4UCMA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucmA00
4A30A 4C2ZA 4UFVA 5G1ZA 4C2YA 5A27A 4A31A 4CYQA 3IU1A 2YNEA 4CAEA 4UFXA 5G21A 4A95A 4A33A 4B14A 4UCNA 4CGOA 2WSAA 4CYNA 4C2XA 4B11A 4B12A 2YNCC 4CAFA 4CGMA 4CGLA 4CYOA 4UCMA 5G20A 4A2ZA 4B10A 4C68A 5AG4A 2WUUA 5AGEA 5A28A 5AG6A 5AG5A 4A32A 5G22A 2YNCA 4BBHA 2YNDA 4B13A 3JTKA 4UFWA 4C7IA 4CGPA 3IU2A 3IWEA 4CYPA 4C7HA 4CGNA 4UCPA 5AG7A 3H5ZA
chains in the Genus database with same CATH superfamily
1Z8LA 1ELLP 2PJCA 1WWZA 4P45A 3VWDA 2NYQA 2ZEMA 4A39A 1Y7EA 1N71A 2DF5A 4PSWA 3KHZA 4B5PA 2PC1A 2Q0YA 1YVKA 4UCNA 4KOTA 4R3KA 3D7GA 4MRIA 4EVYA 3K9TA 4KVME 4B11A 2V8VA 4OC2A 3KHXA 1QSTA 1FNOA 4MHZA 3WC5A 2CIJA 3FF3A 5J8FA 1DTDA 1TF8A 1P0HA 4NGPA 2GU2A 2R8VA 2Q4VA 4W9YA 4YGOA 4AB7A 4DJLA 2GIVA 4HNYB 1VHEA 1X10A 1Z5RA 1KUXA 4LQGA 4ZX9A 3S6FA 1MJBA 4E8OA 3IO1A 2B3UA 2WPWA 4MCSA 5HVHA 4CAVA 2G3TA 2O4HA 3PP9A 4OC3A 4U5YA 4M85A 4MCQA 4R8FA 2Z3KA 3TO6A 2ZEOA 1BPMA 2GREA 5CNPA 2R98A 1UFHA 1NE9A 5LYFA 3WC7A 3N5FA 1F2PA 2OOTA 3I1UA 3R96A 3NH5A 1HDUA 4OC5A 1XMBA 4L89A 3W6XA 1NSLA 2DEAA 2IMOA 3CXQA 3HLPA 4QUSA 3LODA 4H89A 3S9NA 1BOBA 1KUYA 3FBUA 2RFHA 2Z3PA 2ZEPA 4MI4A 2ZELA 6CPAA 5LRGA 1AYEA 1GHEA 1Q7LA 5EMIA 2AFOA 1ZO0A 5G22A 3FXTA 2V8DA 1XE4A 3D4UA 3RYOA 4CGNA 2YGWA 3L2NA 1Z4RA 4P6YA 2C6CA 1S7KA 3MRUA 3LD2A 4R3LA 5HMNA 4UWJA 2PJ6A 4CRZB 1XIXA 3H4QA 4H6UA 3SI1A 2HB6A 2BOAA 1CX8A 2VXKA 5J1QA 2ZOFA 1Z8XA 3PRTA 3BI1A 1H8LA 1QSOA 2RC4A 1PCAA 1S3ZA 2D4OA 2B3VA 1IYKA 1Z9UA 4KOWA 2Q51A 1YGHA 3F0AA 3NA6A 3B8GA 2PJ5A 4PPZA 4DUKA 2BUEA 4OC0A 4ZBGA 2J8RA 5EC4A 3QAHA 3DR6A 5AG5A 4PK3A 1B87A 2Z3MA 3SXOA 3P2FA 3KGQA 4YWYA 2XEFA 4BBHA 2PJAA 2Q43A 2Z11A 2PDOA 2PR1A 1XEBA 2PCUA 4KOVA 3GUXA 4R7MA 4I49A 1Z8TA 1YX0A 1XMTA 2FCKA 4MCRA 4UFVA 5G1ZA 3S6HA 1ZG9A 2PSWA 1Y0YA 3DSBA 5LYDA 3VARA 4AG7A 5K8PA 4CRYB 3N7ZA 3SJXA 4RI1A 4AG9A 4B14A 2J8NA 4B6ZA 2DPSA 2FT0A 3B3VA 4B12A 5HH1A 1BPNA 4X3RA 4R6TA 3RAMA 4KSFA 4P4FA 5G20A 1Q2YA 1ZG7A 2PVWA 3EFAA 3H8FA 3G3SA 3LACA 4OP4A 3RZAA 2WUUA 3S9LA 3LWUA 4CPAA 2Z0ZA 1I1DA 4A32A 4X2TA 3CZXA 3MN8A 3KZWA 3PBEA 4JJXA 3DR8A 4UA3A 4OAEA 4JYWA 1M44A 1UWYA 2I00A 5EBVA 4ZY1A 3TFYA 2GLJA 2HQYA 2ZXVA 3FVLA 4CYQA 3VH9A 2AJ6A 4JLYA 2F7VA 3W6SA 1TIQA 4XPDB 4NJQA 3V38A 2NSMA 4F6AA 2VEZA 4KZTA 1EE3P 3B3TA 3B7IA 2C27A 3B3SA 5AGEA 4F9VA 3FEDA 2VZZA 1YR0A 2ZENA 4AVBA 1TF9A 2FSRA 3PB9X 3PZJA 4IHMA 4NGMA 1I21A 2AFMA 2Q44A 5DWMA 4CAXA 3CT9A 1CM0A 2Z3NA 5JH9A 1KWMA 2RB7A 2PJ1A 2ATRA 2F8HA 1Y9KA 4E0AA 3NFZA 3IIBA 3BJ8A 2PR8A 2IL4A 1QSNA 2OU2A 2QVPA 4IAVA 2PRQA 5GCNA 4QB9A 5F49A 4HNXB 4NEXA 2XEGA 5C82A 2DPTA 2BEIA 4A38A 5K8MA 3B2YA 3GKRA 3NH4A 4FWUA 1NSAA 1A2ZA 4MY3A 4BINA 4UWIA 1L0CA 2EO8A 4UFWA 4C7IA 3K2KA 3F8KA 3SI0A 5IB9A 2AFWA 2R7HA 3F5BA 2CXAA 1Z8WA 3H5ZA 4MFLA 1Z2LA 3ISZA 2CF4A 3PB7X 3QNVA 4UEEA 3R95A 2AE6A 2FVGA 4KOUA 5H84A 2B58A 3FECA 1XRYA 3PBBA 4ZY2A 5IV0A 2ZEFA 2HUZA 2B4BA 4KSIA 4M6IA 1YREA 8CPAA 3PB8X 3ZZIA 4Z65A 3IFEA 3PFOA 2ZOGA 4M3SA 2K5TA 5ISVA 3D8PA 4YFJA 5JGFA 2GE3A 4KORA 1WK4A 4CYOA 1IYLA 1M4IA 4AVCA 1MK4A 1PYTB 1CBXA 3OWCA 1RO5A 1LANA 4WJBA 1I12A 5D29A 5A28A 5I0CA 2DXQA 2B5GB 4XNHB 2PJ8A 5F47A 2AFZA 3R9EA 1RXTA 2PE3A 2YNDA 3FH4A 1VHOA 1YLEA 2PIZA 