAO r;  4NL3 A;  3TCJ A;  1KQS P;  2YRV A;  4TVR A;  3I55 T;  3OSS C;  3PVL A;  4KGV B;  3I56 Q;  2E3I A;  2FYK A;  5HY6 A;  2FL7 A;  2RHX A;  2JM9 A;  1HYO A;  2HBP A;  1RAE B;  7AT1 B;  2E70 A;  1PNJ A;  3NMZ C;  1G3T A;  2BZ8 A;  2DMO A;  4FT2 A;  4C8Q B;  1IHV A;  3REB B;  5IN1 A;  1KQ2 A;  1QVG P;  1WJQ A;  1RAI B;  3OW2 S;  5IHI A;  3QJY A;  2P84 A;  5IT9 E;  3CXC S;  1C1A A;  4M7A G;  3HFO A;  3L42 A;  2KI7 A;  1BK2 A;  1VQP T;  4OF1 A;  3CCQ T;  2DZC A;  2C0I A;  1RLQ C;  4M7D C;  5KYU B;  4KH1 B;  1FX7 A;  2QGF B;  5GAM d;  3NPF A;  1CKB A;  3HHT B;  4AMC A;  1X2K A;  3LH5 A;  4CC7 A;  3OYK A;  4JRI A;  1TUD A;  4XTX A;  2FZK B;  4NS5 A;  2RI3 A;  5GAN d;  1VQM T;  2D0N A;  3MO8 A;  3VS2 A;  3MET A;  2GTJ A;  1VQK A;  4B6M A;  2QK0 A;  2RHI A;  2LJ3 A;  1TUG B;  4M7A E;  2DLP A;  2EGC A;  4KGX B;  2EYZ A;  3E1S A;  2O4X A;  2L5Q A;  2RPN A;  1VQO A;  5CQY A;  1WYX A;  5EC7 A;  5EPP A;  1T3L A;  3JCM e;  3QPH A;  5LJ3 g;  1MMA A;  2DFU A;  3DB3 A;  4M77 B;  2VGM A;  4QQ6 A;  3G71 Q;  3EGD A;  2OTJ Q;  2HD0 A;  5GJW B;  5C6S A;  2KRO A;  3CCE T;  5GAM e;  1VQ9 T;  2QQA A;  4HCK A;  1WPY A;  2YT6 A;  1N27 A;  3BDL A;  1Y07 A;  4QVD A;  3EFS A;  5KYY B;  2CZ7 B;  3QYG B;  4FYV B;  1G83 A;  2EYX A;  5HCK A;  2EIF A;  1QVF S;  3CD6 A;  4PFO A;  1GXI E;  1EFN A;  4FSX A;  4RTZ A;  2PZ1 A;  4BI3 A;  3EHQ A;  2EWN A;  2EYW A;  3EH2 A;  3OB9 A;  2E5Q A;  3GBQ A;  4FYY B;  4E7J A;  4ZTF A;  2SRC A;  4FIB A;  2DXC A;  1YIT A;  4N0A A;  2BTT A;  4A4E A;  4F14 A;  4D8K A;  4KLN A;  5CKH A;  1MMG A;  3IQL A;  4OGE A;  1D1A A;  3CCL A;  1B34 A;  2E64 A;  3NTI A;  3P8B B;  4JJB A;  2BUD A;  3BE3 A;  1OOT A;  3MKD A;  1OQK A;  3CXC P;  3CC7 Q;  5FTJ A;  2VXE A;  5KH6 A;  1WIE A;  4B9W A;  2CP5 A;  2LQK A;  3SWN B;  1AT1 B;  1LOJ A;  1YI2 Q;  1MMN A;  3OS0 A;  3UPU A;  3CPW A;  5A2Q E;  4LN2 A;  2FHD A;  2EQU A;  1S1N A;  3M58 A;  4GY5 A;  4A63 B;  2AZV A;  4JLG A;  2LNV A;  2X35 A;  3REA B;  3DB4 A;  1N6A A;  3RIR A;  3CCJ A;  1AWX A;  2QA4 A;  1M9S A;  2RQW A;  2PTK A;  2XDP A;  4HA8 A;  4LUE A;  3ZBD A;  3JCM b;  1V29 B;  3CME A;  3NFC A;  2E41 A;  4C92 B;  4PJO B;  5IXB A;  1BU1 A;  1I07 A;  2PQW A;  2RNA A;  4NOY A;  1VYV A;  4C0D C;  3G6E A;  1WFW A;  2C0T A;  2VWF A;  3H0I A;  3M54 A;  1YJN A;  1OI1 A;  2JTF A;  2ZCF B;  1VQ4 T;  2K5F A;  8ATC B;  4RTY A;  3S6W A;  2H3J A;  3CCE Q;  3UF4 A;  2OAW A;  1VQ9 Q;  2EQM A;  2L3S A;  2PNI A;  4IIO A;  3UA7 A;  3HRT A;  1PD1 A;  5GAN 4;  3CC4 A;  3ZFJ A;  1H8K A;  2OJ2 A;  4N0A C;  1YN8 A;  3T9N A;  4RTW A;  2EJF A;  4HCZ A;  4F7U A;  1C0M A;  2CH4 W;  1KC8 U;  1E32 A;  3H9N A;  1QWF A;  2R57 A;  2DL8 A;  4XU0 A;  1QVF P;  5CKF A;  4BDY A;  4IKF A;  1NE8 A;  5KCH A;  2K6D A;  1TUC A;  3G4S T;  1VQK Q;  1JB0 E;  1QCS A;  2JXB A;  3C4S A;  1NM7 A;  2QI2 A;  2J7I A;  4M78 B;  3PT9 A;  1AZE A;  4HKE A;  2DYB A;  2YUQ A;  3TSW A;  3CME T;  2D6F A;  2X4X A;  1PSE A;  1VQO Q;  1U06 A;  1R0B G;  4XK8 E;  3MP8 A;  3BW1 A;  3OYJ A;  2YVL A;  2ABL A;  3CCV A;  1NEG