4UCNA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
molecule tags Transferase
source organism Leishmania major
total genus 130
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucnA00
5A27A 4A33A 3IU1A 4CGLA 4UCMA 2YNCC 5AG5A 4UCNA 4A2ZA 4C2ZA 4CGMA 5G22A 4A30A 4B13A 4CYPA 4UFXA 2WUUA 3JTKA 4B10A 5AG4A 5G1ZA 4A32A 4A31A 4CGOA 2YNCA 5A28A 4UFVA 5G21A 4B12A 4CGNA 4C68A 5G20A 2YNEA 4C7IA 4BBHA 4UFWA 4CYOA 3IWEA 4CYQA 3IU2A 2WSAA 5AG6A 5AGEA 4C2XA 4CYNA 4C7HA 4UCPA 2YNDA 5AG7A 4C2YA 4CAEA 4CGPA 4A95A 4CAFA 4B14A 3H5ZA 4B11A
chains in the Genus database with same CATH superfamily
2IQ6A 3MN8A 5I4MA 4KUBA 4MCPA 1AMPA 2VXKA 4HKFA 4ONWA 4MY0A 4X8IA 2VZZA 3JVNA 5G22A 5C82A 4M85A 4KOXA 1R57A 4QB9A 1U6MA 3S6GA 2B4DA 2GE3A 1TF8A 2ZEFA 4TNUA 1A2ZA 2PCUA 2GIVA 2VZYA 3CPXA 3KR5A 1S7FA 1YMEA 2REFA 3SJEA 2ZEOA 4OC2A 4NGPA 2C1CA 5AG6A 2Q0YA 3VATA 4ZY1A 2V8HA 3RZAA 1N71A 4E0AA 1V0CA 2QMLA 3D7FA 1M1DA 4FAIA 4M6HA 4PXDA 3D68A 2DPSA 4F0XA 5DWNA 4UEEA 1LAMA 2POKA 4GXHA 7CPAA 1I1DA 1YQEA 4KSFA 4MFKA 1MJ9A 3FJUA 1R43A 1FY7A 5F09A 4UEZA 5KTDA 3H8GA 4EFDA 3P2FA 3BJ7A 4IF5A 5HVHA 4UF4A 2FCKA 1IOIA 3PP9A 2Q7SA 2PJ9A 4P4IA 1VGYA 2PJBA 1IYKA 1HDQA 4KVXA 3KZWA 1L0CA 2PJ7A 4M6IA 1MJAA 4CYOA 2V8GA 2I79A 1J4JA 2R7HA 4IAVA 2ZW6A 5LRGA 3V8IA 3FVLA 4K30A 1M4LA 4MFZA 4MHYA 3R9GA 2YNDA 4XPDC 2Q7BA 1P4NA 4UBRA 2BCOA 3LD2A 3NE7A 2WYRA 4PXBA 3FYNA 3ZZIA 4KVME 5J8FA 3I3GA 1M44A 1XMTA 2B5GB 2K5TA 2Z10A 1ZLHA 1R3NA 4HNWB 3IJ3A 2EK9A 4AXVA 1WK4A 4KLWA 5IX3A 3VWEA 4CRZB 4II9A 3N7ZA 4F0YA 3FMCA 3BLNA 2GU2A 3RNZA 5AG4A 3TO7A 3FXTA 2OOTA 1NE9A 4CGNA 2CY2A 3D67A 3RYOA 5LYDA 3H8FA 2F5IA 2VI7A 2Z11A 2PJAA 3R1KA 1Z8WA 2Q43A 4OC0A 1XOVA 2GLJA 1KUYA 3WR7A 4QVTA 4DNCA 3ZJ0A 2RC4A 1AUGA 3PEIA 5H84A 2REEA 3TX8A 4LX9A 4R87A 1IGBA 2GLFA 1YSJA 4MJ8A 4YWYA 5A27A 2Q4VA 4AVCA 2VQYA 4NF1A 1Z5RA 4UCNA 8CPAA 3BXMA 2PE3A 5FVJA 2O28A 1CX8A 4H6UA 2ZW5A 3KHXA 4QC6A 1QSNA 4UFXA 4YU9A 3B3CA 2CTCA 3D7GA 2B58A 3E0KA 5LRJA 2FVGA 3D2PA 4NJRA 2G0BA 2JDDA 4JD6A 3F0AA 2Z3NA 3N5FA 2CF4A 4LUAA 3CDXA 4MCRA 1Z8TA 2FE7A 2PJ3A 2PSWA 3IU2A 4ZX9A 4TWEA 4B5PB 1LOKA 4P4DA 4XPKA 5JM6A 4C7HA 4NGQA 4KOWA 4NGNA 4A39A 4J3GA 5F46A 5JPHA 3GY9A 1BLLE 2JBJA 4B6ZA 3BJ8A 1Z9UA 3EO4A 3QNVA 3D8PA 2HB6A 2B3UA 5THWA 3MRUA 5IB9A 2BSWA 2FS5A 2RB7A 4Y49B 4ZY0A 2PJ0A 1Z8XA 4M3SA 3L2NA 1KUVA 5D29A 2D4PA 2PJ4A 3PFEA 4MFPA 5LYLA 3D7HA 4RI1A 4E8OA 2PJCA 2IJZA 2PRBA 4R76A 1YVKA 2J8MA 4X5KA 4C68A 2G3AA 2RFHA 3TTHA 3SI0A 3I1UA 5LYIA 3D7DA 1ARMA 3IFEA 1YX0A 2DEAA 3OWCA 1XMBA 2NMTA 2PC1A 3ISXA 2EBJA 4JWPA 3PB4X 2ANPA 2AE6A 3B3WA 1Y0YA 2JBKA 3SJGA 5HMNA 1IY7A 2V8VA 4BMHA 4WWVA 3KQXA 3KKWA 3CPAA 2OZHA 1ARLA 3PB6X 4OKOA 4UA3A 4ZYQA 4JJXA 4NEXA 2ODFA 3PB9X 5J1QA 1LFWA 4A32A 2PRQA 4GM5A 5ISVA 1Q2CA 2EUIA 3KI9A 4P4EA 3KGQA 5G21A 2GREA 2YNEA 3FBUA 2R98A 3IWEA 4Q36A 2EWBA 2PIZA 2Q44A 2Z3MA 3SXOA 3HLPA 1S7KA 1IYLA 2IL4A 3NH8A 4XNHB 4NJQA 4U9YA 5F47A 3W6SA 4GS4A 4HNXB 1TKFA 2PJ1A 2B5GA 2YNCC 3GUXA 2VL1A 4C2ZA 1GHEA 3D3SA 3PZJA 2ZEPA 4W9YA 2ABZA 5CPAA 2ZEMA 4MFJA 2CNTA 1JQGA 4KZTA 3DLJA 1XIXA 3VWDA 4AVAA 3S9LA 2ZEDA 4NSQA 1F2PA 2ZOGA 4MY3A 1BOBA 3S9MA 2VBQA 4ORFA 1AYEA 3IO1A 2YNCA 5EMIA 2BOAA 2HUZA 1YGHA 5G20A 2I3CA 1MJBA 3RBUA 5J8CA 