4UCMA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucmA00
5AG6A 4B10A 5AG4A 4CGLA 3JTKA 2YNDA 5G1ZA 4C2XA 4CGNA 5G21A 4A31A 5A28A 4UCPA 3IWEA 5AG5A 4C7IA 4BBHA 4CGMA 3IU1A 4A33A 4CYNA 4UFXA 2WSAA 4CAEA 5AGEA 2YNEA 5G20A 4B11A 4A32A 4CAFA 2WUUA 4UCNA 3H5ZA 4UFVA 4CGOA 4A2ZA 5AG7A 4CYQA 5G22A 4B12A 4C68A 4C2ZA 4A95A 4C7HA 5A27A 4B14A 2YNCA 4CYPA 4UCMA 4UFWA 4A30A 2YNCC 4C2YA 4CYOA 4B13A 4CGPA 3IU2A
chains in the Genus database with same CATH superfamily
3B8GA 4KOVA 4HNWB 4BINA 2CTCA 2PSWA 4P45A 4B5OA 2PJ1A 2BUEA 3FRMA 3G8WA 5G21A 5A28A 1CBXA 2Q04A 4R3LA 2NSMA 4ZY0A 2KCWA 4K30A 3PBBA 4IUSA 4PXCA 4MFPA 3DLJA 3LMSA 3TE4A 5IB0A 1R43A 4IF5A 1Z8WA 3S6KA 4PSWA 4NCZA 4Q7AA 4RI1A 2I00A 4UIBA 4YGOA 3KHZA 5HVFA 5J8FA 1Z5RA 2Q7BA 1LOKA 2HUZA 3LODA 5F47A 3TTHA 3IJ3A 3W91A 2REEA 5AG6A 2HC9A 1CG2A 3JRUA 2WPWA 2PIYA 3CPXA 3FH4A 4AG7A 3VARA 3PFOA 3W6SA 3IWEA 3PBEA 3C26A 3RNZA 2PR8A 5F46A 2JLMA 1F2OA 1AYEA 1Y7RA 3JUWA 4AVBA 1X12A 2WYRA 5DWNA 2HQYA 4WJBA 4A33A 3H8EA 2ZW4A 2ARHA 2ODFA 2YGWA 2G9DA 1KWMA 2ZELA 3FF3A 5FVJA 3B3TA 4MY0A 1P4NA 3DR6A 4NEXA 4F9VA 4M6HA 4F0YA 5LRKA 8CPAA 5E96A 4F6AA 3WABA 4GM5A 1RO5A 1XFOA 1P0HA 2CXAA 3D7FA 4MMOA 1FNOA 1MJ9A 3CXPA 4NXYA 3WR7A 4KLWA 4A38A 2QECA 3FEEA 4XNHB 2EBJA 2QVPA 2VZZA 3KZWA 4TWEA 5ISVA 1Y9WA 3SI0A 2O53A 2EK8A 2ZEGA 1ZLHA 3D66A 1QSTA 3DNSA 4NJQA 2B3UA 5JH9A 4UWIA 3G3SA 3IFEA 1WWZA 2PCUA 3KQZA 4A37A 2VEZA 1ELLP 2AFUA 3SXOA 1ZG7A 2PE3A 4A94A 4OMEA 1CJWA 3PGPA 3GUXA 4NGQA 1K4JA 3EC4A 3PRTA 4ZYQA 4ZI6A 1HEEA 4XPKA 4CAFA 1OBRA 1IGBA 2GREA 1Z2LA 1R3NA 4KOYA 1JQGA 2FSRA 4WWVA 2VQYA 4NGSA 1Z8XA 4M3SA 4OC5A 5LRGA 1UWYA 1A2ZA 1PCAA 4NF1A 4IAVA 3GY9A 4OC2A 4R8FA 4R9MA 5BWAB 2AFZA 4B13A 5F09A 2RC4A 1BO4A 2DEAA 4XNHC 3HLPA 2AJ6A 4ZX8A 5EBVA 2PJ8A 3V7ZA 2Q4ZA 2ZOFA 5F49A 1YX0A 1VHSA 4MBUA 3EO4A 4NGNA 3SJXA 4EVYA 2C27A 2OR4A 3FEDA 1ZG8A 4OC4A 2GIVA 2QJ8A 3F8KA 5LYLA 3UY5A 3S9MA 1ELMP 3VWEA 5IB9A 2BL1A 1XF8A 3H5ZA 2P6EA 1B87A 4NFRA 2XEIA 4A39A 4FD4A 3GIUA 3ZJ0A 2Q0YA 2Q44A 4C68A 4A95A 2F7VA 3T90A 4FAIA 2YNCA 4J3GA 3S6HA 4DNCA 3ISXA 2JBJA 3S9NA 2ZPAA 4U5YA 1IOFA 4B10A 2Z3NA 3I9SA 3JTKA 1YREA 3NH8A 3GYAA 3TX8A 4AXVA 2Z3PA 4MFLA 1N71A 2IMOA 1XMTA 4MXUA 2CY2A 1HDUA 4UCPA 3IO1A 3OWCA 2ZEPA 2PRQA 2BCOA 5AG5A 1TF9A 4MJ8A 4OC1A 2PJCA 3NH4A 4CAEA 2REFA 5AGEA 4ONWA 5G20A 3PB8X 4H6UA 2ATRA 2AFXA 3N7ZA 4LX9A 2EUIA 4OLLA 3IWWA 1QSNA 3MGDA 1B6BA 1Q7LA 2JEWA 3K2KA 2B5GB 3S9LA 2X7BA 3BHXA 5AG7A 3RBUA 1Q2DA 4FUUA 3S6GA 4FWUA 4IK2A 1LAMA 5DWMA 2YNCC 4NGTA 1JWQA 5I0CA 3FJUA 3TCVA 2EK9A 2P0WA 5AG4A 3NA6A 4YU9A 3KGQA 1IYLA 1YLEA 5J8CA 4OC0A 4RS2A 5JPHA 4NGMA 2Q43A 4KSIA 2P6FA 2ZENA 1F2PA 3BXMA 1AMPA 3CZXA 3SI1A 2PJ7A 2GU2A 4PPZA 1S7NA 1FY7A 3SXNA 1ZG9A 2AFOA 2G3TA 4AB7A 3S6FA 4E8OA 1CM0A 1XRYA 3D68A 1YW6A 4UEFA 2FXFA 4KSAA 1CP7A 3W6XA 2ZEEA 3NE7A 3PEIA 2HV2A 4CS0B 3LWUA 2ZEDA 1Y9KA 1Z4EA 2OH1A 2Z0ZA 3NFZA 4KUBA 4CPAA 4F9UA 2JDDA 5JM6A 3IGRA 5G1ZA 5K8PA 4ONUA 1ON0A 2BOAA 3KL9A 1BOBA 1TF8A 4X3RA 1YVOA 2CNSA 2FT0A 1M1DA 3I3GA 4HKFA 3BLNA 2O4HA 2WSAA 2OOTA 4KOUA 3TFYA 4KVME 4DYOA 1PYTB 1Z8TA 3NH5A 2B3VA 1I1DA 3B2YA 4UEEA 3SJGA 4ZY1A 4P4FA 1VKCA 2XEGA 2B4BA 6CPAA 3CPAA 2ZW7A 4X8IA 2IJZA 1OZPA 4DJLA 3PZJA 4F0XA 