4UCPA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
b'AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucpA00
4B12A 4A95A 4C2XA 4CAFA 4CGMA 5AGEA 4UCMA 4C68A 4UFXA 4A2ZA 2YNCA 4CYOA 4UCPA 3IU1A 5AG6A 4C2YA 5G22A 2WSAA 4CYNA 3IWEA 3IU2A 4CAEA 5G1ZA 4B13A 4BBHA 4A31A 3JTKA 4A30A 4C2ZA 5AG4A 2YNDA 5A28A 4B11A 5A27A 4B14A 3H5ZA 5G21A 4UFWA 4CGLA 4CYPA 4A33A 4UCNA 4CGNA 5AG7A 4CGOA 5G20A 4CYQA 4C7HA 4B10A 2WUUA 4CGPA 4A32A 4C7IA 2YNEA 4UFVA 5AG5A 2YNCC
chains in the Genus database with same CATH superfamily
4NGQA 2Z3LA 2VXKA 2ZELA 1H8LA 3EFAA 2CNMA 1QSMA 2ZW6A 4XPDC 2JBKA 2V8HA 5D8NA 1BLLE 2CXAA 3NE8A 3SJEA 1Z8XA 4FUUA 1S7LA 4KORA 4CYNA 2Q4VA 1YK3A 4U9YA 4UEFA 3MRUA 1QSRA 5C88A 2PJ4A 1PCAA 4MHDA 2JBJA 4OADA 3L2NA 1ELLP 2YNDA 4PXBA 1XF8A 2FIAA 2REFA 3TO6A 4ZY0A 5HXDA 4MCQA 1ON0A 3R9GA 2CNTA 3B35A 3PB7X 4AB7A 3S9MA 1VHEA 2WPXA 4A33A 3D66A 3D3SA 1TKFA 3R1KA 2OR4A 3GUXA 5G20A 2Q51A 3TE4A 3GB0A 5KTDA 3N5FA 3S9NA 2J9AA 4JJXA 3PB8X 4RI1A 2B5GB 5J1QA 4PQAA 4PK3A 3BHXA 4AVCA 4KVME 5JQ4A 5G22A 2V8VA 1IIDA 4TNUA 5I4MA 4BBHA 3CPXA 1JWQA 2VEZA 1FY7A 1OZPA 3D8PA 2ARHA 2Z3OA 3IJ3A 4L89A 2CTCA 3QB8A 2PJBA 4DUKA 4E2AA 2Q04A 4BD9A 4NJRA 2VZYA 3B3VA 2GU2A 4PK2A 5CNPA 1F2PA 3ZJ0A 4NJQA 3FRMA 4UCNA 3IO1A 5CBMA 3IIBA 2Q7BA 2Q4ZA 2ZOFA 5ISVA 4HPSA 2B4BA 4M85A 3EXNA 5IX3A 4CAVA 3WC5A 2FS5A 2B4DB 1YQEA 4AVBA 2PJCA 5K8PA 4M6HA 2Z3PA 3TC8A 4QC6A 3N7ZA 2PJ3A 2C27A 2ZEOA 1VIXA 3LWUA 4JZ0A 2ZEMA 4MCRA 4B5PB 4CAEA 4J3GA 2VL1A 4MCPA 5HVHA 3B2YA 3QNVA 5JH9A 5LYLA 2PJ0A 4FWUA 2OB0A 2WZNA 2ZW7A 3D68A 4NF1A 4P6YA 4R3KA 4EMEA 2ABZA 5J8CA 4KSIA 2CNSA 4DJLA 5J8FA 4MHYA 3KHXA 5HH1A 1Q2DA 2XEGA 4H6UA 3DNSA 4KUAA 4YRHA 3FXTA 2AFSA 4UWJA 5AG7A 4MHNA 2DEAA 2FSRA 1FNOA 2YGWA 4LQGA 5EC4A 4QBJA 3EY5A 2ZEDA 3K9TA 4KZTA 4HNYB 4B12A 3RYOA 4H2KA 4C2XA 4F9UA 7CPAA 3LODA 4UCMA 3BI0A 4ZY1A 4KUBA 4MBUA 4P10A 3SI2A 3G3SA 1XIXA 3IU1A 3W91A 4C2YA 4CAWA 2WSAA 3T90A 2G3AA 4GM5A 1KUXA 1NSLA 4MRIA 4NGMA 4Y49B 5K8OA 1RO5A 1XEBA 3DDDA 2Z3MA 3FVLA 3KHZA 3QAYA 3IC1A 4Q7AA 3VH9A 4C2ZA 2J8MA 1P0HA 2ATRA 3B8GA 3PFOA 3IGRA 1GHEA 4UFWA 3S9LA 2EWBA 3MGDA 2AFUA 1ZLIA 2J8RA 2PJ7A 4NEXA 5LRJA 4QUSA 3FH4A 1VHOA 2I3CA 3BXMA 2DXQA 2IMOA 1L0CA 5THWA 2NYQA 4MY3A 4C7IA 3FECA 2O28A 1Y9WA 2YNCC 1XBUA 4M6GA 4MHZA 1HEEA 2O4HA 2P6GA 2EK8A 4UIBA 4A30A 5K8NA 1BOBA 4IK2A 3BJ8A 1Z9UA 3D4UA 3JVNA 4B5PA 4OIDA 2QYVA 3WR7A 1TIQA 1XJOA 4X5KA 1PUAA 3B3WA 1LCPA 1SQHA 4CAXA 4UEEA 4GXHA 2P0WA 3JTKA 3KI9A 3FYNA 1BPNA 3BJ7A 3SXOA 3KR5A 4B11A 2FCKA 4FD7A 1AUGA 2PSWA 4ZY2A 4A37A 3I3GA 1NMTA 4L8AA 4NSQA 2Q4YA 4X2TA 4CRZB 4FAIA 4C7HA 2G0BA 4QVTA 3SHPA 2EO8A 3TX8A 4R9MA 1TF9A 1YGHA 3R95A 3D2MA 4UF4A 3NH8A 3VATA 3H8EA 4A95A 4EFDA 1IYLA 2EBJA 3KASA 4PXDA 4WWVA 4OMEA 3VWDA 1Y0YA 4KLWA 2BEIA 3GY9A 1IY7A 2G9DA 4K30A 1IU8A 4ZI6A 4X3RA 1QSTA 2Z10A 4M3SA 4MFPA 1CP7A 1ZO0A 1WWZA 4XPDB 3V38A 3TO9A 2REEA 1IOIA 2FL4A 3IFEA 1UWYA 3P2FA 5DWNA 4PSXA 2P6FA 1KZFA 1Y7EA 3GLJA 4P44A 2EVNA 4MMOA 1XMTA 4FD4A 3PBBA 1Z4RA 3D7HA 4OAEA 1QSOA 4MFLA 4Q38A 3EC4A 1ARLA 2BO9A 4U5YA 2XEFA 5EMIA 1Z8WA 2QECA 4ORFA 4CGMA 5AGEA 1CBXA 4LX9A 1V0CA 4OC0A 4UBRA 4B6ZA 2OOTA 6CPAA 2CF4A 2AFMA 8CPAA 1B6BA 3D7FA 2DPSA 3FEDA 4KOTA 4XNHC 5AG6A 5IV0A 