4UCMA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucmA00
4A30A 5AG4A 4A95A 4C7HA 2YNEA 5G20A 4C2YA 4UCNA 5AGEA 3JTKA 4B13A 4CYQA 2YNDA 5G1ZA 4UCMA 4CGPA 4CGOA 4A33A 2WUUA 3IWEA 4C2XA 4A31A 4CGNA 4CGMA 4CAEA 4CYOA 4A32A 5A27A 3IU2A 4UCPA 4UFWA 4B11A 4B14A 4BBHA 4B12A 4C2ZA 3H5ZA 4C68A 2WSAA 5AG6A 4CAFA 4CYPA 5A28A 2YNCC 4A2ZA 5G21A 5AG5A 4CGLA 4UFXA 5G22A 4B10A 5AG7A 2YNCA 4UFVA 4CYNA 4C7IA 3IU1A
chains in the Genus database with same CATH superfamily
2D4OA 2Q0YA 3NH5A 3SXOA 3CT9A 1M1DA 2IJZA 4P4EA 4P4IA 2PJ3A 1YX0A 3BI1A 3V38A 4KLVA 4F9UA 2CIJA 4QB9A 4CGPA 1TIQA 4LUAA 1SQHA 1BAVA 5CBMA 2ZEDA 5CPAA 4OMEA 5CNPA 1ZG9A 2FE7A 2OOTA 4OAEA 5LRKA 3TO7A 3H5ZA 1VHEA 1S5KA 4YWYA 1Z4RA 1XFOA 3CXPA 4PQAA 5JM6A 1OBRA 4UFXA 4Y49B 3IC1A 3B2YA 1EE3P 4KOSA 5F49A 3B3WA 4ZGYB 1IICA 4YGOA 1M4IA 4RN7A 1S60A 4LQGA 1VIXA 1Z8TA 1MJ9A 1M4GA 5D29A 3H8GA 2CTBA 4PSWA 1FY7A 2REFA 4NJQA 2EWBA 5GCNA 4E0AA 4Y49C 1RTQA 4NGPA 3WR7A 2HQYA 5JGFA 4OC2A 4WWVA 3FMCA 3G3SA 3I1UA 2FIWA 2PJ7A 4P4BA 2ZEFA 2WSAA 4H6ZA 4H89A 4U9YA 1YGHA 3VATA 1UWYA 2ZOGA 4M6GA 1DE4C 4P4DA 1TF9A 4MFKA 2PC1A 2B5GA 3KR4A 4F9VA 1AMPA 2GE3A 4W9YA 1VGYA 2PSWA 2QIRA 4RS2A 5J8FA 2WPWA 5K8MA 2DXQA 2OZGA 3SXNA 1CG2A 3PFOA 1M4LA 4QVTA 3KHZA 4ZX8A 1B87A 4CRZB 4FD6A 4KSIA 4A33A 1L0CA 4F8ZA 2JEWA 2VQYA 2AE6A 3A9LA 2X7BA 3KZWA 4CYOA 4U5YA 3DR8A 3TOAA 1CX8A 2Z3NA 2PJ4A 4MCRA 2BUEA 2AFSA 3NE7A 4CYPA 3EO4A 3PEIA 3IIBA 5ISVA 3CPAA 1M44A 2PJ6A 4QC6A 4A39A 4PXDA 5AG7A 4F0YA 4H2KA 3PB4X 4JJXA 5G22A 4CRYB 4JZ0A 3IU2A 2GLFA 2I3CA 3R96A 4CAVA 5AG4A 4C2YA 4EWTA 3BI0A 2B3VA 2PIYA 3DGVA 4NGQA 1CP7A 2DF5A 3S9MA 5KTCA 2QVPA 4IF5A 2HUZA 2ZEPA 3R9EA 1Q2CA 4DNCA 4ZBGA 2GREA 2ZEEA 4ZYQA 4PXBA 3D7FA 4UCPA 4B11A 3EY5A 1WK4A 4FD5A 2DPSA 3TO9A 1Q2YA 3N7ZA 3LWUA 5A28A 2EVNA 2JBJA 4OIDA 4E8OA 5JPHA 1Y0YA 3D67A 4KVOE 3QAYA 2JDCA 1YK3A 3S9NA 4OADA 1LFWA 5H86A 2CXAA 4C7IA 1ELLP 5IX3A 4KZTA 3F0AA 1Q7LA 3E0KA 3N5FA 1BPNA 4UIBA 3S6HA 4CYQA 1Y7RA 4L8AA 3PB9X 1IYLA 3WC5A 4P44A 4NFRA 3BJ7A 4PV6A 2Q43A 3PP9A 4CGNA 3SHPA 2VL1A 5J1QA 3FX6A 4J3GA 3FJUA 5EBVA 3S6FA 3GUXA 2GFQA 2ABZA 2Q4ZA 1RO5A 1GHEA 2FIAA 2PQ8A 3BXMA 4KUAA 5AG6A 5FVJA 4XNHB 2YNCC 2PR1A 4PXCA 2KCWA 4MHDA 2F5IA 3MRUA 2OR4A 4MFPA 4OC4A 2EBJA 3PB8X 5H84A 1NE9A 2Z0ZA 2EK8A 4MY3A 3D3SA 3TT2A 4GM5A 3EC4A 1AUGA 2POKA 1S7FA 1UFHA 1Z2LA 2GANA 3CDXA 2YGWA 3FYNA 3T90A 2JDDA 3JTKA 2GLJA 2ZOFA 2RC4A 2ZW5A 3B8GA 3PBBA 4NGNA 2Q7SA 1CM0A 3F8KA 4ONUA 5G1ZA 3D8PA 4MI4A 3GB0A 3VWEA 3IWEA 2IL4A 4E2AA 4MFQA 1YSJA 2PDOA 4AB7A 2C1CA 1FNOA 4L89A 4AVCA 2VI7A 3VARA 1VHSA 3DSBA 3SI2A 4P6YA 2AFOA 2V8GA 2ZXVA 4PPZA 5E96A 4B14A 2ZEMA 2RFHA 1NMTA 2ZEHA 4C68A 4GXHA 2G9DA 1F2OA 1ZG7A 4ZY2A 3NH4A 4KOWA 3NE8A 4TWEA 4MHZA 1VKCA 5G21A 4JYWA 2D4PA 3WT4A 4IK2A 2BO9A 4F6AA 5J8CA 5K8NA 1Z4EA 4OC0A 1OZPA 3FECA 3GYAA 3T9YA 2J8MA 2V77A 4ZX9A 1I12A 3PB7X 4A38A 4KUBA 4A95A 1ARLA 1S7NA 1IOIA 2YNEA 1RXTA 4JLYA 3WC7A 4HNYB 4FBEA 2V8DA 1XIXA 3TCVA 3D2PA 3DR6A 4CAXA 2FS5A 1I21A 4HNXB 4FAIA 4XPDB 1XOVA 3CXQA 4KOUA 4GS4A 4A37A 4X2TA 1PYTB 1QQ9A 4MHPA 3S9LA 2HC9A 4KSAA 3I3GA 4KVXA 4MHYA 4U9ZA 4NGRA 5D8NA 4C2ZA 3KQXA 4OC3A 1V0CA 2WYRA 4ORFA 4Q36A 1ELMP 4IAVA 1U6MA 1IY7A 1P0HA 3CPXA 3BHXA 2REEA 