4UCNA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
total genus 130
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucnA00
4C68A 5AG4A 4CYPA 4B14A 5G22A 3JTKA 4BBHA 4CYOA 4CAFA 4UCMA 4A33A 4B11A 5A28A 4CGPA 2YNDA 4B10A 3IU1A 2YNCA 4CGMA 4CGLA 3IU2A 4A30A 5G21A 4CYNA 5G20A 4A31A 4CGNA 5AG6A 3H5ZA 2YNEA 4UFXA 5G1ZA 2YNCC 2WSAA 5AGEA 4CGOA 4C2XA 2WUUA 4A95A 4A32A 4B12A 4UFVA 4UCPA 5A27A 4C2ZA 4C2YA 4UFWA 4CAEA 5AG5A 3IWEA 4B13A 4C7HA 4CYQA 5AG7A 4UCNA 4A2ZA 4C7IA
chains in the Genus database with same CATH superfamily
3GKRA 1S7FA 3FXTA 4BBHA 1GYTA 2EO8A 2PVVA 2REFA 3DGVA 2EUIA 3HLPA 5DS0A 1IB1E 3S6KA 2K5TA 4H6ZA 4Q36A 3V38A 2EK9A 2QECA 4X5KA 5HVGA 1Y9WA 2X7BA 2AFXA 1LANA 1QSMA 1CPSA 2HC9A 2Q0YA 3T9YA 4NEXA 4U9ZA 2FE7A 4MI4A 5G1ZA 1P0HA 3PFOA 2OR4A 3TOAA 2XEIA 3IFEA 1P4NA 1VIXA 2DF5A 2P6FA 5DWMA 1QSRA 4MHZA 2PJ0A 4PXCA 3B2YA 5A27A 4LUAA 5ISVA 5J8CA 4P4DA 4YU9A 2V8HA 4AB7A 2J9AA 2Q4ZA 4KSIA 4LX9A 2FXFA 4UA3A 3CZXA 2PIYA 1L0CA 4OKOA 1Y0RA 1Y7EA 8CPAA 1FNOA 4B5PB 2Q51A 2R1IA 2PRBA 3RAMA 4A33A 2ZENA 4NJQA 5JGFA 3BLNA 3TO9A 1XIXA 1YLEA 3PFEA 4ZY0A 1Z8LA 2PIZA 2WZNA 5G20A 4M3SA 3QAYA 2J8MA 5LYDA 2PSWA 4E8OA 4KOXA 3IJ3A 1X12A 4OC4A 1ZG8A 2HUZA 4MMOA 2AFWA 4DNCA 3B3CA 3S6GA 5F47A 1M1DA 1QSOA 1IY7A 4C2YA 4UEFA 2FIWA 5F09A 4II9A 3FB3A 1YW6A 1DTDA 2IMOA 2OZHA 1CX8A 3D7HA 5LRJA 1JWQA 3BXMA 4KVOE 3ZJ0A 3TTHA 1Z8WA 2VEZA 2CNSA 2ZW7A 3EY5A 3B8GA 4MHPA 3KI9A 5HVHA 5KTCA 5JH9A 2B58A 4MJ8A 2AFOA 1AMPA 4Y49C 2Z3OA 1XEBA 2D4OA 3GYAA 3PB7X 4CGMA 2GLFA 1NSLA 1UWYA 3KL9A 2Q04A 4NGTA 2C27A 2C6GA 2PJ9A 3FVLA 3SXOA 2Q4VA 3DNSA 4R7MA 5J8FA 2OZUA 4NGMA 4TWEA 2I3CA 4NSQA 4R57A 1F2OA 2ABZA 4KUBA 4MFJA 4A38A 1FT7A 4UFVA 1KZFA 3PB6X 1TXRA 4HNYB 4AG9A 4C2ZA 1YR0A 2BOAA 3LD2A 2WPXA 5C88A 3NH4A 4A39A 3I1UA 4QVTA 2FCKA 3GY9A 2VBQA 2JBKA 2P6GA 2GIVA 2I00A 3S6HA 4KOUA 1XRYA 5CPAA 1SQHA 3IC1A 1IOFA 4RUHA 4KOVA 4UCMA 3JUWA 3D67A 4MHYA 1BAVA 2RB7A 3TO6A 3E0KA 1Q7LA 1A2ZA 2YNDA 4IAVA 5EMIA 1XMTA 4M6HA 3ZZIA 4U9YA 1Z4EA 2DPSA 4FD5A 5G21A 3KQXA 3ISXA 4NCZA 4UFXA 3RZAA 4CGOA 3VWDA 3TE4A 1XE4A 4G1PA 4P4FA 3KHXA 4UF4A 5I0CA 3KR5A 2QIRA 1ZG9A 1S7LA 2QVPA 2F5IA 4PSWA 3TT2A 4PK2A 3SJXA 4R3LA 1OBRA 3S9NA 4Q7AA 1VHSA 1TKFA 2Z0ZA 3KGQA 4A2ZA 4GM5A 3CXSA 1M4IA 4OIWA 3SHPA 3NH8A 3SJEA 2CTBA 1LOKA 5HH1A 1GHEA 2Z3PA 3FEEA 1RXTA 3FMCA 4K30A 2ZEGA 5E96A 5A28A 1YVOA 4IK2A 3VARA 2QJ8A 3B3VA 3LMSA 3NE8A 1YREA 1CG2A 1LRZA 4CGNA 3IO1A 5LYFA 1I1DA 4JJXA 2YNEA 4R87A 3TO7A 5EBVA 1XMBA 4KVXA 2JBJA 4ZX8A 3GIUA 1HEEA 2NSMA 3LODA 2REEA 4ZGYB 1AUGA 5CNPA 4NXYA 4UBRA 4R8FA 4UFWA 4JWPA 5HMNA 3R9EA 4X2TA 4C7HA 1MJBA 2HQYA 3D7GA 1KUVA 4UEEA 4ZX9A 2OOTA 2CNMA 1Z4RA 1K4JA 4E0AA 1YSJA 4NGRA 3B3SA 4M85A 2R98A 3T90A 3CPAA 1HDUA 2ZEFA 5LRGA 4F0YA 4UEZA 4FWUA 2EK8A 2YNCA 4MHNA 4CAWA 4ZY2A 4OLLA 4CYNA 4QC6A 2OU2A 2WSAA 1Z8TA 2RC4A 1DE4C 3R96A 3GLJA 3CXPA 2IL4A 2R7HA 2PVWA 4UCPA 4B5OA 3SI0A 1J4JA 2V8GA 4U5YA 2QYVA 5JM6A 1ARMA 1Z5RA 3WR7A 3VWEA 1CJWA 1TF8A 3S6FA 2EVNA 3KASA 4FUUA 4LQGA 4CAXA 4C68A 1Q2YA 2AFSA 2Q43A 2AE6A 3IWGA 2JEWA 3PB4X 3RNZA 2CNTA 1HDQA 1YGHA 4DYOA 5LRKA 3NE7A 5IV0A 3LWUA 1H8LA 1VHOA 3H4QA 4BINA 1MJ9A 1S7KA 2XEGA 4Q38A 4ZBGA 5IX3A 2BUEA 4PPZA 1MK4A 2DXQA 4HNWB 5AG6A 