4UCPA

Crystal structure of leishmania major n-myristoyltransferase (nmt) with bound myristoyl-coa and a fragment
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
411
structure length
411
Chain Sequence
AHAFWSTQPVPQTEDETEKIVFAGPMDEPKTVADIPEEPYPIASTFEWWTPNMEAADDIHAIYELLRDNYVEDDDSMFRFNYSEEFLQWALCPPNYIPDWHVAVRRKADKKLLAFIAGVPVTLRMGTPKYMKVKAQEKGEGEEAAKYDEPRHICEINFLCVHKQLREKRLAPILIKEATRRVNRTNVWQAVYTAGVLLPTPYASGQYFHRSLNPEKLVEIRFSGIPAQYQKFQNPMAMLKRNYQLPSAPKNSGLREMKPSDVPQVRRILMNYLDSFDVGPVFSDAEISHYLLPRDGVVFTYVVENDKKVTDFFSFYRIPSTVIGNSNYNLLNAAYVHYYAATSIPLHQLILDLLIVAHSRGFDVCNMVEILDNRSFVEQLKFGAGDGHLRYYFYNWAYPKIKPSQVALVML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLYCYLPEPTIDE N-TETRADECANOYLTRANSFERASE
publication title Identification and Structure Solution of Fragment Hits Against Kinetoplastid N-Myristoyltransferase
pubmed doi rcsb
source organism Leishmania major
molecule tags Transferase
total genus 128
structure length 411
sequence length 411
ec nomenclature ec 2.3.1.97: Glycylpeptide N-tetradecanoyltransferase.
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01233 NMT Myristoyl-CoA:protein N-myristoyltransferase, N-terminal domain
A PF02799 NMT_C Myristoyl-CoA:protein N-myristoyltransferase, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.170 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 4ucpA00
5AG4A 4CYNA 4C2ZA 4CGLA 5AG5A 4A32A 4A95A 4C7HA 4A30A 4CAEA 5AG7A 4CGNA 4BBHA 5A27A 4C68A 4CGOA 5G21A 5A28A 4B10A 4B14A 4C2XA 4CGMA 4CYPA 4CGPA 4A31A 5G22A 2YNCC 4UCPA 4UFWA 3IWEA 5AG6A 3IU1A 4B11A 4UFXA 2YNDA 2WSAA 5AGEA 4A33A 3IU2A 4C2YA 5G20A 4CAFA 2YNEA 3H5ZA 4UCMA 4UFVA 4UCNA 3JTKA 5G1ZA 4CYQA 4B13A 2WUUA 4CYOA 4B12A 2YNCA 4C7IA 4A2ZA
chains in the Genus database with same CATH superfamily