5LRJA 2Z3OA 3FEEA 2QYVA 1LANA 2G3TA 3FIXA 2PJ0A 2PCUA 3IJ3A 1TKHA 4XPLA 2DPTA 2YNCA 4Z65A 2Q04A 4I49A 4A30A 1LAMA 4OKOA 3R95A 2EK9A 5G20A 1F57A 2I00A 4XPKA 1MJAA 1TF8A 2YNDA 4Q7AA 2NYQA 8CPAA 1HEEA 5I4MA 3KASA 2ZW7A 2FXFA 4MFZA 4MMOA 3QNVA 1Z8WA 3D2MA 2C27A 4BINA 1B6BA 1KUXA 4OP4A 4KVME 3GIUA 2IMOA 4QUSA 3V7ZA 3BJ8A 4LQ6A 2K5TA 3MGDA 2C6GA 2V8VA 1Y0RA 2V8HA 4PXEA 4A94A 4B5OA 1XMBA 2Q4YA 1YR0A 2ZENA 4PK2A 3RO0A 5HMNA 2A4NA 1Y9WA 1QSMA 2F7VA 2ODFA 1LCPA 3IU1A 4R7MA 5KTAA 5I0CA 4K3NA 3LD2A 3TC8A 1XMTA 1F2PA 3FVLA 5F46A 3KKWA 1X12A 3R1KA 2BOAA 4G1PA 4YRHA 2NSMA 4KOTA 4MRIA 4EFDA 1QSRA 2Q7BA 4ONWA 4MXUA 2VBQA 4B6ZA 5A27A 4HNWB 3NH8A 4UWIA 3SI1A 4MBUA 4MJ8A 1ZLIA 2ZPAA 2GIVA 1IGBA 4B5PB 4AVBA 1ZO0A 2PVWA 4MCQA 4H6UA 4KOVA 3KHXA 2IQ6A 1Z8XA 2R98A 4UFVA 4UCNA 5DWNA 2ZW6A 4O23A 1R43A 2XEFA 3KI9A 3WABA 1S7LA 5AGEA 2XEJA 1KZFA 1GYTA 3QB8A 1CPXA 3BLNA 1XF8A 5HVGA 2FT0A 4UCMA 1Z5RA 4CAWA 3D7HA 4KOYA 5DWMA 1YMEA 2OU2A 5DS0A 2Q44A 2O28A 2JEVA 1KUVA 3NFZA 4ZI6A 1YW4A 2CF4A 4RUHA 3LODA 5F09A 5HVHA 2PR8A 1CP6A 2B5GB 4UWJA 1XE4A 4HPSA 1N71A 2GU2A 2ZEGA 1TXRA 2PJ5A 3W91A 2EUIA 4X5KA 4AXVA 4NGTA 2PE3A 5LYLA 1BO4A 4K30A 4PSXA 4CGLA 5C88A 3IWWA 1DTDA 3OWCA 3FF3A 2Z3KA 5IV0A 1JQGA 3IGRA 4Q38A 1Z8LA 4AG7A 4YFJA 1KWMA 5F48A 3FB3A 3IO1A 2B4DA 3PBEA 3UY5A 1IOFA 4NGSA 2CNTA 3W6SA 4P45A 4FD7A 4CAEA 5C82A 1AYEA 2AFMA 2CNMA 1CBXA 2AFUA 2Q4VA 4II9A 3CXSA 1PUAA 2OH1A 2PIZA 3D4UA 4R3LA 2R7HA 1XJOA 2OB0A 2VZYA 3ISZA 4TNUA 4UF4A 2PJAA 3H4QA 4M6HA 1MK4A 4KORA 5ELYA 2Q51A 4UBRA 1I1DA 1WWZA 1LRZA 5JQ4A 3PZJA 4EMEA 4RI1A 4PK3A 4YU9A 3JUWA 4C7HA 4IUSA 4NXYA 4NSQA 1IB1E 4R3KA 4MCSA 3RZAA 1S3ZA 1ZLHA 3ISXA 2R8VA 4NCZA 1QMUA 3P2HA 4KS9A 2O53A 4CS0B 1ON0A 2J8NA 3FRMA 4A31A 2RB7A 3H8FA 4XNHC 3FNCA 2OZHA 1CJWA 3TO6A 3SJFA 3B35A 3SI0A 5EMIA 5LRGA 3KL9A 4CAFA 3GLJA 4NGMA 3LMSA 2Z10A 3QAHA 3TOBA 4BMHA 4A2ZA 2JLMA 6CPAA 2VEZA 4P4FA 3DDDA 2WZNA 3MN8A 3FH4A 3KGQA 5IB0A 3TFYA 4M6IA 1FT7A 3K9UA 3VWDA 1PU9A 2Z3PA 4MCPA 4QBJA 1P4NA 2HB6A 1A2ZA 2B4DB 1BPMA 4X3RA 3RNZA 4IHMA 4R6TA 4MY0A 3GY9A 2Z3LA 3PFEA 4M85A 1ARMA 3V8IA 3SJEA 2J8RA 1BOBA 3SJGA 3B7IA 4B5PA 1NSLA 3SJXA 3IWGA 4BD9A 3JRUA 2CTCA 2EO8A 2NMTA 2Y0MA 1IU8A 2ARHA 5THWA 3B3CA 1QSNA 2ATRA 5HXDA 4ZY1A 1S7KA 1PCAA 1YVKA 3D68A 1NSAA 3D66A 1K4JA 1JWQA 2AFWA 1TKJA 2CY2A 2PRBA 4NEXA 4P4JA 4B10A 2QMLA 4UEEA 5K8PA 3TX8A 3EXNA 3FEDA 4P10A 4NF1A 2BCOA 4AG9A 3CZXA 2C6CA 2F8HA 4B13A 2I79A 2BL1A 4CPAA 4KOXA 2FSRA 4MFLA 1KUYA 5LYIA 3DLJA 1QSTA 4KLWA 2DEAA 5IB9A 4MHNA 3LACA 3B3SA 2J9AA 2P0WA 3S6GA 3T8WA 3D7DA 4R76A 3DNSA 2AFXA 2ZELA 1IIDA 4OC1A 3W6XA 1YLOA 4A32A 3I9SA 2O4HA 3S6KA 2PJCA 3K2KA 5KTDA 4BBHA 2C6PA 4R9MA 2P6FA 4OC5A 1J4JA 5HH1A 2P6GA 3RBUA 1R3NA 2XEGA 1LOKA 4JXQA 4OLLA 4OIWA 2XEIA 4LX9A 4AVAA 2BEIA 3HLPA 1H8LA 3ZJ0A 3P2FA 4CYNA 3NA6A 5LYFA 3D7GA 2VXKA 5F47A 3TTHA 3PGPA 4FUUA 3FXTA 4FWUA 2WPXA 2PJBA 3H8EA 2R1IA 4JWPA 1QSOA 1XRYA 3HUVA 3WC6A 1YREA 3K9TA 2PJ8A 2WUUA 1Z9UA 4R8FA 3PRTA 4C2XA 3EFAA 3VH9A 1YLEA 1BLLE 2P6EA 4CGMA 4M3SA 4R57A 4DUKA 2HV2A 2QECA 1TKFA 4HKFA 1Y9KA 3G8WA 5BWAB 7CPAA 1CPSA 1X10A 4FD4A 3ZZIA 3TE4A 4EVYA 2PJ1A 4UEZA 5K8OA 1ZG8A 4F0XA 2ZW4A 5EC4A 5AG5A 2ANPA 2FL4A 4R87A 2AJ6A 1Y7EA 1XEBA 3F5BA 3PB6X 2QJ8A 4KSFA 4ZY0A 1VHOA 1MJBA 3R9FA 2FCKA 2G3AA 1YW6A 3RAMA 3FBUA 4NJRA 3KQZA 4WJBA 2B58A 2PVVA 2Z11A 5JH9A 2Z3MA 4CGOA 2AFZA 3KR5A 5LYDA 2B3UA 4UA3A 3B3TA 4DYOA 4UIAA 4DJLA 1XBUA 1HDUA 3IFEA 1LAPA 1M4DA 4JD6A 2FVGA 1HDQA 2VZZA 3R9GA 4UFWA 4B12A 2ZEOA 3JVNA 2G0BA 3GKRA 4MFJA 4XPDC 1Q2DA 2JBKA 3IEHA 2PRQA 1YVOA 5HVFA 2PJ2A 1R57A 3C26A 2CNSA 2H5MA 4JXRA 1IYKA 2BSWA 2OZUA 2B4BA 3B3VA 4UEFA 4X8IA 3RYOA 3L2NA 1YQEA 2PJ9A