3H5ZA 5F48A 4NGPA 3ISZA 4B6ZA 4ZYQA 4M6IA 2F7VA 2AFMA 4XPDC 1Z2LA 1AYEA 3KQZA 2POKA 3R1KA 4MCPA 2PJ8A 1S7NA 1OZPA 4AG7A 5F49A 5KTAA 4B13A 5AG7A 2Q7SA 2ZOGA 4GS4A 2RFHA 4CS0B 1B6BA 3G8WA 5JQ4A 1ZLHA 2FT0A 2ZEOA 2HV2A 4WJBA 4OMEA 4A94A 3P2HA 3G3SA 3IGRA 5K8NA 2BEIA 3S9MA 1XOVA 5D8NA 2NMTA 4R3KA 2ZEMA 2PR1A 1YX0A 1BPNA 2VZYA 2YNCC 4GXHA 1IOIA 3DLJA 2I79A 1R57A 4JZ0A 2OB0A 2JEVA 3IWWA 2Q44A 2B5GB 3CT9A 1VHEA 4IF5A 2PE3A 5CBMA 3FBUA 1LAPA 3A9LA 1XFOA 3DDDA 5AG5A 3FX6A 2XEFA 4B5PA 4NJRA 3PEIA 3WABA 2O4HA 2Z3MA 4JD6A 5I4MA 4MFPA 4J3GA 3DR6A 2CTCA 2B4DA 3K2KA 4ONUA 1CP7A 1YK3A 1YW4A 3BJ7A 3PP9A 2C1CA 4KORA 5HVFA 3MN8A 2Z3NA 1NE9A 3QNVA 1Y9KA 3EXNA 3NA6A 2FL4A 1TKJA 4OAEA 4P6YA 4AVCA 4OP4A 3KHZA 2AFZA 2PJ1A 3KR4A 4JYWA 4KSAA 4P45A 4BD9A 2CIJA 4LQ6A 4KOTA 1BOBA 3LACA 4W9YA 4OC0A 2GREA 1TIQA 2V8DA 2PJ3A 2ZXVA 3I3GA 1WWZA 3KKWA 1IYKA 3NH5A 4A32A 1ZLIA 4B12A 4XPKA 4YFJA 1QSNA 2EWBA 3EFAA 1XJOA 3B3WA 4KSFA 4UIAA 5FVJA 4ZI6A 1KUXA 3MRUA 2ZOFA 1Y7RA 4OC2A 1S3ZA 3D7DA 2B3VA 4FD4A 1I21A 4H2KA 2VZZA 4KS9A 2Y0MA 2J8NA 2PJ2A 3UY5A 3VH9A 3F5BA 3D4UA 3SXNA 4XPLA 3SI1A 4KOWA 4Y49B 4I49A 3D2PA 1ARLA 3D3SA 2JDDA 2PCUA 1IYLA 4NGSA 2HB6A 4MCRA 5AGEA 1XBUA 4X3RA 4AVBA 4RI1A 4A95A 2CY2A 1Q2DA 2FIAA 4PV6A 2FS5A 3GB0A 4MY3A 7CPAA 1PYTB 2Z11A 2GE3A 1R43A 1TF9A 2AJ6A 2GLJA 3IEHA 5EC4A 3FEDA 4QUSA 3NFZA 5IB0A 2Q7BA 2ZPAA 4C7IA 1FY7A 3FJUA 2ODFA 4MRIA 3W91A 3RYOA 2O53A 4UIBA 1R3NA 4CYOA 1M4LA 2ARHA 2R8VA 2NYQA 2C6CA 2CF4A 4B11A 2Z3KA 4WWVA 3H8GA 4MFLA 4B10A 1IICA 1LAMA 1M4DA 2PJ7A 4NFRA 1XF8A 2B4BA 3L2NA 4KZTA 5LYLA 4MBUA 3D68A 3H8FA 1Z8XA 4UWJA 1ZG7A 3EO4A 1NMTA 2Z10A 2H5MA 3D66A 4NGNA 3KZWA 2IQ6A 1BPMA 1LFWA 1CPXA 4L89A 4CRZB 2B4DB 2D4PA 1QMUA 4BMHA 4NGQA 4FAIA 3D7FA 2G3AA 4CAVA 1M4GA 3F8KA 2B5GA 2ANPA 2VI7A 4UCNA 4P44A 4F0XA 4OC1A 3N7ZA 4DUKA 2VXKA 4OC3A 3P2FA 4FBEA 4HNXB 4KLVA 1S60A 3PB9X 4KUAA 4CGPA 4H89A 1CBXA 3TOBA 4EFDA 2AFUA 3IU1A 4CGLA 3PBEA 4F9VA 4HKFA 4ZY1A 1QSTA 2YGWA 2Q4YA 2ZEEA 4JLYA 2PQ8A 1CM0A 2ATRA 4PK3A 3FRMA 4AXVA 5K8MA 4C2XA 1WK4A 4KVME 3QAHA 1N71A 4P4IA 2DPTA 3WC5A 2G3TA 5D29A 3B3TA 5ELYA 3JRUA 2QMLA 3CPXA 1LCPA 4YRHA 3SI2A 4XNHC 4JXRA 2FSRA 4FD6A 4A37A 4B14A 3D8PA 5G22A 4L8AA 3SJFA 3CDXA 3K9UA 1KWMA 3V8IA 3PZJA 2DEAA 3DR8A 4F8ZA 4KLWA 4PXEA 4M6GA 2BCOA 4KOYA 1VGYA 4MY0A 4ORFA 3W6SA 3TC8A 1CP6A 2KCWA 2P6EA 2ZEHA 4MFZA 4P4EA 5H84A 1VKCA 1B87A 4XPDB 4YGOA 2CXAA 2G0BA 4PXDA 3W6XA 2JDCA 1KUYA 1F2PA 2J8RA 3BJ8A 4MCSA 4F9UA 2PJ4A 3JVNA 1EE3P 5K8PA 2VQYA 3B35A 4QB9A 2PJ6A 4RS2A 1M44A 4CAEA 3TFYA 4F6AA 3PB8X 1NSAA 5JPHA 1ELMP 5H86A 3BI0A 4E2AA 5AG4A 5KTDA 4MFKA 4CYPA 4PSXA 2PRQA 3JTKA 5BWAB 2PJ5A 5GCNA 5HXDA 2WYRA 1PUAA 2EBJA 2OZGA 4P10A 3RO0A 4OIDA 3IU2A 4FD7A 1PU9A 1V0CA 1ZO0A 4A31A 1ON0A 5THWA 3PBBA 2ZELA 1RO5A 3GUXA 1Z9UA 4TNUA 3S9LA 2PC1A 4RN7A 4IUSA 1U6MA 3DSBA 3FECA 2OH1A 4R6TA 3HUVA 1YVKA 4MXUA 4YWYA 2BO9A 4MHDA 3I9SA 1IGBA 1UFHA 2GFQA 4UWIA 3EC4A 3IWEA 4CYQA 4IHMA 4R9MA 4DJLA 2BSWA 1YLOA 3BHXA 2FVGA 1QQ9A 1TKHA 3WC6A 2PJAA 3WC7A 5J1QA 1RTQA 2V8VA 2C6PA 2O28A 2PR8A 4CPAA 3PGPA 2V77A 3FH4A 3WT4A 4A30A 1Q2CA 5LYIA 1F57A 1YMEA 2BL1A 3B7IA 3T8WA 3R9FA 2ZW4A 2PJCA 3F0AA 4OADA 3MGDA 4MCQA 3V7ZA 4Z65A 2PJBA 2A4NA 3C26A 1ELLP 1YQEA 