5D8NA 1M4GA 2C6GA 4P4DA 4PK2A 5H84A 4Z65A 4A30A 4Q38A 1TIQA 5D29A 5GCNA 1M4IA 1S7KA 3DDDA 2PJ6A 4KSFA 2PJ2A 3FIXA 4P10A 3R96A 3BI0A 4MCPA 1CX8A 4JZ0A 3KHXA 4JJXA 4UA3A 3SHPA 4C7IA 2JDCA 1QSRA 2EO8A 2GFQA 3TOBA 2ZOGA 2IL4A 3QAYA 4U9ZA 2EWBA 2Z3MA 3GKRA 2FIAA 3L2NA 2V8VA 2AFSA 2R98A 4PSXA 3TC8A 2PJ0A 3KASA 2VI7A 4CGOA 4Q36A 2C1CA 3D67A 5JGFA 2DF5A 4MFQA 1YLOA 3RZAA 3R9GA 4G1PA 4JYWA 1LFWA 2CIJA 4CYPA 1CP6A 2FS5A 4UCMA 3D7DA 2OZHA 3BJ7A 4MCSA 4P4IA 2ABZA 3VATA 4C2XA 2JBKA 3RYOA 4EFDA 2CTBA 2FL4A 5I4MA 4KZTA 2IQ6A 4OKOA 3A9LA 1XE4A 1YR0A 4MCRA 3PB7X 3TO7A 2PRBA 1DTDA 2RB7A 1Z8LA 2G0BA 4UEZA 4BBHA 2A4NA 5ELYA 5IX3A 5EMIA 3QNVA 3SJEA 5LRJA 2RFHA 3B7IA 2O28A 3H8FA 1MJBA 2FVGA 4H89A 1XIXA 2P6GA 2QYVA 4JD6A 1GYTA 1ZO0A 4ORFA 1UFHA 2ZEFA 3VH9A 4UF4A 4CAXA 4CRYB 4PXDA 5IV0A 1KUYA 2Z11A 4KLVA 3KI9A 1IICA 5K8NA 2J9AA 2PR1A 3PP9A 1KZFA 1RTQA 4ZBGA 4JWPA 1XBUA 1Y0YA 3MN8A 3D3SA 3FB3A 2GLFA 1AUGA 2B58A 3B3CA 2I3CA 3EXNA 4MY3A 5H86A 3EFAA 1Q2CA 2BSWA 2BEIA 2VZYA 3PB9X 2GANA 1M44A 1ZLIA 3F5BA 2PVWA 3DR8A 4ZX9A 4FD5A 4NJRA 2JEVA 4R6TA 4E2AA 1M4DA 4CRZB 1RXTA 4EMEA 4IHMA 4PK3A 4XPLA 2ZW5A 2J8RA 4P4JA 1IU8A 2C6PA 4MFKA 2OB0A 3DSBA 3T8WA 3FX6A 2K5TA 4YWYA 5A27A 2AFMA 3CDXA 4U9YA 3ZZIA 2PC1A 1H8LA 3I1UA 4MRIA 3KQXA 4HNYB 4C2YA 2B5GA 1IYKA 3P2HA 4P6YA 4B6ZA 2BO9A 3FMCA 4CGLA 4AVCA 3R95A 2YNDA 1KUXA 4KVXA 4FBEA 4NGRA 2Z3OA 4GXHA 1Y0RA 1LRZA 2R7HA 1QMUA 4ZY2A 3FBUA 4MCQA 5K8MA 2PJ4A 4X2TA 4XPDB 2XEFA 1YMEA 2PVVA 2YNEA 4K3NA 2PJ5A 4CAVA 1IY7A 4MHDA 4HNXB 2Q4VA 2WUUA 4UIAA 1NSLA 2Q7SA 3TO6A 1Z4RA 1WK4A 2NYQA 5HH1A 1XOVA 4CYQA 2VXKA 2V77A 3FVLA 3MRUA 3PB6X 4C2ZA 4B14A 4KUAA 3KR4A 4YRHA 4MHPA 1HDQA 3R9FA 5CBMA 2EVNA 2J8NA 4R87A 1KUVA 1ARMA 2CNTA 3FYNA 3K9TA 3LACA 4W9YA 3EY5A 5DS0A 4MFJA 5KTAA 2B4DB 4PXBA 4ZGYB 2CNMA 1S7LA 4BD9A 2ZEOA 3K9UA 2VBQA 3LD2A 2Q51A 2B4DA 4P4BA 2R8VA 2C6CA 3F0AA 4AG9A 5JQ4A 3IU1A 3IIBA 4CYNA 2QMLA 4LQGA 5KTCA 3CT9A 2F5IA 2ANPA 4OADA 4R57A 4X5KA 2Z3KA 2OZGA 3D7HA 4OAEA 1NMTA 3R9EA 5HMNA 4OP4A 4XPDC 4KORA 4KOTA 4O23A 4A2ZA 3BI1A 5CNPA 4KOSA 4M6IA 1VHOA 4JXRA 1XJOA 1VIXA 4DUKA 3KR5A 5C82A 2D4OA 2HB6A 1GHEA 2R1IA 1ARLA 2ZXVA 3IEHA 3GLJA 4L8AA 3RAMA 3V38A 1BPNA 1X10A 2PJAA 3KKWA 7CPAA 3WC5A 3FXTA 4QUSA 4II9A 2Y0MA 3B3VA 4CGMA 2DPSA 4MHNA 1NSAA 2POKA 4QBJA 1NE9A 4MI4A 1PU9A 3CXQA 1BLLE 4KVOE 5KTDA 4L89A 1Q2YA 2WPXA 3D4UA 4UCNA 1QSMA 4P4EA 3TOAA 2G3AA 4CAWA 1Z9UA 2H5MA 4B12A 3R1KA 4OIWA 1S3ZA 5J1QA 1I12A 2OU2A 3WT4A 2FCKA 1TKJA 4MHYA 4JLYA 2PIZA 4B5PB 3WC6A 1QQ9A 3IU2A 3PFEA 4C7HA 5HVGA 5LYFA 4P44A 4RN7A 1SQHA 4B5PA 4CGNA 2GLJA 5C88A 1U6MA 4R7MA 3D2PA 3HUVA 2ZEMA 3BJ8A 3T9YA 2V8HA 3NE8A 4MFZA 2NMTA 1BAVA 3H8GA 4GS4A 1YSJA 4UFXA 1F57A 4TNUA 4FD6A 5THWA 1YVKA 3D7GA 3P2FA 1VHEA 3FECA 4I49A 4UWJA 4UBRA 4PQAA 1FT7A 4UFVA 2PJBA 5HXDA 4KS9A 1S7FA 2ZW6A 5F48A 4LQ6A 1J4JA 3VWDA 2FIWA 1YK3A 4PXEA 3SJFA 4E0AA 5LYIA 3TO9A 4QC6A 1TKHA 2WZNA 4UFWA 3H4QA 4QB9A 1CPSA 4H6ZA 4CGPA 3SI2A 4MHZA 1IB1E 4QVTA 4Y49B 4JXQA 3PB4X 2PJ9A 2XEJA 4M85A 5K8OA 3V8IA 1L0CA 4NGPA 4H2KA 2QIRA 1DE4C 1LANA 3QAHA 2CF4A 3IWGA 1R57A 2VL1A 3QB8A 4KOWA 4OC3A 1S5KA 4AVAA 3B3WA 1CPXA 5HVHA 2PQ8A 3CXSA 2V8DA 5EC4A 5G22A 1MK4A 3E0KA 1XEBA 2AFWA 2F8HA 3B35A 4M6GA 1S60A 4EWTA 1M4LA 1IIDA 3TT2A 1YW4A 2OZUA 1Y7EA 4A31A 1PUAA 1YQEA 1LCPA 2AE6A 1YGHA 3JVNA 4PV6A 5CPAA 4FD7A 4KOXA 4Y49C 4F8ZA 2Z10A 4RUHA 1IOIA 4YFJA 3DGVA 4B11A 3N5FA 4A32A 2Z3LA 1TXRA 2PDOA 5LYDA 3RO0A 2FE7A 1VGYA 1EE3P 1XMBA 2PJ3A 2I79A 2GE3A 3B3SA 1MJAA 1TKFA 3IC1A 4NSQA 2ZEHA 2Q4YA 1I21A 2DXQA 3ISZA 4R76A 2V8GA 4BMHA 1LAPA 1BPMA 3D8PA 3D2MA 3FNCA 1QSOA 2DPTA 2D4PA 4LUAA 2J8MA 1V0CA 4OIDA 4R3KA 3GB0A 3WC7A 4CYOA 4HPSA