4NGPA 1FY7A 3PP9A 3SJEA 1CPXA 2R7HA 5FVJA 2HB6A 3KI9A 3I1UA 3IIBA 3EC4A 1GYTA 4K30A 2DPSA 4DUKA 1CJWA 1RXTA 3EO4A 5G21A 4NXYA 1VHSA 3NH4A 1RTQA 4JWPA 2PVWA 2XEFA 1Z8WA 2JDCA 2FVGA 3CDXA 3PFOA 4FWUA 1P4NA 3TOBA 4PSXA 1I1DA 4OAEA 4NJQA 1VHOA 4ZX9A 2ODFA 4LUAA 1Z2LA 2POKA 3GLJA 4NGTA 5H84A 7CPAA 5THWA 1KZFA 5K8NA 4NCZA 4KOYA 3V7ZA 4OC2A 4B12A 2BL1A 3HLPA 1S5KA 5AG4A 2CF4A 3B7IA 1NE9A 4WJBA 2Q51A 3LMSA 2GANA 1MJ9A 3BJ8A 3BXMA 3QNVA 4II9A 2I3CA 4AXVA 4XPLA 5AG7A 2PQ8A 3PBEA 2EUIA 8CPAA 2EO8A 5K8PA 3PB8X 1TKJA 1M4GA 1YREA 2F7VA 4B14A 4CGMA 3PFEA 1Y9KA 3NH5A 3FEEA 2VBQA 3S6KA 3H5ZA 2IJZA 2HUZA 2Z3MA 2HV2A 3F5BA 4MY0A 2ZEEA 3JUWA 5HMNA 3DR6A 3F0AA 2G0BA 3RBUA 4KVME 3KKWA 3SXOA 1BPMA 1Z5RA 3K9TA 4R6TA 3IEHA 1VKCA 2HC9A 2PE3A 3KR4A 2Z10A 1MK4A 2BOAA 3LACA 4B6ZA 2V8HA 4CAWA 4KOSA 1YVKA 4ZI6A 4ZY2A 1CP6A 3H8EA 4AG9A 4CAEA 5D8NA 5EC4A 1YX0A 1XMTA 2PJ9A 1ARLA 2D4PA 3G3SA 3L2NA 3PZJA 4TNUA 3TT2A 2Q4VA 1TF8A 3PB7X 4BD9A 4CPAA 4PXCA 3D7GA 2YNCC 4H89A 1MJBA 2I00A 2JBKA 4OKOA 4LX9A 4AG7A 4MY3A 1Q7LA 4W9YA 2PIYA 4R3LA 4NF1A 3T90A 2ZXVA 4CS0B 4MFLA 2PJ6A 3KR5A 2YNEA 1DTDA 4F6AA 4UCMA 5F09A 1ON0A 4MFQA 2FIAA 4Y49B 1CX8A 2RC4A 1LANA 1CM0A 4FBEA 3TO9A 1CG2A 4MFPA 4MFKA 5HVGA 2J8MA 4R87A 2O4HA 2BCOA 4ONUA 2H5MA 5DWMA 4CRYB 4LQ6A 4OC0A 2D4OA 2CIJA 3RAMA 5C88A 4M6IA 3SI1A 1IICA 3B3SA 1S7LA 4HPSA 3W6SA 4QBJA 4CGOA 3CXPA 3S6HA 1A2ZA 2OZGA 3RNZA 1IOFA 4KUAA 1ZG9A 4FD5A 4P4BA 1L0CA 1LAPA 4Y49C 4BMHA 4MCSA 2R8VA 3IO1A 4E8OA 1XEBA 4BINA 2K5TA 4YU9A 1QSRA 3CZXA 4KUBA 5KTAA 2REEA 4CYQA 3QAHA 3TX8A 1B87A 4OC5A 4CYOA 1Y7RA 1Y9WA 2ABZA 1YGHA 1HEEA 1F57A 3N5FA 3NH8A 4FUUA 5J8FA 2Q4YA 3FB3A 1Q2YA 3H8FA 3WC6A 5HXDA 4MHZA 2B58A 3HUVA 3V38A 4B5PB 1JQGA 3KL9A 4M6GA 4NGRA 2EVNA 2ZEDA 1VHEA 4PQAA 4X3RA 5A27A 2J9AA 4MI4A 1RO5A 4OC1A 1TKFA 3FXTA 3FBUA 2EBJA 2GLFA 1Z4EA 1HDUA 1IYKA 3GY9A 2AFSA 4U9ZA 4KOUA 3IGRA 3IU1A 3PBBA 2BSWA 1OBRA 3FECA 3WC7A 3DDDA 4IAVA 3K9UA 1X10A 2GE3A 3IWGA 4HNWB 1R57A 3B3TA 4JJXA 4OLLA 5J8CA 5F48A 4KSFA 1CPSA 4ZY1A 3MN8A 1TKHA 1YSJA 1FNOA 4H6UA 4XPKA 4MMOA 3TO6A 1PCAA 4A30A 2GU2A 4UIAA 2PRBA 4NGMA 4O23A 4YRHA 4AVBA 2ZELA 3WABA 1S7KA 1GHEA 1YMEA 2XEJA 4F8ZA 3PB6X 4F0XA 4MJ8A 4CGPA 1KUVA 4A31A 1IU8A 2VL1A 2ZEOA 5LRJA 3ISZA 3IWEA 2R1IA 5LRGA 5AG6A 1CBXA 