2HB6A 4CPAA 5C82A 3DR8A 4FD6A 4PSWA 3TOAA 4F0XA 1YW6A 2ZEPA 4A39A 3KKWA 4U9ZA 1YLEA 1U6MA 1AMPA 5BWAB 1P4NA 5G21A 2Q44A 2IL4A 1LAPA 1Y0RA 1NSAA 4O23A 4NGTA 2QIRA 2Z3KA 1M4LA 4PV6A 4EVYA 2ZW4A 5JGFA 2Z11A 4KOSA 1VHSA 3JRUA 4R57A 2R8VA 2Q0YA 2WPWA 4KOXA 2PRBA 3EO4A 3R9FA 1TKHA 1X10A 2PIZA 3MN8A 3K9UA 3SI0A 1R57A 4A2ZA 2VBQA 2QMLA 2OZGA 2IQ6A 1VKCA 2PJ2A 4KVOE 1XOVA 2A4NA 2AFXA 3H4QA 5F49A 4P4FA 2F8HA 4X8IA 3FJUA 3PGPA 3F0AA 2KCWA 2QJ8A 4JXQA 5GCNA 4B14A 3PB9X 1YSJA 3PB6X 3LMSA 2PIYA 1Q2YA 2ZOGA 3B3SA 4CGOA 4DYOA 2CIJA 2RFHA 4E0AA 4B5OA 3FIXA 1IB1E 2DPTA 3NH4A 2FXFA 2GE3A 4MFJA 4A32A 1I1DA 3DR6A 5AG5A 3TFYA 4MY0A 2R98A 2ZEHA 3FB3A 2ANPA 4ZX8A 4HNXB 4Q36A 2VZZA 3R9EA 4KOWA 2PRQA 2AE6A 2V77A 2C6GA 2H5MA 3IEHA 4NGPA 4PXEA 1M4IA 4JXRA 2DF5A 4A38A 3WABA 1BPMA 4AXVA 5G1ZA 3FEEA 3TTHA 3TCVA 1QMUA 3BI1A 4OC4A 1Z5RA 3TT2A 2D4PA 1WK4A 4JLYA 3LD2A 4YU9A 4KSFA 3VARA 1PU9A 4BMHA 3H5ZA 4II9A 4CYPA 1X12A 3GIUA 3KL9A 5DWMA 5F09A 2AJ6A 3B7IA 1Y7RA 1J4JA 3F8KA 4GS4A 2G3TA 2Z3NA 4XPLA 1M4GA 1TF8A 1IOFA 3KZWA 2ZXVA 5H86A 5F48A 3K2KA 4RS2A 2B3UA 1MJAA 3OWCA 4AVAA 3ISXA 2AFWA 4KVXA 4OP4A 3WC7A 3DLJA 4CS0B 1LFWA 1XMBA 2JLMA 1R43A 1XE4A 1BO4A 3WT4A 2EK9A 1OBRA 4YFJA 4PXCA 1S7FA 5ELYA 1JQGA 1S3ZA 1M44A 4NGNA 4AG7A 3SJGA 1YVKA 4P4IA 4KLVA 4I49A 4A31A 4MFZA 3SI1A 3V8IA 2I79A 3KQXA 1DTDA 2WYRA 2OH1A 2GANA 1F2OA 4IUSA 4F9VA 1LANA 2PQ8A 2FIWA 1MK4A 4P4JA 3D7GA 2XEJA 3CXSA 4IAVA 4MHPA 1XRYA 4OC3A 1M4DA 2BSWA 2C6CA 2PJAA 3H8FA 1I21A 4NCZA 3RZAA 5I0CA 2V8GA 1CPSA 4NGRA 3LACA 1IGBA 1RTQA 3PEIA 3S6KA 2B3VA 3GYAA 4R8FA 1GYTA 2BUEA 3IWEA 5JPHA 1CX8A 1M1DA 3F5BA 1Z2LA 3GKRA 1K4JA 2PJ1A 4F0YA 1ARMA 1CP6A 2FE7A 3B3TA 4MJ8A 4NFRA 4F6AA 5F46A 2CTBA 1CG2A 3CPAA 3D67A 4UEZA 2ZEEA 2RB7A 3UY5A 1YLOA 3WC6A 1ZG9A 4JYWA 2O53A 4BINA 3NE7A 4K3NA 1MJ9A 5FVJA 2J8NA 3TOBA 1HDUA 4R87A 3D2PA 4MFQA 1A2ZA 2ZPAA 4DNCA 2PJ5A 3NA6A 2IJZA 2YNCA 3CXPA 4XPKA 4P4DA 4WJBA 3PBEA 1TKJA 1BAVA 3IU2A 1Z8TA 4P45A 4PPZA 5K8MA 2JEVA 3RAMA 5HMNA 2HV2A 3P2HA 1KUYA 4XNHB 4G1PA 1CPXA 1LAMA 1MJBA 1I12A 4FD5A 1QQ9A 3SXNA 2BOAA 3QAHA 5LRGA 4OLLA 2OU2A 2NSMA 3CXQA 3IWWA 4JD6A 4NGSA 5A27A 1LOKA 4KS9A 3T9YA 4CGNA 2PC1A 1LRZA 1Z8LA 4R6TA 1NE9A 4YGOA 3SJFA 2WUUA 4Z65A 1IYKA 4JWPA 2Q43A 3IWGA 3PFEA 3B3CA 1Q2CA 3DGVA 1DE4C 1S7KA 3I9SA 2C1CA 1F57A 4H89A 1Z4EA 4QB9A 4CRYB 2ZEGA 2RC4A 3A9LA 3CDXA 2I00A 2NMTA 3I1UA 3NH5A 3KGQA 3T8WA 5LYFA 2X7BA 3PP9A 5EBVA 5IB9A 1IICA 1QSNA 1YMEA 3HUVA 2CY2A 2B58A 4R7MA 2K5TA 3RO0A 4MXUA 4HNWB 1CJWA 2JDCA 2AFOA 4F8ZA 2BL1A 2OZHA 4ONUA 5HVFA 4IHMA 3FMCA 3S6HA 1AYEA 4HKFA 3SJXA 2V8DA 3NFZA 3VWEA 1ZLHA 1N71A 2OZUA 2PJ9A 3DSBA 4TWEA 5F47A 4CGPA 2JDDA 2YNEA 3BLNA 4UFVA 2PR1A 4EWTA 4CAFA 1YW4A 1YX0A 5LYIA 1Q7LA 3S6FA 4MCSA 4CYOA 2F7VA 5KTAA 2Q7SA 2AFZA 2HUZA 3CZXA 3G8WA 4MFKA 4C68A 2GREA 3V7ZA 5IB0A 5H84A 4KSAA 2GIVA 5D29A 2PR8A 3H8GA 4UA3A 3CT9A 5AG4A 3KQZA 3ZZIA 1S7NA 2R7HA 4KOYA 5HVGA 1HDQA 4CGLA 1YREA 3RNZA 1ELMP 3FBUA 4ZX9A 4RN7A 2VI7A 5DS0A 5LYDA 4LQ6A 2PE3A 5JM6A 3FF3A 3W6SA 2C6PA 1CM0A 4R3LA 3PB4X 4UIAA 2GLJA 3FX6A 4W9YA 1YR0A 4UWIA 2VQYA 3S6GA 2B5GA 3C26A 4OKOA 2PVVA 2D4OA 4RUHA 4IF5A 4UFXA 4YWYA 4Y49C 3D7DA 2R1IA 4UCPA 2JEWA 2XEIA 2EUIA 2ODFA 4LUAA 2GLFA 4B13A 