1NSLA 1S3ZA 1VKCA 2CNSA 4M6GA 4X3RA 2NYQA 6CPAA 3CXSA 4NFRA 1EE3P 3SHPA 2QJ8A 1Q2YA 2PQ8A 3DGVA 5EC4A 2HQYA 2PJ5A 3SJXA 4F6AA 1NMTA 2GANA 4P45A 1YLOA 3BHXA 4OC4A 2OB0A 3K2KA 4RN7A 2DPTA 2C27A 3IU1A 3KL9A 3PRTA 4JLYA 4MCQA 4UCMA 4EMEA 4ZI6A 1Z8LA 2VEZA 3CXPA 2Q04A 2XEIA 2WPXA 1Z4EA 3TT2A 4UIAA 4DUKA 3LACA 3EXNA 2P6GA 3A9LA 3NA6A 4KUAA 4CAXA 3PFOA 4R7MA 1ELLP 3B7IA 3WT4A 4I49A 4UWJA 5JGFA 1CG2A 1P0HA 3TCVA 1IU8A 3LWUA 3R9EA 3EC4A 2PJ2A 4OIDA 3BI0A 4UFWA 3R95A 2EO8A 3IWGA 4U9ZA 2BUEA 3DSBA 4LQGA 1HDUA 2B4BA 4EWTA 2ZEEA 4Z65A 3T8WA 4NGSA 2DF5A 4CAEA 3SI2A 2JLMA 4PSWA 4MFQA 2C6CA 1LANA 2FIWA 2ZEGA 2AFMA 2GFQA 3KQZA 3CZXA 4NGRA 5ELYA 4A38A 4E2AA 2DXQA 1HEEA 1QSMA 1YVOA 2FIAA 5BWAB 5K8OA 3IEHA 4OC1A 4R3LA 1JWQA 2WUUA 4KOYA 3FH4A 3WABA 5LYFA 2JEVA 3P2HA 4P10A 3FRMA 4DJLA 4R57A 3EFAA 1Y9KA 2EVNA 4B12A 5I0CA 2HC9A 1QSOA 2ARHA 1XBUA 2FXFA 4KOSA 1VIXA 3IGRA 3FEEA 2J9AA 1TF9A 1FNOA 1YK3A 2ZW4A 1UFHA 4CAVA 5C88A 1IICA 3V38A 4L8AA 3DNSA 5IB0A 2Q4YA 4A33A 5GCNA 3B3VA 3I9SA 3TE4A 2Y0MA 3JRUA 4P4JA 1X12A 3IIBA 4LQ6A 1Q7LA 4MI4A 1XE4A 4WJBA 1BAVA 1S60A 4XPDB 5E96A 1YW6A 2AFWA 3JTKA 3B3TA 5H86A 1QMUA 2PVVA 3MGDA 4HPSA 4AB7A 4HNYB 4UFVA 4KLVA 3FEDA 2OR4A 4FD7A 1F2OA 4L89A 1YREA 4IK2A 4PXCA 5JH9A 2PDOA 1ELMP 4KOVA 4MBUA 4O23A 4UWIA 5DS0A 1LAPA 2ZPAA 5LRKA 4C2XA 3JUWA 4C2YA 1RXTA 1RTQA 3NE8A 1KUXA 1ZLIA 4A95A 4CAFA 3FECA 3IC1A 1LCPA 2XEJA 2BO9A 4KOTA 4OC3A 3TFYA 1X10A 2X7BA 2HV2A 2ZELA 3H8EA 1RO5A 1Y0RA 3DR8A 1KWMA 1LRZA 1CPSA 1Q2DA 4MHZA 3VH9A 2ATRA 4JZ0A 3CXQA 4OAEA 2AJ6A 4MCSA 2PVWA 4A31A 3WC6A 1ZG7A 4H6ZA 4C7IA 4YGOA 4CPAA 4A94A 1ZO0A 1IIDA 1Z2LA 1YLEA 4FD5A 2WSAA 3NH4A 1TXRA 4OADA 3D4UA 4FBEA 2A4NA 4NXYA 1XRYA 1CM0A 3ISZA 4ONUA 5AG7A 1H8LA 2ZXVA 2OZUA 1SQHA 2JEWA 3EY5A 3QB8A 3RAMA 2Q51A 4P6YA 4BINA 3QAHA 5IV0A 1VHEA 3FF3A 3W91A 1M4DA 2FT0A 4PK3A 4PPZA 4P44A 1CJWA 3R96A 5JQ4A 1F57A 5F48A 4CYPA 4EVYA 4F9UA 4JYWA 4YRHA 4F9VA 4FWUA 2P6FA 4R3KA 1OZPA 1Z4RA 2V77A 1UWYA 2EK8A 4PSXA 5A28A 1M4IA 5HXDA 2OZGA 4H89A 2AFZA 1CP7A 4Q38A 1QSTA 4OIWA 2BEIA 2C6GA 4Q7AA 3UY5A 3S6KA 1I12A 1QQ9A 2J8NA 3K9TA 3TO9A 4U5YA 4OMEA 3PGPA 3F8KA 2IMOA 2OH1A 1BPMA 4KOUA 1CBXA 2PR1A 4NGMA 4ZGYB 2KCWA 2CNMA 2O53A 1Y7RA 1S7LA 4NGTA 3GB0A 2C6PA 4G1PA 2B3VA 2FSRA 3W6XA 3TO6A 4A37A 2R1IA 3S6HA 4AVBA 2ZW7A 3FIXA 4H2KA 2F7VA 3H4QA 2Z3LA 2B4DB 3LODA 3B8GA 1DTDA 4B10A 2AFUA 2G3TA 5D8NA 3TOBA 1K4JA 5G1ZA 3F5BA 4KS9A 2P6EA 2G9DA 2PJ8A 4BD9A 1YW4A 1YR0A 3K9UA 3KHZA 4X2TA 4RUHA 1TKHA 1GYTA 3D2MA 2Z3KA 3FB3A 4R6TA 5HVFA 3T90A 3CT9A 4B5PA 2ZOFA 2PR8A 1I21A 3KR4A 4UIBA 1S7NA 1OBRA 1QSRA 4Y49C 4FD6A 1TKJA 1M4GA 5AG5A 4B5OA 1XEBA 3QAYA 1B87A 4F8ZA 2P0WA 2Z3OA 5DWMA 4OLLA 3DDDA 1VHSA 2AFSA 5KTAA 3FNCA 4MHDA 4P4FA 1PU9A 2D4OA 3SXNA 2PJ6A 3PB8X 4CGOA 1XF8A 2H5MA 4ZY2A 1Y9WA 3D66A 2NSMA 1ON0A 4MFLA 5KTCA 2J8RA 1WWZA 4BBHA 4FUUA 1S5KA 3V7ZA 4JXRA 5AGEA 2YGWA 3T9YA 2AFOA 1MK4A 4UCPA 1VHOA 4PK2A 5HH1A 4KVOE 1FT7A 3H5ZA 1NSAA 3G3SA 4K3NA 1PCAA 3DR6A 1TIQA 3GLJA 3NH5A 4IHMA 4A2ZA 4R9MA 2QECA 3S9NA 1PYTB 4A30A 3PBEA 3B35A 3GIUA 1BO4A 3PB7X 4MXUA 4P4BA 3SI1A 3R9FA 2F8HA 4QBJA 2XEFA 4CS0B 1XFOA 4XNHC 4XPLA 1Y7EA 2QIRA 1CPXA 3BI1A 2OU2A 4MMOA 1CP6A 4MRIA 3NFZA 4OC5A 4UEFA 3SJFA 4PXEA 2JDCA 4KSAA 