chains in the Genus database with same CATH topology
2D4OA 2Q0YA 3SXOA 1M1DA 1YX0A 4KLVA 4QB9A 4CGPA 1TIQA 4LUAA 1SQHA 5CNPA 2FE7A 3TO7A 3H5ZA 1S5KA 1Z4RA 3CXPA 4UFXA 4Y49B 4KOSA 5F49A 4ZGYB 1IICA 4YGOA 1M4IA 1S60A 1MJ9A 1M4GA 4PSWA 1FY7A 2REFA 5GCNA 4E0AA 4Y49C 3WR7A 2HQYA 3G3SA 2FIWA 2WSAA 4H6ZA 4H89A 4U9YA 1YGHA 4MFKA 2PC1A 2B5GA 2GE3A 2PSWA 2QIRA 4RS2A 5J8FA 2WPWA 2DXQA 2OZGA 3SXNA 4QVTA 1B87A 4CRZB 4FD6A 4A33A 1L0CA 2VQYA 2AE6A 3A9LA 2X7BA 4CYOA 4U5YA 3DR8A 3TOAA 2Z3NA 2BUEA 3NE7A 4CYPA 3EO4A 5ISVA 1M44A 4QC6A 5AG7A 4F0YA 4JJXA 5G22A 4CRYB 3IU2A 4CAVA 3R96A 5AG4A 4C2YA 2B3VA 5KTCA 4IF5A 2HUZA 3R9EA 1Q2CA 4DNCA 4ZBGA 4UCPA 4B11A 3EY5A 1WK4A 4FD5A 2DPSA 3TO9A 1Q2YA 3N7ZA 5A28A 5JPHA 2EVNA 4E8OA 4KVOE 2JDCA 1YK3A 4OADA 5H86A 2CXAA 4C7IA 5IX3A 4KZTA 3F0AA 3E0KA 3S6HA 4CYQA 1Y7RA 4L8AA 1IYLA 3BJ7A 4PV6A 3PP9A 4CGNA 3SHPA 4J3GA 5EBVA 3S6FA 1RO5A 1GHEA 2FIAA 2PQ8A 4KUAA 5AG6A 5FVJA 4XNHB 2YNCC 2PR1A 2KCWA 4MHDA 2F5IA 4MFPA 5H84A 1NE9A 2Z0ZA 4MY3A 3D3SA 3TT2A 3EC4A 1S7FA 1UFHA 2GANA 3FYNA 2YGWA 3T90A 2JDDA 3JTKA 3B8GA 4OAEA 2RC4A 2ZW5A 4ONUA 5G1ZA 1CM0A 3F8KA 3D8PA 4MI4A 3VWEA 4E2AA 3IWEA 2IL4A 4MFQA 2PDOA 4AB7A 4L89A 4AVCA 2VI7A 1VHSA 3DSBA 2ZXVA 5E96A 4B14A 4C68A 1NMTA 4KOWA 1VKCA 5G21A 2D4PA 4F6AA 5J8CA 1Z4EA 1OZPA 3T9YA 3GYAA 2J8MA 1I12A 4KUBA 4A95A 1S7NA 2YNEA 1RXTA 4JLYA 4HNYB 1XIXA 3TCVA 3D2PA 3DR6A 4CAXA 2FS5A 1I21A 4HNXB 4XPDB 3CXQA 4KOUA 4GS4A 4KSAA 3I3GA 4KVXA 4U9ZA 4C2ZA 4Q36A 1V0CA 4ORFA 1U6MA 1P0HA 2REEA 2Z3OA 2G3TA 3FIXA 4XPLA 2DPTA 2YNCA 2Q04A 4I49A 4A30A 3R95A 5G20A 2I00A 4XPKA 1MJAA 2YNDA 2ZW7A 2FXFA 4MFZA 3D2MA 2C27A 1B6BA 1KUXA 4KVME 4QUSA 3BJ8A 2K5TA 3MGDA 4B5OA 2Q4YA 4PK2A 1YR0A 5HMNA 2A4NA 1Y9WA 1QSMA 3IU1A 5KTAA 5I0CA 3LD2A 1XMTA 5F46A 3KKWA 3R1KA 4YRHA 4KOTA 1QSRA 2Q7BA 2VBQA 5A27A 4HNWB 4UWIA 4MBUA 4MJ8A 2ZPAA 2GIVA 4B5PB 4AVBA 1ZO0A 4H6UA 4KOVA 2R98A 4UFVA 4UCNA 5DWNA 2ZW6A 1S7LA 5AGEA 1KZFA 3QB8A 3BLNA 1XF8A 2FT0A 4UCMA 4CAWA 4KOYA 5DWMA 2OU2A 2Q44A 2O28A 2JEVA 1KUVA 3LODA 2PR8A 2B5GB 4UWJA 1XE4A 1N71A 3W91A 2EUIA 4X5KA 1BO4A 4K30A 4PSXA 4CGLA 5C88A 3OWCA 2Z3KA 5IV0A 3IGRA 4Q38A 4AG7A 4YFJA 5F48A 3FB3A 2B4DA 3UY5A 2CNTA 3W6SA 4FD7A 4CAEA 5C82A 2CNMA 2Q4VA 4II9A 3CXSA 1PUAA 2OH1A 4R3LA 2R7HA 2OB0A 2VZYA 3H4QA 1MK4A 4KORA 4UBRA 1I1DA 1WWZA 1LRZA 5JQ4A 3PZJA 4RI1A 4PK3A 3JUWA 4C7HA 4IUSA 4NXYA 4NSQA 1IB1E 4R3KA 1S3ZA 2R8VA 4NCZA 3P2HA 4KS9A 4CS0B 1ON0A 2J8NA 3FRMA 4A31A 4XNHC 3FNCA 2OZHA 1CJWA 3TO6A 4CAFA 2Z10A 3QAHA 3TOBA 4BMHA 4A2ZA 2JLMA 2VEZA 3DDDA 5IB0A 3TFYA 3K9UA 3VWDA 2Z3PA 1PU9A 4QBJA 1P4NA 2B4DB 4MY0A 3GY9A 2Z3LA 4M85A 3V8IA 2J8RA 1BOBA 4B5PA 1NSLA 3IWGA 2NMTA 2Y0MA 2ARHA 1QSNA 2ATRA 1S7KA 1YVKA 1K4JA 2CY2A 2PRBA 4NEXA 4B10A 2QMLA 3EXNA 4NF1A 4AG9A 