2FT0A 1S60A 4ONWA 1Y9KA 2HC9A 1UFHA 4E8OA 2FVGA 5KTCA 2QVPA 3RBUA 1XFOA 4OC5A 1KUVA 2GFQA 3PRTA 4OC2A 3E0KA 1YVOA 5A28A 1S5KA 4MI4A 4H6ZA 1EE3P 2B4DA 4KOUA 2ZEFA 3FNCA 4OC1A 4R76A 5CPAA 4P4BA 2F5IA 3ISZA 4A94A 2ZENA 1R3NA 2PDOA 2POKA 1B87A 3JUWA 1ZG7A 4M6IA 5E96A 4ZYQA 2PCUA 5LRKA 1RXTA 4AG9A 1ZG8A 1FT7A 2BCOA 2PJ6A 1KWMA 1VGYA 3HLPA 2P6EA 4ZGYB 4FBEA 3KR4A 3W6XA 4NXYA 2ZW5A 3PZJA 2HQYA 2Y0MA 2PVWA 4OIWA 4ZBGA 3TO7A 2Z0ZA 4P4EA 4CYQA 4KOVA 2PJ8A 4B10A 1TXRA 1PYTB 3R96A
chains in the Genus database with same CATH topology
2Z3LA 2VXKA 3EFAA 2CNMA 1QSMA 2ZW6A 4XPDC 2CXAA 1S7LA 4KORA 4CYNA 2Q4VA 1YK3A 4U9YA 1QSRA 5C88A 4MHDA 4OADA 2YNDA 1XF8A 2FIAA 2REFA 3TO6A 1ON0A 3R9GA 2CNTA 4AB7A 2WPXA 4A33A 3D3SA 3R1KA 5G20A 3TE4A 5KTDA 4JJXA 4RI1A 2B5GB 4PK3A 4AVCA 4KVME 5JQ4A 5G22A 1IIDA 4BBHA 2VEZA 1FY7A 1OZPA 3D8PA 2ARHA 2Z3OA 4L89A 3QB8A 4E2AA 2Q04A 2VZYA 4PK2A 5CNPA 3ZJ0A 3FRMA 4UCNA 2Q7BA 5ISVA 2B4BA 4M85A 3EXNA 5IX3A 4CAVA 2FS5A 2B4DB 4AVBA 2Z3PA 4QC6A 3N7ZA 2C27A 4B5PB 4CAEA 4J3GA 4NF1A 2OB0A 2ZW7A 4R3KA 5J8CA 5J8FA 2CNSA 5HH1A 1Q2DA 4H6UA 4KUAA 3DNSA 4YRHA 3FXTA 4UWJA 5AG7A 2FSRA 2YGWA 5EC4A 4QBJA 3EY5A 4KZTA 4HNYB 4B12A 3RYOA 4C2XA 3LODA 4UCMA 4KUBA 4MBUA 3G3SA 1XIXA 3IU1A 3W91A 4C2YA 4CAWA 2WSAA 3T90A 2G3AA 1NSLA 1KUXA 4Y49B 1RO5A 1XEBA 3DDDA 2Z3MA 4C2ZA 2J8MA 1P0HA 2ATRA 3B8GA 3IGRA 1GHEA 4UFWA 3MGDA 2J8RA 4NEXA 4QUSA 2DXQA 1L0CA 4C7IA 4MY3A 2O28A 1Y9WA 2YNCC 2P6GA 1BOBA 3BJ8A 1Z9UA 3JVNA 4B5PA 3WR7A 1TIQA 4X5KA 1PUAA 1SQHA 4CAXA 2P0WA 3JTKA 3FYNA 3BJ7A 3SXOA 4B11A 2FCKA 4FD7A 2PSWA 3I3GA 1NMTA 4L8AA 4NSQA 2Q4YA 4CRZB 4C7HA 2G0BA 4QVTA 3SHPA 4R9MA 1YGHA 3R95A 3D2MA 4A95A 1IYLA 3VWDA 4KLWA 2BEIA 3GY9A 4K30A 1QSTA 2Z10A 4M3SA 4MFPA 1ZO0A 1WWZA 4XPDB 3TO9A 2REEA 2FL4A 3P2FA 5DWNA 4PSXA 2P6FA 1KZFA 2EVNA 1XMTA 4FD4A 1Z4RA 4OAEA 1QSOA 4MFLA 4Q38A 3EC4A 4U5YA 2QECA 4ORFA 4CGMA 5AGEA 4LX9A 1V0CA 4UBRA 1B6BA 4XNHC 2DPSA 5AG6A 4KOTA 5IV0A 5C82A 3DR8A 4FD6A 4PSWA 3TOAA 4F0XA 3KKWA 4U9ZA 1YLEA 1U6MA 5BWAB 1P4NA 5G21A 2Q44A 2IL4A 2QIRA 2Z3KA 4PV6A 4EVYA 2ZW4A 2Z11A 4KOSA 1VHSA 4R57A 2R8VA 2Q0YA 2WPWA 4KOXA 2PRBA 3EO4A 3R9FA 4C68A 4A2ZA 3K9UA 1R57A 2VBQA 2QMLA 2OZGA 1VKCA 4KVOE 2A4NA 3H4QA 5F49A 3PGPA 3F0AA 2KCWA 4JXQA 5GCNA 4B14A 1Q2YA 4CGOA 4E0AA 4B5OA 3FIXA 1IB1E 2DPTA 4A32A 2FXFA 2GE3A 4MFJA 3TFYA 1I1DA 3DR6A 5AG5A 4MY0A 2R98A 3FB3A 4HNXB 4Q36A 2VZZA 3R9EA 4KOWA 2AE6A 2H5MA 1M4IA 4JXRA 5G1ZA 3TTHA 3TCVA 3TT2A 2D4PA 1WK4A 4JLYA 3LD2A 4KSFA 1PU9A 4BMHA 3H5ZA 4II9A 4CYPA 5DWMA 2AJ6A 1Y7RA 1J4JA 3F8KA 4GS4A 2G3TA 2Z3NA 4XPLA 1M4GA 2ZXVA 5H86A 5F48A 4RS2A 2B3UA 1MJAA 3OWCA 4AVAA 4KVXA 4CS0B 2JLMA 1XE4A 1BO4A 4YFJA 1S7FA 1S3ZA 1M44A 4AG7A 1YVKA 4KLVA 4I49A 4A31A 4MFZA 3V8IA 2I79A 2OH1A 2GANA 4IUSA 2PQ8A 2FIWA 1MK4A 3CXSA 1M4DA 2BSWA 4NCZA 1I21A 5I0CA 3S6KA 2B3VA 3GYAA 3IWEA 2BUEA 5JPHA 1M1DA 3F5BA 3GKRA 1K4JA 4F0YA 2FE7A 4MJ8A 4F6AA 5F46A 3UY5A 3NE7A 1MJ9A 5FVJA 2J8NA 3TOBA 4R87A 3D2PA 4MFQA 4DNCA 2ZPAA 2YNCA 3CXPA 4XPKA 3IU2A 2JEVA 5HMNA 2HV2A 3P2HA 1KUYA 4XNHB 4A30A 4FD5A 1MJBA 1I12A 3SXNA 3QAHA 4OLLA 2OU2A 3CXQA 4JD6A 5A27A 4KS9A 3T9YA 4CGNA 2PC1A 1LRZA 1NE9A 4YGOA 2WUUA 1IYKA 4JWPA 3IWGA 1Q2CA 1S7KA 3I9SA 4QB9A 4H89A 4CRYB 