3GYAA 3HUVA 4PQAA 3B2YA 1ZG9A 2CIJA 4KORA 4KSIA 4CYNA 2Q4ZA 2O4HA 2PIYA 4CGPA 3PBBA 4QUSA 4CRYB 4B14A 3TC8A 3B3SA 1ZG8A 4IUSA 4MHPA 4OP4A 3RO0A 4CGMA 4CGLA 2ZENA 5K8MA 2WPWA 2CXAA 5K8PA 1XJOA 4ZX8A 3GKRA 3VARA 3LMSA 4B13A 5K8NA 2ZEHA 2QVPA 2R8VA 5HVGA 4MHNA 3S6FA 4AG9A 4R8FA 5EBVA 4JXQA 4PV6A 4RS2A 2XEGA 1DE4C 1IOFA 2FL4A 3G8WA 3C26A 4ZBGA 3KASA 3WC7A 4CAWA 2Z3PA 2WZNA 2V8DA 4CYQA 4DYOA 4YFJA 1BPNA 5F49A 1KZFA 2I00A 3TOAA 5CNPA 3WC5A 2Z0ZA 3FX6A 4NCZA 2CTBA 1PUAA 2AFXA 4AG7A 2BL1A 2QYVA 1IB1E 5CBMA 1B6BA 4FD4A 3IWWA 4B11A
chains in the Genus database with same CATH topology
4KUBA 2VXKA 4HKFA 4MY0A 2VZZA 3JVNA 5G22A 5C82A 4M85A 4KOXA 1R57A 4QB9A 1U6MA 3S6GA 2B4DA 2GE3A 2GIVA 2VZYA 1S7FA 2REFA 5AG6A 2Q0YA 1N71A 4E0AA 1V0CA 2QMLA 1M1DA 2DPSA 4F0XA 5DWNA 1I1DA 4KSFA 4MFKA 1MJ9A 1FY7A 5KTDA 3P2FA 3BJ7A 4IF5A 2FCKA 3PP9A 1IYKA 4KVXA 1L0CA 1MJAA 4CYOA 2I79A 1J4JA 2R7HA 2ZW6A 3V8IA 4K30A 4MFZA 3R9GA 2YNDA 4XPDC 2Q7BA 1P4NA 4UBRA 3LD2A 3NE7A 3FYNA 3ZZIA 4KVME 5J8FA 3I3GA 1M44A 1XMTA 2B5GB 2K5TA 2Z10A 4HNWB 1WK4A 4KLWA 5IX3A 3VWEA 4CRZB 4II9A 3N7ZA 4F0YA 3BLNA 5AG4A 3TO7A 3FXTA 1NE9A 4CGNA 2CY2A 3RYOA 2F5IA 2VI7A 2Z11A 3R1KA 1KUYA 3WR7A 4QVTA 4DNCA 3ZJ0A 2RC4A 5H84A 2REEA 4LX9A 4R87A 4MJ8A 5A27A 2Q4VA 4AVCA 2VQYA 4NF1A 4UCNA 5FVJA 2O28A 4H6UA 2ZW5A 4QC6A 1QSNA 4UFXA 2B58A 3E0KA 3D2PA 2G0BA 2JDDA 4JD6A 3F0AA 2Z3NA 4LUAA 3IU2A 2FE7A 2PSWA 4B5PB 4XPKA 4C7HA 4KOWA 4J3GA 5F46A 5JPHA 3GY9A 3BJ8A 1Z9UA 3EO4A 3D8PA 2B3UA 2BSWA 2FS5A 4Y49B 4M3SA 1KUVA 2D4PA 4MFPA 4RI1A 4E8OA 2PRBA 4C68A 4X5KA 1YVKA 2J8MA 2G3AA 3TTHA 1YX0A 3OWCA 2NMTA 2PC1A 4JWPA 2AE6A 5HMNA 4BMHA 3KKWA 2OZHA 4UA3A 4JJXA 4NEXA 4A32A 5ISVA 1Q2CA 2EUIA 5G21A 2YNEA 3FBUA 2R98A 3IWEA 4Q36A 2Z3MA 3SXOA 2Q44A 1S7KA 1IYLA 2IL4A 4XNHB 4U9YA 5F47A 3W6SA 4GS4A 4HNXB 2B5GA 2YNCC 4C2ZA 1GHEA 3D3SA 3PZJA 4MFJA 2CNTA 4KZTA 1XIXA 3VWDA 4AVAA 4NSQA 4MY3A 1BOBA 2VBQA 4ORFA 2YNCA 2HUZA 1YGHA 5G20A 1MJBA 5J8CA 1NSLA 1S3ZA 1VKCA 2CNSA 3CXSA 3SHPA 1Q2YA 2PQ8A 5EC4A 2HQYA 4F6AA 1NMTA 2GANA 2OB0A 2DPTA 2C27A 3IU1A 4JLYA 4UCMA 2VEZA 3CXPA 2Q04A 2WPXA 1Z4EA 3TT2A 3EXNA 2P6GA 3A9LA 4KUAA 4CAXA 4I49A 4UWJA 1P0HA 3TCVA 3R9EA 3EC4A 4UFWA 3R95A 3IWGA 4U9ZA 2BUEA 3DSBA 2B4BA 4CAEA 2JLMA 4PSWA 4MFQA 2FIWA 4E2AA 2DXQA 1QSMA 1YVOA 2FIAA 5BWAB 4R3LA 2WUUA 4KOYA 2JEVA 3P2HA 3FRMA 4R57A 3EFAA 1Y9KA 2EVNA 4B12A 5I0CA 1QSOA 2ARHA 2FXFA 4KOSA 3IGRA 1YK3A 2ZW4A 1UFHA 4CAVA 5C88A 1IICA 4L8AA 3DNSA 5IB0A 2Q4YA 4A33A 5GCNA 3TE4A 3I9SA 2Y0MA 4MI4A 1XE4A 1S60A 4XPDB 5E96A 3JTKA 5H86A 3MGDA 4AB7A 4HNYB 4UFVA 4KLVA 4FD7A 4L89A 1YREA 2PDOA 4KOVA 4MBUA 4UWIA 2ZPAA 4C2XA 3JUWA 4C2YA 1RXTA 4A95A 1KUXA 4CAFA 4KOTA 3TFYA 2X7BA 2HV2A 1RO5A 3DR8A 1LRZA 1Q2DA 2ATRA 3CXQA 4OAEA 2AJ6A 4A31A 4H6ZA 4C7IA 4YGOA 1ZO0A 1IIDA 1YLEA 4FD5A 2WSAA 4OADA 2A4NA 4NXYA 1CM0A 4ONUA 5AG7A 2ZXVA 2OZUA 1SQHA 3EY5A 3QB8A 3QAHA 5IV0A 3W91A 1M4DA 2FT0A 4PK3A 1CJWA 3R96A 5JQ4A 4CYPA 5F48A 4EVYA 4YRHA 2P6FA 4R3KA 1OZPA 1Z4RA 4PSXA 5A28A 1M4IA 2OZGA 4H89A 4Q38A 1QSTA 2BEIA 3UY5A 3S6KA 1I12A 3TO9A 2J8NA 4U5YA 3PGPA 3F8KA 2OH1A 4KOUA 4ZGYB 2PR1A 2KCWA 2CNMA 1Y7RA 1S7LA 2B3VA 2FSRA 3W6XA 3TO6A 2R1IA 3S6HA 4AVBA 2ZW7A 3FIXA 3H4QA 2Z3LA 2B4DB 3LODA 3B8GA 4B10A 