5IB9A 3CXQA 4JXQA 1JQGA 2ZEDA 1X10A 4H6UA 5DWNA 1IU8A 1PCAA 3PRTA 3QB8A 4MFQA 3FNCA 4PXBA 2WPWA 4PQAA 4XNHB 2VL1A 2ZEPA 3TCVA 2GANA 4CRYB 4CAFA 3IIBA 4ONWA 3H8EA 3D2MA 3VATA 4EMEA 4NF1A 3N5FA 4K3NA 2B3UA 2PDOA 4P4JA 3TX8A 3FYNA 3SJGA 6CPAA 4R76A 1Y0YA 3BI1A 3K9TA 3OWCA 2ZW5A 4O23A 4QBJA 5C82A 2IJZA 3FF3A 4HPSA 4OC5A 4AVAA 2GU2A 2WUUA 5K8OA 4EWTA 2JLMA 4P4BA 4KOSA 1I12A 5F46A 2F8HA 1BLLE 2XEJA 3FIXA 2G9DA 3RBUA 1MJAA 2ZW6A 3R9GA 1IIDA 1BO4A 1S5KA 2Z3LA 4EVYA 2P0WA 3R95A 4X8IA
chains in the Genus database with same CATH topology
3GKRA 1S7FA 3FXTA 4BBHA 2REFA 2EUIA 1IB1E 3S6KA 2K5TA 4H6ZA 4Q36A 2QECA 4X5KA 1Y9WA 2X7BA 1QSMA 2Q0YA 3T9YA 4NEXA 4U9ZA 2FE7A 4MI4A 5G1ZA 1P0HA 3TOAA 1P4NA 2P6FA 5DWMA 1QSRA 5A27A 4LUAA 5ISVA 5J8CA 4AB7A 4LX9A 2FXFA 4UA3A 1L0CA 4B5PB 2R1IA 2PRBA 4A33A 3BLNA 3TO9A 1XIXA 1YLEA 5G20A 4M3SA 2J8MA 2PSWA 4E8OA 4KOXA 4DNCA 2HUZA 3S6GA 5F47A 1M1DA 1QSOA 4C2YA 2FIWA 4II9A 3FB3A 2OZHA 4KVOE 3ZJ0A 3TTHA 2VEZA 3EY5A 2CNSA 2ZW7A 3B8GA 5KTCA 2B58A 4MJ8A 4Y49C 2Z3OA 1XEBA 2D4OA 3GYAA 4CGMA 1NSLA 2Q04A 2C27A 3SXOA 2Q4VA 3DNSA 5J8FA 2OZUA 4NSQA 4R57A 4MFJA 4KUBA 4AG9A 4UFVA 1KZFA 4HNYB 4C2ZA 1YR0A 3LD2A 2WPXA 5C88A 4QVTA 2FCKA 3GY9A 2VBQA 2P6GA 2GIVA 2I00A 3S6HA 4KOUA 1SQHA 4KOVA 4UCMA 3JUWA 3TO6A 3E0KA 2YNDA 1XMTA 3ZZIA 4U9YA 1Z4EA 2DPSA 4FD5A 5G21A 4NCZA 4UFXA 4CGOA 3VWDA 3TE4A 1XE4A 5I0CA 2QIRA 1S7LA 2F5IA 4PSWA 3TT2A 4PK2A 4R3LA 1VHSA 2Z0ZA 4A2ZA 3CXSA 1M4IA 3SHPA 5HH1A 1GHEA 2Z3PA 1RXTA 4K30A 5E96A 5A28A 1YVOA 1YREA 1LRZA 4CGNA 1I1DA 4JJXA 2YNEA 4R87A 3TO7A 5EBVA 4KVXA 3LODA 2REEA 4ZGYB 5CNPA 4NXYA 4UBRA 4UFWA 4JWPA 5HMNA 3R9EA 4C7HA 1MJBA 2HQYA 1KUVA 2CNMA 1Z4RA 1K4JA 4E0AA 4M85A 2R98A 3T90A 4F0YA 2YNCA 4CAWA 4OLLA 4CYNA 4QC6A 2OU2A 2WSAA 2RC4A 3R96A 3CXPA 2IL4A 2R7HA 4UCPA 4B5OA 1J4JA 4U5YA 3WR7A 3VWEA 1CJWA 3S6FA 2EVNA 4CAXA 4C68A 1Q2YA 2AE6A 3IWGA 2CNTA 1YGHA 3NE7A 5IV0A 3H4QA 1MJ9A 1S7KA 4Q38A 4ZBGA 5IX3A 2BUEA 1MK4A 2DXQA 4HNWB 5AG6A 3H5ZA 5F48A 4XPDC 3R1KA 1S7NA 1OZPA 4AG7A 5F49A 5KTAA 4B13A 5AG7A 4GS4A 4CS0B 1B6BA 3G8WA 5JQ4A 2FT0A 2HV2A 3P2HA 3G3SA 3IGRA 2BEIA 2NMTA 4R3KA 2PR1A 1YX0A 2VZYA 2YNCC 2I79A 1R57A 2OB0A 2JEVA 2Q44A 2B5GB 4IF5A 3FBUA 3A9LA 3DDDA 5AG5A 4B5PA 2Z3MA 4JD6A 4MFPA 4J3GA 3DR6A 2B4DA 4ONUA 1YK3A 3PP9A 3BJ7A 4KORA 2Z3NA 1NE9A 1Y9KA 3EXNA 4OAEA 2FL4A 4AVCA 4KSAA 4KOTA 1BOBA 3KKWA 1TIQA 3I3GA 2ZXVA 1WWZA 1IYKA 4A32A 4B12A 4YFJA 4XPKA 1QSNA 3EFAA 4KSFA 5FVJA 1KUXA 1Y7RA 1S3ZA 2B3VA 4FD4A 1I21A 2VZZA 4KS9A 2Y0MA 2J8NA 3UY5A 3F5BA 3SXNA 4XPLA 4KOWA 4Y49B 4I49A 3D2PA 3D3SA 2JDDA 1IYLA 5AGEA 4AVBA 4RI1A 4A95A 2CY2A 1Q2DA 2FIAA 4PV6A 2FS5A 4MY3A 2Z11A 2GE3A 2AJ6A 5EC4A 5IB0A 4QUSA 2Q7BA 2ZPAA 4C7IA 1FY7A 3W91A 3RYOA 4CYOA 2ARHA 2R8VA 4B11A 2Z3KA 4MFLA 4B10A 1IICA 1M4DA 1XF8A 2B4BA 4KZTA 4MBUA 4UWJA 3EO4A 1NMTA 2Z10A 2H5MA 4L89A 4CRZB 2B4DB 2D4PA 4BMHA 2G3AA 4CAVA 1M4GA 3F8KA 2B5GA 2VI7A 4UCNA 4F0XA 3N7ZA 2VXKA 3P2FA 4HNXB 4KLVA 1S60A 4CGPA 4KUAA 4H89A 3TOBA 3IU1A 4CGLA 4HKFA 1QSTA 2YGWA 2Q4YA 4JLYA 2PQ8A 1CM0A 2ATRA 4PK3A 3FRMA 4C2XA 1WK4A 4KVME 3QAHA 1N71A 2DPTA 2G3TA 2QMLA 4YRHA 4XNHC 4JXRA 2FSRA 4FD6A 4B14A 3D8PA 5G22A 4L8AA 3K9UA 3V8IA 3PZJA 3DR8A 4KLWA 4KOYA 4MY0A 4ORFA 3W6SA 