1Z4EA 2RC4A 3A9LA 2I00A 2NMTA 2X7BA 3PP9A 5EBVA 1IICA 1QSNA 2CY2A 2B58A 2K5TA 4HNWB 1CJWA 2JDCA 2BL1A 2OZHA 4ONUA 3S6HA 4HKFA 3VWEA 3DSBA 1N71A 2OZUA 5F47A 4CGPA 2JDDA 2YNEA 3BLNA 4UFVA 2PR1A 4CAFA 1YX0A 3S6FA 4CYOA 5KTAA 4MFKA 2HUZA 3G8WA 5IB0A 5H84A 4KSAA 2GIVA 2PR8A 4UA3A 5AG4A 3ZZIA 1S7NA 2R7HA 4KOYA 4CGLA 1YREA 3FBUA 2VI7A 3W6SA 4R3LA 1CM0A 1YR0A 4UWIA 2VQYA 3S6GA 2B5GA 3C26A 2D4OA 4IF5A 4UFXA 4Y49C 2R1IA 4UCPA 2EUIA 4LUAA 4B13A 2FT0A 1S60A 5KTCA 1Y9KA 1UFHA 4E8OA 1KUVA 5A28A 3E0KA 1YVOA 1S5KA 4MI4A 4H6ZA 4KOUA 2B4DA 3FNCA 2F5IA 2PDOA 1B87A 3JUWA 5E96A 1RXTA 4AG9A 2P6EA 4ZGYB 3W6XA 4NXYA 2ZW5A 3PZJA 2HQYA 2Y0MA 4ZBGA 3TO7A 2Z0ZA 4CYQA 4KOVA 4B10A 3R96A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B12 A;  4A95 A;  4C2X A;  4CAF A;  4CGM A;  5AGE A;  4UCM A;  4C68 A;  4UFX A;  4A2Z A;  2YNC A;  4CYO A;  4UCP A;  3IU1 A;  5AG6 A;  4C2Y A;  5G22 A;  2WSA A;  4CYN A;  3IWE A;  3IU2 A;  4CAE A;  5G1Z A;  4B13 A;  4BBH A;  4A31 A;  3JTK A;  4A30 A;  4C2Z A;  5AG4 A;  2YND A;  5A28 A;  4B11 A;  5A27 A;  4B14 A;  3H5Z A;  5G21 A;  4UFW A;  4CGL A;  4CYP A;  4A33 A;  4UCN A;  4CGN A;  5AG7 A;  4CGO A;  5G20 A;  4CYQ A;  4C7H A;  4B10 A;  2WUU A;  4CGP A;  4A32 A;  4C7I A;  2YNE A;  4UFV A;  5AG5 A;  2YNC C; 
#chains in the Genus database with same CATH topology
 4NGQ A;  2Z3L A;  2VXK A;  2ZEL A;  1H8L A;  3EFA A;  2CNM A;  1QSM A;  2ZW6 A;  4XPD C;  2JBK A;  2V8H A;  5D8N A;  1BLL E;  2CXA A;  3NE8 A;  3SJE A;  1Z8X A;  4FUU A;  1S7L A;  4KOR A;  4CYN A;  2Q4V A;  1YK3 A;  4U9Y A;  4UEF A;  3MRU A;  1QSR A;  5C88 A;  2PJ4 A;  1PCA A;  4MHD A;  2JBJ A;  4OAD A;  3L2N A;  1ELL P;  2YND A;  4PXB A;  1XF8 A;  2FIA A;  2REF A;  3TO6 A;  4ZY0 A;  5HXD A;  4MCQ A;  1ON0 A;  3R9G A;  2CNT A;  3B35 A;  3PB7 X;  4AB7 A;  3S9M A;  1VHE A;  2WPX A;  4A33 A;  3D66 A;  3D3S A;  1TKF A;  3R1K A;  2OR4 A;  3GUX A;  5G20 A;  2Q51 A;  3TE4 A;  3GB0 A;  5KTD A;  3N5F A;  3S9N A;  2J9A A;  4JJX A;  3PB8 X;  4RI1 A;  2B5G B;  5J1Q A;  4PQA A;  4PK3 A;  3BHX A;  4AVC A;  4KVM E;  5JQ4 A;  5G22 A;  2V8V A;  1IID A;  4TNU A;  5I4M A;  4BBH A;  3CPX A;  1JWQ A;  2VEZ A;  1FY7 A;  1OZP A;  3D8P A;  2ARH A;  2Z3O A;  3IJ3 A;  4L89 A;  2CTC A;  3QB8 A;  2PJB A;  4DUK A;  4E2A A;  2Q04 A;  4BD9 A;  4NJR A;  2VZY A;  3B3V A;  2GU2 A;  4PK2 A;  5CNP A;  1F2P A;  3ZJ0 A;  4NJQ A;  3FRM A;  4UCN A;  3IO1 A;  5CBM A;  3IIB A;  2Q7B A;  2Q4Z A;  2ZOF A;  5ISV A;  4HPS A;  2B4B A;  4M85 A;  3EXN A;  5IX3 A;  4CAV A;  3WC5 A;  2FS5 A;  2B4D B;  1YQE A;  4AVB A;  2PJC A;  5K8P A;  4M6H A;  2Z3P A;  3TC8 A;  4QC6 A;  3N7Z A;  2PJ3 A;  2C27 A;  2ZEO A;  1VIX A;  3LWU A;  4JZ0 A;  2ZEM A;  4MCR A;  4B5P B;  4CAE A;  4J3G A;  2VL1 A;  4MCP A;  5HVH A;  3B2Y A;  3QNV A;  5JH9 A;  5LYL A;  2PJ0 A;  4FWU A;  2OB0 A;  2WZN A;  2ZW7 A;  3D68 A;  4NF1 A;  4P6Y A;  4R3K A;  4EME A;  2ABZ A;  5J8C A;  4KSI A;  2CNS A;  4DJL A;  5J8F A;  4MHY A;  3KHX A;  5HH1 A;  1Q2D A;  2XEG A;  4H6U A;  3DNS A;  4KUA A;  4YRH A;  3FXT A;  2AFS A;  4UWJ A;  5AG7 A;  4MHN A;  2DEA A;  2FSR A;  1FNO A;  2YGW A;  4LQG A;  5EC4 A;  4QBJ A;  3EY5 A;  2ZED A;  3K9T A;  4KZT