A;  2KBT A;  1IHW A;  1BCO A;  2KRM A;  1BKB A;  1O9S A;  4BB7 A;  4EMK B;  1K9M U;  4KT0 E;  1HK9 A;  5FRO A;  2KVQ G;  2EVR A;  2XMF A;  1NEB A;  2RK1 A;  1LVK A;  4JS5 A;  2JZ2 A;  1W1F A;  2RQU A;  3CC4 T;  4CI0 C;  3GLX A;  1WLF A;  4KUD K;  3CD6 Q;  2DX1 A;  3FEO A;  1M2V A;  1NBE B;  2YWW A;  3X24 B;  3RER A;  4HVW A;  1QDN A;  5IH2 A;  3EG0 A;  3HFN A;  3SEM A;  2EPD A;  2GFA A;  1YIT Q;  1RLP C;  1VQL T;  2HSE B;  1IO6 A;  4HT9 A;  1U8R A;  3EAE A;  3LH0 A;  4Y91 A;  1FMV A;  5C1B A;  2EJG A;  3CCL Q;  4L6V 5;  2W10 A;  5IHK A;  1QKX A;  5CD1 A;  3ZGZ A;  2YDL A;  5DM7 R;  4HCC A;  2MM0 A;  5LJ5 f;  1ABO A;  3CCS T;  4JJD A;  2A28 A;  3QKJ A;  3CCV T;  5DLQ E;  2LX9 A;  1ZUK A;  2LJ0 A;  4LDU A;  1VQ8 T;  2CP7 A;  1ZSZ A;  2HNI A;  3V8L A;  2FPE A;  1UG1 A;  2LX7 A;  2DBM A;  4C8Q D;  2K2M A;  2KAF A;  2MM2 A;  4MDX A;  2RJE A;  1M5Q 1;  1WA7 A;  3M0U A;  3QXE B;  2GGR A;  3PIO A;  3N5B B;  3V8J A;  1BCM A;  1KG1 A;  5KE3 A;  3D7S B;  1WQW A;  4ZGE B;  3PTA A;  2QA4 Q;  1YNZ A;  4Y28 E;  2M9U A;  2CSQ A;  3CME Q;  4BI8 B;  5GAO n;  3SFM A;  3OS1 A;  3S3M A;  1AWO A;  2ZAE A;  2XID A;  3G6E Q;  5KE2 A;  4X9C A;  4JJC A;  1YJN Q;  1KHI A;  4QT7 A;  4GLM A;  4MZM A;  3OYB A;  4C0F A;  2KGT A;  3ASK A;  3QWX X;  4E7I A;  3EG9 B;  4XU2 A;  5AT1 B;  4CC4 B;  5J26 A;  4RG2 A;  4R0K A;  1D0Z A;  3FRN A;  2KNB B;  1E7O A;  2LW6 A;  3CC4 Q;  2ZPB B;  2P4T A;  3QBY A;  2EGE A;  3H41 A;  3LGL A;  2VVK A;  5GLF A;  3RKW A;  1CKA A;  4JJN K;  1K4U S;  2LMJ A;  1CR5 A;  1X43 A;  1YJW T;  1JXM A;  3ZJU A;  1KJW A;  2MMP A;  5CCX A;  4A4G A;  4M77 D;  4CC3 A;  3JCM P;  4M75 B;  3VUZ A;  2BKD N;  3JB9 I;  2D8J A;  3JCM c;  2F5T X;  2PVD B;  9ATC B;  1HSQ A;  4LXC A;  4DBR A;  3OW2 A;  3QC8 A;  3VRZ A;  2DJQ A;  3CCV Q;  3OYA A;  3UAT A;  1VYU A;  1TWB A;  2FB7 A;  1KD1 C;  2HL3 A;  3RMQ A;  1SEM A;  2AKK A;  5LL6 S;  5B6C A;  2K3X A;  2QQR A;  1JBM A;  1KD1 R;  2M16 A;  3RUX A;  2LCS A;  2JS0 A;  5CIU A;  2R5M A;  2LJ1 A;  2RQR A;  2V1R A;  4F7U E;  3CMA A;  2JW4 A;  5FTL A;  1OZ2 A;  1Q81 U;  4AT1 B;  3M55 A;  3M56 A;  4AFS C;  2AKL A;  4E6R A;  2X4J A;  3TVT A;  2M0O A;  3WVE B;  2D0Q B;  2CZ6 B;  3QG1 A;  1F1B B;  3VS6 A;  5GMK e;  3EFO A;  1BI3 A;  3DLL A;  4DOV A;  4J8O A;  5EQJ B;  3HU1 A;  2BZX A;  2K9G A;  4PL6 A;  1JJ2 P;  3A8M B;  1ZLM A;  1M27 C;  1YIJ T;  2QXF A;  2Q19 X;  3EHR A;  4JDS A;  4ARI A;  4M7A C;  3I55 A;  1KIK A;  1SF9 A;  2I0N A;  1K73 C;  1ZBJ A;  2D1X A;  1OV3 A;  4RTT A;  4ZN1 A;  1MGQ A;  3BY7 A;  2KR3 A;  3QQ7 A;  1K73 R;  1SHF A;  1B7T A;  3EGX B;  4BUG A;  1RAG B;  2FZG B;  4BY6 C;  4BE1 A;  3CCM T;  5GAM h;  4BAC A;  3CC2 T;  3P8H A;  4C92 D;  1N9R A;  4PJO D;  3RMS A;  2PUO B;  4F16 A;  4GBQ A;  1K0S A;  3VJP A;  4LNP A;  2L3P A;  3TU4 K;  3NGP A;  4FYX B;  2YRD A;  5GAN h;  2LT1 A;  2EW3 A;  4BE2 A;  1X01 A;  2MI6 A;  2O31 A;  3CMA T;  4PJM A;  1WXB A;  1VQP A;  1D3B B;  4KDL A;  2DIQ A;  2RD1 A;  2GNC A;  4NL2 A;  3MCA B;  3CCQ A;  2OX7 A;  4CQN A;  1VUB A;  4RMO A;  