chains in the Genus database with same CATH topology
3B8GA 4KOVA 4HNWB 2PSWA 4B5OA 5G21A 2BUEA 3FRMA 3G8WA 5A28A 2Q04A 4R3LA 2KCWA 4K30A 4IUSA 4MFPA 3TE4A 5IB0A 4IF5A 3S6KA 4PSWA 4NCZA 4RI1A 2I00A 4YGOA 5J8FA 2HUZA 3LODA 5F47A 3TTHA 3W91A 2REEA 5AG6A 2WPWA 4AG7A 3W6SA 3IWEA 5F46A 3C26A 2PR8A 2JLMA 1Y7RA 3JUWA 4AVBA 5DWNA 2HQYA 4A33A 2ZW4A 2ARHA 2YGWA 5FVJA 4MY0A 1P4NA 3DR6A 4NEXA 4F0YA 5E96A 4F6AA 1RO5A 4NXYA 1P0HA 2CXAA 3WR7A 3CXPA 1MJ9A 4KLWA 2QECA 4XNHB 2VZZA 5ISVA 1Y9WA 1QSTA 3DNSA 2B3UA 4UWIA 3G3SA 1WWZA 2VEZA 3SXOA 1CJWA 3PGPA 1K4JA 3EC4A 4XPKA 4CAFA 4KOYA 2FSRA 2VQYA 4M3SA 4NF1A 3GY9A 4R9MA 5BWAB 4B13A 2RC4A 1BO4A 4XNHC 2AJ6A 5EBVA 5F49A 1YX0A 1VHSA 4MBUA 3EO4A 4EVYA 2C27A 2GIVA 3F8KA 3UY5A 3VWEA 2BL1A 1XF8A 3H5ZA 2P6EA 1B87A 4FD4A 3ZJ0A 2Q0YA 2Q44A 4C68A 4A95A 3T90A 2YNCA 4J3GA 3S6HA 4DNCA 2ZPAA 4U5YA 4B10A 2Z3NA 3I9SA 3JTKA 1YREA 3GYAA 2Z3PA 4MFLA 1N71A 2Q7BA 1XMTA 2CY2A 4UCPA 3OWCA 5AG5A 4MJ8A 4CAEA 2REFA 5AGEA 5G20A 4H6UA 2ATRA 3N7ZA 4LX9A 2EUIA 4OLLA 1QSNA 3MGDA 1B6BA 2B5GB 2X7BA 5AG7A 1Q2DA 3S6GA 5DWMA 2YNCC 5I0CA 3TCVA 5AG4A 2P0WA 1IYLA 1YLEA 5J8CA 4RS2A 5JPHA 2P6FA 1S7NA 1FY7A 3SXNA 2G3TA 4AB7A 3S6FA 4E8OA 1CM0A 2FXFA 4KSAA 3W6XA 3NE7A 2HV2A 4CS0B 1Y9KA 1Z4EA 2OH1A 2Z0ZA 4KUBA 2JDDA 3IGRA 5G1ZA 4ONUA 1ON0A 1BOBA 1YVOA 2CNSA 2FT0A 1M1DA 3I3GA 4HKFA 3BLNA 2WSAA 4KOUA 3TFYA 4KVME 2B3VA 1I1DA 1VKCA 2B4BA 2ZW7A 1OZPA 3PZJA 4F0XA 1M4GA 4PK2A 5H84A 4A30A 4Q38A 1TIQA 5GCNA 1M4IA 1S7KA 3DDDA 4KSFA 3FIXA 3R96A 3SHPA 4JJXA 4UA3A 2JDCA 1QSRA 3TOBA 2IL4A 4U9ZA 2Z3MA 3GKRA 2FIAA 2R98A 4PSXA 2VI7A 4CGOA 4Q36A 4MFQA 3R9GA 4CYPA 2FS5A 4UCMA 2OZHA 3BJ7A 4C2XA 3RYOA 2FL4A 4KZTA 3A9LA 1XE4A 1YR0A 3TO7A 2PRBA 4BBHA 2G0BA 2A4NA 5IX3A 2O28A 1MJBA 4H89A 1XIXA 2P6GA 4JD6A 4ORFA 1ZO0A 4CRYB 1UFHA 4CAXA 5IV0A 1KUYA 2Z11A 4KLVA 1IICA 2PR1A 3PP9A 1KZFA 4ZBGA 4JWPA 3D3SA 3FB3A 2B58A 5H86A 3EXNA 4MY3A 3EFAA 1Q2CA 2BSWA 2BEIA 2VZYA 2GANA 1M44A 3F5BA 3DR8A 4FD5A 2JEVA 4E2AA 1M4DA 4CRZB 1RXTA 4PK3A 4XPLA 2ZW5A 2J8RA 4MFKA 2OB0A 3DSBA 2K5TA 5A27A 4U9YA 3ZZIA 2PC1A 4HNYB 4C2YA 2B5GA 1IYKA 3P2HA 4CGLA 4AVCA 3R95A 2YNDA 1KUXA 4KVXA 2Z3OA 1LRZA 2R7HA 3FBUA 4XPDB 2YNEA 4CAVA 4MHDA 4HNXB 2Q4VA 2WUUA 1NSLA 3TO6A 1Z4RA 1WK4A 5HH1A 4CYQA 2VXKA 4C2ZA 4B14A 4KUAA 4YRHA 3R9FA 2EVNA 2J8NA 4R87A 1KUVA 3FYNA 2CNTA 3EY5A 4MFJA 5KTAA 2B4DB 4ZGYB 2CNMA 1S7LA 3K9UA 2VBQA 3LD2A 2B4DA 2R8VA 3F0AA 4AG9A 5JQ4A 3IU1A 4CYNA 2QMLA 5KTCA 4R57A 2F5IA 4OADA 4X5KA 2Z3KA 2OZGA 4OAEA 1NMTA 3R9EA 5HMNA 4XPDC 4KORA 4KOTA 4A2ZA 5CNPA 4KOSA 4JXRA 5C82A 2D4OA 2R1IA 1GHEA 2ZXVA 4L8AA 4C7IA 3KKWA 3FXTA 4QUSA 4II9A 2Y0MA 4CGMA 2DPSA 4QBJA 1NE9A 4MI4A 1PU9A 3CXQA 4KVOE 5KTDA 4L89A 1Q2YA 2WPXA 4UCNA 1QSMA 3TOAA 2G3AA 4CAWA 1Z9UA 2H5MA 4B12A 