4H6ZA 2PJ0A 4UCPA 1VKCA 2IQ6A 2Q4ZA 4OLLA 4ONWA 1CPSA 2Z3OA 1R3NA 2Z10A 1OZPA 4NGSA 5IB0A 2V77A 1Y7RA 4IK2A 4MFPA 4MHNA 4KOSA 4B5PB 4PXDA 4FUUA 1F2OA 3TO7A 1KZFA 4ZI6A 3RBUA 2REFA 2EWBA 2PJ4A 2ZEHA 4EMEA 7CPAA 2ZEDA 3QAYA 4UBRA 4HNWB 4LQ6A 5LYIA 5THWA 1Q2CA 1XF8A 5LRJA 3V7ZA 4UIBA 3LMSA 1LFWA 1ELMP 1M4GA 4EWTA 1YQEA 3D67A 2AFUA 1FT7A 4RUHA 4A2ZA 1R43A 2OZHA 2PIYA 4P4DA 2EBJA 3PB4X 1YMEA 4ORFA 4JXRA 3BI0A 4ZX8A 1ZG8A 2ABZA 3D68A 2B4DB 1SQHA 4NFRA 1HEEA 4R87A 3GY9A 4F0XA 2G0BA 3B3WA 3S9MA 3T9YA 2QECA 2OB0A 3NH8A 4ONUA 3T90A 2ZEGA 1IOIA 2PJ9A 1CP6A 3TT2A 2J9AA 5A27A 1OBRA 2JEWA 2PQ8A 1AUGA 2CNMA 4OMEA 3ZJ0A 4MHDA 4F0YA 1IU8A 1ON0A 1TKHA 3KL9A 4NGTA 3PEIA 4XNHC 3B3CA 3MGDA 2OZGA 2EVNA 3VATA 4CGLA 4PXBA 1U6MA 3CPXA 1Z4EA 2ZEEA 3K9UA 4MFQA 4PV6A 2O28A 4E2AA 1AMPA 4NJRA 5HVFA 2Q4YA 4Q36A 4NF1A 1NMTA 5AG6A 4NSQA 4RS2A 2D4PA 2JDCA 2XEJA 1FY7A 3SI2A 4K3NA 3IU2A 2F5IA 4CGPA 1Y0RA 4NGRA 3FYNA 2GFQA 2Q04A 2QJ8A 5F48A 3GIUA 3DLJA 4KSAA 3KASA 1S7FA 2JEVA 3BLNA 4G1PA 5FVJA 3TC8A 2P6EA 3JUWA 4TWEA 4X8IA 3EY5A 2ZPAA 4P4JA 1ARMA 1B6BA 3WR7A 4PSXA 3TCVA 4C2XA 4KS9A 4CGMA 5F09A 3E0KA 4EFDA 2G3AA 2PJ3A 2FE7A 4OIDA 4LX9A 2QMLA 1M4LA 3CDXA 2BO9A 3PB6X 4MFZA 2HC9A 4PQAA 4MXUA 1TXRA 1IICA 1TKFA 5HVGA 2CTBA 3D2PA 3IEHA 3H8GA 1P4NA 4P4BA 4OADA 3ISXA 1GYTA 1PU9A 4M6HA 2VQYA 4DYOA 2AFXA 5LYLA 4QC6A 2I79A 3SJEA 3D66A 3KKWA 3WC6A 2ZW5A 3EO4A 4B5OA 1XJOA 3HUVA 2CTCA 4KUAA 1QSRA 4PK2A 4OC1A 1BAVA 3TOAA 4H2KA 3CPAA 2I3CA 4P4EA 4UEFA 4FD6A 4OIWA 5KTAA 1HDQA 4FD5A 5DS0A 2ARHA 4M6GA 3I9SA 4ZGYB 1JQGA 2EK8A 3VWEA 2JLMA 3B35A 1YLOA 1F57A 3FEEA 2FS5A 1BO4A 2Y0MA 4KLWA 4DNCA 3JRUA 4MMOA 4R76A 1CP7A 1LCPA 2BCOA 2NMTA 3TE4A 1IB1E 1ARLA 2C6PA 2C6GA 2PJ7A 2PJBA 4MY0A 1ZLIA 4AVAA 5KTCA 3D7DA 4XPDC 4A31A 4JWPA 3IWGA 3WT4A 2VL1A 3DGVA 3DDDA 3IU1A 4P4IA 4UFXA 4XPKA 1M1DA 4JXQA 2VI7A 3KQZA 1CG2A 1J4JA 1Q2DA 2ZW7A 3BXMA 4F9UA 3D2MA 4CYNA 1RTQA 2HV2A 4BMHA 4F8ZA 2EK9A 4MHYA 1ZLHA 2Q7SA 4HKFA 4WWVA 5JPHA 2OH1A 3RNZA 4B10A 2KCWA 5DWNA 3G8WA 1S7LA 2ZW6A 2CY2A 3KR4A 2EUIA 4JZ0A 3FB3A 4PXEA 3JTKA 2B4DA 2P6GA 4X5KA 4FD4A 4GXHA 3FMCA 1YW4A 4A30A 4ZY0A 4GM5A 4C2ZA 4NGQA 2XEIA 2FXFA 3R1KA 4AXVA 2JDDA 4Y49B 3TO9A 4CAEA 1KUVA 4JD6A 3FX6A 3JVNA 4QBJA 2V8GA 2WSAA 1XFOA 1QQ9A 4O23A 5CBMA 5KTDA 2YNCC 4J3GA 4CAFA 1XOVA 3R9FA 3TOBA 3KI9A 4FBEA 4U9YA 4A94A 1TKJA 3PFEA 1LAPA 4MFKA 1VGYA 3GB0A 2WZNA 4IUSA 4GS4A 5ELYA 3CXSA 2O53A 4C7HA 5LRKA 1YSJA 2Q7BA 2P0WA 1LRZA 4FAIA 3EXNA 3UY5A 4K30A 5I4MA 2AFSA 4C2YA 4BD9A 5H86A 4MJ8A 1V0CA 2JBKA 1PUAA 2QIRA 1XBUA 1YVOA 2CNSA 3H8EA 1IGBA 3IC1A 2FIWA 3A9LA 1IIDA 3DNSA 4KOXA 4L8AA 2J8MA 4A37A 2Z3LA 3BHXA 1YW6A 4MFJA 5J8CA 3IJ3A 4KOYA 1R57A 4YU9A 3FIXA 4P44A 5CPAA 5F46A 2OR4A 4II9A 2V8HA 1M4DA 1DE4C 2BL1A 3C26A 3GLJA 4RN7A 3SJFA 5C88A 4Y49C 4PXCA 5D8NA 4KLVA 5AG7A 3FNCA 3SHPA 3V8IA 3IGRA 1QSMA 3IWEA 4TNUA 3KQXA 3BJ7A 3I3GA 4R9MA 4CS0B 2P6FA 1MJ9A 3D3SA 4MBUA 4CAWA 4MCPA 3NE7A 1BLLE 4UEZA 4KUBA 4Q38A 2YNEA 1IY7A 3TTHA 3EC4A 3QB8A 2A4NA 3R9GA 3FJUA 3KR5A 4CGOA 3SJGA 1QMUA 2PJ2A 3FRMA 1IOFA 1S5KA 1LOKA 3PGPA 3W91A 2VZYA 3S6GA 5K8OA 2PRBA 2C1CA 5BWAB 5K8NA 5IX3A 2GANA 2PVVA 3D7FA 3T8WA 2ODFA 2CNTA 2WPXA 3IWWA 4IF5A 3SXNA 3TX8A 2YNCA 5HXDA 4U9ZA 2ZW4A 2IJZA 1S7NA 2ANPA 2FIAA 4CYPA 1VIXA 4MHPA 4NGNA 4FD7A 1YK3A 1JWQA 1K4JA 2WYRA 2BSWA 4P10A 2JBJA 3P2HA 2FL4A 5G21A 3S6KA 4A95A 4UF4A 1Y9WA 4NCZA 4A33A 2R1IA 4YRHA 3NE8A 2G9DA 4UIAA 1MJAA 3GYAA 4OC4A 4OKOA 4UCMA 5E96A 3D7HA 4XPLA 3RO0A 4HPSA 5AG4A 1VHSA 2H5MA 4QVTA 4LUAA 1X12A 2POKA 5JM6A 2B5GA 2OZUA 2VBQA 4KVOE 4Q7AA 2REEA 2QYVA 1S60A 2X7BA 1LAMA 4NXYA 4R57A 3WABA 4B13A 4ZYQA 4C68A 3CXPA 1CJWA 5JQ4A 1CPXA 4KVXA 2GLFA