3QUI A;  1UEB A;  1X2Q A;  4II1 A;  2Q1C X;  4J9H A;  2VXF A;  2DET A;  1SG5 A;  5CKE A;  1VQM A;  1JQQ A;  5DYG A;  5FRN A;  1M3B A;  3JSC A;  4J5Y A;  2MF2 A;  4C8Q F;  2JUF A;  2NYS A;  3CCU T;  2H8H A;  4M78 D;  2CT4 A;  5LJ5 e;  1UB4 A;  3JB9 D;  4RUG A;  1RAB B;  1ZQ1 A;  4FL6 A;  4C8Q G;  2YLC A;  4JUV A;  3JCM d;  3OQ5 A;  1YJ9 T;  1Y7X A;  1FMK A;  1YWP A;  1W70 A;  4X34 A;  2V8J A;  3X26 B;  2QGG A;  4XU1 A;  2FVU A;  3CCE A;  1M1F A;  1BBZ A;  1FYN A;  5IHN A;  1VQ9 A;  1Q95 G;  1IGU A;  5FWB A;  4J6X A;  3LYI A;  2F2W A;  2MOX A;  3H6Z A;  2RJF A;  1Z9Z A;  2F2V A;  2CZ0 B;  1CZ4 A;  3GNF B;  2R5A A;  3QYH B;  2QQ9 A;  1G5V A;  3GPL A;  5DLO A;  3TRE A;  2LCC A;  5A0L A;  2YLB A;  3ZJV A;  1VQ5 A;  4ELY C;  1JRI A;  3BFM A;  4WF2 A;  4N4G A;  2AZS A;  1K8A C;  2ATC B;  1GRI A;  3HU3 A;  5M9O A;  1QCN A;  4L5G A;  1UJY A;  1K8A R;  4C8Q E;  2KXD A;  3VU3 C;  2X51 A;  1WI7 A;  4M4Z A;  3NTK A;  2EJ9 A;  2D9T A;  3JCM V;  2DO3 A;  3OS5 A;  2COZ A;  2IPO B;  2QDY B;  3CCR T;  3CMA Q;  3PFS A;  1X27 A;  2MAM A;  5KYW A;  2M51 A;  4J6W A;  4M77 F;  2JV2 A;  5GJV B;  3JB9 H;  1K9A A;  5DY9 A;  2RMO A;  2E6Z A;  2K4Y A;  2CDT A;  1T3S A;  1XNI A;  4Y92 A;  2MCN A;  2AHJ B;  4A4F A;  5FLX E;  2KT8 A;  4C0G A;  1V76 A;  4EIK A;  2AK5 A;  1D1B A;  2EQK A;  2K79 A;  3OYC A;  4M77 G;  1M8M A;  2DXU A;  1M3C A;  1J3T A;  3O8V A;  2JJ9 A;  3I55 Q;  3X28 B;  4DBF A;  2VAS A;  2VYT A;  3L2Q A;  1Q82 U;  1GFD A;  3EG1 A;  1WJR A;  4IUR A;  2HZY A;  5CKB A;  2CGH A;  1G3W A;  1VQ5 T;  5LJ3 d;  5J39 A;  4R55 A;  2DZ9 A;  4IUT A;  2P0K A;  2HBW A;  4OGC A;  1CSK A;  2DPP B;  2WAC A;  3Q1J A;  1IZ6 A;  2F69 A;  3VS7 A;  2RN8 A;  5DYI A;  2E10 A;  1VQ4 A;  2FPF A;  3QZ5 B;  2DEU A;  3CBP A;  3H0H A;  1XOV A;  1JO8 A;  4OB2 B;  5FW9 A;  4M77 E;  1KQ1 A;  1VQP Q;  4EMG A;  3CCQ Q;  1VIF A;  2HMA A;  1NZ9 A;  1N9S A;  4ME7 A;  4M7D B;  5C0M A;  3PNW C;  5GAN 8;  4JPB W;  1ZBX A;  2CZ1 B;  2OAU A;  4LE9 A;  3VV0 A;  2LCL A;  3A8G B;  2MPX C;  1WQ7 A;  1VQM Q;  2AT1 B;  5GAO m;  3VS1 A;  1SKU B;  1V1C A;  2KE9 A;  2ENM A;  5KCO A;  3G4S A;  3VKI A;  4C92 F;  1OX8 A;  4PJO F;  5LJ3 e;  3PIP A;  2D8H A;  4M75 D;  3ER0 A;  5CCA A;  4E7S A;  2B8A A;  3V7C A;  2OTL T;  2A08 A;  2VKN A;  3S3O A;  1N8R U;  2DE0 X;  2C06 A;  2B25 A;  2RH2 A;  1IXD A;  2O2O A;  3FPR A;  5GAN 5;  4E7K A;  4C92 G;  1X69 A;  1X6O A;  3EG9 A;  1PKT A;  4PJO G;  2NUT A;  4AFU C;  2EYQ A;  3OYM A;  3PGG A;  2HCK A;  5IAY A;  3M9Q A;  2E3H A;  4QVC A;  5I11 A;  3OYG A;  3RES A;  4Z8A A;  3A8O B;  2DNU A;  2HQH A;  1UE9 A;  2EKH A;  1QP3 A;  2FRY A;  2KYB A;  4CRI A;  3HPW A;  4FYW B;  5J3B A;  2KEA A;  3I5S A;  3THK A;  1WHG A;  3GNG A;  5GAM j;  2NUP B;  1VQ5 Q;  1DJ7 B;  1UFF A;  1GCP A;  4MMK A;  5FU6 C;  1W4S A;  1VQL A;  1Q82 C;  1YBY A;  3TQ7 P;  2DBK A;  5GAN j;  4C92 E;  4M78 F;  2JNG A;  1U1T A;  5KYX A;  1Q82 R;  4LUD A;  3C12 A;  2AIR B;  3JB9 F;  1TU0 B;  4ZGJ B;  3J81 E;  3V8K A;  1NG2 A;  3KBG A;  1WHJ A;  2RO0 A;  1KK7 A;  