3R1KA 1S3ZA 1I12A 2OU2A 2FCKA 4JLYA 4B5PB 3IU2A 4C7HA 1SQHA 4B5PA 4CGNA 5C88A 1U6MA 3D2PA 3BJ8A 3T9YA 4MFZA 2NMTA 4GS4A 4UFXA 4FD6A 1YVKA 3P2FA 4I49A 4UWJA 4UBRA 4UFVA 4KS9A 1S7FA 2ZW6A 5F48A 1J4JA 3VWDA 2FIWA 1YK3A 4E0AA 3TO9A 4QC6A 4UFWA 3H4QA 4QB9A 4H6ZA 4CGPA 1IB1E 4QVTA 4Y49B 4JXQA 4M85A 3V8IA 1L0CA 2QIRA 3QAHA 3IWGA 1R57A 3QB8A 4KOWA 1S5KA 4AVAA 2PQ8A 3CXSA 5EC4A 5G22A 1MK4A 3E0KA 1XEBA 1S60A 1IIDA 3TT2A 2OZUA 4A31A 1PUAA 2AE6A 1YGHA 3JVNA 4PV6A 4FD7A 4KOXA 4Y49C 2Z10A 4YFJA 4B11A 4A32A 2Z3LA 2PDOA 2FE7A 2I79A 2GE3A 1MJAA 4NSQA 2Q4YA 1I21A 2DXQA 4BMHA 3FNCA 3D8PA 3D2MA 4R3KA 1QSOA 2DPTA 2D4PA 4LUAA 2J8MA 1V0CA 4CYOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG6 A;  4B10 A;  5AG4 A;  4CGL A;  3JTK A;  2YND A;  5G1Z A;  4C2X A;  4CGN A;  5G21 A;  4A31 A;  5A28 A;  4UCP A;  3IWE A;  5AG5 A;  4C7I A;  4BBH A;  4CGM A;  3IU1 A;  4A33 A;  4CYN A;  4UFX A;  2WSA A;  4CAE A;  5AGE A;  2YNE A;  5G20 A;  4B11 A;  4A32 A;  4CAF A;  2WUU A;  4UCN A;  3H5Z A;  4UFV A;  4CGO A;  4A2Z A;  5AG7 A;  4CYQ A;  5G22 A;  4B12 A;  4C68 A;  4C2Z A;  4A95 A;  4C7H A;  5A27 A;  4B14 A;  2YNC A;  4CYP A;  4UCM A;  4UFW A;  4A30 A;  2YNC C;  4C2Y A;  4CYO A;  4B13 A;  4CGP A;  3IU2 A; 
#chains in the Genus database with same CATH topology
 3B8G A;  4KOV A;  4HNW B;  4BIN A;  2CTC A;  2PSW A;  4P45 A;  4B5O A;  2PJ1 A;  2BUE A;  3FRM A;  3G8W A;  5G21 A;  5A28 A;  1CBX A;  2Q04 A;  4R3L A;  2NSM A;  4ZY0 A;  2KCW A;  4K30 A;  3PBB A;  4IUS A;  4PXC A;  4MFP A;  3DLJ A;  3LMS A;  3TE4 A;  5IB0 A;  1R43 A;  4IF5 A;  1Z8W A;  3S6K A;  4PSW A;  4NCZ A;  4Q7A A;  4RI1 A;  2I00 A;  4UIB A;  4YGO A;  3KHZ A;  5HVF A;  5J8F A;  1Z5R A;  2Q7B A;  1LOK A;  2HUZ A;  3LOD A;  5F47 A;  3TTH A;  3IJ3 A;  3W91 A;  2REE A;  5AG6 A;  2HC9 A;  1CG2 A;  3JRU A;  2WPW A;  2PIY A;  3CPX A;  3FH4 A;  4AG7 A;  3VAR A;  3PFO A;  3W6S A;  3IWE A;  3PBE A;  3C26 A;  3RNZ A;  2PR8 A;  5F46 A;  2JLM A;  1F2O A;  1AYE A;  1Y7R A;  3JUW A;  4AVB A;  1X12 A;  2WYR A;  5DWN A;  2HQY A;  4WJB A;  4A33 A;  3H8E A;  2ZW4 A;  2ARH A;  2ODF A;  2YGW A;  2G9D A;  1KWM A;  2ZEL A;  3FF3 A;  5FVJ A;  3B3T A;  4MY0 A;  1P4N A;  3DR6 A;  4NEX A;  4F9V A;  4M6H A;  4F0Y A;  5LRK A;  8CPA A;  5E96 A;  4F6A A;  3WAB A;  4GM5 A;  1RO5 A;  1XFO A;  1P0H A;  2CXA A;  3D7F A;  4MMO A;  1FNO A;  1MJ9 A;  3CXP A;  4NXY A;  3WR7 A;  4KLW A;  4A38 A;  2QEC A;  3FEE A;  4XNH B;  2EBJ A;  2QVP A;  2VZZ A;  3KZW A;  4TWE A;  5ISV A;  1Y9W A;  3SI0 A;  2O53 A;  2EK8 A;  2ZEG A;  1ZLH A;  3D66 A;  1QST A;  3DNS A;  4NJQ A;  2B3U A;  5JH9 A;  4UWI A;  3G3S A;  3IFE A;  1WWZ A;  2PCU A;  3KQZ A;  4A37 A;  2VEZ A;  1ELL P;  2AFU A;  3SXO A;  1ZG7 A;  2PE3 A;  4A94 A;  4OME A;  1CJW A;  3PGP A;  3GUX A;  4NGQ A;  1K4J A;  3EC4 A;  3PRT A;  4ZYQ A;  4ZI6 A;  1HEE A;  4XPK A;  4CAF A;  1OBR A;  1IGB A;  2GRE A;  1Z2L A;  1R3N A;  4KOY A;  1JQG A;  2FSR A;  4WWV A;  2VQY A;  4NGS A;  1Z8X A;  4M3S A;  4OC5 A;  5LRG A;  1UWY A;  1A2Z A;  1PCA A;  4NF1 A;  4IAV A;  3GY9 A;  4OC2 A;  4R8F A;  4R9M A;  5BWA B;  2AFZ A;  4B13 A;  5F09 A;  2RC4 A;  1BO4 A;  2DEA A;  4XNH C;  3HLP