chains in the Genus database with same CATH topology
1WWZA 3VWDA 1N71A 4PSWA 4B5PA 2PC1A 2Q0YA 1YVKA 4UCNA 4KOTA 4R3KA 4EVYA 4KVME 4B11A 1QSTA 5J8FA 1P0HA 2R8VA 2Q4VA 4YGOA 4AB7A 2GIVA 4HNYB 1KUXA 3S6FA 1MJBA 4E8OA 2B3UA 2WPWA 4CAVA 2G3TA 3PP9A 4U5YA 4M85A 2Z3KA 3TO6A 5CNPA 2R98A 1UFHA 1NE9A 3R96A 4L89A 3W6XA 1NSLA 3CXQA 4QUSA 3LODA 4H89A 1BOBA 1KUYA 3FBUA 4MI4A 2Z3PA 1GHEA 5G22A 1ZO0A 3FXTA 1XE4A 3RYOA 4CGNA 2YGWA 1Z4RA 1S7KA 3LD2A 4R3LA 5HMNA 4UWJA 4CRZB 1XIXA 3H4QA 4H6UA 2VXKA 1QSOA 2RC4A 1S3ZA 2D4OA 2B3VA 1IYKA 1Z9UA 4KOWA 1YGHA 3F0AA 3B8GA 2BUEA 4ZBGA 2J8RA 5EC4A 3QAHA 3DR6A 5AG5A 4PK3A 1B87A 2Z3MA 3SXOA 3P2FA 4BBHA 2Z11A 2PDOA 2PR1A 1XEBA 4KOVA 4I49A 3S6HA 1YX0A 1XMTA 2FCKA 4UFVA 5G1ZA 2PSWA 3DSBA 4AG7A 4CRYB 3N7ZA 4RI1A 4AG9A 4B14A 2J8NA 2DPSA 2FT0A 4B12A 5HH1A 4KSFA 5G20A 1Q2YA 3EFAA 3G3SA 2WUUA 2Z0ZA 1I1DA 4A32A 4JJXA 3DR8A 4UA3A 4OAEA 1M44A 2I00A 5EBVA 3TFYA 2HQYA 2ZXVA 4CYQA 2AJ6A 4JLYA 3W6SA 1TIQA 4XPDB 4F6AA 2VEZA 4KZTA 2C27A 5AGEA 2VZZA 1YR0A 4AVBA 2FSRA 3PZJA 4CAXA 1I21A 2Q44A 5DWMA 1CM0A 2Z3NA 2ATRA 1Y9KA 4E0AA 3BJ8A 2PR8A 2IL4A 1QSNA 2OU2A 5GCNA 4QB9A 5F49A 4HNXB 4NEXA 5C82A 2DPTA 2BEIA 3GKRA 4MY3A 4UWIA 1L0CA 4UFWA 4C7IA 3F8KA 2R7HA 3F5BA 2CXAA 3H5ZA 4MFLA 3R95A 2AE6A 4KOUA 5H84A 2B58A 5IV0A 2HUZA 2B4BA 1YREA 3ZZIA 4M3SA 2K5TA 5ISVA 3D8PA 4YFJA 2GE3A 4KORA 1WK4A 4CYOA 1IYLA 1M4IA 4AVCA 1MK4A 3OWCA 1RO5A 5A28A 1I12A 5I0CA 5KTAA 2DXQA 2B5GB 4XNHB 5F47A 3R9EA 1RXTA 2YNDA 1YLEA 4H6ZA 4UCPA 1VKCA 4OLLA 2Z3OA 2Z10A 1OZPA 5IB0A 4MFPA 1Y7RA 4B5PB 4KOSA 3TO7A 1KZFA 2REFA 4UBRA 4HNWB 1Q2CA 1XF8A 1M4GA 4A2ZA 2OZHA 4ORFA 4JXRA 2B4DB 1SQHA 4R87A 3GY9A 4F0XA 2G0BA 3T9YA 2QECA 2OB0A 3T90A 4ONUA 3TT2A 5A27A 2PQ8A 2CNMA 3ZJ0A 4MHDA 4F0YA 1ON0A 4XNHC 3MGDA 2OZGA 2EVNA 4CGLA 1U6MA 1Z4EA 3K9UA 4MFQA 4PV6A 2O28A 4E2AA 2Q4YA 4Q36A 4NF1A 1NMTA 5AG6A 4NSQA 4RS2A 2D4PA 2JDCA 1FY7A 4CGPA 3IU2A 2F5IA 3FYNA 2Q04A 5F48A 4KSAA 1S7FA 2JEVA 3BLNA 5FVJA 2P6EA 3JUWA 3EY5A 2ZPAA 3WR7A 1B6BA 4PSXA 3TCVA 4C2XA 4KS9A 4CGMA 3E0KA 2G3AA 2FE7A 4LX9A 2QMLA 4MFZA 1IICA 3D2PA 1P4NA 4OADA 1PU9A 2VQYA 4QC6A 2I79A 3KKWA 2ZW5A 3EO4A 4B5OA 4KUAA 1QSRA 4PK2A 3TOAA 4FD6A 4FD5A 2ARHA 3I9SA 4ZGYB 3VWEA 2JLMA 2FS5A 1BO4A 2Y0MA 4KLWA 4DNCA 2NMTA 3TE4A 1IB1E 4MY0A 4AVAA 5KTCA 4XPDC 4A31A 4JWPA 3IWGA 3IU1A 3DDDA 4UFXA 4XPKA 1M1DA 4JXQA 2VI7A 1J4JA 1Q2DA 2ZW7A 3D2MA 4CYNA 2HV2A 4BMHA 5JPHA 4HKFA 2OH1A 4B10A 2KCWA 5DWNA 3G8WA 1S7LA 2ZW6A 2CY2A 2EUIA 3FB3A 3JTKA 2B4DA 2P6GA 4X5KA 4FD4A 4A30A 4C2ZA 2FXFA 3R1KA 2JDDA 4Y49B 3TO9A 4CAEA 1KUVA 4JD6A 3JVNA 4QBJA 2WSAA 5KTDA 2YNCC 4J3GA 4CAFA 3R9FA 3TOBA 4U9YA 4MFKA 4IUSA 4GS4A 3CXSA 4C7HA 2Q7BA 2P0WA 1LRZA 3EXNA 3UY5A 4K30A 4C2YA 5H86A 4MJ8A 1V0CA 1PUAA 2QIRA 1YVOA 2CNSA 2FIWA 