4B13A 2I79A 2BL1A 4KOXA 2FSRA 4MFLA 1KUYA 1QSTA 4KLWA 2P0WA 3S6GA 3DNSA 3W6XA 1IIDA 4A32A 3I9SA 3S6KA 5KTDA 4BBHA 4R9MA 2P6FA 1J4JA 5HH1A 2P6GA 4JXQA 4OLLA 4AVAA 4LX9A 2BEIA 3ZJ0A 4CYNA 3P2FA 2VXKA 5F47A 3TTHA 3PGPA 3FXTA 2WPXA 4JWPA 2R1IA 1QSOA 1YREA 2WUUA 4C2XA 1Z9UA 3EFAA 1YLEA 2P6EA 4CGMA 4M3SA 4R57A 2HV2A 2QECA 4HKFA 1Y9KA 3G8WA 5BWAB 4FD4A 3ZZIA 3TE4A 4F0XA 2ZW4A 5EC4A 5AG5A 4R87A 2FL4A 2AJ6A 4KSFA 1XEBA 3F5BA 1MJBA 3R9FA 2FCKA 2G3AA 3FBUA 2B58A 2Z11A 2Z3MA 4CGOA 2B3UA 4UA3A 4JD6A 1M4DA 2VZZA 3R9GA 4UFWA 4B12A 3JVNA 2G0BA 3GKRA 4MFJA 4XPDC 1Q2DA 1YVOA 1R57A 4JXRA 3C26A 2CNSA 2H5MA 1IYKA 2BSWA 2OZUA 2B4BA 3RYOA 4EVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A30 A;  5AG4 A;  4A95 A;  4C7H A;  2YNE A;  5G20 A;  4C2Y A;  4UCN A;  5AGE A;  3JTK A;  4B13 A;  4CYQ A;  2YND A;  5G1Z A;  4UCM A;  4CGP A;  4CGO A;  4A33 A;  2WUU A;  3IWE A;  4C2X A;  4A31 A;  4CGN A;  4CGM A;  4CAE A;  4CYO A;  4A32 A;  5A27 A;  3IU2 A;  4UCP A;  4UFW A;  4B11 A;  4B14 A;  4BBH A;  4B12 A;  4C2Z A;  3H5Z A;  4C68 A;  2WSA A;  5AG6 A;  4CAF A;  4CYP A;  5A28 A;  2YNC C;  4A2Z A;  5G21 A;  5AG5 A;  4CGL A;  4UFX A;  5G22 A;  4B10 A;  5AG7 A;  2YNC A;  4UFV A;  4CYN A;  4C7I A;  3IU1 A; 
#chains in the Genus database with same CATH topology
 2D4O A;  2Q0Y A;  3NH5 A;  3SXO A;  3CT9 A;  1M1D A;  2IJZ A;  4P4E A;  4P4I A;  2PJ3 A;  1YX0 A;  3BI1 A;  3V38 A;  4KLV A;  4F9U A;  2CIJ A;  4QB9 A;  4CGP A;  1TIQ A;  4LUA A;  1SQH A;  1BAV A;  5CBM A;  2ZED A;  5CPA A;  4OME A;  5CNP A;  1ZG9 A;  2FE7 A;  2OOT A;  4OAE A;  5LRK A;  3TO7 A;  3H5Z A;  1VHE A;  1S5K A;  4YWY A;  1Z4R A;  1XFO A;  3CXP A;  4PQA A;  5JM6 A;  1OBR A;  4UFX A;  4Y49 B;  3IC1 A;  3B2Y A;  1EE3 P;  4KOS A;  5F49 A;  3B3W A;  4ZGY B;  1IIC A;  4YGO A;  1M4I A;  4RN7 A;  1S60 A;  4LQG A;  1VIX A;  1Z8T A;  1MJ9 A;  1M4G A;  5D29 A;  3H8G A;  2CTB A;  4PSW A;  1FY7 A;  2REF A;  4NJQ A;  2EWB A;  5GCN A;  4E0A A;  4Y49 C;  1RTQ A;  4NGP A;  3WR7 A;  2HQY A;  5JGF A;  4OC2 A;  4WWV A;  3FMC A;  3G3S A;  3I1U A;  2FIW A;  2PJ7 A;  4P4B A;  2ZEF A;  2WSA A;  4H6Z A;  4H89 A;  4U9Y A;  1YGH A;  3VAT A;  1UWY A;  2ZOG A;  4M6G A;  1DE4 C;  4P4D A;  1TF9 A;  4MFK A;  2PC1 A;  2B5G A;  3KR4 A;  4F9V A;  1AMP A;  2GE3 A;  4W9Y A;  1VGY A;  2PSW A;  2QIR A;  4RS2 A;  5J8F A;  2WPW A;  5K8M A;  2DXQ A;  2OZG A;  3SXN A;  1CG2 A;  3PFO A;  1M4L A;  4QVT A;  3KHZ A;  4ZX8 A;  1B87 A;  4CRZ B;  4FD6 A;  4KSI A;  4A33 A;  1L0C A;  4F8Z A;  2JEW A;  2VQY A;  2AE6 A;  3A9L A;  2X7B A;  3KZW A;  4CYO A;  4U5Y A;  3DR8 A;  3TOA A;  1CX8 A;  2Z3N A;  2PJ4 A;  4MCR A;  2BUE A;  2AFS A;  3NE7 A;  4CYP A;  3EO4 A;  3PEI A;  3IIB A;  5ISV A;  3CPA A;  1M44 A;  2PJ6 A;  4QC6 A;  4A39 A;  4PXD A;  5AG7 A;  4F0Y A;  4H2K A;  3PB4 X;  4JJX A;  5G22 A;  4CRY B;  4JZ0 A;  3IU2 A;  2GLF A;  2I3C A;  3R96 A;  4CAV A;  5AG4 A;  4C2Y A;  4EWT A;  3BI0 A;  2B3V A;  2PIY A;  3DGV A;  4NGQ A;  1CP7 A;  2DF5 A;  3S9M A;  5KTC A;  2QVP A;  4IF5 A;  2HUZ A;  2ZEP A;  3R9E A;  1Q2C A;  4DNC A;  4ZBG A;  2GRE A;  2ZEE A;  4ZYQ A;  4PXB A;  3D7F A;  4UCP A;  4B11 A;  3EY5 A;  1WK4 A;  4FD5 