A;  2AJ6 A;  4ZX8 A;  5EBV A;  2PJ8 A;  3V7Z A;  2Q4Z A;  2ZOF A;  5F49 A;  1YX0 A;  1VHS A;  4MBU A;  3EO4 A;  4NGN A;  3SJX A;  4EVY A;  2C27 A;  2OR4 A;  3FED A;  1ZG8 A;  4OC4 A;  2GIV A;  2QJ8 A;  3F8K A;  5LYL A;  3UY5 A;  3S9M A;  1ELM P;  3VWE A;  5IB9 A;  2BL1 A;  1XF8 A;  3H5Z A;  2P6E A;  1B87 A;  4NFR A;  2XEI A;  4A39 A;  4FD4 A;  3GIU A;  3ZJ0 A;  2Q0Y A;  2Q44 A;  4C68 A;  4A95 A;  2F7V A;  3T90 A;  4FAI A;  2YNC A;  4J3G A;  3S6H A;  4DNC A;  3ISX A;  2JBJ A;  3S9N A;  2ZPA A;  4U5Y A;  1IOF A;  4B10 A;  2Z3N A;  3I9S A;  3JTK A;  1YRE A;  3NH8 A;  3GYA A;  3TX8 A;  4AXV A;  2Z3P A;  4MFL A;  1N71 A;  2IMO A;  1XMT A;  4MXU A;  2CY2 A;  1HDU A;  4UCP A;  3IO1 A;  3OWC A;  2ZEP A;  2PRQ A;  2BCO A;  5AG5 A;  1TF9 A;  4MJ8 A;  4OC1 A;  2PJC A;  3NH4 A;  4CAE A;  2REF A;  5AGE A;  4ONW A;  5G20 A;  3PB8 X;  4H6U A;  2ATR A;  2AFX A;  3N7Z A;  4LX9 A;  2EUI A;  4OLL A;  3IWW A;  1QSN A;  3MGD A;  1B6B A;  1Q7L A;  2JEW A;  3K2K A;  2B5G B;  3S9L A;  2X7B A;  3BHX A;  5AG7 A;  3RBU A;  1Q2D A;  4FUU A;  3S6G A;  4FWU A;  4IK2 A;  1LAM A;  5DWM A;  2YNC C;  4NGT A;  1JWQ A;  5I0C A;  3FJU A;  3TCV A;  2EK9 A;  2P0W A;  5AG4 A;  3NA6 A;  4YU9 A;  3KGQ A;  1IYL A;  1YLE A;  5J8C A;  4OC0 A;  4RS2 A;  5JPH A;  4NGM A;  2Q43 A;  4KSI A;  2P6F A;  2ZEN A;  1F2P A;  3BXM A;  1AMP A;  3CZX A;  3SI1 A;  2PJ7 A;  2GU2 A;  4PPZ A;  1S7N A;  1FY7 A;  3SXN A;  1ZG9 A;  2AFO A;  2G3T A;  4AB7 A;  3S6F A;  4E8O A;  1CM0 A;  1XRY A;  3D68 A;  1YW6 A;  4UEF A;  2FXF A;  4KSA A;  1CP7 A;  3W6X A;  2ZEE A;  3NE7 A;  3PEI A;  2HV2 A;  4CS0 B;  3LWU A;  2ZED A;  1Y9K A;  1Z4E A;  2OH1 A;  2Z0Z A;  3NFZ A;  4KUB A;  4CPA A;  4F9U A;  2JDD A;  5JM6 A;  3IGR A;  5G1Z A;  5K8P A;  4ONU A;  1ON0 A;  2BOA A;  3KL9 A;  1BOB A;  1TF8 A;  4X3R A;  1YVO A;  2CNS A;  2FT0 A;  1M1D A;  3I3G A;  4HKF A;  3BLN A;  2O4H A;  2WSA A;  2OOT A;  4KOU A;  3TFY A;  4KVM E;  4DYO A;  1PYT B;  1Z8T A;  3NH5 A;  2B3V A;  1I1D A;  3B2Y A;  4UEE A;  3SJG A;  4ZY1 A;  4P4F A;  1VKC A;  2XEG A;  2B4B A;  6CPA A;  3CPA A;  2ZW7 A;  4X8I A;  2IJZ A;  1OZP A;  4DJL A;  3PZJ A;  4F0X A;  5D8N A;  1M4G A;  2C6G A;  4P4D A;  4PK2 A;  5H84 A;  4Z65 A;  4A30 A;  4Q38 A;  1TIQ A;  5D29 A;  5GCN A;  1M4I A;  1S7K A;  3DDD A;  2PJ6 A;  4KSF A;  2PJ2 A;  3FIX A;  4P10 A;  3R96 A;  3BI0 A;  4MCP A;  1CX8 A;  4JZ0 A;  3KHX A;  4JJX A;  4UA3 A;  3SHP A;  4C7I A;  2JDC A;  1QSR A;  2EO8 A;  2GFQ A;  3TOB A;  2ZOG A;  2IL4 A;  3QAY A;  4U9Z A;  2EWB A;  2Z3M A;  3GKR A;  2FIA A;  3L2N A;  2V8V A;  2AFS A;  2R98 A;  4PSX A;  3TC8 A;  2PJ0 A;  3KAS A;  2VI7 A;  4CGO A;  4Q36 A;  2C1C A;  3D67 A;  5JGF A;  2DF5 A;  4MFQ A;  1YLO A;  3RZA A;  3R9G A;  4G1P A;  4JYW A;  1LFW A;  2CIJ A;  4CYP A;  1CP6 A;  2FS5 A;  4UCM A;  3D7D A;  2OZH A;  3BJ7 A;  4MCS A;  4P4I A;  2ABZ A;  3VAT A;  4C2X A;  2JBK A;  3RYO A;  4EFD A;  2CTB A;  2FL4 A;  5I4M A;  4KZT A;  2IQ6 A;  4OKO A;  3A9L A;  1XE4 A;  1YR0 A;  4MCR A;  3PB7 X;  3TO7 A;  2PRB A;  1DTD A;  2RB7 A;  1Z8L A;  2G0B A;  4UEZ A;  4BBH A;  2A4N A;  5ELY A;  5IX3 A;  5EMI A;  3QNV A;  3SJE A;  5LRJ A;  2RFH A;  