3A9LA 1IIDA 3DNSA 4KOXA 4L8AA 2J8MA 2Z3LA 4MFJA 5J8CA 4KOYA 1R57A 3FIXA 5F46A 4II9A 3C26A 1M4DA 2BL1A 5C88A 4Y49C 4KLVA 5AG7A 3FNCA 3SHPA 3V8IA 3IGRA 1QSMA 3IWEA 3BJ7A 3I3GA 4R9MA 4CS0B 2P6FA 1MJ9A 3D3SA 4MBUA 4CAWA 3NE7A 4KUBA 4Q38A 2YNEA 3TTHA 3EC4A 3QB8A 2A4NA 3R9GA 4CGOA 3FRMA 1S5KA 3PGPA 3W91A 2VZYA 3S6GA 2PRBA 5BWAB 5IX3A 2GANA 2CNTA 2WPXA 4IF5A 3SXNA 2YNCA 4U9ZA 2ZW4A 2FIAA 1S7NA 4CYPA 4FD7A 1YK3A 1K4JA 2BSWA 3P2HA 2FL4A 5G21A 3S6KA 4A95A 1Y9WA 4NCZA 4A33A 2R1IA 4YRHA 1MJAA 3GYAA 5E96A 4UCMA 4XPLA 5AG4A 1VHSA 2H5MA 4QVTA 4LUAA 2B5GA 2OZUA 2VBQA 4KVOE 4B13A 2REEA 1S60A 2X7BA 4NXYA 4R57A 5JQ4A 4C68A 3CXPA 1CJWA 4KVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A30 A;  4C2Z A;  4UFV A;  5G1Z A;  4C2Y A;  5A27 A;  4A31 A;  4CYQ A;  3IU1 A;  2YNE A;  4CAE A;  4UFX A;  5G21 A;  4A95 A;  4A33 A;  4B14 A;  4UCN A;  4CGO A;  2WSA A;  4CYN A;  4C2X A;  4B11 A;  4B12 A;  2YNC C;  4CAF A;  4CGM A;  4CGL A;  4CYO A;  4UCM A;  5G20 A;  4A2Z A;  4B10 A;  4C68 A;  5AG4 A;  2WUU A;  5AGE A;  5A28 A;  5AG6 A;  5AG5 A;  4A32 A;  5G22 A;  2YNC A;  4BBH A;  2YND A;  4B13 A;  3JTK A;  4UFW A;  4C7I A;  4CGP A;  3IU2 A;  3IWE A;  4CYP A;  4C7H A;  4CGN A;  4UCP A;  5AG7 A;  3H5Z A; 
#chains in the Genus database with same CATH topology
 1Z8L A;  1ELL P;  2PJC A;  1WWZ A;  4P45 A;  3VWD A;  2NYQ A;  2ZEM A;  4A39 A;  1Y7E A;  1N71 A;  2DF5 A;  4PSW A;  3KHZ A;  4B5P A;  2PC1 A;  2Q0Y A;  1YVK A;  4UCN A;  4KOT A;  4R3K A;  3D7G A;  4MRI A;  4EVY A;  3K9T A;  4KVM E;  4B11 A;  2V8V A;  4OC2 A;  3KHX A;  1QST A;  1FNO A;  4MHZ A;  3WC5 A;  2CIJ A;  3FF3 A;  5J8F A;  1DTD A;  1TF8 A;  1P0H A;  4NGP A;  2GU2 A;  2R8V A;  2Q4V A;  4W9Y A;  4YGO A;  4AB7 A;  4DJL A;  2GIV A;  4HNY B;  1VHE A;  1X10 A;  1Z5R A;  1KUX A;  4LQG A;  4ZX9 A;  3S6F A;  1MJB A;  4E8O A;  3IO1 A;  2B3U A;  2WPW A;  4MCS A;  5HVH A;  4CAV A;  2G3T A;  2O4H A;  3PP9 A;  4OC3 A;  4U5Y A;  4M85 A;  4MCQ A;  4R8F A;  2Z3K A;  3TO6 A;  2ZEO A;  1BPM A;  2GRE A;  5CNP A;  2R98 A;  1UFH A;  1NE9 A;  5LYF A;  3WC7 A;  3N5F A;  1F2P A;  2OOT A;  3I1U A;  3R96 A;  3NH5 A;  1HDU A;  4OC5 A;  1XMB A;  4L89 A;  3W6X A;  1NSL A;  2DEA A;  2IMO A;  3CXQ A;  3HLP A;  4QUS A;  3LOD A;  4H89 A;  3S9N A;  1BOB A;  1KUY A;  3FBU A;  2RFH A;  2Z3P A;  2ZEP A;  4MI4 A;  2ZEL A;  6CPA A;  5LRG A;  1AYE A;  1GHE A;  1Q7L A;  5EMI A;  2AFO A;  1ZO0 A;  5G22 A;  3FXT A;  2V8D A;  1XE4 A;  3D4U A;  3RYO A;  4CGN A;  2YGW A;  3L2N A;  1Z4R A;  4P6Y A;  2C6C A;  1S7K A;  3MRU A;  3LD2 A;  4R3L A;  5HMN A;  4UWJ A;  2PJ6 A;  4CRZ B;  1XIX A;  3H4Q A;  4H6U A;  3SI1 A;  2HB6 A;  2BOA A;  1CX8 A;  2VXK A;  5J1Q A;  2ZOF A;  1Z8X A;  3PRT A;  3BI1 A;  1H8L A;  1QSO A;  2RC4 A;  1PCA A;  1S3Z A;  2D4O A;  2B3V A;  1IYK A;  1Z9U A;  4KOW A;  2Q51 A;  1YGH A;  3F0A A;  3NA6 A;  3B8G A;  2PJ5 A;  4PPZ A;  4DUK A;  2BUE A;  4OC0 A;  4ZBG A;  2J8R A;  5EC4 A;  3QAH A;  3DR6 A;  5AG5 A;  4PK3 A;  1B87 A;  2Z3M A;  3SXO A;  3P2F A;  3KGQ A;  4YWY A;  2XEF A;  4BBH A;  2PJA A;  2Q43 A;  2Z11 A;  2PDO A;  2PR1 A;  1XEB A;  2PCU A;  4KOV A;  3GUX A;  4R7M A;  4I49 A;  1Z8T A;  1YX0 