2KCWA 2P6EA 4MFZA 5H84A 1VKCA 1B87A 4XPDB 4YGOA 2CXAA 2G0BA 3W6XA 2JDCA 1KUYA 2J8RA 3BJ8A 3JVNA 2VQYA 4QB9A 4CAEA 4RS2A 1M44A 3TFYA 4F6AA 5JPHA 5H86A 5KTDA 4E2AA 5AG4A 4MFKA 4CYPA 4PSXA 3JTKA 5BWAB 5GCNA 1PUAA 2OZGA 3IU2A 4FD7A 1PU9A 1V0CA 1ZO0A 4A31A 1ON0A 1RO5A 1Z9UA 2PC1A 4IUSA 1U6MA 3DSBA 2OH1A 1YVKA 4MHDA 3I9SA 1UFHA 4UWIA 3EC4A 3IWEA 4CYQA 4R9MA 2BSWA 2O28A 2PR8A 3PGPA 4A30A 1Q2CA 2BL1A 3R9FA 2ZW4A 3F0AA 4OADA 3MGDA 2A4NA 3C26A 3CXQA 4JXQA 4H6UA 5DWNA 3QB8A 4MFQA 3FNCA 2WPWA 4XNHB 4CRYB 3TCVA 2GANA 4CAFA 3D2MA 4NF1A 2B3UA 2PDOA 3FYNA 5C82A 4QBJA 3OWCA 2ZW5A 4AVAA 2WUUA 2JLMA 4KOSA 1I12A 5F46A 3FIXA 1MJAA 2ZW6A 3R9GA 1IIDA 1BO4A 1S5KA 2Z3LA 4EVYA 2P0WA 3R95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C68 A;  5AG4 A;  4CYP A;  4B14 A;  5G22 A;  3JTK A;  4BBH A;  4CYO A;  4CAF A;  4UCM A;  4A33 A;  4B11 A;  5A28 A;  4CGP A;  2YND A;  4B10 A;  3IU1 A;  2YNC A;  4CGM A;  4CGL A;  3IU2 A;  4A30 A;  5G21 A;  4CYN A;  5G20 A;  4A31 A;  4CGN A;  5AG6 A;  3H5Z A;  2YNE A;  4UFX A;  5G1Z A;  2YNC C;  2WSA A;  5AGE A;  4CGO A;  4C2X A;  2WUU A;  4A95 A;  4A32 A;  4B12 A;  4UFV A;  4UCP A;  5A27 A;  4C2Z A;  4C2Y A;  4UFW A;  4CAE A;  5AG5 A;  3IWE A;  4B13 A;  4C7H A;  4CYQ A;  5AG7 A;  4UCN A;  4A2Z A;  4C7I A; 
#chains in the Genus database with same CATH topology
 3GKR A;  1S7F A;  3FXT A;  4BBH A;  1GYT A;  2EO8 A;  2PVV A;  2REF A;  3DGV A;  2EUI A;  3HLP A;  5DS0 A;  1IB1 E;  3S6K A;  2K5T A;  4H6Z A;  4Q36 A;  3V38 A;  2EK9 A;  2QEC A;  4X5K A;  5HVG A;  1Y9W A;  2X7B A;  2AFX A;  1LAN A;  1QSM A;  1CPS A;  2HC9 A;  2Q0Y A;  3T9Y A;  4NEX A;  4U9Z A;  2FE7 A;  4MI4 A;  5G1Z A;  1P0H A;  3PFO A;  2OR4 A;  3TOA A;  2XEI A;  3IFE A;  1P4N A;  1VIX A;  2DF5 A;  2P6F A;  5DWM A;  1QSR A;  4MHZ A;  2PJ0 A;  4PXC A;  3B2Y A;  5A27 A;  4LUA A;  5ISV A;  5J8C A;  4P4D A;  4YU9 A;  2V8H A;  4AB7 A;  2J9A A;  2Q4Z A;  4KSI A;  4LX9 A;  2FXF A;  4UA3 A;  3CZX A;  2PIY A;  1L0C A;  4OKO A;  1Y0R A;  1Y7E A;  8CPA A;  1FNO A;  4B5P B;  2Q51 A;  2R1I A;  2PRB A;  3RAM A;  4A33 A;  2ZEN A;  4NJQ A;  5JGF A;  3BLN A;  3TO9 A;  1XIX A;  1YLE A;  3PFE A;  4ZY0 A;  1Z8L A;  2PIZ A;  2WZN A;  5G20 A;  4M3S A;  3QAY A;  2J8M A;  5LYD A;  2PSW A;  4E8O A;  4KOX A;  3IJ3 A;  1X12 A;  4OC4 A;  1ZG8 A;  2HUZ A;  4MMO A;  2AFW A;  4DNC A;  3B3C A;  3S6G A;  5F47 A;  1M1D A;  1QSO A;  1IY7 A;  4C2Y A;  4UEF A;  2FIW A;  5F09 A;  4II9 A;  3FB3 A;  1YW6 A;  1DTD A;  2IMO A;  2OZH A;  1CX8 A;  3D7H A;  5LRJ A;  1JWQ A;  3BXM A;  4KVO E;  3ZJ0 A;  3TTH A;  1Z8W A;  2VEZ A;  2CNS A;  2ZW7 A;  3EY5 A;  3B8G A;  4MHP A;  3KI9 A;  5HVH A;  5KTC A;  5JH9 A;  2B58 A;  4MJ8 A;  2AFO A;  1AMP A;  4Y49 C;  2Z3O A;  1XEB A;  2D4O A;  3GYA A;  3PB7 X;  4CGM A;  2GLF A;  1NSL A;  1UWY A;  3KL9 A;  2Q04 A;  4NGT A;  2C27 A;  2C6G A;  2PJ9 A;  3FVL A;  3SXO A;  2Q4V A;  3DNS A;  4R7M A;  5J8F A;  2OZU A;  4NGM A;  4TWE A;  2I3C A;  4NSQ A;  4R57 A;  1F2O A;  2ABZ A;  4KUB A;  4MFJ A;  4A38 A;  1FT7 A;  4UFV A;  1KZF A;  3PB6 X;  1TXR A;  4HNY B;  4AG9 A;  4C2Z A;  1YR0 A;  2BOA A;  3LD2 A;  2WPX A;  5C88 A;  3NH4 A;  4A39 A;  3I1U A;  4QVT A;  