3B7I A;  2O28 A;  3H8F A;  1MJB A;  2FVG A;  4H89 A;  1XIX A;  2P6G A;  2QYV A;  4JD6 A;  1GYT A;  1ZO0 A;  4ORF A;  1UFH A;  2ZEF A;  3VH9 A;  4UF4 A;  4CAX A;  4CRY B;  4PXD A;  5IV0 A;  1KUY A;  2Z11 A;  4KLV A;  3KI9 A;  1IIC A;  5K8N A;  2J9A A;  2PR1 A;  3PP9 A;  1KZF A;  1RTQ A;  4ZBG A;  4JWP A;  1XBU A;  1Y0Y A;  3MN8 A;  3D3S A;  3FB3 A;  2GLF A;  1AUG A;  2B58 A;  3B3C A;  2I3C A;  3EXN A;  4MY3 A;  5H86 A;  3EFA A;  1Q2C A;  2BSW A;  2BEI A;  2VZY A;  3PB9 X;  2GAN A;  1M44 A;  1ZLI A;  3F5B A;  2PVW A;  3DR8 A;  4ZX9 A;  4FD5 A;  4NJR A;  2JEV A;  4R6T A;  4E2A A;  1M4D A;  4CRZ B;  1RXT A;  4EME A;  4IHM A;  4PK3 A;  4XPL A;  2ZW5 A;  2J8R A;  4P4J A;  1IU8 A;  2C6P A;  4MFK A;  2OB0 A;  3DSB A;  3T8W A;  3FX6 A;  2K5T A;  4YWY A;  5A27 A;  2AFM A;  3CDX A;  4U9Y A;  3ZZI A;  2PC1 A;  1H8L A;  3I1U A;  4MRI A;  3KQX A;  4HNY B;  4C2Y A;  2B5G A;  1IYK A;  3P2H A;  4P6Y A;  4B6Z A;  2BO9 A;  3FMC A;  4CGL A;  4AVC A;  3R95 A;  2YND A;  1KUX A;  4KVX A;  4FBE A;  4NGR A;  2Z3O A;  4GXH A;  1Y0R A;  1LRZ A;  2R7H A;  1QMU A;  4ZY2 A;  3FBU A;  4MCQ A;  5K8M A;  2PJ4 A;  4X2T A;  4XPD B;  2XEF A;  1YME A;  2PVV A;  2YNE A;  4K3N A;  2PJ5 A;  4CAV A;  1IY7 A;  4MHD A;  4HNX B;  2Q4V A;  2WUU A;  4UIA A;  1NSL A;  2Q7S A;  3TO6 A;  1Z4R A;  1WK4 A;  2NYQ A;  5HH1 A;  1XOV A;  4CYQ A;  2VXK A;  2V77 A;  3FVL A;  3MRU A;  3PB6 X;  4C2Z A;  4B14 A;  4KUA A;  3KR4 A;  4YRH A;  4MHP A;  1HDQ A;  3R9F A;  5CBM A;  2EVN A;  2J8N A;  4R87 A;  1KUV A;  1ARM A;  2CNT A;  3FYN A;  3K9T A;  3LAC A;  4W9Y A;  3EY5 A;  5DS0 A;  4MFJ A;  5KTA A;  2B4D B;  4PXB A;  4ZGY B;  2CNM A;  1S7L A;  4BD9 A;  2ZEO A;  3K9U A;  2VBQ A;  3LD2 A;  2Q51 A;  2B4D A;  4P4B A;  2R8V A;  2C6C A;  3F0A A;  4AG9 A;  5JQ4 A;  3IU1 A;  3IIB A;  4CYN A;  2QML A;  4LQG A;  5KTC A;  3CT9 A;  2F5I A;  2ANP A;  4OAD A;  4R57 A;  4X5K A;  2Z3K A;  2OZG A;  3D7H A;  4OAE A;  1NMT A;  3R9E A;  5HMN A;  4OP4 A;  4XPD C;  4KOR A;  4KOT A;  4O23 A;  4A2Z A;  3BI1 A;  5CNP A;  4KOS A;  4M6I A;  1VHO A;  4JXR A;  1XJO A;  1VIX A;  4DUK A;  3KR5 A;  5C82 A;  2D4O A;  2HB6 A;  1GHE A;  2R1I A;  1ARL A;  2ZXV A;  3IEH A;  3GLJ A;  4L8A A;  3RAM A;  3V38 A;  1BPN A;  1X10 A;  2PJA A;  3KKW A;  7CPA A;  3WC5 A;  3FXT A;  4QUS A;  4II9 A;  2Y0M A;  3B3V A;  4CGM A;  2DPS A;  4MHN A;  1NSA A;  2POK A;  4QBJ A;  1NE9 A;  4MI4 A;  1PU9 A;  3CXQ A;  1BLL E;  4KVO E;  5KTD A;  4L89 A;  1Q2Y A;  2WPX A;  3D4U A;  4UCN A;  1QSM A;  4P4E A;  3TOA A;  2G3A A;  4CAW A;  1Z9U A;  2H5M A;  4B12 A;  3R1K A;  4OIW A;  1S3Z A;  5J1Q A;  1I12 A;  2OU2 A;  3WT4 A;  2FCK A;  1TKJ A;  4MHY A;  4JLY A;  2PIZ A;  4B5P B;  3WC6 A;  1QQ9 A;  3IU2 A;  3PFE A;  4C7H A;  5HVG A;  5LYF A;  4P44 A;  4RN7 A;  1SQH A;  4B5P A;  4CGN A;  2GLJ A;  5C88 A;  1U6M A;  4R7M A;  3D2P A;  3HUV A;  2ZEM A;  3BJ8 A;  3T9Y A;  2V8H A;  3NE8 A;  4MFZ A;  2NMT A;  1BAV A;  3H8G A;  4GS4 A;  1YSJ A;  4UFX A;  1F57 A;  4TNU A;  4FD6 A;  5THW A;  1YVK A;  3D7G A;  3P2F A;  1VHE A;  3FEC A;  4I49 A;  4UWJ A;  4UBR A;  4PQA A;  1FT7 A;  4UFV A;  2PJB A;  5HXD A;  4KS9 A;  1S7F A;  2ZW6 A;  5F48 