4GLK A;  3VS3 A;  3CCS A;  3ZEH A;  4KUI A;  4M78 G;  2HAX A;  2DL5 A;  3I5R A;  1BIB A;  1RAH B;  4VUB A;  2R58 A;  3JB9 G;  3SHW A;  2JS2 A;  1H92 A;  1VQ8 A;  3QWZ A;  1UGQ B;  2LQW A;  3M4G A;  4RTV A;  2X3W D;  1P92 A;  4XU3 A;  1RI9 A;  2GBQ A;  2F1L A;  1A0N B;  5D6X A;  2L3R A;  1KQS A;  2O4X B;  3E9F A;  2E6N A;  3G7Z A;  4J9G A;  5FU7 C;  4OMM A;  4XTU A;  2QTX A;  3NHN A;  2PVO B;  1VQN T;  4OMQ A;  3HRU A;  2XK0 A;  3CQT A;  1K1Z A;  2FZC B;  1WNL A;  4RTX A;  2BIV A;  1Y96 B;  2CH4 A;  3EGD B;  1M90 U;  1WX6 A;  2QEX A;  3M5A A;  4M78 E;  4XTV A;  1ZC1 A;  3FPU A;  1XJW B;  1QVG A;  1WGS A;  2DD5 A;  1VQ4 Q;  1XQH A;  3FC3 A;  1GCQ A;  1QP2 A;  3M4Y A;  2RK2 A;  2K5L A;  1UTI A;  3WVD B;  5GAN 2;  3FLG A;  2IVW A;  1MUZ A;  3EG2 A;  2IG0 A;  5CR2 A;  1N8R R;  4C5E A;  2XHC A;  3CBM A;  4LDY A;  1QLY A;  3MJX A;  1ACM B;  2PJH B;  3AT1 B;  2ZPE B;  3OA6 A;  3CF2 A;  4OMN A;  1ZSG A;  1G3Y A;  3V7R A;  3VRY A;  1XTD A;  1RAA B;  2V26 A;  1YJW A;  1TTH B;  5GMK i;  1WHH A;  3RKX A;  3OY9 A;  1ZHI A;  2K5I A;  2KYM A;  2F2X A;  3HU2 A;  3G4S Q;  1HJD A;  3SB2 A;  1KC8 C;  3VUB A;  1UJ0 A;  3M0P A;  4RCB A;  2KT1 A;  1KC8 R;  1JJ2 S;  4XQ3 A;  2QEX T;  4J9E A;  2DXB A;  4DEY A;  3WXM B;  5ERG B;  1K76 A;  1JEG A;  3MHX A;  2WSF E;  2RI5 A;  2NUZ A;  5C18 A;  3G1J A;  4LDW A;  3A1P A;  4ZTJ A;  2VUB A;  2YHT A;  4AS1 A;  1YHQ T;  2V1Q A;  1LNX A;  2CKK A;  3VS5 A;  1VQ6 T;  2LQ8 A;  1OYX A;  3PMT A;  2JT4 A;  1S3S A;  4F04 B;  4C8Q A;  2L2P A;  2LNH B;  2LC4 A;  4C5I A;  4JZ4 A;  1K9M C;  4O6J A;  1X6B A;  2FG0 A;  1RUW A;  4DEX A;  4P5N A;  1MND A;  2HQX A;  2FEI A;  3HKS A;  2BE7 D;  2K3B A;  1K9M R;  2DVJ A;  1GCQ C;  1VYT A;  1MV3 A;  4KDI A;  1OPK A;  3UA6 A;  3L2U A;  4QQD A;  1VQL Q;  1E6G A;  4M75 F;  2RHZ A;  1K0X A;  1TSF A;  4RV0 A;  1M4Z A;  2XU8 A;  1VQ7 T;  5GMK m;  1Q86 U;  2KSS A;  2QDL A;  2QQS A;  3V7S A;  5KYU A;  1OU8 A;  1U1S A;  2XKO C;  1YIJ A;  3ZL7 C;  1ZSZ C;  1HXD A;  5LJ5 h;  5GAM f;  2DK3 A;  4M75 G;  2Q1A X;  4PJL A;  3OYD A;  1G8X A;  4F7U B;  1GFC A;  3CCS Q;  4HCB A;  1M2O A;  2E5K A;  1IB8 A;  1WHM A;  1PC0 A;  3MEU A;  2DF6 A;  4BE0 A;  4JRQ A;  3RKY A;  2RJC A;  3LGA A;  3CXC A;  5GAN f;  2VV5 A;  1VQ8 Q;  2E1H A;  1JXO A;  3M53 A;  4A53 A;  2O9S A;  2PU9 B;  3CCM A;  1MHN A;  1LJO A;  4ZGD B;  3CC2 A;  4O5V A;  2QYZ A;  5CKD A;  2XDD A;  4D8D A;  4QQG A;  1YFN A;  2E65 A;  3FIF A;  1UEC A;  2M0Y A;  3PMI A;  4PFZ A;  2E4H A;  1MMD A;  4FW1 A;  4AQ7 A;  3CEY A;  3M57 A;  3OSV A;  3QJ6 A;  2LTO A;  4M77 A;  1PWT A;  2GF7 A;  4KBM B;  4M75 E;  1X75 C;  4MML A;  2QEX Q;  3I56 T;  2RF0 A;  1SPK A;  4M7D D;  2JMA A;  2KRN A;  2X9H A;  4ATO A;  4X9D A;  3HL8 A;  4C8Q C;  2JVV A;  3ME9 A;  5KYY A;  1WXU A;  4ORZ A;  1M2V B;  4FSS A;  3JCM h;  2XDB A;  3OYE A;  3VS4 A;  5D7U A;  1KSW A;  2YUN A;  4HVU A;  2DTH A;  1B3Q A;  1UGV A;  2VB6 A;  3CCU A;  2ZGW A;  1D09 B;  2X4W A;  2VGN A;  4JRK A;  5A0D A;  3QZ9 B;  1YJW Q;  3VYH B;  5LJ5 d;  2GCX A;  1WDX A;  1QVF