2FCK A;  3GY9 A;  2VBQ A;  2JBK A;  2P6G A;  2GIV A;  2I00 A;  3S6H A;  4KOU A;  1XRY A;  5CPA A;  1SQH A;  3IC1 A;  1IOF A;  4RUH A;  4KOV A;  4UCM A;  3JUW A;  3D67 A;  4MHY A;  1BAV A;  2RB7 A;  3TO6 A;  3E0K A;  1Q7L A;  1A2Z A;  2YND A;  4IAV A;  5EMI A;  1XMT A;  4M6H A;  3ZZI A;  4U9Y A;  1Z4E A;  2DPS A;  4FD5 A;  5G21 A;  3KQX A;  3ISX A;  4NCZ A;  4UFX A;  3RZA A;  4CGO A;  3VWD A;  3TE4 A;  1XE4 A;  4G1P A;  4P4F A;  3KHX A;  4UF4 A;  5I0C A;  3KR5 A;  2QIR A;  1ZG9 A;  1S7L A;  2QVP A;  2F5I A;  4PSW A;  3TT2 A;  4PK2 A;  3SJX A;  4R3L A;  1OBR A;  3S9N A;  4Q7A A;  1VHS A;  1TKF A;  2Z0Z A;  3KGQ A;  4A2Z A;  4GM5 A;  3CXS A;  1M4I A;  4OIW A;  3SHP A;  3NH8 A;  3SJE A;  2CTB A;  1LOK A;  5HH1 A;  1GHE A;  2Z3P A;  3FEE A;  1RXT A;  3FMC A;  4K30 A;  2ZEG A;  5E96 A;  5A28 A;  1YVO A;  4IK2 A;  3VAR A;  2QJ8 A;  3B3V A;  3LMS A;  3NE8 A;  1YRE A;  1CG2 A;  1LRZ A;  4CGN A;  3IO1 A;  5LYF A;  1I1D A;  4JJX A;  2YNE A;  4R87 A;  3TO7 A;  5EBV A;  1XMB A;  4KVX A;  2JBJ A;  4ZX8 A;  3GIU A;  1HEE A;  2NSM A;  3LOD A;  2REE A;  4ZGY B;  1AUG A;  5CNP A;  4NXY A;  4UBR A;  4R8F A;  4UFW A;  4JWP A;  5HMN A;  3R9E A;  4X2T A;  4C7H A;  1MJB A;  2HQY A;  3D7G A;  1KUV A;  4UEE A;  4ZX9 A;  2OOT A;  2CNM A;  1Z4R A;  1K4J A;  4E0A A;  1YSJ A;  4NGR A;  3B3S A;  4M85 A;  2R98 A;  3T90 A;  3CPA A;  1HDU A;  2ZEF A;  5LRG A;  4F0Y A;  4UEZ A;  4FWU A;  2EK8 A;  2YNC A;  4MHN A;  4CAW A;  4ZY2 A;  4OLL A;  4CYN A;  4QC6 A;  2OU2 A;  2WSA A;  1Z8T A;  2RC4 A;  1DE4 C;  3R96 A;  3GLJ A;  3CXP A;  2IL4 A;  2R7H A;  2PVW A;  4UCP A;  4B5O A;  3SI0 A;  1J4J A;  2V8G A;  4U5Y A;  2QYV A;  5JM6 A;  1ARM A;  1Z5R A;  3WR7 A;  3VWE A;  1CJW A;  1TF8 A;  3S6F A;  2EVN A;  3KAS A;  4FUU A;  4LQG A;  4CAX A;  4C68 A;  1Q2Y A;  2AFS A;  2Q43 A;  2AE6 A;  3IWG A;  2JEW A;  3PB4 X;  3RNZ A;  2CNT A;  1HDQ A;  1YGH A;  4DYO A;  5LRK A;  3NE7 A;  5IV0 A;  3LWU A;  1H8L A;  1VHO A;  3H4Q A;  4BIN A;  1MJ9 A;  1S7K A;  2XEG A;  4Q38 A;  4ZBG A;  5IX3 A;  2BUE A;  4PPZ A;  1MK4 A;  2DXQ A;  4HNW B;  5AG6 A;  3H5Z A;  5F48 A;  4NGP A;  3ISZ A;  4B6Z A;  4ZYQ A;  4M6I A;  2F7V A;  2AFM A;  4XPD C;  1Z2L A;  1AYE A;  3KQZ A;  2POK A;  3R1K A;  4MCP A;  2PJ8 A;  1S7N A;  1OZP A;  4AG7 A;  5F49 A;  5KTA A;  4B13 A;  5AG7 A;  2Q7S A;  2ZOG A;  4GS4 A;  2RFH A;  4CS0 B;  1B6B A;  3G8W A;  5JQ4 A;  1ZLH A;  2FT0 A;  2ZEO A;  2HV2 A;  4WJB A;  4OME A;  4A94 A;  3P2H A;  3G3S A;  3IGR A;  5K8N A;  2BEI A;  3S9M A;  1XOV A;  5D8N A;  2NMT A;  4R3K A;  2ZEM A;  2PR1 A;  1YX0 A;  1BPN A;  2VZY A;  2YNC C;  4GXH A;  1IOI A;  3DLJ A;  2I79 A;  1R57 A;  4JZ0 A;  2OB0 A;  2JEV A;  3IWW A;  2Q44 A;  2B5G B;  3CT9 A;  1VHE A;  4IF5 A;  2PE3 A;  5CBM A;  3FBU A;  1LAP A;  3A9L A;  1XFO A;  3DDD A;  5AG5 A;  3FX6 A;  2XEF A;  4B5P A;  4NJR A;  3PEI A;  3WAB A;  2O4H A;  2Z3M A;  4JD6 A;  5I4M A;  4MFP A;  4J3G A;  3DR6 A;  2CTC A;  2B4D A;  3K2K A;  4ONU A;  1CP7 A;  1YK3 A;  1YW4 A;  3BJ7 A;  3PP9 A;  2C1C A;  4KOR A;  5HVF A;  3MN8 A;  2Z3N A;  1NE9 A;  3QNV A;  1Y9K A;  3EXN A;  3NA6 A;  2FL4 A;  1TKJ A;  4OAE A;  4P6Y A;  4AVC A;  4OP4 A;  3KHZ A;  2AFZ A;  2PJ1 A;  3KR4 A;  4JYW A;  4KSA A;  4P45 A;  4BD9 A;  2CIJ A;  4LQ6 A;  4KOT A;  1BOB A;  3LAC A;  4W9Y A;  4OC0 A;  2GRE A;  1TIQ A;  2V8D A;  2PJ3 A;  2ZXV A;  3I3G A;  1WWZ A;  3KKW A;  1IYK A;  3NH5 A;  4A32 A;  1ZLI A;  4B12 A;  4XPK A;  4YFJ A;  1QSN A;  2EWB A;  3EFA A;  1XJO A;  3B3W A;  4KSF A;  4UIA A;  5FVJ A;  4ZI6 A;  1KUX A;  3MRU A;  2ZOF A;  1Y7R A;  4OC2 A;  1S3Z A;  3D7D A;  2B3V A;  4FD4 A;  1I21 A;  4H2K A;  2VZZ A;  4KS9 A;  2Y0M A;  2J8N A;  2PJ2 A;  3UY5 A;  3VH9 A;  3F5B A;  3D4U A;  3SXN A;  4XPL A;  3SI1 A;  4KOW A;  4Y49 B;  4I49 A;  3D2P A;  1ARL A;  3D3S A;  2JDD A;  2PCU A;  1IYL A;  4NGS A;  2HB6 A;  4MCR A;  5AGE A;  1XBU A;  4X3R A;  4AVB A;  4RI1 A;  4A95 A;  2CY2 A;  1Q2D A;  2FIA A;  4PV6 A;  2FS5 A;  3GB0 A;  4MY3 A;  7CPA A;  1PYT B;  2Z11 A;  2GE3 A;  1R43 A;  1TF9 A;  2AJ6 A;  2GLJ A;  3IEH A;  5EC4 A;  3FED A;  4QUS A;  3NFZ A;  5IB0 A;  2Q7B A;  2ZPA A;  4C7I A;  1FY7 A;  3FJU A;  2ODF A;  4MRI A;  3W91 A;  3RYO A;  2O53 A;  4UIB A;  1R3N A;  4CYO A;  1M4L A;  2ARH A;  2R8V A;  2NYQ A;  2C6C A;  2CF4 A;  4B11 A;  2Z3K A;  4WWV A;  3H8G A;  4MFL A;  4B10 A;  1IIC A;  1LAM A;  1M4D A;  2PJ7 A;  4NFR A;  1XF8 A;  2B4B A;  3L2N A;  4KZT A;  5LYL A;  4MBU A;  3D68 A;  3H8F A;  1Z8X A;  4UWJ A;  1ZG7 A;  3EO4 A;  1NMT A;  2Z10 A;  2H5M A;  3D66 A;  4NGN A;  3KZW A;  2IQ6 A;  1BPM A;  1LFW A;  1CPX A;  4L89 A;  4CRZ B;  2B4D B;  2D4P A;  1QMU A;  4BMH A;  4NGQ A;  4FAI A;  3D7F A;  2G3A A;  4CAV A;  1M4G A;  3F8K A;  2B5G A;  2ANP A;  2VI7 A;  4UCN A;  4P44 A;  4F0X A;  4OC1 A;  3N7Z A;  4DUK A;  2VXK A;  4OC3 A;  3P2F A;  4FBE A;  4HNX B;  4KLV A;  1S60 A;  3PB9 X;  4KUA A;  4CGP A;  4H89 A;  1CBX A;  3TOB A;  4EFD A;  2AFU A;  3IU1 A;  4CGL A;  3PBE A;  4F9V A;  4HKF A;  4ZY1 A;  1QST A;  2YGW A;  2Q4Y A;  2ZEE A;  4JLY A;  2PQ8 A;  1CM0 A;  2ATR A;  4PK3 A;  3FRM A;  4AXV A;  5K8M A;  4C2X A;  1WK4 A;  4KVM E;  3QAH A;  1N71 A;  4P4I A;  2DPT A;  3WC5 A;  2G3T A;  5D29 A;  3B3T A;  5ELY A;  3JRU A;  2QML A;  3CPX A;  1LCP A;  4YRH A;  3SI2 A;  4XNH C;  4JXR A;  2FSR A;  4FD6 A;  4A37 A;  4B14 A;  3D8P A;  5G22 A;  4L8A A;  3SJF A;  3CDX A;  3K9U A;  1KWM A;  3V8I A;  3PZJ A;  2DEA A;  3DR8 A;  4F8Z A;  4KLW A;  4PXE A;  4M6G A;  2BCO A;  4KOY A;  1VGY A;  4MY0 A;  4ORF A;  3W6S A;  3TC8 A;  1CP6 A;  2KCW A;  2P6E A;  2ZEH A;  4MFZ A;  4P4E A;  5H84 A;  1VKC A;  1B87 A;  4XPD B;  4YGO A;  2CXA A;  2G0B A;  4PXD A;  3W6X A;  2JDC A;  1KUY A;  1F2P A;  2J8R A;  3BJ8 A;  4MCS A;  4F9U A;  2PJ4 A;  3JVN A;  1EE3 P;  5K8P A;  2VQY A;  3B35 A;  4QB9 A;  2PJ6 A;  4RS2 A;  1M44 A;  4CAE A;  3TFY A;  4F6A A;  3PB8 X;  1NSA A;  5JPH A;  1ELM P;  5H86 A;  3BI0 A;  4E2A A;  5AG4 A;  5KTD A;  4MFK A;  4CYP A;  4PSX A;  2PRQ A;  3JTK A;  5BWA B;  2PJ5 A;  5GCN A;  5HXD A;  2WYR A;  1PUA A;  2EBJ A;  2OZG A;  4P10 A;  3RO0 A;  4OID A;  3IU2 A;  4FD7 A;  1PU9 A;  1V0C A;  1ZO0 A;  4A31 A;  1ON0 A;  5THW A;  3PBB A;  2ZEL A;  1RO5 A;  3GUX A;  1Z9U A;  4TNU A;  3S9L A;  2PC1 A;  4RN7 A;  4IUS A;  1U6M A;  3DSB A;  3FEC A;  2OH1 A;  4R6T A;  3HUV A;  1YVK A;  4MXU A;  4YWY A;  