A;  4LQ6 A;  1J4J A;  3VWD A;  2FIW A;  1YK3 A;  4PXE A;  3SJF A;  4E0A A;  5LYI A;  3TO9 A;  4QC6 A;  1TKH A;  2WZN A;  4UFW A;  3H4Q A;  4QB9 A;  1CPS A;  4H6Z A;  4CGP A;  3SI2 A;  4MHZ A;  1IB1 E;  4QVT A;  4Y49 B;  4JXQ A;  3PB4 X;  2PJ9 A;  2XEJ A;  4M85 A;  5K8O A;  3V8I A;  1L0C A;  4NGP A;  4H2K A;  2QIR A;  1DE4 C;  1LAN A;  3QAH A;  2CF4 A;  3IWG A;  1R57 A;  2VL1 A;  3QB8 A;  4KOW A;  4OC3 A;  1S5K A;  4AVA A;  3B3W A;  1CPX A;  5HVH A;  2PQ8 A;  3CXS A;  2V8D A;  5EC4 A;  5G22 A;  1MK4 A;  3E0K A;  1XEB A;  2AFW A;  2F8H A;  3B35 A;  4M6G A;  1S60 A;  4EWT A;  1M4L A;  1IID A;  3TT2 A;  1YW4 A;  2OZU A;  1Y7E A;  4A31 A;  1PUA A;  1YQE A;  1LCP A;  2AE6 A;  1YGH A;  3JVN A;  4PV6 A;  5CPA A;  4FD7 A;  4KOX A;  4Y49 C;  4F8Z A;  2Z10 A;  4RUH A;  1IOI A;  4YFJ A;  3DGV A;  4B11 A;  3N5F A;  4A32 A;  2Z3L A;  1TXR A;  2PDO A;  5LYD A;  3RO0 A;  2FE7 A;  1VGY A;  1EE3 P;  1XMB A;  2PJ3 A;  2I79 A;  2GE3 A;  3B3S A;  1MJA A;  1TKF A;  3IC1 A;  4NSQ A;  2ZEH A;  2Q4Y A;  1I21 A;  2DXQ A;  3ISZ A;  4R76 A;  2V8G A;  4BMH A;  1LAP A;  1BPM A;  3D8P A;  3D2M A;  3FNC A;  1QSO A;  2DPT A;  2D4P A;  4LUA A;  2J8M A;  1V0C A;  4OID A;  4R3K A;  3GB0 A;  3WC7 A;  4CYO A;  4HPS A; 
#chains in the Genus database with same CATH homology
 3B8G A;  4KOV A;  4HNW B;  2PSW A;  4B5O A;  5G21 A;  2BUE A;  3FRM A;  3G8W A;  5A28 A;  2Q04 A;  4R3L A;  2KCW A;  4K30 A;  4IUS A;  4MFP A;  3TE4 A;  5IB0 A;  4IF5 A;  3S6K A;  4PSW A;  4NCZ A;  4RI1 A;  2I00 A;  4YGO A;  5J8F A;  2HUZ A;  3LOD A;  5F47 A;  3TTH A;  3W91 A;  2REE A;  5AG6 A;  2WPW A;  4AG7 A;  3W6S A;  3IWE A;  5F46 A;  3C26 A;  2PR8 A;  2JLM A;  1Y7R A;  3JUW A;  4AVB A;  5DWN A;  2HQY A;  4A33 A;  2ZW4 A;  2ARH A;  2YGW A;  5FVJ A;  4MY0 A;  1P4N A;  3DR6 A;  4NEX A;  4F0Y A;  5E96 A;  4F6A A;  1RO5 A;  4NXY A;  1P0H A;  2CXA A;  3WR7 A;  3CXP A;  1MJ9 A;  4KLW A;  2QEC A;  4XNH B;  2VZZ A;  5ISV A;  1Y9W A;  1QST A;  3DNS A;  2B3U A;  4UWI A;  3G3S A;  1WWZ A;  2VEZ A;  3SXO A;  1CJW A;  3PGP A;  1K4J A;  3EC4 A;  4XPK A;  4CAF A;  4KOY A;  2FSR A;  2VQY A;  4M3S A;  4NF1 A;  3GY9 A;  4R9M A;  5BWA B;  4B13 A;  2RC4 A;  1BO4 A;  4XNH C;  2AJ6 A;  5EBV A;  5F49 A;  1YX0 A;  1VHS A;  4MBU A;  3EO4 A;  4EVY A;  2C27 A;  2GIV A;  3F8K A;  3UY5 A;  3VWE A;  2BL1 A;  1XF8 A;  3H5Z A;  2P6E A;  1B87 A;  4FD4 A;  3ZJ0 A;  2Q0Y A;  2Q44 A;  4C68 A;  4A95 A;  3T90 A;  2YNC A;  4J3G A;  3S6H A;  4DNC A;  2ZPA A;  4U5Y A;  4B10 A;  2Z3N A;  3I9S A;  3JTK A;  1YRE A;  3GYA A;  2Z3P A;  4MFL A;  1N71 A;  2Q7B A;  1XMT A;  2CY2 A;  4UCP A;  3OWC A;  5AG5 A;  4MJ8 A;  4CAE A;  2REF A;  5AGE A;  5G20 A;  4H6U A;  2ATR A;  3N7Z A;  4LX9 A;  2EUI A;  4OLL A;  1QSN A;  3MGD A;  1B6B A;  2B5G B;  2X7B A;  5AG7 A;  1Q2D A;  3S6G A;  5DWM A;  2YNC C;  5I0C A;  3TCV A;  5AG4 A;  2P0W A;  1IYL A;  1YLE A;  5J8C A;  4RS2 A;  5JPH A;  2P6F A;  1S7N A;  1FY7 A;  3SXN A;  2G3T A;  4AB7 A;  3S6F A;  4E8O A;  1CM0 A;  2FXF A;  4KSA A;  3W6X A;  3NE7 A;  2HV2 A;  4CS0 B;  1Y9K A;  1Z4E A;  2OH1 A;  2Z0Z A;  4KUB A;  2JDD A;  3IGR A;  5G1Z A;  4ONU A;  1ON0 A;  1BOB A;  1YVO A;  