A;  1YJ9 A;  1VQ7 Q;  1UGP B;  4J7I A;  5L8R E;  3O5Z A;  2A7Y A;  3FJ5 A;  2MK5 A;  1N5Z A;  5CAI A;  3L2V A;  3CBO A;  1TG0 A;  1ZUY A;  1FMW A;  5GAO l;  4JRP A;  1RI0 A;  3JRZ A;  2EQI A;  3SWN A;  5I22 A;  2ESW A;  2HKN A;  2ED0 A;  2Q1D X;  2LVM A;  1FXX A;  1YWO A;  2K7A A;  3LWI A;  2EYY A;  4J9I A;  4DQ2 A;  2X3X D;  4EDU A;  5CK9 A;  1O54 A;  4HVV A;  1TXQ A;  4E47 A;  3JB9 J;  4M77 C;  4Z02 A;  1BI1 A;  2BE9 B;  4OB3 B;  5EG2 A;  3G71 T;  4C92 A;  3CCR A;  4PJO A;  2DKG A;  2OTJ T;  2A3L A;  1UUE A;  2DRM A;  3UT1 A;  3OMC A;  2RHU A;  5GAO p;  3JCM g;  3QSU A;  1TH7 A;  2DVE A;  1PRL C;  4E7H A;  5HK0 A;  1M30 A;  4EMH A;  1M1G A;  4UC4 A;  4R56 A;  2A36 A;  2YRC A;  1KHC A;  1ZX6 A;  1OU9 A;  5LJ3 h;  4QW2 A;  3SDZ A;  1Q81 C;  5GAM g;  3A5Z B;  3CPF A;  1S72 A;  4M7A F;  1YIJ Q;  4Q5W A;  4B9X A;  3QII A;  1Q81 R;  1I9G A;  2K57 A;  3KFV A;  1NLO C;  3INZ A;  5GMK j;  2VC8 A;  1BI0 A;  2LQN A;  4M7A B;  2RM4 A;  1T0J A;  1AD5 A;  5GAN g;  1VA7 A;  4J6Y A;  2DEQ A;  2NUP A;  3MP6 A;  4KH0 B;  1Y71 A;  2RB6 A;  2QTV A;  4IUU A;  5HK3 A;  2PUK B;  4C5G A;  2RHY A;  3GOX A;  1I0C A;  4L59 A;  3CCM Q;  3QDR B; 
#chains in the Genus database with same CATH homology
 5DLQ E;  4BY6 B;  2LX9 A;  4LD9 K;  3FPR A;  3JCM X;  1YCY A;  2ZPI B;  5GAN 5;  4E7K A;  4LDU A;  4C92 G;  2P0Q A;  1X6O A;  4PJO G;  1VQ8 T;  2HNI A;  2EYQ A;  3QO3 A;  3PGG A;  2I2L A;  1R8O B;  4J7F A;  3V8L A;  3OYM A;  5IAY A;  2JTM A;  4A4K A;  3CC7 T;  4C8Q D;  2KAF A;  3M9Q A;  4M78 A;  3JCM J;  3ZJT A;  5AYF A;  3SWN C;  4QVC A;  4MDX A;  2MM2 A;  3OYG A;  3RES A;  3HSB A;  2G3R A;  3QQ8 A;  2EAY A;  3A8O B;  2RJE A;  3JCM W;  1M5Q 1;  1NJI C;  3G71 A;  3H8Z A;  3QXE B;  1QP3 A;  2OTJ A;  5LJ3 f;  3SD4 A;  1YI2 T;  3P8D A;  2K2V A;  4HT8 A;  3PIO A;  2LT4 A;  3N5B B;  3V8J A;  2XD0 A;  1KG1 A;  2P0P A;  1I4K 1;  4PKC C;  5LJ5 g;  1Q7Y U;  5KE3 A;  4CRI A;  2GFU A;  3HPW A;  3J80 E;  1WQW A;  2DAQ A;  2DTO A;  5J3B A;  4ZGE B;  5GAN 3;  3PTA A;  2KQW A;  4Y28 E;  4EMK A;  2M9U A;  1K8A U;  3URG A;  2RJD A;  3GNG A;  3FJP A;  5GAM j;  4BI8 B;  5GAO n;  1DJ7 B;  4KUL A;  3SFM A;  3OS1 A;  1I8F A;  3LX7 A;  3S3M A;  3HRS A;  4MMK A;  2XID A;  4C92 C;  4PJO C;  5FU6 C;  4X9C A;  5KE2 A;  1S72 T;  5CVI A;  1W2B A;  1W4S A;  1VQL A;  1Q82 C;  1YBY A;  4LDX A;  1KHI A;  2O01 E;  2EKO A;  2MWP A;  3VYG A;  3L2Z A;  4M7D A;  5GAN j;  4MZM A;  4C92 E;  4M78 F;  2JNG A;  4C0F A;  3OYB A;  4JS4 A;  1U1T A;  3ASK A;  4E7I A;  4XU2 A;  3C12 A;  3LGF A;  3JB9 F;  5GAN 7;  2ZPG B;  4ZGJ B;  3J81 E;  3LW5 E;  5I2M A;  5J26 A;  4RG2 A;  3V8K A;  1Y96 A;  4OB1 B;  5FTM A;  1Q86 C;  3KBG A;  1WJS A;  2LDM A;  3FRN A;  4C5H A;  1W2B S;  4KO8 A;  2LW6 A;  2RO0 A;  4GLK A;  2ZPB B;  3CCS A;  2P4T A;  3QBY A;  3ZEH A;  3MB5 A;  4KUI A;  2OTL A;  4M78 G;  4N4I A;  2HAX A;  2JOY A;  1BIB A;  3LGL A;  4VUB A;  3J7A F;  2R58 A;  3JB9 G;  3OYY A;  4RG8 A;  5GLF A;  1VQ8 A;  3RKW A;  3QWZ A;  4JJN K;  1UGQ B;  3M4G A;  4BD3 A;  3TEE A;  2HQE