A;  4HNY B;  4B12 A;  3RYO A;  4H2K A;  4C2X A;  4F9U A;  7CPA A;  3LOD A;  4UCM A;  3BI0 A;  4ZY1 A;  4KUB A;  4MBU A;  4P10 A;  3SI2 A;  3G3S A;  1XIX A;  3IU1 A;  3W91 A;  4C2Y A;  4CAW A;  2WSA A;  3T90 A;  2G3A A;  4GM5 A;  1KUX A;  1NSL A;  4MRI A;  4NGM A;  4Y49 B;  5K8O A;  1RO5 A;  1XEB A;  3DDD A;  2Z3M A;  3FVL A;  3KHZ A;  3QAY A;  3IC1 A;  4Q7A A;  3VH9 A;  4C2Z A;  2J8M A;  1P0H A;  2ATR A;  3B8G A;  3PFO A;  3IGR A;  1GHE A;  4UFW A;  3S9L A;  2EWB A;  3MGD A;  2AFU A;  1ZLI A;  2J8R A;  2PJ7 A;  4NEX A;  5LRJ A;  4QUS A;  3FH4 A;  1VHO A;  2I3C A;  3BXM A;  2DXQ A;  2IMO A;  1L0C A;  5THW A;  2NYQ A;  4MY3 A;  4C7I A;  3FEC A;  2O28 A;  1Y9W A;  2YNC C;  1XBU A;  4M6G A;  4MHZ A;  1HEE A;  2O4H A;  2P6G A;  2EK8 A;  4UIB A;  4A30 A;  5K8N A;  1BOB A;  4IK2 A;  3BJ8 A;  1Z9U A;  3D4U A;  3JVN A;  4B5P A;  4OID A;  2QYV A;  3WR7 A;  1TIQ A;  1XJO A;  4X5K A;  1PUA A;  3B3W A;  1LCP A;  1SQH A;  4CAX A;  4UEE A;  4GXH A;  2P0W A;  3JTK A;  3KI9 A;  3FYN A;  1BPN A;  3BJ7 A;  3SXO A;  3KR5 A;  4B11 A;  2FCK A;  4FD7 A;  1AUG A;  2PSW A;  4ZY2 A;  4A37 A;  3I3G A;  1NMT A;  4L8A A;  4NSQ A;  2Q4Y A;  4X2T A;  4CRZ B;  4FAI A;  4C7H A;  2G0B A;  4QVT A;  3SHP A;  2EO8 A;  3TX8 A;  4R9M A;  1TF9 A;  1YGH A;  3R95 A;  3D2M A;  4UF4 A;  3NH8 A;  3VAT A;  3H8E A;  4A95 A;  4EFD A;  1IYL A;  2EBJ A;  3KAS A;  4PXD A;  4WWV A;  4OME A;  3VWD A;  1Y0Y A;  4KLW A;  2BEI A;  3GY9 A;  1IY7 A;  2G9D A;  4K30 A;  1IU8 A;  4ZI6 A;  4X3R A;  1QST A;  2Z10 A;  4M3S A;  4MFP A;  1CP7 A;  1ZO0 A;  1WWZ A;  4XPD B;  3V38 A;  3TO9 A;  2REE A;  1IOI A;  2FL4 A;  3IFE A;  1UWY A;  3P2F A;  5DWN A;  4PSX A;  2P6F A;  1KZF A;  1Y7E A;  3GLJ A;  4P44 A;  2EVN A;  4MMO A;  1XMT A;  4FD4 A;  3PBB A;  1Z4R A;  3D7H A;  4OAE A;  1QSO A;  4MFL A;  4Q38 A;  3EC4 A;  1ARL A;  2BO9 A;  4U5Y A;  2XEF A;  5EMI A;  1Z8W A;  2QEC A;  4ORF A;  4CGM A;  5AGE A;  1CBX A;  4LX9 A;  1V0C A;  4OC0 A;  4UBR A;  4B6Z A;  2OOT A;  6CPA A;  2CF4 A;  2AFM A;  8CPA A;  1B6B A;  3D7F A;  2DPS A;  3FED A;  4KOT A;  4XNH C;  5AG6 A;  5IV0 A;  2HB6 A;  4CPA A;  5C82 A;  3DR8 A;  4FD6 A;  4PSW A;  3TOA A;  4F0X A;  1YW6 A;  2ZEP A;  4A39 A;  3KKW A;  4U9Z A;  1YLE A;  1U6M A;  1AMP A;  5BWA B;  1P4N A;  5G21 A;  2Q44 A;  2IL4 A;  1LAP A;  1Y0R A;  1NSA A;  4O23 A;  4NGT A;  2QIR A;  2Z3K A;  1M4L A;  4PV6 A;  4EVY A;  2ZW4 A;  5JGF A;  2Z11 A;  4KOS A;  1VHS A;  3JRU A;  4R57 A;  2R8V A;  2Q0Y A;  2WPW A;  4KOX A;  2PRB A;  3EO4 A;  3R9F A;  1TKH A;  1X10 A;  2PIZ A;  3MN8 A;  3K9U A;  3SI0 A;  1R57 A;  4A2Z A;  2VBQ A;  2QML A;  2OZG A;  2IQ6 A;  1VKC A;  2PJ2 A;  4KVO E;  1XOV A;  2A4N A;  2AFX A;  3H4Q A;  5F49 A;  4P4F A;  2F8H A;  4X8I A;  3FJU A;  3PGP A;  3F0A A;  2KCW A;  2QJ8 A;  4JXQ A;  5GCN A;  4B14 A;  3PB9 X;  1YSJ A;  3PB6 X;  3LMS A;  2PIY A;  1Q2Y A;  2ZOG A;  3B3S A;  4CGO A;  4DYO A;  2CIJ A;  2RFH A;  4E0A A;  4B5O A;  3FIX A;  1IB1 E;  2DPT A;  3NH4 A;  2FXF A;  2GE3 A;  4MFJ A;  4A32 A;  1I1D A;  3DR6 A;  5AG5 A;  3TFY A;  4MY0 A;  2R98 A;  2ZEH A;  3FB3 A;  2ANP A;  4ZX8 A;  4HNX B;  4Q36 A;  2VZZ A;  3R9E A;  4KOW A;  2PRQ A;  