1AUGA 1S7FA 4B5OA 1M4LA 1XF8A 4X2TA 1M4IA 4P4EA 4JXQA 2CNTA 4NFRA 2QJ8A 5GCNA 4YGOA 4UWIA 3TOAA 2PC1A 1TF9A 2OR4A 3FYNA 1ZLIA 3KHZA 4QUSA 3VH9A 2Z11A 2C27A 3GUXA 2QYVA 4OC4A 2VEZA 3C26A 4QVTA 2OZUA 4ONWA 4P4IA 5E96A 4Q36A 2PJ8A 3K2KA 1XJOA 2ZW6A 4JD6A 3RYOA 3NA6A 3LODA 4XNHC 1ZG8A 4LQGA 2QECA 4OIWA 2PJ3A 1YK3A 5CNPA 4A37A 2YNDA 1Z4RA 2BUEA 1QMUA 4RN7A 2PJBA 1YLEA 3D67A 4KVOE 4OP4A 1YVOA 1NSAA 3KQXA 1S7NA 4UCNA 2XEIA 2WPXA 4H6ZA 1V0CA 4KOXA 3WT4A 3N7ZA 1BLLE 2PSWA 3FRMA 1LCPA 4JZ0A 3LD2A 5IB0A 3D2MA 3KQZA 2FT0A 3WR7A 4A32A 3VWDA 4E2AA 2B4BA 4A95A 4PK3A 1YR0A 3G8WA 2DXQA 4ZX8A 5EBVA 4AVCA 4X5KA 3GKRA 3SJGA 4IK2A 3TE4A 2ZEHA 3SHPA 2B3VA 3JRUA 5LYIA 2VZZA 4IUSA 4UA3A 2OZHA 2C6GA 3S6GA 1MJAA 1UFHA 4E0AA 3FVLA 5JM6A 3IC1A 2P0WA 3OWCA 3IJ3A 3PGPA 2RFHA 1AYEA 1IGBA 3LWUA 3BHXA 3BI1A 2WUUA 1ELLP 2QIRA 3RO0A 2IL4A 2Z3OA 3TC8A 1LAMA 3D7DA 4ZY0A 1BPNA 4G1PA 1I12A 1Z8XA 2J8NA 4XPDC 4C2ZA 4CGLA 4MBUA 4DNCA 2VQYA 2PJ2A 3A9LA 1ELMP 3GB0A 5LYDA 3R95A 1UWYA 2ZW4A 2JEWA 2PJ5A 4MHPA 4MRIA 4BBHA 4A38A 1LFWA 3SI0A 1QQ9A 1R3NA 2PVVA 2Y0MA 5ELYA 1VIXA 4L8AA 5LRKA 5EMIA 3TO7A 1QSNA 1LOKA 2GIVA 4KLWA 2OOTA 3WC5A 5F46A 4AVAA 4HNXB 4UFXA 3SXNA 2B4DA 2WSAA 5I4MA 5JQ4A 4Q38A 2PR8A 4UEZA 4PXBA 4P45A 4ZGYB 3D8PA 2Z3NA 3BJ7A 4A39A 4WWVA 5G1ZA 3QAYA 2P6FA 2I79A 4C7IA 3NE7A 5F49A 4PSWA 2NYQA 2O53A 1H8LA 4A94A 5HVFA 3CXSA 5ISVA 2Z3PA 4R9MA 1XE4A 2KCWA 2GLJA 4JXRA 1WK4A 4UIBA 1P0HA 3DLJA 5G22A 2IQ6A 2Q43A 4R7MA 2AE6A 2WYRA 2ZW7A 1PUAA 4ORFA 4TWEA 5LYLA 2IMOA 2B5GA 4A33A 4FAIA 5D29A 2AFWA 2EK8A 1IIDA 4QB9A 2V8GA 1ZO0A 1OZPA 2FS5A 3FEDA 4GXHA 3D7FA 4NEXA 4EWTA 3TFYA 3FF3A 1PU9A 1XMBA 5H86A 4YFJA 2OU2A 3IWWA 1DE4C 3JVNA 1QSTA 4NGQA 2FXFA 4RI1A 2P6GA 4FD6A 4MFJA 2ZW5A 2C6PA 4K3NA 1VGYA 3GYAA 2X7BA 3MRUA 2JDDA 3E0KA 1KUYA 1BO4A 4JYWA 4C68A 3I9SA 4OIDA 3PRTA 2PDOA 5K8MA 1IOIA 4U5YA 2PJAA 1X12A 3NFZA 2XEGA 2FIWA 4GS4A 1S3ZA 4MHNA 3S9MA 3I3GA 5K8OA 1I21A 3B2YA 2AJ6A 4XNHB 1IB1E 4M85A 4NSQA 2ZEPA 3D2PA 3CT9A 5C82A 3VWEA 5LYFA 3DSBA 4L89A 4R57A 4A2ZA 4M6HA 3BLNA 