A;  2DPS A;  3TO9 A;  1Q2Y A;  3N7Z A;  3LWU A;  5A28 A;  2EVN A;  2JBJ A;  4OID A;  4E8O A;  5JPH A;  1Y0Y A;  3D67 A;  4KVO E;  3QAY A;  2JDC A;  1YK3 A;  3S9N A;  4OAD A;  1LFW A;  5H86 A;  2CXA A;  4C7I A;  1ELL P;  5IX3 A;  4KZT A;  3F0A A;  1Q7L A;  3E0K A;  3N5F A;  1BPN A;  4UIB A;  3S6H A;  4CYQ A;  1Y7R A;  4L8A A;  3PB9 X;  1IYL A;  3WC5 A;  4P44 A;  4NFR A;  3BJ7 A;  4PV6 A;  2Q43 A;  3PP9 A;  4CGN A;  3SHP A;  2VL1 A;  5J1Q A;  3FX6 A;  4J3G A;  3FJU A;  5EBV A;  3S6F A;  3GUX A;  2GFQ A;  2ABZ A;  2Q4Z A;  1RO5 A;  1GHE A;  2FIA A;  2PQ8 A;  3BXM A;  4KUA A;  5AG6 A;  5FVJ A;  4XNH B;  2YNC C;  2PR1 A;  4PXC A;  2KCW A;  4MHD A;  2F5I A;  3MRU A;  2OR4 A;  4MFP A;  4OC4 A;  2EBJ A;  3PB8 X;  5H84 A;  1NE9 A;  2Z0Z A;  2EK8 A;  4MY3 A;  3D3S A;  3TT2 A;  4GM5 A;  3EC4 A;  1AUG A;  2POK A;  1S7F A;  1UFH A;  1Z2L A;  2GAN A;  3CDX A;  2YGW A;  3FYN A;  3T90 A;  2JDD A;  3JTK A;  2GLJ A;  2ZOF A;  2RC4 A;  2ZW5 A;  3B8G A;  3PBB A;  4NGN A;  2Q7S A;  1CM0 A;  3F8K A;  4ONU A;  5G1Z A;  3D8P A;  4MI4 A;  3GB0 A;  3VWE A;  3IWE A;  2IL4 A;  4E2A A;  4MFQ A;  1YSJ A;  2PDO A;  4AB7 A;  2C1C A;  1FNO A;  4L89 A;  4AVC A;  2VI7 A;  3VAR A;  1VHS A;  3DSB A;  3SI2 A;  4P6Y A;  2AFO A;  2V8G A;  2ZXV A;  4PPZ A;  5E96 A;  4B14 A;  2ZEM A;  2RFH A;  1NMT A;  2ZEH A;  4C68 A;  4GXH A;  2G9D A;  1F2O A;  1ZG7 A;  4ZY2 A;  3NH4 A;  4KOW A;  3NE8 A;  4TWE A;  4MHZ A;  1VKC A;  5G21 A;  4JYW A;  2D4P A;  3WT4 A;  4IK2 A;  2BO9 A;  4F6A A;  5J8C A;  5K8N A;  1Z4E A;  4OC0 A;  1OZP A;  3FEC A;  3GYA A;  3T9Y A;  2J8M A;  2V77 A;  4ZX9 A;  1I12 A;  3PB7 X;  4A38 A;  4KUB A;  4A95 A;  1ARL A;  1S7N A;  1IOI A;  2YNE A;  1RXT A;  4JLY A;  3WC7 A;  4HNY B;  4FBE A;  2V8D A;  1XIX A;  3TCV A;  3D2P A;  3DR6 A;  4CAX A;  2FS5 A;  1I21 A;  4HNX B;  4FAI A;  4XPD B;  1XOV A;  3CXQ A;  4KOU A;  4GS4 A;  4A37 A;  4X2T A;  1PYT B;  1QQ9 A;  4MHP A;  3S9L A;  2HC9 A;  4KSA A;  3I3G A;  4KVX A;  4MHY A;  4U9Z A;  4NGR A;  5D8N A;  4C2Z A;  3KQX A;  4OC3 A;  1V0C A;  2WYR A;  4ORF A;  4Q36 A;  1ELM P;  4IAV A;  1U6M A;  1IY7 A;  1P0H A;  3CPX A;  3BHX A;  2REE A;  5LRJ A;  2Z3O A;  3FEE A;  2QYV A;  1LAN A;  2G3T A;  3FIX A;  2PJ0 A;  2PCU A;  3IJ3 A;  1TKH A;  4XPL A;  2DPT A;  2YNC A;  4Z65 A;  2Q04 A;  4I49 A;  4A30 A;  1LAM A;  4OKO A;  3R95 A;  2EK9 A;  5G20 A;  1F57 A;  2I00 A;  4XPK A;  1MJA A;  1TF8 A;  2YND A;  4Q7A A;  2NYQ A;  8CPA A;  1HEE A;  5I4M A;  3KAS A;  2ZW7 A;  2FXF A;  4MFZ A;  4MMO A;  3QNV A;  1Z8W A;  3D2M A;  2C27 A;  4BIN A;  1B6B A;  1KUX A;  4OP4 A;  4KVM E;  3GIU A;  2IMO A;  4QUS A;  3V7Z A;  3BJ8 A;  4LQ6 A;  2K5T A;  3MGD A;  2C6G A;  2V8V A;  1Y0R A;  2V8H A;  4PXE A;  4A94 A;  4B5O A;  1XMB A;  2Q4Y A;  1YR0 A;  2ZEN A;  4PK2 A;  3RO0 A;  5HMN A;  2A4N A;  1Y9W A;  1QSM A;  2F7V A;  2ODF A;  1LCP A;  3IU1 A;  4R7M A;  5KTA A;  5I0C A;  4K3N A;  3LD2 A;  3TC8 A;  1XMT A;  1F2P A;  3FVL A;  5F46 A;  3KKW A;  1X12 A;  3R1K A;  2BOA A;  4G1P A;  4YRH A;  2NSM A;  4KOT A;  4MRI A;  4EFD A;  1QSR A;  2Q7B A;  4ONW A;  4MXU A;  2VBQ A;  4B6Z A;  5A27 A;  4HNW B;  3NH8 A;  4UWI A;  3SI1 A;  