2CNS A;  2FT0 A;  1M1D A;  3I3G A;  4HKF A;  3BLN A;  2WSA A;  4KOU A;  3TFY A;  4KVM E;  2B3V A;  1I1D A;  1VKC A;  2B4B A;  2ZW7 A;  1OZP A;  3PZJ A;  4F0X A;  1M4G A;  4PK2 A;  5H84 A;  4A30 A;  4Q38 A;  1TIQ A;  5GCN A;  1M4I A;  1S7K A;  3DDD A;  4KSF A;  3FIX A;  3R96 A;  3SHP A;  4JJX A;  4UA3 A;  2JDC A;  1QSR A;  3TOB A;  2IL4 A;  4U9Z A;  2Z3M A;  3GKR A;  2FIA A;  2R98 A;  4PSX A;  2VI7 A;  4CGO A;  4Q36 A;  4MFQ A;  3R9G A;  4CYP A;  2FS5 A;  4UCM A;  2OZH A;  3BJ7 A;  4C2X A;  3RYO A;  2FL4 A;  4KZT A;  3A9L A;  1XE4 A;  1YR0 A;  3TO7 A;  2PRB A;  4BBH A;  2G0B A;  2A4N A;  5IX3 A;  2O28 A;  1MJB A;  4H89 A;  1XIX A;  2P6G A;  4JD6 A;  4ORF A;  1ZO0 A;  4CRY B;  1UFH A;  4CAX A;  5IV0 A;  1KUY A;  2Z11 A;  4KLV A;  1IIC A;  2PR1 A;  3PP9 A;  1KZF A;  4ZBG A;  4JWP A;  3D3S A;  3FB3 A;  2B58 A;  5H86 A;  3EXN A;  4MY3 A;  3EFA A;  1Q2C A;  2BSW A;  2BEI A;  2VZY A;  2GAN A;  1M44 A;  3F5B A;  3DR8 A;  4FD5 A;  2JEV A;  4E2A A;  1M4D A;  4CRZ B;  1RXT A;  4PK3 A;  4XPL A;  2ZW5 A;  2J8R A;  4MFK A;  2OB0 A;  3DSB A;  2K5T A;  5A27 A;  4U9Y A;  3ZZI A;  2PC1 A;  4HNY B;  4C2Y A;  2B5G A;  1IYK A;  3P2H A;  4CGL A;  4AVC A;  3R95 A;  2YND A;  1KUX A;  4KVX A;  2Z3O A;  1LRZ A;  2R7H A;  3FBU A;  4XPD B;  2YNE A;  4CAV A;  4MHD A;  4HNX B;  2Q4V A;  2WUU A;  1NSL A;  3TO6 A;  1Z4R A;  1WK4 A;  5HH1 A;  4CYQ A;  2VXK A;  4C2Z A;  4B14 A;  4KUA A;  4YRH A;  3R9F A;  2EVN A;  2J8N A;  4R87 A;  1KUV A;  3FYN A;  2CNT A;  3EY5 A;  4MFJ A;  5KTA A;  2B4D B;  4ZGY B;  2CNM A;  1S7L A;  3K9U A;  2VBQ A;  3LD2 A;  2B4D A;  2R8V A;  3F0A A;  4AG9 A;  5JQ4 A;  3IU1 A;  4CYN A;  2QML A;  5KTC A;  4R57 A;  2F5I A;  4OAD A;  4X5K A;  2Z3K A;  2OZG A;  4OAE A;  1NMT A;  3R9E A;  5HMN A;  4XPD C;  4KOR A;  4KOT A;  4A2Z A;  5CNP A;  4KOS A;  4JXR A;  5C82 A;  2D4O A;  2R1I A;  1GHE A;  2ZXV A;  4L8A A;  4C7I A;  3KKW A;  3FXT A;  4QUS A;  4II9 A;  2Y0M A;  4CGM A;  2DPS A;  4QBJ A;  1NE9 A;  4MI4 A;  1PU9 A;  3CXQ A;  4KVO E;  5KTD A;  4L89 A;  1Q2Y A;  2WPX A;  4UCN A;  1QSM A;  3TOA A;  2G3A A;  4CAW A;  1Z9U A;  2H5M A;  4B12 A;  3R1K A;  1S3Z A;  1I12 A;  2OU2 A;  2FCK A;  4JLY A;  4B5P B;  3IU2 A;  4C7H A;  1SQH A;  4B5P A;  4CGN A;  5C88 A;  1U6M A;  3D2P A;  3BJ8 A;  3T9Y A;  4MFZ A;  2NMT A;  4GS4 A;  4UFX A;  4FD6 A;  1YVK A;  3P2F A;  4I49 A;  4UWJ A;  4UBR A;  4UFV A;  4KS9 A;  1S7F A;  2ZW6 A;  5F48 A;  1J4J A;  3VWD A;  2FIW A;  1YK3 A;  4E0A A;  3TO9 A;  4QC6 A;  4UFW A;  3H4Q A;  4QB9 A;  4H6Z A;  4CGP A;  1IB1 E;  4QVT A;  4Y49 B;  4JXQ A;  4M85 A;  3V8I A;  1L0C A;  2QIR A;  3QAH A;  3IWG A;  1R57 A;  3QB8 A;  4KOW A;  1S5K A;  4AVA A;  2PQ8 A;  3CXS A;  5EC4 A;  5G22 A;  1MK4 A;  3E0K A;  1XEB A;  1S60 A;  1IID A;  3TT2 A;  2OZU A;  4A31 A;  1PUA A;  2AE6 A;  1YGH A;  3JVN A;  4PV6 A;  4FD7 A;  4KOX A;  4Y49 C;  2Z10 A;  4YFJ A;  4B11 A;  4A32 A;  2Z3L A;  2PDO A;  2FE7 A;  2I79 A;  2GE3 A;  1MJA A;  4NSQ A;  2Q4Y A;  1I21 A;  2DXQ A;  4BMH A;  3FNC A;  3D8P A;  3D2M A;  4R3K A;  1QSO A;  2DPT A;  2D4P A;  4LUA A;  2J8M A;  1V0C A;  4CYO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...