A;  1XMT A;  2FCK A;  4MCR A;  4UFV A;  5G1Z A;  3S6H A;  1ZG9 A;  2PSW A;  1Y0Y A;  3DSB A;  5LYD A;  3VAR A;  4AG7 A;  5K8P A;  4CRY B;  3N7Z A;  3SJX A;  4RI1 A;  4AG9 A;  4B14 A;  2J8N A;  4B6Z A;  2DPS A;  2FT0 A;  3B3V A;  4B12 A;  5HH1 A;  1BPN A;  4X3R A;  4R6T A;  3RAM A;  4KSF A;  4P4F A;  5G20 A;  1Q2Y A;  1ZG7 A;  2PVW A;  3EFA A;  3H8F A;  3G3S A;  3LAC A;  4OP4 A;  3RZA A;  2WUU A;  3S9L A;  3LWU A;  4CPA A;  2Z0Z A;  1I1D A;  4A32 A;  4X2T A;  3CZX A;  3MN8 A;  3KZW A;  3PBE A;  4JJX A;  3DR8 A;  4UA3 A;  4OAE A;  4JYW A;  1M44 A;  1UWY A;  2I00 A;  5EBV A;  4ZY1 A;  3TFY A;  2GLJ A;  2HQY A;  2ZXV A;  3FVL A;  4CYQ A;  3VH9 A;  2AJ6 A;  4JLY A;  2F7V A;  3W6S A;  1TIQ A;  4XPD B;  4NJQ A;  3V38 A;  2NSM A;  4F6A A;  2VEZ A;  4KZT A;  1EE3 P;  3B3T A;  3B7I A;  2C27 A;  3B3S A;  5AGE A;  4F9V A;  3FED A;  2VZZ A;  1YR0 A;  2ZEN A;  4AVB A;  1TF9 A;  2FSR A;  3PB9 X;  3PZJ A;  4IHM A;  4NGM A;  1I21 A;  2AFM A;  2Q44 A;  5DWM A;  4CAX A;  3CT9 A;  1CM0 A;  2Z3N A;  5JH9 A;  1KWM A;  2RB7 A;  2PJ1 A;  2ATR A;  2F8H A;  1Y9K A;  4E0A A;  3NFZ A;  3IIB A;  3BJ8 A;  2PR8 A;  2IL4 A;  1QSN A;  2OU2 A;  2QVP A;  4IAV A;  2PRQ A;  5GCN A;  4QB9 A;  5F49 A;  4HNX B;  4NEX A;  2XEG A;  5C82 A;  2DPT A;  2BEI A;  4A38 A;  5K8M A;  3B2Y A;  3GKR A;  3NH4 A;  4FWU A;  1NSA A;  1A2Z A;  4MY3 A;  4BIN A;  4UWI A;  1L0C A;  2EO8 A;  4UFW A;  4C7I A;  3K2K A;  3F8K A;  3SI0 A;  5IB9 A;  2AFW A;  2R7H A;  3F5B A;  2CXA A;  1Z8W A;  3H5Z A;  4MFL A;  1Z2L A;  3ISZ A;  2CF4 A;  3PB7 X;  3QNV A;  4UEE A;  3R95 A;  2AE6 A;  2FVG A;  4KOU A;  5H84 A;  2B58 A;  3FEC A;  1XRY A;  3PBB A;  4ZY2 A;  5IV0 A;  2ZEF A;  2HUZ A;  2B4B A;  4KSI A;  4M6I A;  1YRE A;  8CPA A;  3PB8 X;  3ZZI A;  4Z65 A;  3IFE A;  3PFO A;  2ZOG A;  4M3S A;  2K5T A;  5ISV A;  3D8P A;  4YFJ A;  5JGF A;  2GE3 A;  4KOR A;  1WK4 A;  4CYO A;  1IYL A;  1M4I A;  4AVC A;  1MK4 A;  1PYT B;  1CBX A;  3OWC A;  1RO5 A;  1LAN A;  4WJB A;  1I12 A;  5D29 A;  5A28 A;  5I0C A;  2DXQ A;  2B5G B;  4XNH B;  2PJ8 A;  5F47 A;  2AFZ A;  3R9E A;  1RXT A;  2PE3 A;  2YND A;  3FH4 A;  1VHO A;  1YLE A;  2PIZ A;  4H6Z A;  2PJ0 A;  4UCP A;  1VKC A;  2IQ6 A;  2Q4Z A;  4OLL A;  4ONW A;  1CPS A;  2Z3O A;  1R3N A;  2Z10 A;  1OZP A;  4NGS A;  5IB0 A;  2V77 A;  1Y7R A;  4IK2 A;  4MFP A;  4MHN A;  4KOS A;  4B5P B;  4PXD A;  4FUU A;  1F2O A;  3TO7 A;  1KZF A;  4ZI6 A;  3RBU A;  2REF A;  2EWB A;  2PJ4 A;  2ZEH A;  4EME A;  7CPA A;  2ZED A;  3QAY A;  4UBR A;  4HNW B;  4LQ6 A;  5LYI A;  5THW A;  1Q2C A;  1XF8 A;  5LRJ A;  3V7Z A;  4UIB A;  3LMS A;  1LFW A;  1ELM P;  1M4G A;  4EWT A;  1YQE A;  3D67 A;  2AFU A;  1FT7 A;  4RUH A;  4A2Z A;  1R43 A;  2OZH A;  2PIY A;  4P4D A;  2EBJ A;  3PB4 X;  1YME A;  4ORF A;  4JXR A;  3BI0 A;  4ZX8 A;  1ZG8 A;  2ABZ A;  3D68 A;  2B4D B;  1SQH A;  4NFR A;  1HEE A;  4R87 A;  3GY9 A;  4F0X A;  2G0B A;  3B3W A;  3S9M A;  3T9Y A;  2QEC A;  2OB0 A;  3NH8 A;  4ONU A;  3T90 A;  2ZEG A;  1IOI A;  2PJ9 A;  1CP6 A;  3TT2 A;  2J9A A;  5A27 A;  1OBR A;  2JEW A;  2PQ8 A;  1AUG A;  2CNM A;  4OME A;  3ZJ0 A;  4MHD A;  4F0Y A;  1IU8 A;  1ON0 A;  1TKH A;  3KL9 A;  