4MBU A;  4MJ8 A;  1ZLI A;  2ZPA A;  2GIV A;  1IGB A;  4B5P B;  4AVB A;  1ZO0 A;  2PVW A;  4MCQ A;  4H6U A;  4KOV A;  3KHX A;  2IQ6 A;  1Z8X A;  2R98 A;  4UFV A;  4UCN A;  5DWN A;  2ZW6 A;  4O23 A;  1R43 A;  2XEF A;  3KI9 A;  3WAB A;  1S7L A;  5AGE A;  2XEJ A;  1KZF A;  1GYT A;  3QB8 A;  1CPX A;  3BLN A;  1XF8 A;  5HVG A;  2FT0 A;  4UCM A;  1Z5R A;  4CAW A;  3D7H A;  4KOY A;  5DWM A;  1YME A;  2OU2 A;  5DS0 A;  2Q44 A;  2O28 A;  2JEV A;  1KUV A;  3NFZ A;  4ZI6 A;  1YW4 A;  2CF4 A;  4RUH A;  3LOD A;  5F09 A;  5HVH A;  2PR8 A;  1CP6 A;  2B5G B;  4UWJ A;  1XE4 A;  4HPS A;  1N71 A;  2GU2 A;  2ZEG A;  1TXR A;  2PJ5 A;  3W91 A;  2EUI A;  4X5K A;  4AXV A;  4NGT A;  2PE3 A;  5LYL A;  1BO4 A;  4K30 A;  4PSX A;  4CGL A;  5C88 A;  3IWW A;  1DTD A;  3OWC A;  3FF3 A;  2Z3K A;  5IV0 A;  1JQG A;  3IGR A;  4Q38 A;  1Z8L A;  4AG7 A;  4YFJ A;  1KWM A;  5F48 A;  3FB3 A;  3IO1 A;  2B4D A;  3PBE A;  3UY5 A;  1IOF A;  4NGS A;  2CNT A;  3W6S A;  4P45 A;  4FD7 A;  4CAE A;  5C82 A;  1AYE A;  2AFM A;  2CNM A;  1CBX A;  2AFU A;  2Q4V A;  4II9 A;  3CXS A;  1PUA A;  2OH1 A;  2PIZ A;  3D4U A;  4R3L A;  2R7H A;  1XJO A;  2OB0 A;  2VZY A;  3ISZ A;  4TNU A;  4UF4 A;  2PJA A;  3H4Q A;  4M6H A;  1MK4 A;  4KOR A;  5ELY A;  2Q51 A;  4UBR A;  1I1D A;  1WWZ A;  1LRZ A;  5JQ4 A;  3PZJ A;  4EME A;  4RI1 A;  4PK3 A;  4YU9 A;  3JUW A;  4C7H A;  4IUS A;  4NXY A;  4NSQ A;  1IB1 E;  4R3K A;  4MCS A;  3RZA A;  1S3Z A;  1ZLH A;  3ISX A;  2R8V A;  4NCZ A;  1QMU A;  3P2H A;  4KS9 A;  2O53 A;  4CS0 B;  1ON0 A;  2J8N A;  3FRM A;  4A31 A;  2RB7 A;  3H8F A;  4XNH C;  3FNC A;  2OZH A;  1CJW A;  3TO6 A;  3SJF A;  3B35 A;  3SI0 A;  5EMI A;  5LRG A;  3KL9 A;  4CAF A;  3GLJ A;  4NGM A;  3LMS A;  2Z10 A;  3QAH A;  3TOB A;  4BMH A;  4A2Z A;  2JLM A;  6CPA A;  2VEZ A;  4P4F A;  3DDD A;  2WZN A;  3MN8 A;  3FH4 A;  3KGQ A;  5IB0 A;  3TFY A;  4M6I A;  1FT7 A;  3K9U A;  3VWD A;  1PU9 A;  2Z3P A;  4MCP A;  4QBJ A;  1P4N A;  2HB6 A;  1A2Z A;  2B4D B;  1BPM A;  4X3R A;  3RNZ A;  4IHM A;  4R6T A;  4MY0 A;  3GY9 A;  2Z3L A;  3PFE A;  4M85 A;  1ARM A;  3V8I A;  3SJE A;  2J8R A;  1BOB A;  3SJG A;  3B7I A;  4B5P A;  1NSL A;  3SJX A;  3IWG A;  4BD9 A;  3JRU A;  2CTC A;  2EO8 A;  2NMT A;  2Y0M A;  1IU8 A;  2ARH A;  5THW A;  3B3C A;  1QSN A;  2ATR A;  5HXD A;  4ZY1 A;  1S7K A;  1PCA A;  1YVK A;  3D68 A;  1NSA A;  3D66 A;  1K4J A;  1JWQ A;  2AFW A;  1TKJ A;  2CY2 A;  2PRB A;  4NEX A;  4P4J A;  4B10 A;  2QML A;  4UEE A;  5K8P A;  3TX8 A;  3EXN A;  3FED A;  4P10 A;  4NF1 A;  2BCO A;  4AG9 A;  3CZX A;  2C6C A;  2F8H A;  4B13 A;  2I79 A;  2BL1 A;  4CPA A;  4KOX A;  2FSR A;  4MFL A;  1KUY A;  5LYI A;  3DLJ A;  1QST A;  4KLW A;  2DEA A;  5IB9 A;  4MHN A;  3LAC A;  3B3S A;  2J9A A;  2P0W A;  3S6G A;  3T8W A;  3D7D A;  4R76 A;  3DNS A;  2AFX A;  2ZEL A;  1IID A;  4OC1 A;  3W6X A;  1YLO A;  4A32 A;  3I9S A;  2O4H A;  3S6K A;  2PJC A;  3K2K A;  5KTD A;  4BBH A;  2C6P A;  4R9M A;  2P6F A;  4OC5 A;  1J4J A;  5HH1 A;  2P6G A;  3RBU A;  1R3N A;  2XEG A;  1LOK A;  4JXQ A;  4OLL A;  4OIW A;  2XEI A;  4LX9 A;  4AVA A;  2BEI A;  3HLP A;  1H8L A;  3ZJ0 A;  3P2F A;  4CYN A;  3NA6 A;  5LYF A;  3D7G