2G3TA 3TOBA 1K4JA 5G1ZA 3F5BA 4KS9A 2P6EA 1YR0A 3K9UA 3D2MA 2Z3KA 3FB3A 3T90A 4B5PA 2PR8A 1I21A 1S7NA 1QSRA 4Y49C 4FD6A 1M4GA 5AG5A 4B5OA 1XEBA 1B87A 2P0WA 2Z3OA 5DWMA 4OLLA 3DDDA 1VHSA 5KTAA 3FNCA 4MHDA 1PU9A 2D4OA 3SXNA 4CGOA 1XF8A 2H5MA 1Y9WA 1ON0A 4MFLA 5KTCA 2J8RA 1WWZA 4BBHA 1S5KA 4JXRA 5AGEA 2YGWA 3T9YA 1MK4A 4UCPA 4PK2A 5HH1A 4KVOE 3H5ZA 3G3SA 3DR6A 1TIQA 4A2ZA 4R9MA 2QECA 4A30A 1BO4A 3R9FA 4QBJA 4CS0B 4XNHC 4XPLA 2QIRA 2OU2A 2JDCA 4KSAA 3GYAA 4KORA 4CYNA 4CGPA 4QUSA 4CRYB 4B14A 4IUSA 4CGLA 4CGMA 2WPWA 2CXAA 3GKRA 4B13A 2R8VA 3S6FA 4AG9A 5EBVA 4JXQA 4PV6A 4RS2A 2FL4A 3G8WA 3C26A 4ZBGA 4CAWA 2Z3PA 4CYQA 4YFJA 5F49A 1KZFA 2I00A 3TOAA 5CNPA 2Z0ZA 4NCZA 1PUAA 4AG7A 2BL1A 1IB1E 1B6BA 4FD4A 4B11A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5A27 A;  4A33 A;  3IU1 A;  4CGL A;  4UCM A;  2YNC C;  5AG5 A;  4UCN A;  4A2Z A;  4C2Z A;  4CGM A;  5G22 A;  4A30 A;  4B13 A;  4CYP A;  4UFX A;  2WUU A;  3JTK A;  4B10 A;  5AG4 A;  5G1Z A;  4A32 A;  4A31 A;  4CGO A;  2YNC A;  5A28 A;  4UFV A;  5G21 A;  4B12 A;  4CGN A;  4C68 A;  5G20 A;  2YNE A;  4C7I A;  4BBH A;  4UFW A;  4CYO A;  3IWE A;  4CYQ A;  3IU2 A;  2WSA A;  5AG6 A;  5AGE A;  4C2X A;  4CYN A;  4C7H A;  4UCP A;  2YND A;  5AG7 A;  4C2Y A;  4CAE A;  4CGP A;  4A95 A;  4CAF A;  4B14 A;  3H5Z A;  4B11 A; 
#chains in the Genus database with same CATH topology
 2IQ6 A;  3MN8 A;  5I4M A;  4KUB A;  4MCP A;  1AMP A;  2VXK A;  4HKF A;  4ONW A;  4MY0 A;  4X8I A;  2VZZ A;  3JVN A;  5G22 A;  5C82 A;  4M85 A;  4KOX A;  1R57 A;  4QB9 A;  1U6M A;  3S6G A;  2B4D A;  2GE3 A;  1TF8 A;  2ZEF A;  4TNU A;  1A2Z A;  2PCU A;  2GIV A;  2VZY A;  3CPX A;  3KR5 A;  1S7F A;  1YME A;  2REF A;  3SJE A;  2ZEO A;  4OC2 A;  4NGP A;  2C1C A;  5AG6 A;  2Q0Y A;  3VAT A;  4ZY1 A;  2V8H A;  3RZA A;  1N71 A;  4E0A A;  1V0C A;  2QML A;  3D7F A;  1M1D A;  4FAI A;  4M6H A;  4PXD A;  3D68 A;  2DPS A;  4F0X A;  5DWN A;  4UEE A;  1LAM A;  2POK A;  4GXH A;  7CPA A;  1I1D A;  1YQE A;  4KSF A;  4MFK A;  1MJ9 A;  3FJU A;  1R43 A;  1FY7 A;  5F09 A;  4UEZ A;  5KTD A;  3H8G A;  4EFD A;  3P2F A;  3BJ7 A;  4IF5 A;  5HVH A;  4UF4 A;  2FCK A;  1IOI A;  3PP9 A;  2Q7S A;  2PJ9 A;  4P4I A;  1VGY A;  2PJB A;  1IYK A;  1HDQ A;  4KVX A;  3KZW A;  1L0C A;  2PJ7 A;  4M6I A;  1MJA A;  4CYO A;  2V8G A;  2I79 A;  1J4J A;  2R7H A;  4IAV A;  2ZW6 A;  5LRG A;  3V8I A;  3FVL A;  4K30 A;  1M4L A;  4MFZ A;  4MHY A;  3R9G A;  2YND A;  4XPD C;  2Q7B A;  1P4N A;  4UBR A;  2BCO A;  3LD2 A;  3NE7 A;  2WYR A;  4PXB A;  3FYN A;  3ZZI A;  4KVM E;  5J8F A;  3I3G A;  1M44 A;  1XMT A;  2B5G B;  2K5T A;  2Z10 A;  1ZLH A;  1R3N A;  4HNW B;  3IJ3 A;  2EK9 A;  4AXV A;  1WK4 A;  4KLW A;  5IX3 A;  3VWE A;  4CRZ B;  4II9 A;  3N7Z A;  4F0Y A;  3FMC A;  3BLN A;  2GU2 A;  3RNZ A;  5AG4 A;  3TO7 A;  3FXT A;  2OOT A;  1NE9 A;  4CGN A;  2CY2 A;  3D67 A;  3RYO A;  5LYD A;  3H8F A;  2F5I A;  2VI7 A;  2Z11 A;  2PJA A;  3R1K A;  1Z8W A;  2Q43 A;  4OC0 A;  1XOV A;  2GLJ A;  1KUY A;  3WR7 A;  4QVT A;  4DNC A;  3ZJ0 A;  2RC4 A;  1AUG A;  3PEI A;  5H84 A;  2REE A;  3TX8 A;  4LX9 A;  4R87 A;  1IGB A;  2GLF A;  1YSJ A;  4MJ8 A;  4YWY A;  5A27 A;  2Q4V A;  4AVC A;  2VQY A;  4NF1 A;  1Z5R A;  4UCN A;  8CPA A;  3BXM A;  2PE3 A;  5FVJ A;  2O28 A;  1CX8 A;  4H6U A;  2ZW5 A;  3KHX A;  4QC6 A;  1QSN A;  4UFX A;  4YU9 A;  3B3C A;  2CTC A;  3D7G A;  2B58 A;  3E0K A;  5LRJ A;  2FVG A;  3D2P A;  4NJR A;  2G0B A;  2JDD A;  4JD6 A;  3F0A A;  2Z3N A;  3N5F A;  2CF4 A;  4LUA A;  3CDX A;  4MCR A;  1Z8T A;  2FE7 A;  2PJ3 A;  2PSW A;  3IU2 A;  4ZX9 A;  4TWE A;  4B5P B;  1LOK A;  4P4D A;  4XPK A;  5JM6 A;  4C7H A;  4NGQ A;  4KOW A;  4NGN A;  4A39 A;  4J3G A;  5F46 A;  5JPH A;  3GY9 A;  1BLL E;  2JBJ A;  4B6Z A;  3BJ8 A;  1Z9U A;  3EO4 A;  3QNV A;  3D8P A;  2HB6 A;  2B3U A;  5THW A;  3MRU A;  5IB9 A;  2BSW A;  2FS5 A;  2RB7 A;  4Y49 B;  4ZY0 A;  2PJ0 A;  1Z8X A;  4M3S A;  3L2N A;  1KUV A;  5D29 A;  2D4P A;  2PJ4 A;  3PFE A;  4MFP A;  5LYL A;  3D7H A;  4RI1 A;  4E8O A;  2PJC A;  2IJZ A;  2PRB A;  4R76 A;  1YVK A;  2J8M A;  4X5K A;  4C68 A;  2G3A A;  2RFH A;  3TTH A;  3SI0 A;  3I1U A;  5LYI A;  3D7D A;  1ARM A;  3IFE A;  1YX0 A;  2DEA A;  3OWC A;  1XMB A;  2NMT A;  2PC1 A;  3ISX A;  2EBJ A;  4JWP A;  3PB4 X;  2ANP A;  2AE6 A;  3B3W A;  1Y0Y A;  2JBK A;  3SJG A;  5HMN A;  1IY7 A;  2V8V A;  4BMH A;  4WWV A;  3KQX A;  3KKW A;  3CPA A;  2OZH A;  1ARL A;  3PB6 X;  4OKO A;  4UA3 A;  4ZYQ A;  4JJX A;  4NEX A;  2ODF A;  3PB9 X;  5J1Q A;  1LFW A;  4A32 A;  2PRQ A;  4GM5 A;  5ISV A;  1Q2C A;  2EUI A;  3KI9 A;  4P4E A;  3KGQ A;  5G21 A;  2GRE A;  2YNE A;  3FBU A;  2R98 A;  3IWE A;  4Q36 A;  2EWB A;  2PIZ A;  2Q44 A;  2Z3M A;  3SXO A;  3HLP A;  1S7K A;  1IYL A;  2IL4 A;  3NH8 A;  4XNH B;  4NJQ A;  4U9Y A;  5F47 A;  3W6S A;  4GS4 A;  4HNX B;  1TKF A;  2PJ1 A;  2B5G A;  2YNC C;  3GUX A;  2VL1 A;  4C2Z A;  1GHE A;  3D3S A;  3PZJ A;  2ZEP A;  4W9Y A;  2ABZ A;  5CPA A;  2ZEM A;  4MFJ A;  2CNT A;  1JQG A;  4KZT A;  3DLJ A;  1XIX A;  3VWD A;  4AVA A;  3S9L A;  2ZED A;  4NSQ A;  1F2P A;  2ZOG A;  4MY3 A;  1BOB A;  3S9M A;  2VBQ A;  4ORF A;  1AYE A;  3IO1 A;  2YNC A;  5EMI A;  2BOA A;  2HUZ A;  1YGH A;  5G20 A;  2I3C A;  1MJB A;  3RBU A;  5J8C A;  1NSL A;  1S3Z A;  1VKC A;  2CNS A;  4M6G A;  4X3R A;  2NYQ A;  6CPA A;  3CXS A;  4NFR A;  1EE3 P;  3SHP A;  2QJ8 A;  1Q2Y A;  2PQ8 A;  3DGV A;  5EC4 A;  2HQY A;  2PJ5 A;  3SJX A;  4F6A A;  1NMT A;  2GAN A;  4P45 A;  1YLO A;  3BHX A;  4OC4 A;  2OB0 A;  3K2K A;  4RN7 A;  2DPT A;  2C27 A;  3IU1 A;  3KL9 A;  3PRT A;  4JLY A;  4MCQ A;  4UCM A;  4EME A;  4ZI6 A;  1Z8L A;  2VEZ A;  3CXP A;  2Q04 A;  2XEI A;  2WPX A;  1Z4E A;  3TT2 A;  4UIA A;  4DUK A;  3LAC A;  3EXN A;  2P6G A;  3A9L A;  3NA6 A;  4KUA A;  4CAX A;  3PFO A;  4R7M A;  1ELL P;  3B7I A;  3WT4 A;  4I49 A;  4UWJ A;  5JGF A;  1CG2 A;  1P0H A;  3TCV A;  1IU8 A;  3LWU A;  3R9E A;  3EC4 A;  2PJ2 A;  4OID A;  3BI0 A;  4UFW A;  3R95 A;  2EO8 A;  3IWG A;  4U9Z A;  2BUE A;  3DSB A;  4LQG A;  1HDU A;  2B4B A;  4EWT A;  2ZEE A;  4Z65 A;  3T8W A;  4NGS A;  2DF5 A;  4CAE A;  3SI2 A;  2JLM A;  4PSW A;  4MFQ A;  2C6C A;  1LAN A;  2FIW A;  2ZEG A;  2AFM A;  2GFQ A;  3KQZ A;  3CZX A;  4NGR A;  5ELY A;  4A38 A;  4E2A A;  2DXQ A;  1HEE A;  1QSM A;  1YVO A;  2FIA A;  5BWA B;  5K8O A;  3IEH A;  4OC1 A;  4R3L A;  1JWQ A;  2WUU A;  4KOY A;  3FH4 A;  