A;  3L2W A;  3CC7 A;  1CR5 A;  3A8L B;  5GAN e;  2KDS A;  5GAO q;  1P92 A;  4XU3 A;  4YTL A;  1YJW T;  3ZJU A;  2XI9 A;  5LJ5 j;  3MEA A;  4M7D F;  2MMP A;  5CCX A;  4A4G A;  2V8K A;  4IUQ A;  4M77 D;  5D6X A;  2L3R A;  3LWH A;  3JCM P;  1YI2 A;  2XIC A;  1KQS A;  2O4X B;  3E9F A;  4D6W A;  2E6N A;  3G7Z A;  2ZZD A;  4M75 B;  3BDU A;  5FU7 C;  3M59 A;  4XTU A;  2QTX A;  3BQB A;  3VUZ A;  5GAO r;  4NL3 A;  2PVO B;  2BKD N;  2YRV A;  4TVR A;  3TCJ A;  1VQN T;  1BYM A;  3HRU A;  3I55 T;  3OSS C;  2XK0 A;  3JB9 I;  2V8I A;  2Y90 A;  3JCM c;  2F5T X;  2PVD B;  4ELZ C;  1WNL A;  1VQK T;  2BIV A;  1Y96 B;  2FYK A;  4M78 C;  4OP0 A;  2FL7 A;  5HY6 A;  4M7D G;  3OW2 A;  3QC8 A;  2RHX A;  2DIG A;  1M90 U;  2HBP A;  2NLU A;  2E70 A;  5GAN 6;  3OYA A;  2QEX A;  1G3T A;  2FB7 A;  3M5A A;  4M78 E;  4XTV A;  1KD1 C;  4FT2 A;  4C8Q B;  1QVG A;  1ZC1 A;  3EFR A;  3FPU A;  3RMQ A;  1WGS A;  2DD5 A;  1VQO T;  5B6C A;  5LL6 S;  2K3X A;  5IN1 A;  1KQ2 A;  2QQR A;  1JBM A;  2RA2 A;  2M16 A;  3RUX A;  1XQH A;  3FC3 A;  1WJQ A;  3M4Y A;  1QP2 A;  4EMK C;  3OW2 S;  2RK2 A;  3L1A A;  2K5L A;  4DOW A;  5CIU A;  3WVD B;  3S3N A;  3QJY A;  4PLL A;  5GAN 2;  2R5M A;  5IT9 E;  3AHU A;  2DD4 A;  3L2R A;  3FLG A;  3GP8 A;  3CXC S;  2IVW A;  4M7A G;  2IG0 A;  3HFO A;  3L42 A;  3KUF A;  5CR2 A;  4C5E A;  2XHC A;  3CBM A;  4F7U E;  4LDY A;  1QVP A;  3CMA A;  1VQP T;  5FTL A;  1OZ2 A;  2KY9 A;  2PJH B;  4OF1 A;  2ZPE B;  2DZC A;  3CCQ T;  1I81 A;  1Q81 U;  4OMF B;  3M55 A;  4M7D C;  3M56 A;  1FWZ A;  5LJ5 f;  3OA6 A;  1FX7 A;  4C0Z A;  5GAM d;  3CD6 T;  3CF2 A;  2X4J A;  2M0O A;  2Y4Y A;  2Q18 X;  1G3Y A;  3HHT B;  3X25 B;  3WVE B;  2D0Q B;  4M7D E;  3V7R A;  2CZ6 B;  3QG1 A;  4LDV A;  5GMK e;  1XTD A;  4JRI A;  3OYK A;  1BI3 A;  3F70 A;  4XTX A;  5GMK i;  2E12 A;  4NS5 A;  4DOV A;  3DLL A;  2RI3 A;  3RKX A;  3OY9 A;  1BIA A;  1JJ2 A;  1ZHI A;  4J8O A;  2RI2 A;  2K5I A;  5GAN d;  1G3S A;  1YIT T;  3HU1 A;  5EQJ B;  3HU2 A;  3MEW A;  4PLI A;  4PL6 A;  3A8M B;  1VQM T;  3MO8 A;  4MZP A;  2QXF A;  1YIJ T;  2Q19 X;  3MET A;  3SB2 A;  2MWO A;  3VUB A;  5GMK l;  1KC8 C;  3TIW A;  4JDS A;  4FM4 B;  4JLI A;  4ARI A;  1VQN A;  4M7A C;  3I55 A;  4FT4 A;  4RCB A;  5D6W A;  3CCL T;  1K73 C;  1JJ2 S;  1VQK A;  2RHI A;  4IUP A;  5FTK A;  4XQ3 A;  4ZN1 A;  2QEX T;  4M7A E;  2KMT A;  1MGQ A;  3BY7 A;  2DXB A;  3QQ7 A;  3WXM B;  3DLM A;  3E1S A;  4XTW A;  2O4X A;  4BUG A;  2L5Q A;  3MHX A;  5ERG B;  4BY6 C;  4BE1 A;  4M75 A;  2WSF E;  5GAM h;  3CCM T;  5CQY A;  4BAC A;  1VQO A;  4PJO E;  5EPP A;  3JCM e;  3CC2 T;  3QPH A;  5LJ3 g;  3P8H A;  2RI5 A;  4C92 D;  1N9R A;  4LDW A;  3OYI A;  3RMS A;  4PJO D;  4ZTJ A;  5C18 A;  2VUB A;  2PUO B;  3DB3 A;  2YHT A;  4M77 B;  1M1K U;  4AS1 A;  1YHQ T;  2VGM A;  1LNX A;  4QQ6 A;  3VJP A;  2CKK A;  1H3Z A;  2HD0 A;  1VQ6 T;  3TU4 K;  2LQ8 A;  2ZPH B;  5GAN h;  1OYX A;  3PMT A;  5C6S A;  1S3S A;  2LT1 A;  3CCE T;  5HKC A;  4BE2 A;  1X01 A;  2MI6 A;  4C8Q A;  5GAM e;  4C5I A;  2LC4 A;  1VQ9 T;  3CMA T;  2QQA A;  