A;  2VXK A;  5F47 A;  3TTH A;  3PGP A;  4FUU A;  3FXT A;  4FWU A;  2WPX A;  2PJB A;  3H8E A;  2R1I A;  4JWP A;  1QSO A;  1XRY A;  3HUV A;  3WC6 A;  1YRE A;  3K9T A;  2PJ8 A;  2WUU A;  1Z9U A;  4R8F A;  3PRT A;  4C2X A;  3EFA A;  3VH9 A;  1YLE A;  1BLL E;  2P6E A;  4CGM A;  4M3S A;  4R57 A;  4DUK A;  2HV2 A;  2QEC A;  1TKF A;  4HKF A;  1Y9K A;  3G8W A;  5BWA B;  7CPA A;  1CPS A;  1X10 A;  4FD4 A;  3ZZI A;  3TE4 A;  4EVY A;  2PJ1 A;  4UEZ A;  5K8O A;  1ZG8 A;  4F0X A;  2ZW4 A;  5EC4 A;  5AG5 A;  2ANP A;  2FL4 A;  4R87 A;  2AJ6 A;  1Y7E A;  1XEB A;  3F5B A;  3PB6 X;  2QJ8 A;  4KSF A;  4ZY0 A;  1VHO A;  1MJB A;  3R9F A;  2FCK A;  2G3A A;  1YW6 A;  3RAM A;  3FBU A;  4NJR A;  3KQZ A;  4WJB A;  2B58 A;  2PVV A;  2Z11 A;  5JH9 A;  2Z3M A;  4CGO A;  2AFZ A;  3KR5 A;  5LYD A;  2B3U A;  4UA3 A;  3B3T A;  4DYO A;  4UIA A;  4DJL A;  1XBU A;  1HDU A;  3IFE A;  1LAP A;  1M4D A;  4JD6 A;  2FVG A;  1HDQ A;  2VZZ A;  3R9G A;  4UFW A;  4B12 A;  2ZEO A;  3JVN A;  2G0B A;  3GKR A;  4MFJ A;  4XPD C;  1Q2D A;  2JBK A;  3IEH A;  2PRQ A;  1YVO A;  5HVF A;  2PJ2 A;  1R57 A;  3C26 A;  2CNS A;  2H5M A;  4JXR A;  1IYK A;  2BSW A;  2OZU A;  2B4B A;  3B3V A;  4UEF A;  4X8I A;  3RYO A;  3L2N A;  1YQE A;  2PJ9 A; 
#chains in the Genus database with same CATH homology
 2D4O A;  2Q0Y A;  3SXO A;  1M1D A;  1YX0 A;  4KLV A;  4QB9 A;  4CGP A;  1TIQ A;  4LUA A;  1SQH A;  5CNP A;  2FE7 A;  3TO7 A;  3H5Z A;  1S5K A;  1Z4R A;  3CXP A;  4UFX A;  4Y49 B;  4KOS A;  5F49 A;  4ZGY B;  1IIC A;  4YGO A;  1M4I A;  1S60 A;  1MJ9 A;  1M4G A;  4PSW A;  1FY7 A;  2REF A;  5GCN A;  4E0A A;  4Y49 C;  3WR7 A;  2HQY A;  3G3S A;  2FIW A;  2WSA A;  4H6Z A;  4H89 A;  4U9Y A;  1YGH A;  4MFK A;  2PC1 A;  2B5G A;  2GE3 A;  2PSW A;  2QIR A;  4RS2 A;  5J8F A;  2WPW A;  2DXQ A;  2OZG A;  3SXN A;  4QVT A;  1B87 A;  4CRZ B;  4FD6 A;  4A33 A;  1L0C A;  2VQY A;  2AE6 A;  3A9L A;  2X7B A;  4CYO A;  4U5Y A;  3DR8 A;  3TOA A;  2Z3N A;  2BUE A;  3NE7 A;  4CYP A;  3EO4 A;  5ISV A;  1M44 A;  4QC6 A;  5AG7 A;  4F0Y A;  4JJX A;  5G22 A;  4CRY B;  3IU2 A;  4CAV A;  3R96 A;  5AG4 A;  4C2Y A;  2B3V A;  5KTC A;  4IF5 A;  2HUZ A;  3R9E A;  1Q2C A;  4DNC A;  4ZBG A;  4UCP A;  4B11 A;  3EY5 A;  1WK4 A;  4FD5 A;  2DPS A;  3TO9 A;  1Q2Y A;  3N7Z A;  5A28 A;  5JPH A;  2EVN A;  4E8O A;  4KVO E;  2JDC A;  1YK3 A;  4OAD A;  5H86 A;  2CXA A;  4C7I A;  5IX3 A;  4KZT A;  3F0A A;  3E0K A;  3S6H A;  4CYQ A;  1Y7R A;  4L8A A;  1IYL A;  3BJ7 A;  4PV6 A;  3PP9 A;  4CGN A;  3SHP A;  4J3G A;  5EBV A;  3S6F A;  1RO5 A;  1GHE A;  2FIA A;  2PQ8 A;  4KUA A;  5AG6 A;  5FVJ A;  4XNH B;  2YNC C;  2PR1 A;  2KCW A;  4MHD A;  2F5I A;  4MFP A;  5H84 A;  1NE9 A;  2Z0Z A;  4MY3 A;  3D3S A;  3TT2 A;  3EC4 A;  1S7F A;  1UFH A;  2GAN A;  3FYN A;  2YGW A;  3T90 A;  2JDD A;  3JTK A;  3B8G A;  4OAE A;  2RC4 A;  2ZW5 A;  4ONU A;  5G1Z A;  1CM0 A;  3F8K A;  3D8P A;  4MI4 A;  3VWE A;  4E2A A;  3IWE A;  2IL4 A;  4MFQ A;  2PDO A;  4AB7 A;  4L89 A;  4AVC A;  2VI7 A;  1VHS A;  3DSB A;  2ZXV A;  5E96 A;  4B14 A;  4C68 A;  1NMT A;  4KOW A;  1VKC A;  5G21 A;  2D4P A;  4F6A A;  5J8C A;  1Z4E A;  1OZP A;  3T9Y A;  3GYA A;  2J8M A;  