3WAB A;  5LYF A;  2JEV A;  3P2H A;  4P10 A;  3FRM A;  4DJL A;  4R57 A;  3EFA A;  1Y9K A;  2EVN A;  4B12 A;  5I0C A;  2HC9 A;  1QSO A;  2ARH A;  1XBU A;  2FXF A;  4KOS A;  1VIX A;  3IGR A;  3FEE A;  2J9A A;  1TF9 A;  1FNO A;  1YK3 A;  2ZW4 A;  1UFH A;  4CAV A;  5C88 A;  1IIC A;  3V38 A;  4L8A A;  3DNS A;  5IB0 A;  2Q4Y A;  4A33 A;  5GCN A;  3B3V A;  3I9S A;  3TE4 A;  2Y0M A;  3JRU A;  4P4J A;  1X12 A;  3IIB A;  4LQ6 A;  1Q7L A;  4MI4 A;  1XE4 A;  4WJB A;  1BAV A;  1S60 A;  4XPD B;  5E96 A;  1YW6 A;  2AFW A;  3JTK A;  3B3T A;  5H86 A;  1QMU A;  2PVV A;  3MGD A;  4HPS A;  4AB7 A;  4HNY B;  4UFV A;  4KLV A;  3FED A;  2OR4 A;  4FD7 A;  1F2O A;  4L89 A;  1YRE A;  4IK2 A;  4PXC A;  5JH9 A;  2PDO A;  1ELM P;  4KOV A;  4MBU A;  4O23 A;  4UWI A;  5DS0 A;  1LAP A;  2ZPA A;  5LRK A;  4C2X A;  3JUW A;  4C2Y A;  1RXT A;  1RTQ A;  3NE8 A;  1KUX A;  1ZLI A;  4A95 A;  4CAF A;  3FEC A;  3IC1 A;  1LCP A;  2XEJ A;  2BO9 A;  4KOT A;  4OC3 A;  3TFY A;  1X10 A;  2X7B A;  2HV2 A;  2ZEL A;  3H8E A;  1RO5 A;  1Y0R A;  3DR8 A;  1KWM A;  1LRZ A;  1CPS A;  1Q2D A;  4MHZ A;  3VH9 A;  2ATR A;  4JZ0 A;  3CXQ A;  4OAE A;  2AJ6 A;  4MCS A;  2PVW A;  4A31 A;  3WC6 A;  1ZG7 A;  4H6Z A;  4C7I A;  4YGO A;  4CPA A;  4A94 A;  1ZO0 A;  1IID A;  1Z2L A;  1YLE A;  4FD5 A;  2WSA A;  3NH4 A;  1TXR A;  4OAD A;  3D4U A;  4FBE A;  2A4N A;  4NXY A;  1XRY A;  1CM0 A;  3ISZ A;  4ONU A;  5AG7 A;  1H8L A;  2ZXV A;  2OZU A;  1SQH A;  2JEW A;  3EY5 A;  3QB8 A;  3RAM A;  2Q51 A;  4P6Y A;  4BIN A;  3QAH A;  5IV0 A;  1VHE A;  3FF3 A;  3W91 A;  1M4D A;  2FT0 A;  4PK3 A;  4PPZ A;  4P44 A;  1CJW A;  3R96 A;  5JQ4 A;  1F57 A;  5F48 A;  4CYP A;  4EVY A;  4F9U A;  4JYW A;  4YRH A;  4F9V A;  4FWU A;  2P6F A;  4R3K A;  1OZP A;  1Z4R A;  2V77 A;  1UWY A;  2EK8 A;  4PSX A;  5A28 A;  1M4I A;  5HXD A;  2OZG A;  4H89 A;  2AFZ A;  1CP7 A;  4Q38 A;  1QST A;  4OIW A;  2BEI A;  2C6G A;  4Q7A A;  3UY5 A;  3S6K A;  1I12 A;  1QQ9 A;  2J8N A;  3K9T A;  3TO9 A;  4U5Y A;  4OME A;  3PGP A;  3F8K A;  2IMO A;  2OH1 A;  1BPM A;  4KOU A;  1CBX A;  2PR1 A;  4NGM A;  4ZGY B;  2KCW A;  2CNM A;  2O53 A;  1Y7R A;  1S7L A;  4NGT A;  3GB0 A;  2C6P A;  4G1P A;  2B3V A;  2FSR A;  3W6X A;  3TO6 A;  4A37 A;  2R1I A;  3S6H A;  4AVB A;  2ZW7 A;  3FIX A;  4H2K A;  2F7V A;  3H4Q A;  2Z3L A;  2B4D B;  3LOD A;  3B8G A;  1DTD A;  4B10 A;  2AFU A;  2G3T A;  5D8N A;  3TOB A;  1K4J A;  5G1Z A;  3F5B A;  4KS9 A;  2P6E A;  2G9D A;  2PJ8 A;  4BD9 A;  1YW4 A;  1YR0 A;  3K9U A;  3KHZ A;  4X2T A;  4RUH A;  1TKH A;  1GYT A;  3D2M A;  2Z3K A;  3FB3 A;  4R6T A;  5HVF A;  3T90 A;  3CT9 A;  4B5P A;  2ZOF A;  2PR8 A;  1I21 A;  3KR4 A;  4UIB A;  1S7N A;  1OBR A;  1QSR A;  4Y49 C;  4FD6 A;  1TKJ A;  1M4G A;  5AG5 A;  4B5O A;  1XEB A;  3QAY A;  1B87 A;  4F8Z A;  2P0W A;  2Z3O A;  5DWM A;  4OLL A;  3DDD A;  1VHS A;  2AFS A;  5KTA A;  3FNC A;  4MHD A;  4P4F A;  1PU9 A;  2D4O A;  3SXN A;  2PJ6 A;  3PB8 X;  4CGO A;  1XF8 A;  2H5M A;  4ZY2 A;  1Y9W A;  3D66 A;  2NSM A;  1ON0 A;  4MFL A;  5KTC A;  2J8R A;  1WWZ A;  4BBH A;  4FUU A;  1S5K A;  3V7Z A;  4JXR A;  5AGE A;  2YGW A;  3T9Y A;  2AFO A;  1MK4 A;  4UCP A;  1VHO A;  4PK2 A;  5HH1 A;  