4NGT A;  3PEI A;  4XNH C;  3B3C A;  3MGD A;  2OZG A;  2EVN A;  3VAT A;  4CGL A;  4PXB A;  1U6M A;  3CPX A;  1Z4E A;  2ZEE A;  3K9U A;  4MFQ A;  4PV6 A;  2O28 A;  4E2A A;  1AMP A;  4NJR A;  5HVF A;  2Q4Y A;  4Q36 A;  4NF1 A;  1NMT A;  5AG6 A;  4NSQ A;  4RS2 A;  2D4P A;  2JDC A;  2XEJ A;  1FY7 A;  3SI2 A;  4K3N A;  3IU2 A;  2F5I A;  4CGP A;  1Y0R A;  4NGR A;  3FYN A;  2GFQ A;  2Q04 A;  2QJ8 A;  5F48 A;  3GIU A;  3DLJ A;  4KSA A;  3KAS A;  1S7F A;  2JEV A;  3BLN A;  4G1P A;  5FVJ A;  3TC8 A;  2P6E A;  3JUW A;  4TWE A;  4X8I A;  3EY5 A;  2ZPA A;  4P4J A;  1ARM A;  1B6B A;  3WR7 A;  4PSX A;  3TCV A;  4C2X A;  4KS9 A;  4CGM A;  5F09 A;  3E0K A;  4EFD A;  2G3A A;  2PJ3 A;  2FE7 A;  4OID A;  4LX9 A;  2QML A;  1M4L A;  3CDX A;  2BO9 A;  3PB6 X;  4MFZ A;  2HC9 A;  4PQA A;  4MXU A;  1TXR A;  1IIC A;  1TKF A;  5HVG A;  2CTB A;  3D2P A;  3IEH A;  3H8G A;  1P4N A;  4P4B A;  4OAD A;  3ISX A;  1GYT A;  1PU9 A;  4M6H A;  2VQY A;  4DYO A;  2AFX A;  5LYL A;  4QC6 A;  2I79 A;  3SJE A;  3D66 A;  3KKW A;  3WC6 A;  2ZW5 A;  3EO4 A;  4B5O A;  1XJO A;  3HUV A;  2CTC A;  4KUA A;  1QSR A;  4PK2 A;  4OC1 A;  1BAV A;  3TOA A;  4H2K A;  3CPA A;  2I3C A;  4P4E A;  4UEF A;  4FD6 A;  4OIW A;  5KTA A;  1HDQ A;  4FD5 A;  5DS0 A;  2ARH A;  4M6G A;  3I9S A;  4ZGY B;  1JQG A;  2EK8 A;  3VWE A;  2JLM A;  3B35 A;  1YLO A;  1F57 A;  3FEE A;  2FS5 A;  1BO4 A;  2Y0M A;  4KLW A;  4DNC A;  3JRU A;  4MMO A;  4R76 A;  1CP7 A;  1LCP A;  2BCO A;  2NMT A;  3TE4 A;  1IB1 E;  1ARL A;  2C6P A;  2C6G A;  2PJ7 A;  2PJB A;  4MY0 A;  1ZLI A;  4AVA A;  5KTC A;  3D7D A;  4XPD C;  4A31 A;  4JWP A;  3IWG A;  3WT4 A;  2VL1 A;  3DGV A;  3DDD A;  3IU1 A;  4P4I A;  4UFX A;  4XPK A;  1M1D A;  4JXQ A;  2VI7 A;  3KQZ A;  1CG2 A;  1J4J A;  1Q2D A;  2ZW7 A;  3BXM A;  4F9U A;  3D2M A;  4CYN A;  1RTQ A;  2HV2 A;  4BMH A;  4F8Z A;  2EK9 A;  4MHY A;  1ZLH A;  2Q7S A;  4HKF A;  4WWV A;  5JPH A;  2OH1 A;  3RNZ A;  4B10 A;  2KCW A;  5DWN A;  3G8W A;  1S7L A;  2ZW6 A;  2CY2 A;  3KR4 A;  2EUI A;  4JZ0 A;  3FB3 A;  4PXE A;  3JTK A;  2B4D A;  2P6G A;  4X5K A;  4FD4 A;  4GXH A;  3FMC A;  1YW4 A;  4A30 A;  4ZY0 A;  4GM5 A;  4C2Z A;  4NGQ A;  2XEI A;  2FXF A;  3R1K A;  4AXV A;  2JDD A;  4Y49 B;  3TO9 A;  4CAE A;  1KUV A;  4JD6 A;  3FX6 A;  3JVN A;  4QBJ A;  2V8G A;  2WSA A;  1XFO A;  1QQ9 A;  4O23 A;  5CBM A;  5KTD A;  2YNC C;  4J3G A;  4CAF A;  1XOV A;  3R9F A;  3TOB A;  3KI9 A;  4FBE A;  4U9Y A;  4A94 A;  1TKJ A;  3PFE A;  1LAP A;  4MFK A;  1VGY A;  3GB0 A;  2WZN A;  4IUS A;  4GS4 A;  5ELY A;  3CXS A;  2O53 A;  4C7H A;  5LRK A;  1YSJ A;  2Q7B A;  2P0W A;  1LRZ A;  4FAI A;  3EXN A;  3UY5 A;  4K30 A;  5I4M A;  2AFS A;  4C2Y A;  4BD9 A;  5H86 A;  4MJ8 A;  1V0C A;  2JBK A;  1PUA A;  2QIR A;  1XBU A;  1YVO A;  2CNS A;  3H8E A;  1IGB A;  3IC1 A;  2FIW A;  3A9L A;  1IID A;  3DNS A;  4KOX A;  4L8A A;  2J8M A;  4A37 A;  2Z3L A;  3BHX A;  1YW6 A;  4MFJ A;  5J8C A;  3IJ3 A;  4KOY A;  1R57 A;  4YU9 A;  3FIX A;  4P44 A;  5CPA A;  5F46 A;  2OR4 A;  4II9 A;  2V8H A;  1M4D A;  1DE4 C;  2BL1 A;  3C26 A;  3GLJ A;  4RN7 A;  3SJF A;  5C88 A;  4Y49 C;  4PXC A;  5D8N A;  4KLV A;  5AG7 A;  3FNC A;  3SHP