2CS7 A;  1WPY A;  1K9M C;  4O6J A;  1VQP A;  1D3B B;  4KDL A;  1N27 A;  3BDL A;  2DIQ A;  1Y07 A;  4ARC A;  2RD1 A;  4NL2 A;  3CCQ A;  3MCA B;  4P5N A;  4QVD A;  2HQX A;  3EFS A;  1VUB A;  4CQN A;  3HKS A;  4RMO A;  2CZ7 B;  3QYG B;  3CCJ T;  2QA4 T;  2EIF A;  1QVF S;  3QUI A;  3CD6 A;  1UEB A;  4KDI A;  1GXI E;  4FSX A;  4II1 A;  2Q1C X;  4BI3 A;  2EWN A;  3L2U A;  3OB9 A;  4QQD A;  3LLR A;  4M75 F;  4XTY A;  2RHZ A;  2E5Q A;  3UDC A;  3OBW A;  4RV0 A;  3OBY A;  1M4Z A;  2VXF A;  2XU8 A;  3OYN A;  3UWN A;  4E7J A;  4ZTF A;  5GMK m;  1VQ7 T;  2LRQ A;  2DXC A;  4FIB A;  3G6E T;  1Q86 U;  1YIT A;  4N0A A;  2KSS A;  5CKE A;  2QQB A;  2QQS A;  3V7S A;  4A4E A;  2XG8 D;  1YJN T;  1VQM A;  1U1S A;  2XKO C;  1YIJ A;  4KLN A;  5CKH A;  5DYG A;  1HXD A;  5FRN A;  5LJ5 h;  5GAM f;  4OGE A;  1O75 A;  2DK3 A;  3JSC A;  4J5Y A;  4M75 G;  1IRE B;  2Q1A X;  3OYD A;  3CCL A;  2MF2 A;  1B34 A;  2E64 A;  2KK4 A;  3NTI A;  2JUF A;  4C8Q F;  4F7U B;  4HCB A;  4MZT A;  3P8B B;  2EFI A;  2BUD A;  3MEU A;  4BE0 A;  4JRQ A;  4PNO A;  3RKY A;  2RJC A;  3FDR A;  3CXC A;  3CCU T;  3LGA A;  1CZ5 A;  5LJ3 j;  5GAN f;  2VV5 A;  4RKU E;  4C0D B;  2E1H A;  2M1H A;  4M78 D;  3M53 A;  2X4Y A;  4A53 A;  5LJ5 e;  2PU9 B;  3CCM A;  1MHN A;  1UB4 A;  3JB9 D;  1ZQ1 A;  4KOD A;  1LJO A;  2VXE A;  4FL6 A;  4ZGD B;  4B9W A;  5KH6 A;  3CC2 A;  3HP9 A;  2YLC A;  4C8Q G;  4JUV A;  1OZ3 A;  4LD6 A;  4O5V A;  5I21 A;  3JCM Q;  1N8R C;  2LQK A;  3SWN B;  5CKD A;  1YHQ A;  3JCM d;  3OQ5 A;  2XDD A;  1YJ9 T;  1Y7X A;  1LOJ A;  4QQG A;  1VQ6 A;  3OYF A;  4X34 A;  3FIF A;  2E65 A;  2V8J A;  3X26 B;  3OS0 A;  3UPU A;  5GMK h;  3CPW A;  5D6Y A;  4XU1 A;  2FVU A;  3PMI A;  1M1F A;  5A2Q E;  3CCE A;  5FRM A;  1YJW A;  1VQ9 A;  3MP1 A;  2FHD A;  4A54 A;  2EQU A;  1PSF A;  4M75 C;  3LYI A;  4J6X A;  3M58 A;  4GY5 A;  3H6Z A;  1UGS B;  2WSE E;  3CEY A;  3M57 A;  1KD1 U;  4AQ7 A;  3OSV A;  2Y4X A;  3QJ6 A;  2RJF A;  2LNV A;  2GF7 A;  2LTO A;  2X35 A;  4JLG A;  1UGR B;  1N6A A;  2CZ0 B;  3DB4 A;  3RIR A;  3CCJ A;  3E19 A;  1CZ4 A;  4KBM B;  1M9S A;  3GNF B;  2DXT A;  2R5A A;  4M75 E;  1X75 C;  2QQ9 A;  2XDP A;  3QYH B;  4MML A;  3GPL A;  1G5V A;  3I56 T;  5DLO A;  2PWY A;  3CPW S;  1B34 B;  4HA8 A;  4XTZ A;  2LCC A;  3TRE A;  1V29 B;  2YLB A;  3ZBD A;  5A0G A;  5A0L A;  3JCM b;  3NFC A;  3CME A;  4M7D D;  2E41 A;  4C92 B;  4ELY C;  1VQ5 A;  4X9D A;  4ATO A;  5FU6 B;  4PJO B;  1JRI A;  3BFM A;  3FB9 A;  3HL8 A;  2PQW A;  4N4G A;  4NOY A;  4WF2 A;  4BI4 A;  3OS2 A;  4C8Q C;  1K8A C;  1VQ7 A;  1D3B A;  4IUV A;  4C0D C;  2JVV A;  3G6E A;  2F5K A;  3ZJV A;  3HU3 A;  3ME9 A;  5M9O A;  3M54 A;  5FTN A;  1EIF A;  1YJN A;  1OI1 A;  2JTF A;  4L5G A;  2ZCF B;  4C8Q E;  3VU3 C;  1VQ4 T;  2K5F A;  3JCM h;  1H64 1;  3NTK A;  4EPC A;  2EJ9 A;  2XDB A;  2D9T A;  3JCM V;  3OYE A;  3S6W A;  2H3J A;  2DO3 A;  3OS5 A;  2QDY B;  3CCR T;  3DKM A;  4XAX B;  2DTH A;  3R6O A;  2EQM A;  3PFS A;  4M7A D;  2MAM A;  3HRT A;  2EQJ A;  4M77 A;  4J6W A;  5GAN 4;  3CCU A;  2ZGW A;  4J83 