2AE6 A;  2V77 A;  2C6G A;  2H5M A;  3IEH A;  4NGP A;  4PXE A;  1M4I A;  4JXR A;  2DF5 A;  4A38 A;  3WAB A;  1BPM A;  4AXV A;  5G1Z A;  3FEE A;  3TTH A;  3TCV A;  1QMU A;  3BI1 A;  4OC4 A;  1Z5R A;  3TT2 A;  2D4P A;  1WK4 A;  4JLY A;  3LD2 A;  4YU9 A;  4KSF A;  3VAR A;  1PU9 A;  4BMH A;  3H5Z A;  4II9 A;  4CYP A;  1X12 A;  3GIU A;  3KL9 A;  5DWM A;  5F09 A;  2AJ6 A;  3B7I A;  1Y7R A;  1J4J A;  3F8K A;  4GS4 A;  2G3T A;  2Z3N A;  4XPL A;  1M4G A;  1TF8 A;  1IOF A;  3KZW A;  2ZXV A;  5H86 A;  5F48 A;  3K2K A;  4RS2 A;  2B3U A;  1MJA A;  3OWC A;  4AVA A;  3ISX A;  2AFW A;  4KVX A;  4OP4 A;  3WC7 A;  3DLJ A;  4CS0 B;  1LFW A;  1XMB A;  2JLM A;  1R43 A;  1XE4 A;  1BO4 A;  3WT4 A;  2EK9 A;  1OBR A;  4YFJ A;  4PXC A;  1S7F A;  5ELY A;  1JQG A;  1S3Z A;  1M44 A;  4NGN A;  4AG7 A;  3SJG A;  1YVK A;  4P4I A;  4KLV A;  4I49 A;  4A31 A;  4MFZ A;  3SI1 A;  3V8I A;  2I79 A;  3KQX A;  1DTD A;  2WYR A;  2OH1 A;  2GAN A;  1F2O A;  4IUS A;  4F9V A;  1LAN A;  2PQ8 A;  2FIW A;  1MK4 A;  4P4J A;  3D7G A;  2XEJ A;  3CXS A;  4IAV A;  4MHP A;  1XRY A;  4OC3 A;  1M4D A;  2BSW A;  2C6C A;  2PJA A;  3H8F A;  1I21 A;  4NCZ A;  3RZA A;  5I0C A;  2V8G A;  1CPS A;  4NGR A;  3LAC A;  1IGB A;  1RTQ A;  3PEI A;  3S6K A;  2B3V A;  3GYA A;  4R8F A;  1GYT A;  2BUE A;  3IWE A;  5JPH A;  1CX8 A;  1M1D A;  3F5B A;  1Z2L A;  3GKR A;  1K4J A;  2PJ1 A;  4F0Y A;  1ARM A;  1CP6 A;  2FE7 A;  3B3T A;  4MJ8 A;  4NFR A;  4F6A A;  5F46 A;  2CTB A;  1CG2 A;  3CPA A;  3D67 A;  4UEZ A;  2ZEE A;  2RB7 A;  3UY5 A;  1YLO A;  3WC6 A;  1ZG9 A;  4JYW A;  2O53 A;  4BIN A;  3NE7 A;  4K3N A;  1MJ9 A;  5FVJ A;  2J8N A;  3TOB A;  1HDU A;  4R87 A;  3D2P A;  4MFQ A;  1A2Z A;  2ZPA A;  4DNC A;  2PJ5 A;  3NA6 A;  2IJZ A;  2YNC A;  3CXP A;  4XPK A;  4P4D A;  4WJB A;  3PBE A;  1TKJ A;  1BAV A;  3IU2 A;  1Z8T A;  4P45 A;  4PPZ A;  5K8M A;  2JEV A;  3RAM A;  5HMN A;  2HV2 A;  3P2H A;  1KUY A;  4XNH B;  4G1P A;  1CPX A;  1LAM A;  1MJB A;  1I12 A;  4FD5 A;  1QQ9 A;  3SXN A;  2BOA A;  3QAH A;  5LRG A;  4OLL A;  2OU2 A;  2NSM A;  3CXQ A;  3IWW A;  4JD6 A;  4NGS A;  5A27 A;  1LOK A;  4KS9 A;  3T9Y A;  4CGN A;  2PC1 A;  1LRZ A;  1Z8L A;  4R6T A;  1NE9 A;  4YGO A;  3SJF A;  2WUU A;  4Z65 A;  1IYK A;  4JWP A;  2Q43 A;  3IWG A;  3PFE A;  3B3C A;  1Q2C A;  3DGV A;  1DE4 C;  1S7K A;  3I9S A;  2C1C A;  1F57 A;  4H89 A;  1Z4E A;  4QB9 A;  4CRY B;  2ZEG A;  2RC4 A;  3A9L A;  3CDX A;  2I00 A;  2NMT A;  3I1U A;  3NH5 A;  3KGQ A;  3T8W A;  5LYF A;  2X7B A;  3PP9 A;  5EBV A;  5IB9 A;  1IIC A;  1QSN A;  1YME A;  3HUV A;  2CY2 A;  2B58 A;  4R7M A;  2K5T A;  3RO0 A;  4MXU A;  4HNW B;  1CJW A;  2JDC A;  2AFO A;  4F8Z A;  2BL1 A;  2OZH A;  4ONU A;  5HVF A;  4IHM A;  3FMC A;  3S6H A;  1AYE A;  4HKF A;  3SJX A;  2V8D A;  3NFZ A;  3VWE A;  1ZLH A;  1N71 A;  2OZU A;  2PJ9 A;  3DSB A;  4TWE A;  5F47 A;  4CGP A;  2JDD A;  2YNE A;  3BLN A;  4UFV A;  2PR1 A;  4EWT A;  4CAF A;  1YW4 A;  1YX0 A;  5LYI A;  1Q7L A;  3S6F A;  4MCS A;  4CYO A;  2F7V A;  5KTA A;  2Q7S A;  2AFZ A;  2HUZ A;  3CZX A;  3G8W A;  4MFK A;  4C68 A;  2GRE A;  3V7Z A;  5IB0 A;  5H84 A;  4KSA A;  2GIV A;  5D29 A;  2PR8 A;  3H8G A;  4UA3 A;  