4KVO E;  1FT7 A;  3H5Z A;  1NSA A;  3G3S A;  4K3N A;  1PCA A;  3DR6 A;  1TIQ A;  3GLJ A;  3NH5 A;  4IHM A;  4A2Z A;  4R9M A;  2QEC A;  3S9N A;  1PYT B;  4A30 A;  3PBE A;  3B35 A;  3GIU A;  1BO4 A;  3PB7 X;  4MXU A;  4P4B A;  3SI1 A;  3R9F A;  2F8H A;  4QBJ A;  2XEF A;  4CS0 B;  1XFO A;  4XNH C;  4XPL A;  1Y7E A;  2QIR A;  1CPX A;  3BI1 A;  2OU2 A;  4MMO A;  1CP6 A;  4MRI A;  3NFZ A;  4OC5 A;  4UEF A;  3SJF A;  4PXE A;  2JDC A;  4KSA A;  3GYA A;  3HUV A;  4PQA A;  3B2Y A;  1ZG9 A;  2CIJ A;  4KOR A;  4KSI A;  4CYN A;  2Q4Z A;  2O4H A;  2PIY A;  4CGP A;  3PBB A;  4QUS A;  4CRY B;  4B14 A;  3TC8 A;  3B3S A;  1ZG8 A;  4IUS A;  4MHP A;  4OP4 A;  3RO0 A;  4CGM A;  4CGL A;  2ZEN A;  5K8M A;  2WPW A;  2CXA A;  5K8P A;  1XJO A;  4ZX8 A;  3GKR A;  3VAR A;  3LMS A;  4B13 A;  5K8N A;  2ZEH A;  2QVP A;  2R8V A;  5HVG A;  4MHN A;  3S6F A;  4AG9 A;  4R8F A;  5EBV A;  4JXQ A;  4PV6 A;  4RS2 A;  2XEG A;  1DE4 C;  1IOF A;  2FL4 A;  3G8W A;  3C26 A;  4ZBG A;  3KAS A;  3WC7 A;  4CAW A;  2Z3P A;  2WZN A;  2V8D A;  4CYQ A;  4DYO A;  4YFJ A;  1BPN A;  5F49 A;  1KZF A;  2I00 A;  3TOA A;  5CNP A;  3WC5 A;  2Z0Z A;  3FX6 A;  4NCZ A;  2CTB A;  1PUA A;  2AFX A;  4AG7 A;  2BL1 A;  2QYV A;  1IB1 E;  5CBM A;  1B6B A;  4FD4 A;  3IWW A;  4B11 A; 
#chains in the Genus database with same CATH homology
 4KUB A;  2VXK A;  4HKF A;  4MY0 A;  2VZZ A;  3JVN A;  5G22 A;  5C82 A;  4M85 A;  4KOX A;  1R57 A;  4QB9 A;  1U6M A;  3S6G A;  2B4D A;  2GE3 A;  2GIV A;  2VZY A;  1S7F A;  2REF A;  5AG6 A;  2Q0Y A;  1N71 A;  4E0A A;  1V0C A;  2QML A;  1M1D A;  2DPS A;  4F0X A;  5DWN A;  1I1D A;  4KSF A;  4MFK A;  1MJ9 A;  1FY7 A;  5KTD A;  3P2F A;  3BJ7 A;  4IF5 A;  2FCK A;  3PP9 A;  1IYK A;  4KVX A;  1L0C A;  1MJA A;  4CYO A;  2I79 A;  1J4J A;  2R7H A;  2ZW6 A;  3V8I A;  4K30 A;  4MFZ A;  3R9G A;  2YND A;  4XPD C;  2Q7B A;  1P4N A;  4UBR A;  3LD2 A;  3NE7 A;  3FYN A;  3ZZI A;  4KVM E;  5J8F A;  3I3G A;  1M44 A;  1XMT A;  2B5G B;  2K5T A;  2Z10 A;  4HNW B;  1WK4 A;  4KLW A;  5IX3 A;  3VWE A;  4CRZ B;  4II9 A;  3N7Z A;  4F0Y A;  3BLN A;  5AG4 A;  3TO7 A;  3FXT A;  1NE9 A;  4CGN A;  2CY2 A;  3RYO A;  2F5I A;  2VI7 A;  2Z11 A;  3R1K A;  1KUY A;  3WR7 A;  4QVT A;  4DNC A;  3ZJ0 A;  2RC4 A;  5H84 A;  2REE A;  4LX9 A;  4R87 A;  4MJ8 A;  5A27 A;  2Q4V A;  4AVC A;  2VQY A;  4NF1 A;  4UCN A;  5FVJ A;  2O28 A;  4H6U A;  2ZW5 A;  4QC6 A;  1QSN A;  4UFX A;  2B58 A;  3E0K A;  3D2P A;  2G0B A;  2JDD A;  4JD6 A;  3F0A A;  2Z3N A;  4LUA A;  3IU2 A;  2FE7 A;  2PSW A;  4B5P B;  4XPK A;  4C7H A;  4KOW A;  4J3G A;  5F46 A;  5JPH A;  3GY9 A;  3BJ8 A;  1Z9U A;  3EO4 A;  3D8P A;  2B3U A;  2BSW A;  2FS5 A;  4Y49 B;  4M3S A;  1KUV A;  2D4P A;  4MFP A;  4RI1 A;  4E8O A;  2PRB A;  4C68 A;  4X5K A;  1YVK A;  2J8M A;  2G3A A;  3TTH A;  1YX0 A;  3OWC A;  2NMT A;  2PC1 A;  4JWP A;  2AE6 A;  5HMN A;  4BMH A;  3KKW A;  2OZH A;  4UA3 A;  4JJX A;  4NEX A;  4A32 A;  5ISV A;  1Q2C A;  2EUI A;  5G21 A;  2YNE A;  3FBU A;  2R98 A;  3IWE A;  4Q36 A;  2Z3M A;  3SXO A;  2Q44 A;  1S7K A;  1IYL A;  2IL4 A;  4XNH B;  4U9Y A;  5F47 A;  3W6S A;  4GS4 A;  4HNX B;  2B5G A;  2YNC C;  4C2Z A;  1GHE A;  3D3S A;  3PZJ A;  4MFJ A;  2CNT A;  4KZT A;  1XIX A;  3VWD A;  4AVA A;  4NSQ A;  4MY3 A;  1BOB A;  2VBQ A;  4ORF A;  2YNC A;  2HUZ A;  1YGH A;  5G20 A;  1MJB A;  5J8C A;  1NSL A;  1S3Z A;  1VKC A;  2CNS A;  3CXS A;  3SHP A;  1Q2Y A;  2PQ8 A;  5EC4 A;  2HQY A;  4F6A A;  1NMT A;  2GAN A;  2OB0 A;  2DPT A;  2C27 A;  3IU1 A;  4JLY A;  4UCM A;  2VEZ A;  3CXP A;  2Q04 A;  2WPX A;  1Z4E A;  3TT2 A;  3EXN A;  2P6G A;  3A9L A;  4KUA A;  4CAX A;  4I49 A;  4UWJ A;  1P0H A;  3TCV A;  3R9E A;  3EC4 A;  4UFW A;  3R95 A;  3IWG A;  4U9Z A;  2BUE A;  3DSB A;  2B4B A;  4CAE A;  2JLM A;  4PSW A;  4MFQ A;  2FIW A;  4E2A A;  2DXQ A;  1QSM A;  1YVO A;  2FIA A;  5BWA B;  4R3L A;  2WUU A;  4KOY A;  2JEV A;  3P2H A;  3FRM A;  4R57 A;  3EFA A;  1Y9K A;  2EVN A;  4B12 A;  5I0C A;  1QSO A;  2ARH A;  2FXF A;  4KOS A;  3IGR A;  1YK3 A;  2ZW4 A;  1UFH A;  4CAV A;  5C88 A;  1IIC A;  4L8A A;  3DNS A;  5IB0 A;  2Q4Y A;  4A33 A;  5GCN A;  3TE4 A;  3I9S A;  2Y0M A;  4MI4 A;  1XE4 A;  1S60 A;  4XPD B;  5E96 A;  3JTK A;  5H86 A;  3MGD A;  4AB7 A;  4HNY B;  4UFV A;  4KLV A;  4FD7 A;  4L89 A;  1YRE A;  2PDO A;  4KOV A;  4MBU A;  4UWI A;  2ZPA A;  4C2X A;  3JUW A;  4C2Y A;  1RXT A;  4A95 A;  1KUX A;  4CAF A;  4KOT A;  3TFY A;  2X7B A;  2HV2 A;  1RO5 A;  3DR8 A;  1LRZ A;  1Q2D A;  2ATR A;  3CXQ A;  4OAE A;  2AJ6 A;  4A31 A;  4H6Z A;  4C7I A;  4YGO A;  1ZO0 A;  1IID A;  1YLE A;  4FD5 A;  2WSA A;  4OAD A;  2A4N A;  4NXY A;  1CM0 A;  4ONU A;  5AG7 A;  2ZXV A;  2OZU A;  1SQH A;  3EY5 A;  3QB8 A;  3QAH A;  5IV0 A;  3W91 A;  1M4D A;  2FT0 A;  4PK3 A;  1CJW A;  3R96 A;  5JQ4 A;  4CYP A;  5F48 A;  4EVY A;  4YRH A;  2P6F A;  4R3K A;  1OZP A;  1Z4R A;  4PSX A;  5A28 A;  1M4I A;  2OZG A;  4H89 A;  4Q38 A;  1QST A;  2BEI A;  3UY5 A;  3S6K A;  1I12 A;  3TO9 A;  2J8N A;  4U5Y A;  3PGP A;  3F8K A;  2OH1 A;  4KOU A;  4ZGY B;  2PR1 A;  2KCW A;  2CNM A;  1Y7R A;  1S7L A;  2B3V A;  2FSR A;  3W6X A;  3TO6 A;  2R1I A;  3S6H A;  4AVB A;  2ZW7 A;  3FIX A;  3H4Q A;  2Z3L A;  2B4D B;  3LOD A;  3B8G A;  4B10 A;  2G3T A;  3TOB A;  1K4J A;  5G1Z A;  3F5B A;  4KS9 A;  2P6E A;  1YR0 A;  3K9U A;  3D2M A;  2Z3K A;  3FB3 A;  3T90 A;  4B5P A;  2PR8 A;  1I21 A;  1S7N A;  1QSR A;  4Y49 C;  4FD6 A;  1M4G A;  5AG5 A;  4B5O A;  1XEB A;  1B87 A;  2P0W A;  2Z3O A;  5DWM A;  4OLL A;  3DDD A;  1VHS A;  5KTA A;  3FNC A;  4MHD A;  1PU9 A;  2D4O A;  3SXN A;  4CGO A;  1XF8 A;  2H5M A;  1Y9W A;  1ON0 A;  4MFL A;  5KTC A;  2J8R A;  1WWZ A;  4BBH A;  1S5K A;  4JXR A;  5AGE A;  2YGW A;  3T9Y A;  1MK4 A;  4UCP A;  4PK2 A;  5HH1 A;  4KVO E;  3H5Z A;  3G3S A;  3DR6 A;  1TIQ A;  4A2Z A;  4R9M A;  2QEC A;  4A30 A;  1BO4 A;  3R9F A;  4QBJ A;  4CS0 B;  4XNH C;  4XPL A;  2QIR A;  2OU2 A;  2JDC A;  4KSA A;  3GYA A;  4KOR A;  4CYN A;  4CGP A;  4QUS A;  4CRY B;  4B14 A;  4IUS A;  4CGL A;  4CGM A;  2WPW A;  2CXA A;  3GKR A;  4B13 A;  2R8V A;  3S6F A;  4AG9 A;  5EBV A;  4JXQ A;  4PV6 A;  4RS2 A;  2FL4 A;  3G8W A;  3C26 A;  4ZBG A;  4CAW A;  2Z3P A;  4CYQ A;  4YFJ A;  5F49 A;  1KZF A;  2I00 A;  3TOA A;  5CNP A;  2Z0Z A;  4NCZ A;  1PUA A;  4AG7 A;  2BL1 A;  1IB1 E;  1B6B A;  4FD4 A;  4B11 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...