1I12 A;  4KUB A;  4A95 A;  1S7N A;  2YNE A;  1RXT A;  4JLY A;  4HNY B;  1XIX A;  3TCV A;  3D2P A;  3DR6 A;  4CAX A;  2FS5 A;  1I21 A;  4HNX B;  4XPD B;  3CXQ A;  4KOU A;  4GS4 A;  4KSA A;  3I3G A;  4KVX A;  4U9Z A;  4C2Z A;  4Q36 A;  1V0C A;  4ORF A;  1U6M A;  1P0H A;  2REE A;  2Z3O A;  2G3T A;  3FIX A;  4XPL A;  2DPT A;  2YNC A;  2Q04 A;  4I49 A;  4A30 A;  3R95 A;  5G20 A;  2I00 A;  4XPK A;  1MJA A;  2YND A;  2ZW7 A;  2FXF A;  4MFZ A;  3D2M A;  2C27 A;  1B6B A;  1KUX A;  4KVM E;  4QUS A;  3BJ8 A;  2K5T A;  3MGD A;  4B5O A;  2Q4Y A;  4PK2 A;  1YR0 A;  5HMN A;  2A4N A;  1Y9W A;  1QSM A;  3IU1 A;  5KTA A;  5I0C A;  3LD2 A;  1XMT A;  5F46 A;  3KKW A;  3R1K A;  4YRH A;  4KOT A;  1QSR A;  2Q7B A;  2VBQ A;  5A27 A;  4HNW B;  4UWI A;  4MBU A;  4MJ8 A;  2ZPA A;  2GIV A;  4B5P B;  4AVB A;  1ZO0 A;  4H6U A;  4KOV A;  2R98 A;  4UFV A;  4UCN A;  5DWN A;  2ZW6 A;  1S7L A;  5AGE A;  1KZF A;  3QB8 A;  3BLN A;  1XF8 A;  2FT0 A;  4UCM A;  4CAW A;  4KOY A;  5DWM A;  2OU2 A;  2Q44 A;  2O28 A;  2JEV A;  1KUV A;  3LOD A;  2PR8 A;  2B5G B;  4UWJ A;  1XE4 A;  1N71 A;  3W91 A;  2EUI A;  4X5K A;  1BO4 A;  4K30 A;  4PSX A;  4CGL A;  5C88 A;  3OWC A;  2Z3K A;  5IV0 A;  3IGR A;  4Q38 A;  4AG7 A;  4YFJ A;  5F48 A;  3FB3 A;  2B4D A;  3UY5 A;  2CNT A;  3W6S A;  4FD7 A;  4CAE A;  5C82 A;  2CNM A;  2Q4V A;  4II9 A;  3CXS A;  1PUA A;  2OH1 A;  4R3L A;  2R7H A;  2OB0 A;  2VZY A;  3H4Q A;  1MK4 A;  4KOR A;  4UBR A;  1I1D A;  1WWZ A;  1LRZ A;  5JQ4 A;  3PZJ A;  4RI1 A;  4PK3 A;  3JUW A;  4C7H A;  4IUS A;  4NXY A;  4NSQ A;  1IB1 E;  4R3K A;  1S3Z A;  2R8V A;  4NCZ A;  3P2H A;  4KS9 A;  4CS0 B;  1ON0 A;  2J8N A;  3FRM A;  4A31 A;  4XNH C;  3FNC A;  2OZH A;  1CJW A;  3TO6 A;  4CAF A;  2Z10 A;  3QAH A;  3TOB A;  4BMH A;  4A2Z A;  2JLM A;  2VEZ A;  3DDD A;  5IB0 A;  3TFY A;  3K9U A;  3VWD A;  2Z3P A;  1PU9 A;  4QBJ A;  1P4N A;  2B4D B;  4MY0 A;  3GY9 A;  2Z3L A;  4M85 A;  3V8I A;  2J8R A;  1BOB A;  4B5P A;  1NSL A;  3IWG A;  2NMT A;  2Y0M A;  2ARH A;  1QSN A;  2ATR A;  1S7K A;  1YVK A;  1K4J A;  2CY2 A;  2PRB A;  4NEX A;  4B10 A;  2QML A;  3EXN A;  4NF1 A;  4AG9 A;  4B13 A;  2I79 A;  2BL1 A;  4KOX A;  2FSR A;  4MFL A;  1KUY A;  1QST A;  4KLW A;  2P0W A;  3S6G A;  3DNS A;  3W6X A;  1IID A;  4A32 A;  3I9S A;  3S6K A;  5KTD A;  4BBH A;  4R9M A;  2P6F A;  1J4J A;  5HH1 A;  2P6G A;  4JXQ A;  4OLL A;  4AVA A;  4LX9 A;  2BEI A;  3ZJ0 A;  4CYN A;  3P2F A;  2VXK A;  5F47 A;  3TTH A;  3PGP A;  3FXT A;  2WPX A;  4JWP A;  2R1I A;  1QSO A;  1YRE A;  2WUU A;  4C2X A;  1Z9U A;  3EFA A;  1YLE A;  2P6E A;  4CGM A;  4M3S A;  4R57 A;  2HV2 A;  2QEC A;  4HKF A;  1Y9K A;  3G8W A;  5BWA B;  4FD4 A;  3ZZI A;  3TE4 A;  4F0X A;  2ZW4 A;  5EC4 A;  5AG5 A;  4R87 A;  2FL4 A;  2AJ6 A;  4KSF A;  1XEB A;  3F5B A;  1MJB A;  3R9F A;  2FCK A;  2G3A A;  3FBU A;  2B58 A;  2Z11 A;  2Z3M A;  4CGO A;  2B3U A;  4UA3 A;  4JD6 A;  1M4D A;  2VZZ A;  3R9G A;  4UFW A;  4B12 A;  3JVN A;  2G0B A;  3GKR A;  4MFJ A;  4XPD C;  1Q2D A;  1YVO A;  1R57 A;  4JXR A;  3C26 A;  2CNS A;  2H5M A;  1IYK A;  2BSW A;  2OZU A;  2B4B A;  3RYO A;  4EVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...