3CT9 A;  5AG4 A;  3KQZ A;  3ZZI A;  1S7N A;  2R7H A;  4KOY A;  5HVG A;  1HDQ A;  4CGL A;  1YRE A;  3RNZ A;  1ELM P;  3FBU A;  4ZX9 A;  4RN7 A;  2VI7 A;  5DS0 A;  5LYD A;  4LQ6 A;  2PE3 A;  5JM6 A;  3FF3 A;  3W6S A;  2C6P A;  1CM0 A;  4R3L A;  3PB4 X;  4UIA A;  2GLJ A;  3FX6 A;  4W9Y A;  1YR0 A;  4UWI A;  2VQY A;  3S6G A;  2B5G A;  3C26 A;  4OKO A;  2PVV A;  2D4O A;  4RUH A;  4IF5 A;  4UFX A;  4YWY A;  4Y49 C;  3D7D A;  2R1I A;  4UCP A;  2JEW A;  2XEI A;  2EUI A;  2ODF A;  4LUA A;  2GLF A;  4B13 A;  2FT0 A;  1S60 A;  4ONW A;  1Y9K A;  2HC9 A;  1UFH A;  4E8O A;  2FVG A;  5KTC A;  2QVP A;  3RBU A;  1XFO A;  4OC5 A;  1KUV A;  2GFQ A;  3PRT A;  4OC2 A;  3E0K A;  1YVO A;  5A28 A;  1S5K A;  4MI4 A;  4H6Z A;  1EE3 P;  2B4D A;  4KOU A;  2ZEF A;  3FNC A;  4OC1 A;  4R76 A;  5CPA A;  4P4B A;  2F5I A;  3ISZ A;  4A94 A;  2ZEN A;  1R3N A;  2PDO A;  2POK A;  1B87 A;  3JUW A;  1ZG7 A;  4M6I A;  5E96 A;  4ZYQ A;  2PCU A;  5LRK A;  1RXT A;  4AG9 A;  1ZG8 A;  1FT7 A;  2BCO A;  2PJ6 A;  1KWM A;  1VGY A;  3HLP A;  2P6E A;  4ZGY B;  4FBE A;  3KR4 A;  3W6X A;  4NXY A;  2ZW5 A;  3PZJ A;  2HQY A;  2Y0M A;  2PVW A;  4OIW A;  4ZBG A;  3TO7 A;  2Z0Z A;  4P4E A;  4CYQ A;  4KOV A;  2PJ8 A;  4B10 A;  1TXR A;  1PYT B;  3R96 A; 
#chains in the Genus database with same CATH homology
 2Z3L A;  2VXK A;  3EFA A;  2CNM A;  1QSM A;  2ZW6 A;  4XPD C;  2CXA A;  1S7L A;  4KOR A;  4CYN A;  2Q4V A;  1YK3 A;  4U9Y A;  1QSR A;  5C88 A;  4MHD A;  4OAD A;  2YND A;  1XF8 A;  2FIA A;  2REF A;  3TO6 A;  1ON0 A;  3R9G A;  2CNT A;  4AB7 A;  2WPX A;  4A33 A;  3D3S A;  3R1K A;  5G20 A;  3TE4 A;  5KTD A;  4JJX A;  4RI1 A;  2B5G B;  4PK3 A;  4AVC A;  4KVM E;  5JQ4 A;  5G22 A;  1IID A;  4BBH A;  2VEZ A;  1FY7 A;  1OZP A;  3D8P A;  2ARH A;  2Z3O A;  4L89 A;  3QB8 A;  4E2A A;  2Q04 A;  2VZY A;  4PK2 A;  5CNP A;  3ZJ0 A;  3FRM A;  4UCN A;  2Q7B A;  5ISV A;  2B4B A;  4M85 A;  3EXN A;  5IX3 A;  4CAV A;  2FS5 A;  2B4D B;  4AVB A;  2Z3P A;  4QC6 A;  3N7Z A;  2C27 A;  4B5P B;  4CAE A;  4J3G A;  4NF1 A;  2OB0 A;  2ZW7 A;  4R3K A;  5J8C A;  5J8F A;  2CNS A;  5HH1 A;  1Q2D A;  4H6U A;  4KUA A;  3DNS A;  4YRH A;  3FXT A;  4UWJ A;  5AG7 A;  2FSR A;  2YGW A;  5EC4 A;  4QBJ A;  3EY5 A;  4KZT A;  4HNY B;  4B12 A;  3RYO A;  4C2X A;  3LOD A;  4UCM A;  4KUB A;  4MBU A;  3G3S A;  1XIX A;  3IU1 A;  3W91 A;  4C2Y A;  4CAW A;  2WSA A;  3T90 A;  2G3A A;  1NSL A;  1KUX A;  4Y49 B;  1RO5 A;  1XEB A;  3DDD A;  2Z3M A;  4C2Z A;  2J8M A;  1P0H A;  2ATR A;  3B8G A;  3IGR A;  1GHE A;  4UFW A;  3MGD A;  2J8R A;  4NEX A;  4QUS A;  2DXQ A;  1L0C A;  4C7I A;  4MY3 A;  2O28 A;  1Y9W A;  2YNC C;  2P6G A;  1BOB A;  3BJ8 A;  1Z9U A;  3JVN A;  4B5P A;  3WR7 A;  1TIQ A;  4X5K A;  1PUA A;  1SQH A;  4CAX A;  2P0W A;  3JTK A;  3FYN A;  3BJ7 A;  3SXO A;  4B11 A;  2FCK A;  4FD7 A;  2PSW A;  3I3G A;  1NMT A;  4L8A A;  4NSQ A;  2Q4Y A;  4CRZ B;  4C7H A;  2G0B A;  4QVT A;  3SHP A;  4R9M A;  1YGH A;  3R95 A;  3D2M A;  4A95 A;  1IYL A;  3VWD A;  4KLW A;  2BEI A;  3GY9 A;  4K30 A;  1QST A;  2Z10 A;  4M3S A;  4MFP A;  1ZO0 A;  1WWZ A;  4XPD B;  3TO9 A;  2REE A;  2FL4 A;  3P2F A;  5DWN A;  4PSX A;  2P6F A;  1KZF A;  2EVN A;  1XMT A;  4FD4 A;  1Z4R A;  4OAE A;  1QSO A;  4MFL A;  4Q38 A;  3EC4 A;  4U5Y A;  2QEC A;  4ORF A;  4CGM A;  5AGE A;  4LX9 A;  1V0C A;  4UBR A;  1B6B A;  4XNH C;  2DPS A;  5AG6 A;  4KOT A;  5IV0 A;  5C82 A;  3DR8 A;  4FD6 A;  4PSW A;  3TOA A;  4F0X A;  3KKW A;  4U9Z A;  1YLE A;  1U6M A;  5BWA B;  1P4N A;  5G21 A;  2Q44 A;  2IL4 A;  2QIR A;  2Z3K A;  4PV6 A;  4EVY A;  2ZW4 A;  2Z11 A;  4KOS A;  1VHS A;  4R57 A;  2R8V A;  2Q0Y A;  2WPW A;  4KOX A;  2PRB A;  3EO4 A;  3R9F A;  4C68 A;  4A2Z A;  3K9U A;  1R57 A;  2VBQ A;  2QML A;  2OZG A;  1VKC A;  4KVO E;  2A4N A;  3H4Q A;  5F49 A;  3PGP A;  3F0A A;  2KCW A;  4JXQ A;  5GCN A;  4B14 A;  1Q2Y A;  4CGO A;  4E0A A;  4B5O A;  3FIX A;  1IB1 E;  2DPT A;  4A32 A;  2FXF A;  2GE3 A;  4MFJ A;  3TFY A;  1I1D A;  3DR6 A;  5AG5 A;  4MY0 A;  2R98 A;  3FB3 A;  4HNX B;  4Q36 A;  2VZZ A;  3R9E A;  4KOW A;  2AE6 A;  2H5M A;  1M4I A;  4JXR A;  5G1Z A;  3TTH A;  3TCV A;  3TT2 A;  2D4P A;  1WK4 A;  4JLY A;  3LD2 A;  4KSF A;  1PU9 A;  4BMH A;  3H5Z A;  4II9 A;  4CYP A;  5DWM A;  2AJ6 A;  1Y7R A;  1J4J A;  3F8K A;  4GS4 A;  2G3T A;  2Z3N A;  4XPL A;  1M4G A;  2ZXV A;  5H86 A;  5F48 A;  4RS2 A;  2B3U A;  1MJA A;  3OWC A;  4AVA A;  4KVX A;  4CS0 B;  2JLM A;  1XE4 A;  1BO4 A;  4YFJ A;  1S7F A;  1S3Z A;  1M44 A;  4AG7 A;  1YVK A;  4KLV A;  4I49 A;  4A31 A;  4MFZ A;  3V8I A;  2I79 A;  2OH1 A;  2GAN A;  4IUS A;  2PQ8 A;  2FIW A;  1MK4 A;  3CXS A;  1M4D A;  2BSW A;  4NCZ A;  1I21 A;  5I0C A;  3S6K A;  2B3V A;  3GYA A;  3IWE A;  2BUE A;  5JPH A;  1M1D A;  3F5B A;  3GKR A;  1K4J A;  4F0Y A;  2FE7 A;  4MJ8 A;  4F6A A;  5F46 A;  3UY5 A;  3NE7 A;  1MJ9 A;  5FVJ A;  2J8N A;  3TOB A;  4R87 A;  3D2P A;  4MFQ A;  4DNC A;  2ZPA A;  2YNC A;  3CXP A;  4XPK A;  3IU2 A;  2JEV A;  5HMN A;  2HV2 A;  3P2H A;  1KUY A;  4XNH B;  4A30 A;  4FD5 A;  1MJB A;  1I12 A;  3SXN A;  3QAH A;  4OLL A;  2OU2 A;  3CXQ A;  4JD6 A;  5A27 A;  4KS9 A;  3T9Y A;  4CGN A;  2PC1 A;  1LRZ A;  1NE9 A;  4YGO A;  2WUU A;  1IYK A;  4JWP A;  3IWG A;  1Q2C A;  1S7K A;  3I9S A;  4QB9 A;  4H89 A;  4CRY B;  1Z4E A;  2RC4 A;  3A9L A;  2I00 A;  2NMT A;  2X7B A;  3PP9 A;  5EBV A;  1IIC A;  1QSN A;  2CY2 A;  2B58 A;  2K5T A;  4HNW B;  1CJW A;  2JDC A;  2BL1 A;  2OZH A;  4ONU A;  3S6H A;  4HKF A;  3VWE A;  3DSB A;  1N71 A;  2OZU A;  5F47 A;  4CGP A;  2JDD A;  2YNE A;  3BLN A;  4UFV A;  2PR1 A;  4CAF A;  1YX0 A;  3S6F A;  4CYO A;  5KTA A;  4MFK A;  2HUZ A;  3G8W A;  5IB0 A;  5H84 A;  4KSA A;  2GIV A;  2PR8 A;  4UA3 A;  5AG4 A;  3ZZI A;  1S7N A;  2R7H A;  4KOY A;  4CGL A;  1YRE A;  3FBU A;  2VI7 A;  3W6S A;  4R3L A;  1CM0 A;  1YR0 A;  4UWI A;  2VQY A;  3S6G A;  2B5G A;  3C26 A;  2D4O A;  4IF5 A;  4UFX A;  4Y49 C;  2R1I A;  4UCP A;  2EUI A;  4LUA A;  4B13 A;  2FT0 A;  1S60 A;  5KTC A;  1Y9K A;  1UFH A;  4E8O A;  1KUV A;  5A28 A;  3E0K A;  1YVO A;  1S5K A;  4MI4 A;  4H6Z A;  4KOU A;  2B4D A;  3FNC A;  2F5I A;  2PDO A;  1B87 A;  3JUW A;  5E96 A;  1RXT A;  4AG9 A;  2P6E A;  4ZGY B;  3W6X A;  4NXY A;  2ZW5 A;  3PZJ A;  2HQY A;  2Y0M A;  4ZBG A;  3TO7 A;  2Z0Z A;  4CYQ A;  4KOV A;  4B10 A;  3R96 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...