2BO9 A;  4MHD A;  3I9S A;  1IGB A;  1UFH A;  2GFQ A;  4UWI A;  3EC4 A;  3IWE A;  4CYQ A;  4IHM A;  4R9M A;  4DJL A;  2BSW A;  1YLO A;  3BHX A;  2FVG A;  1QQ9 A;  1TKH A;  3WC6 A;  2PJA A;  3WC7 A;  5J1Q A;  1RTQ A;  2V8V A;  2C6P A;  2O28 A;  2PR8 A;  4CPA A;  3PGP A;  2V77 A;  3FH4 A;  3WT4 A;  4A30 A;  1Q2C A;  5LYI A;  1F57 A;  1YME A;  2BL1 A;  3B7I A;  3T8W A;  3R9F A;  2ZW4 A;  2PJC A;  3F0A A;  4OAD A;  3MGD A;  4MCQ A;  3V7Z A;  4Z65 A;  2PJB A;  2A4N A;  3C26 A;  1ELL P;  1YQE A;  5IB9 A;  3CXQ A;  4JXQ A;  1JQG A;  2ZED A;  1X10 A;  4H6U A;  5DWN A;  1IU8 A;  1PCA A;  3PRT A;  3QB8 A;  4MFQ A;  3FNC A;  4PXB A;  2WPW A;  4PQA A;  4XNH B;  2VL1 A;  2ZEP A;  3TCV A;  2GAN A;  4CRY B;  4CAF A;  3IIB A;  4ONW A;  3H8E A;  3D2M A;  3VAT A;  4EME A;  4NF1 A;  3N5F A;  4K3N A;  2B3U A;  2PDO A;  4P4J A;  3TX8 A;  3FYN A;  3SJG A;  6CPA A;  4R76 A;  1Y0Y A;  3BI1 A;  3K9T A;  3OWC A;  2ZW5 A;  4O23 A;  4QBJ A;  5C82 A;  2IJZ A;  3FF3 A;  4HPS A;  4OC5 A;  4AVA A;  2GU2 A;  2WUU A;  5K8O A;  4EWT A;  2JLM A;  4P4B A;  4KOS A;  1I12 A;  5F46 A;  2F8H A;  1BLL E;  2XEJ A;  3FIX A;  2G9D A;  3RBU A;  1MJA A;  2ZW6 A;  3R9G A;  1IID A;  1BO4 A;  1S5K A;  2Z3L A;  4EVY A;  2P0W A;  3R95 A;  4X8I A; 
#chains in the Genus database with same CATH homology
 3GKR A;  1S7F A;  3FXT A;  4BBH A;  2REF A;  2EUI A;  1IB1 E;  3S6K A;  2K5T A;  4H6Z A;  4Q36 A;  2QEC A;  4X5K A;  1Y9W A;  2X7B A;  1QSM A;  2Q0Y A;  3T9Y A;  4NEX A;  4U9Z A;  2FE7 A;  4MI4 A;  5G1Z A;  1P0H A;  3TOA A;  1P4N A;  2P6F A;  5DWM A;  1QSR A;  5A27 A;  4LUA A;  5ISV A;  5J8C A;  4AB7 A;  4LX9 A;  2FXF A;  4UA3 A;  1L0C A;  4B5P B;  2R1I A;  2PRB A;  4A33 A;  3BLN A;  3TO9 A;  1XIX A;  1YLE A;  5G20 A;  4M3S A;  2J8M A;  2PSW A;  4E8O A;  4KOX A;  4DNC A;  2HUZ A;  3S6G A;  5F47 A;  1M1D A;  1QSO A;  4C2Y A;  2FIW A;  4II9 A;  3FB3 A;  2OZH A;  4KVO E;  3ZJ0 A;  3TTH A;  2VEZ A;  3EY5 A;  2CNS A;  2ZW7 A;  3B8G A;  5KTC A;  2B58 A;  4MJ8 A;  4Y49 C;  2Z3O A;  1XEB A;  2D4O A;  3GYA A;  4CGM A;  1NSL A;  2Q04 A;  2C27 A;  3SXO A;  2Q4V A;  3DNS A;  5J8F A;  2OZU A;  4NSQ A;  4R57 A;  4MFJ A;  4KUB A;  4AG9 A;  4UFV A;  1KZF A;  4HNY B;  4C2Z A;  1YR0 A;  3LD2 A;  2WPX A;  5C88 A;  4QVT A;  2FCK A;  3GY9 A;  2VBQ A;  2P6G A;  2GIV A;  2I00 A;  3S6H A;  4KOU A;  1SQH A;  4KOV A;  4UCM A;  3JUW A;  3TO6 A;  3E0K A;  2YND A;  1XMT A;  3ZZI A;  4U9Y A;  1Z4E A;  2DPS A;  4FD5 A;  5G21 A;  4NCZ A;  4UFX A;  4CGO A;  3VWD A;  3TE4 A;  1XE4 A;  5I0C A;  2QIR A;  1S7L A;  2F5I A;  4PSW A;  3TT2 A;  4PK2 A;  4R3L A;  1VHS A;  2Z0Z A;  4A2Z A;  3CXS A;  1M4I A;  3SHP A;  5HH1 A;  1GHE A;  2Z3P A;  1RXT A;  4K30 A;  5E96 A;  5A28 A;  1YVO A;  1YRE A;  1LRZ A;  4CGN A;  1I1D A;  4JJX A;  2YNE A;  4R87 A;  3TO7 A;  5EBV A;  4KVX A;  3LOD A;  2REE A;  4ZGY B;  5CNP A;  4NXY A;  4UBR A;  4UFW A;  4JWP A;  5HMN A;  3R9E A;  4C7H A;  1MJB A;  2HQY A;  1KUV A;  2CNM A;  1Z4R A;  1K4J A;  4E0A A;  4M85 A;  2R98 A;  3T90 A;  4F0Y A;  2YNC A;  4CAW A;  4OLL A;  4CYN A;  4QC6 A;  2OU2 A;  2WSA A;  2RC4 A;  3R96 A;  3CXP A;  2IL4 A;  2R7H A;  4UCP A;  4B5O A;  1J4J A;  