A;  3V8I A;  3IGR A;  1QSM A;  3IWE A;  4TNU A;  3KQX A;  3BJ7 A;  3I3G A;  4R9M A;  4CS0 B;  2P6F A;  1MJ9 A;  3D3S A;  4MBU A;  4CAW A;  4MCP A;  3NE7 A;  1BLL E;  4UEZ A;  4KUB A;  4Q38 A;  2YNE A;  1IY7 A;  3TTH A;  3EC4 A;  3QB8 A;  2A4N A;  3R9G A;  3FJU A;  3KR5 A;  4CGO A;  3SJG A;  1QMU A;  2PJ2 A;  3FRM A;  1IOF A;  1S5K A;  1LOK A;  3PGP A;  3W91 A;  2VZY A;  3S6G A;  5K8O A;  2PRB A;  2C1C A;  5BWA B;  5K8N A;  5IX3 A;  2GAN A;  2PVV A;  3D7F A;  3T8W A;  2ODF A;  2CNT A;  2WPX A;  3IWW A;  4IF5 A;  3SXN A;  3TX8 A;  2YNC A;  5HXD A;  4U9Z A;  2ZW4 A;  2IJZ A;  1S7N A;  2ANP A;  2FIA A;  4CYP A;  1VIX A;  4MHP A;  4NGN A;  4FD7 A;  1YK3 A;  1JWQ A;  1K4J A;  2WYR A;  2BSW A;  4P10 A;  2JBJ A;  3P2H A;  2FL4 A;  5G21 A;  3S6K A;  4A95 A;  4UF4 A;  1Y9W A;  4NCZ A;  4A33 A;  2R1I A;  4YRH A;  3NE8 A;  2G9D A;  4UIA A;  1MJA A;  3GYA A;  4OC4 A;  4OKO A;  4UCM A;  5E96 A;  3D7H A;  4XPL A;  3RO0 A;  4HPS A;  5AG4 A;  1VHS A;  2H5M A;  4QVT A;  4LUA A;  1X12 A;  2POK A;  5JM6 A;  2B5G A;  2OZU A;  2VBQ A;  4KVO E;  4Q7A A;  2REE A;  2QYV A;  1S60 A;  2X7B A;  1LAM A;  4NXY A;  4R57 A;  3WAB A;  4B13 A;  4ZYQ A;  4C68 A;  3CXP A;  1CJW A;  5JQ4 A;  1CPX A;  4KVX A;  2GLF A; 
#chains in the Genus database with same CATH homology
 1WWZ A;  3VWD A;  1N71 A;  4PSW A;  4B5P A;  2PC1 A;  2Q0Y A;  1YVK A;  4UCN A;  4KOT A;  4R3K A;  4EVY A;  4KVM E;  4B11 A;  1QST A;  5J8F A;  1P0H A;  2R8V A;  2Q4V A;  4YGO A;  4AB7 A;  2GIV A;  4HNY B;  1KUX A;  3S6F A;  1MJB A;  4E8O A;  2B3U A;  2WPW A;  4CAV A;  2G3T A;  3PP9 A;  4U5Y A;  4M85 A;  2Z3K A;  3TO6 A;  5CNP A;  2R98 A;  1UFH A;  1NE9 A;  3R96 A;  4L89 A;  3W6X A;  1NSL A;  3CXQ A;  4QUS A;  3LOD A;  4H89 A;  1BOB A;  1KUY A;  3FBU A;  4MI4 A;  2Z3P A;  1GHE A;  5G22 A;  1ZO0 A;  3FXT A;  1XE4 A;  3RYO A;  4CGN A;  2YGW A;  1Z4R A;  1S7K A;  3LD2 A;  4R3L A;  5HMN A;  4UWJ A;  4CRZ B;  1XIX A;  3H4Q A;  4H6U A;  2VXK A;  1QSO A;  2RC4 A;  1S3Z A;  2D4O A;  2B3V A;  1IYK A;  1Z9U A;  4KOW A;  1YGH A;  3F0A A;  3B8G A;  2BUE A;  4ZBG A;  2J8R A;  5EC4 A;  3QAH A;  3DR6 A;  5AG5 A;  4PK3 A;  1B87 A;  2Z3M A;  3SXO A;  3P2F A;  4BBH A;  2Z11 A;  2PDO A;  2PR1 A;  1XEB A;  4KOV A;  4I49 A;  3S6H A;  1YX0 A;  1XMT A;  2FCK A;  4UFV A;  5G1Z A;  2PSW A;  3DSB A;  4AG7 A;  4CRY B;  3N7Z A;  4RI1 A;  4AG9 A;  4B14 A;  2J8N A;  2DPS A;  2FT0 A;  4B12 A;  5HH1 A;  4KSF A;  5G20 A;  1Q2Y A;  3EFA A;  3G3S A;  2WUU A;  2Z0Z A;  1I1D A;  4A32 A;  4JJX A;  3DR8 A;  4UA3 A;  4OAE A;  1M44 A;  2I00 A;  5EBV A;  3TFY A;  2HQY A;  2ZXV A;  4CYQ A;  2AJ6 A;  4JLY A;  3W6S A;  1TIQ A;  4XPD B;  4F6A A;  2VEZ A;  4KZT A;  2C27 A;  5AGE A;  2VZZ A;  1YR0 A;  4AVB A;  2FSR A;  3PZJ A;  4CAX A;  1I21 A;  2Q44 A;  5DWM A;  1CM0 A;  2Z3N A;  2ATR A;  1Y9K A;  4E0A A;  3BJ8 A;  2PR8 A;  2IL4 A;  1QSN A;  2OU2 A;  5GCN A;  4QB9 A;  5F49 A;  4HNX B;  4NEX A;  5C82 A;  2DPT A;  2BEI A;  3GKR A;  4MY3 A;  4UWI A;  1L0C A;  4UFW A;  4C7I A;  3F8K A;  2R7H A;  3F5B A;  2CXA A;  3H5Z A;  4MFL A;  3R95 A;  2AE6 A;  4KOU A;  5H84 A;  2B58 A;  5IV0 A;  2HUZ A;  2B4B A;  1YRE A;  3ZZI A;  