A;  4M77 F;  3CC4 A;  2JV2 A;  3ZFJ A;  1NJI U;  1M1K C;  3JB9 H;  4N0A C;  2X4W A;  2VGN A;  2L89 A;  5DY9 A;  2K4Y A;  2E6Z A;  1XNI A;  4JRK A;  5A0D A;  3T9N A;  3QZ9 B;  3A8H B;  3FPT A;  2AHJ B;  4A4F A;  2EJF A;  5FLX E;  4HCZ A;  4F7U A;  3VYH B;  4C0G A;  5LJ5 d;  2GCX A;  5DYI A;  1KC8 U;  1QVF A;  1YJ9 A;  1E32 A;  1UGP B;  4J7I A;  2EQK A;  3OYC A;  4M77 G;  2R57 A;  5L8R E;  4XU0 A;  2A7Y A;  2DXU A;  1K73 U;  2L8D A;  5CKF A;  4BDY A;  5CAI A;  3L2V A;  3O8V A;  4BDZ A;  4IKF A;  5FU7 B;  1NE8 A;  1NPR A;  3CBO A;  3X28 B;  3CCV T;  3QHS A;  5KCH A;  4JRP A;  5GAO l;  3L2Q A;  1RI0 A;  2VYT A;  3GF5 A;  3G4S T;  1Q82 U;  2DTI A;  1JB0 E;  3C95 A;  3JRZ A;  1WJR A;  3JAM E;  2DJZ A;  4IUR A;  1QCS A;  3SWN A;  2YUJ A;  3C4S A;  2QI2 A;  4M78 B;  3OYH A;  5CKB A;  3PT9 A;  4HKE A;  2Q1D X;  2LVM A;  1FXX A;  3JCM f;  3CME T;  3E9G A;  3I56 A;  2CGH A;  2X4X A;  1G3W A;  1PSE A;  1NPP A;  1QW1 A;  3LWI A;  1VQ5 T;  2D6F A;  5LJ3 d;  5J39 A;  4R55 A;  4DQ2 A;  1VIE A;  2DZ9 A;  2ZPF B;  4XK8 E;  4IUT A;  3MP8 A;  3BW1 A;  2P0K A;  3OYJ A;  2YVL A;  3CCV A;  4OGC A;  4A4H A;  2DPP B;  4EDU A;  5CK9 A;  1O54 A;  4F7U F;  1BKB A;  1M8V A;  2WAC A;  4M7A A;  1SSF A;  2JN0 A;  3Q1J A;  1IZ6 A;  1O9S A;  2F69 A;  4BB7 A;  4EMK B;  3PIP A;  1M90 C;  2E10 A;  4E47 A;  3JB9 J;  4KT0 E;  1HK9 A;  4M77 C;  1K9M U;  1VQ4 A;  5FRO A;  4Z02 A;  3QZ5 B;  1BI1 A;  3CBP A;  2KVQ G;  3X20 B;  2RK1 A;  4ZN3 A;  4OB3 B;  5EG2 A;  1XOV A;  3G71 T;  4C92 A;  4OB2 B;  3CCR A;  4JS5 A;  2DKG A;  2JZ2 A;  4PJO A;  4M77 E;  1KQ1 A;  2OTJ T;  2A3L A;  5CCB A;  1R7R A;  4E7L A;  3UT1 A;  4EMG A;  3OMC A;  3LHD A;  2RHU A;  5GAO p;  3CC4 T;  1VIF A;  4F7U G;  5FTJ A;  4CI0 C;  3JCM g;  1NZ9 A;  1RL2 A;  3GLX A;  1WLF A;  3QSU A;  1N9S A;  4KUD K;  4ME7 A;  3GIB A;  5I2S A;  4V2S A;  1TH7 A;  4MDW A;  4M7D B;  2DVE A;  3FEO A;  4E7H A;  4OVA A;  5HK0 A;  4EMH A;  4R56 A;  1M1G A;  4UC4 A;  3X24 B;  5C0M A;  4QVZ A;  3RER A;  3KXT A;  1KHC A;  3PNW C;  5GAN 8;  1QDN A;  2GQV A;  2K3Y A;  2WSC E;  3HFN A;  4FU6 A;  1ZBX A;  5LJ3 h;  4QW2 A;  2CZ1 B;  3SDZ A;  2OAU A;  2GFA A;  3VV0 A;  5GAM g;  1Q81 C;  2LCL A;  3A5Z B;  1KQS S;  3A8G B;  1VQL T;  1WQ7 A;  3CPF A;  1S72 A;  4HT9 A;  4M7A F;  5GAO m;  1U8R A;  3MEV A;  3EAE A;  4Q5W A;  4B9X A;  3QII A;  4OB0 B;  3LH0 A;  4N4H A;  1I9G A;  2K57 A;  1Q7Y C;  4Y91 A;  2QA4 A;  3INZ A;  5CO7 A;  2VC8 A;  5GMK j;  5C1B A;  2EJG A;  1BI0 A;  4L6V 5;  5KCO A;  4M7A B;  3OYL A;  2RM4 A;  3G4S A;  3VKI A;  4C92 F;  5GAN g;  4PJO F;  4J6Y A;  1BI2 A;  2DEQ A;  1AHJ B;  3MP6 A;  5LJ3 e;  5CD1 A;  1Y71 A;  1I5L A;  3ZGZ A;  2RB6 A;  5DM7 R;  2MM0 A;  4HCC A;  3OMG A;  4IUU A;  4M75 D;  3ER0 A;  4RCC A;  5CQX A;  5CCA A;  2PUK B;  4C5G A;  5HK3 A;  4DA4 A;  2RHY A;  3GOX A;  3NTH A;  1QVG S;  3CCS T;  2PVG B;  2B8A A;  3V7C A;  3C94 A;  2OTL T;  3S3O A;  2CYZ B;  3QKJ A;  4L59 A;  1N8R U;  2C06 A;  2B25 A;  3QDR B;  2RH2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...