4U5Y A;  3WR7 A;  3VWE A;  1CJW A;  3S6F A;  2EVN A;  4CAX A;  4C68 A;  1Q2Y A;  2AE6 A;  3IWG A;  2CNT A;  1YGH A;  3NE7 A;  5IV0 A;  3H4Q A;  1MJ9 A;  1S7K A;  4Q38 A;  4ZBG A;  5IX3 A;  2BUE A;  1MK4 A;  2DXQ A;  4HNW B;  5AG6 A;  3H5Z A;  5F48 A;  4XPD C;  3R1K A;  1S7N A;  1OZP A;  4AG7 A;  5F49 A;  5KTA A;  4B13 A;  5AG7 A;  4GS4 A;  4CS0 B;  1B6B A;  3G8W A;  5JQ4 A;  2FT0 A;  2HV2 A;  3P2H A;  3G3S A;  3IGR A;  2BEI A;  2NMT A;  4R3K A;  2PR1 A;  1YX0 A;  2VZY A;  2YNC C;  2I79 A;  1R57 A;  2OB0 A;  2JEV A;  2Q44 A;  2B5G B;  4IF5 A;  3FBU A;  3A9L A;  3DDD A;  5AG5 A;  4B5P A;  2Z3M A;  4JD6 A;  4MFP A;  4J3G A;  3DR6 A;  2B4D A;  4ONU A;  1YK3 A;  3PP9 A;  3BJ7 A;  4KOR A;  2Z3N A;  1NE9 A;  1Y9K A;  3EXN A;  4OAE A;  2FL4 A;  4AVC A;  4KSA A;  4KOT A;  1BOB A;  3KKW A;  1TIQ A;  3I3G A;  2ZXV A;  1WWZ A;  1IYK A;  4A32 A;  4B12 A;  4YFJ A;  4XPK A;  1QSN A;  3EFA A;  4KSF A;  5FVJ A;  1KUX A;  1Y7R A;  1S3Z A;  2B3V A;  4FD4 A;  1I21 A;  2VZZ A;  4KS9 A;  2Y0M A;  2J8N A;  3UY5 A;  3F5B A;  3SXN A;  4XPL A;  4KOW A;  4Y49 B;  4I49 A;  3D2P A;  3D3S A;  2JDD A;  1IYL A;  5AGE A;  4AVB A;  4RI1 A;  4A95 A;  2CY2 A;  1Q2D A;  2FIA A;  4PV6 A;  2FS5 A;  4MY3 A;  2Z11 A;  2GE3 A;  2AJ6 A;  5EC4 A;  5IB0 A;  4QUS A;  2Q7B A;  2ZPA A;  4C7I A;  1FY7 A;  3W91 A;  3RYO A;  4CYO A;  2ARH A;  2R8V A;  4B11 A;  2Z3K A;  4MFL A;  4B10 A;  1IIC A;  1M4D A;  1XF8 A;  2B4B A;  4KZT A;  4MBU A;  4UWJ A;  3EO4 A;  1NMT A;  2Z10 A;  2H5M A;  4L89 A;  4CRZ B;  2B4D B;  2D4P A;  4BMH A;  2G3A A;  4CAV A;  1M4G A;  3F8K A;  2B5G A;  2VI7 A;  4UCN A;  4F0X A;  3N7Z A;  2VXK A;  3P2F A;  4HNX B;  4KLV A;  1S60 A;  4CGP A;  4KUA A;  4H89 A;  3TOB A;  3IU1 A;  4CGL A;  4HKF A;  1QST A;  2YGW A;  2Q4Y A;  4JLY A;  2PQ8 A;  1CM0 A;  2ATR A;  4PK3 A;  3FRM A;  4C2X A;  1WK4 A;  4KVM E;  3QAH A;  1N71 A;  2DPT A;  2G3T A;  2QML A;  4YRH A;  4XNH C;  4JXR A;  2FSR A;  4FD6 A;  4B14 A;  3D8P A;  5G22 A;  4L8A A;  3K9U A;  3V8I A;  3PZJ A;  3DR8 A;  4KLW A;  4KOY A;  4MY0 A;  4ORF A;  3W6S A;  2KCW A;  2P6E A;  4MFZ A;  5H84 A;  1VKC A;  1B87 A;  4XPD B;  4YGO A;  2CXA A;  2G0B A;  3W6X A;  2JDC A;  1KUY A;  2J8R A;  3BJ8 A;  3JVN A;  2VQY A;  4QB9 A;  4CAE A;  4RS2 A;  1M44 A;  3TFY A;  4F6A A;  5JPH A;  5H86 A;  5KTD A;  4E2A A;  5AG4 A;  4MFK A;  4CYP A;  4PSX A;  3JTK A;  5BWA B;  5GCN A;  1PUA A;  2OZG A;  3IU2 A;  4FD7 A;  1PU9 A;  1V0C A;  1ZO0 A;  4A31 A;  1ON0 A;  1RO5 A;  1Z9U A;  2PC1 A;  4IUS A;  1U6M A;  3DSB A;  2OH1 A;  1YVK A;  4MHD A;  3I9S A;  1UFH A;  4UWI A;  3EC4 A;  3IWE A;  4CYQ A;  4R9M A;  2BSW A;  2O28 A;  2PR8 A;  3PGP A;  4A30 A;  1Q2C A;  2BL1 A;  3R9F A;  2ZW4 A;  3F0A A;  4OAD A;  3MGD A;  2A4N A;  3C26 A;  3CXQ A;  4JXQ A;  4H6U A;  5DWN A;  3QB8 A;  4MFQ A;  3FNC A;  2WPW A;  4XNH B;  4CRY B;  3TCV A;  2GAN A;  4CAF A;  3D2M A;  4NF1 A;  2B3U A;  2PDO A;  3FYN A;  5C82 A;  4QBJ A;  3OWC A;  2ZW5 A;  4AVA A;  2WUU A;  2JLM A;  4KOS A;  1I12 A;  5F46 A;  3FIX A;  1MJA A;  2ZW6 A;  3R9G A;  1IID A;  1BO4 A;  1S5K A;  2Z3L A;  4EVY A;  2P0W A;  3R95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...