4M3S A;  2K5T A;  5ISV A;  3D8P A;  4YFJ A;  2GE3 A;  4KOR A;  1WK4 A;  4CYO A;  1IYL A;  1M4I A;  4AVC A;  1MK4 A;  3OWC A;  1RO5 A;  5A28 A;  1I12 A;  5I0C A;  5KTA A;  2DXQ A;  2B5G B;  4XNH B;  5F47 A;  3R9E A;  1RXT A;  2YND A;  1YLE A;  4H6Z A;  4UCP A;  1VKC A;  4OLL A;  2Z3O A;  2Z10 A;  1OZP A;  5IB0 A;  4MFP A;  1Y7R A;  4B5P B;  4KOS A;  3TO7 A;  1KZF A;  2REF A;  4UBR A;  4HNW B;  1Q2C A;  1XF8 A;  1M4G A;  4A2Z A;  2OZH A;  4ORF A;  4JXR A;  2B4D B;  1SQH A;  4R87 A;  3GY9 A;  4F0X A;  2G0B A;  3T9Y A;  2QEC A;  2OB0 A;  3T90 A;  4ONU A;  3TT2 A;  5A27 A;  2PQ8 A;  2CNM A;  3ZJ0 A;  4MHD A;  4F0Y A;  1ON0 A;  4XNH C;  3MGD A;  2OZG A;  2EVN A;  4CGL A;  1U6M A;  1Z4E A;  3K9U A;  4MFQ A;  4PV6 A;  2O28 A;  4E2A A;  2Q4Y A;  4Q36 A;  4NF1 A;  1NMT A;  5AG6 A;  4NSQ A;  4RS2 A;  2D4P A;  2JDC A;  1FY7 A;  4CGP A;  3IU2 A;  2F5I A;  3FYN A;  2Q04 A;  5F48 A;  4KSA A;  1S7F A;  2JEV A;  3BLN A;  5FVJ A;  2P6E A;  3JUW A;  3EY5 A;  2ZPA A;  3WR7 A;  1B6B A;  4PSX A;  3TCV A;  4C2X A;  4KS9 A;  4CGM A;  3E0K A;  2G3A A;  2FE7 A;  4LX9 A;  2QML A;  4MFZ A;  1IIC A;  3D2P A;  1P4N A;  4OAD A;  1PU9 A;  2VQY A;  4QC6 A;  2I79 A;  3KKW A;  2ZW5 A;  3EO4 A;  4B5O A;  4KUA A;  1QSR A;  4PK2 A;  3TOA A;  4FD6 A;  4FD5 A;  2ARH A;  3I9S A;  4ZGY B;  3VWE A;  2JLM A;  2FS5 A;  1BO4 A;  2Y0M A;  4KLW A;  4DNC A;  2NMT A;  3TE4 A;  1IB1 E;  4MY0 A;  4AVA A;  5KTC A;  4XPD C;  4A31 A;  4JWP A;  3IWG A;  3IU1 A;  3DDD A;  4UFX A;  4XPK A;  1M1D A;  4JXQ A;  2VI7 A;  1J4J A;  1Q2D A;  2ZW7 A;  3D2M A;  4CYN A;  2HV2 A;  4BMH A;  5JPH A;  4HKF A;  2OH1 A;  4B10 A;  2KCW A;  5DWN A;  3G8W A;  1S7L A;  2ZW6 A;  2CY2 A;  2EUI A;  3FB3 A;  3JTK A;  2B4D A;  2P6G A;  4X5K A;  4FD4 A;  4A30 A;  4C2Z A;  2FXF A;  3R1K A;  2JDD A;  4Y49 B;  3TO9 A;  4CAE A;  1KUV A;  4JD6 A;  3JVN A;  4QBJ A;  2WSA A;  5KTD A;  2YNC C;  4J3G A;  4CAF A;  3R9F A;  3TOB A;  4U9Y A;  4MFK A;  4IUS A;  4GS4 A;  3CXS A;  4C7H A;  2Q7B A;  2P0W A;  1LRZ A;  3EXN A;  3UY5 A;  4K30 A;  4C2Y A;  5H86 A;  4MJ8 A;  1V0C A;  1PUA A;  2QIR A;  1YVO A;  2CNS A;  2FIW A;  3A9L A;  1IID A;  3DNS A;  4KOX A;  4L8A A;  2J8M A;  2Z3L A;  4MFJ A;  5J8C A;  4KOY A;  1R57 A;  3FIX A;  5F46 A;  4II9 A;  3C26 A;  1M4D A;  2BL1 A;  5C88 A;  4Y49 C;  4KLV A;  5AG7 A;  3FNC A;  3SHP A;  3V8I A;  3IGR A;  1QSM A;  3IWE A;  3BJ7 A;  3I3G A;  4R9M A;  4CS0 B;  2P6F A;  1MJ9 A;  3D3S A;  4MBU A;  4CAW A;  3NE7 A;  4KUB A;  4Q38 A;  2YNE A;  3TTH A;  3EC4 A;  3QB8 A;  2A4N A;  3R9G A;  4CGO A;  3FRM A;  1S5K A;  3PGP A;  3W91 A;  2VZY A;  3S6G A;  2PRB A;  5BWA B;  5IX3 A;  2GAN A;  2CNT A;  2WPX A;  4IF5 A;  3SXN A;  2YNC A;  4U9Z A;  2ZW4 A;  2FIA A;  1S7N A;  4CYP A;  4FD7 A;  1YK3 A;  1K4J A;  2BSW A;  3P2H A;  2FL4 A;  5G21 A;  3S6K A;  4A95 A;  1Y9W A;  4NCZ A;  4A33 A;  2R1I A;  4YRH A;  1MJA A;  3GYA A;  5E96 A;  4UCM A;  4XPL A;  5AG4 A;  1VHS A;  2H5M A;  4QVT A;  4LUA A;  2B5G A;  2OZU A;  2VBQ A;  4KVO E;  4B13 A;  2REE A;  1S60 A;  2X7B A;  4NXY A;  4R57 A;  5JQ4 A;  4C68 A;  3CXP A;  1CJW A;  4KVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...