4RUHA 3S6FA 1XIXA 2PJ0A 3SJXA 3TCVA 2WPWA 5IX3A 1N71A 4RS2A 2FSRA 1B6BA 1R43A 3R96A 2O28A 3H4QA 4PPZA 3VATA 2ZPAA 1U6MA 3CXQA 1Z8TA 2EWBA 1CP7A 4NJRA 4GM5A 4KLVA 2PJ7A 2FE7A 2FL4A 1JWQA 4J3GA 3KASA 2ZENA 3CPXA 3IU2A 4FD7A 3GIUA 2PIZA 4CAXA 4Q7AA 1Y0YA 1ZLHA 2DF5A 4UFVA 3ZZIA 1ZG7A 3B3VA 4OC3A 4UF4A 1XBUA 2PR1A 2J8RA 4KSIA 2YNCA 3FX6A 1NSLA 2VZYA 2Z3KA 2GREA 2ARHA 1M1DA 1YW4A 3TTHA 2F8HA 3KHXA 2ZEMA 3W6XA 1TXRA 3KZWA 4F9UA 3BI0A 1QSOA 3ZJ0A 3EFAA 3W91A 4CGNA 2GFQA 1KWMA 2C6CA 3DR8A 2FCKA 5A28A 4F0YA 4B10A 4R3KA 2V8DA 4XPDB 3VARA 1TIQA 4CRZB 5HVHA 2CTBA 3R9GA 4UCPA 4NGSA 2VI7A 5HH1A 4H2KA 4X8IA 3T8WA 1IY7A 3B35A 4KVXA 4OMEA 2AFOA 1SQHA 1KUXA 3D7HA 2PRQA 2Z3LA 4KS9A 4MFZA 4UBRA 2BEIA 5G20A 3B8GA 4CAFA 4Z65A 1EE3P 2BO9A 5KTDA 4MCRA 3JTKA 3P2FA 4OADA 3V8IA 5KTCA 2DEAA 4CAVA 5JPHA 4NGNA 2R98A 3R9EA 3D66A 1FT7A 2QVPA 2G9DA 5BWAB 2Q4ZA 3R9FA 5JGFA 3D68A 4KSAA 2AFZA 3SJFA 1J4JA 4MXUA 3S9LA 4JLYA 4P44A 4MCQA 3D3SA 4C2XA 4P4DA 4KORA 1QSMA 4UFWA 3R1KA 4UWJA 1F2PA 2REFA 2Q0YA 5DS0A 2PJCA 4C2YA 3DGVA 1WWZA 3SI2A 2G3TA 3ISXA 3FJUA 3EXNA 3NE8A 1XOVA 4KOWA 3F8KA 4PV6A 4P10A 2AFMA 2ZOFA 3FMCA 5JH9A 4EFDA 4PXDA 2G3AA 3S9NA 1AMPA 2CNSA 3DNSA 3QB8A 1Z9UA 4C7HA 2Z0ZA 1YLOA 2CY2A 1M44A 4P4FA 5IV0A 1S60A 1BAVA 2ZOGA 3PB9X 2B4DB 4PXEA 4YWYA 2HQYA 4HKFA 4B5PA 4FD4A 3FH4A 1XFOA 2OH1A 2AFUA 4I49A 1Q2DA 2B3UA 1ARMA 4MHYA 4CYNA 1IYLA 2V8VA 3UY5A 3B3WA 5AGEA 2RB7A 4M3SA 2C1CA 3B3CA 1NMTA 5DWNA 2CTCA 3IFEA 2Q7BA 6CPAA 1XRYA 2F5IA 2AFXA 1YW6A 2PCUA 4IHMA 2QMLA 2VXKA 4DYOA 4PK2A 1K4JA 4EMEA 1M4DA 2JEVA 5J1QA 2JBJA 2PJ4A 3FNCA 3CPAA 1Z8LA 2DPTA 4UEEA 4B13A 2A4NA 4P6YA 3FIXA 2WZNA 3D4UA 2JLMA 4F9VA 3H8GA 4EVYA 4ZYQA 3MGDA 3PB4X 1HDQA 2ANPA 3RZAA 5I0CA 4R76A 2OB0A 5AG5A 2PJ1A 2CXAA 4MCPA 4U9YA 3PEIA 2ATRA 5CPAA 1F2OA 1BOBA 2YGWA 4P4JA 2B5GB 1LRZA 3P2HA 2CNMA 2Q7SA 4CYPA 1Q2CA 5CBMA 1PYTB 4DJLA 4AB7A 2P6EA 4QC6A 5F47A 4B11A 4ZBGA 5IB9A 4KOVA 1Y7EA 4KOTA 2ZEFA 1Y0RA 2NSMA 2Q44A 3T9YA 2EK9A 2NMTA 4KZTA 2Q04A 4R8FA 4MHDA 3KGQA 4HNYB 1YQEA 4UEFA 3EY5A 4IF5A 2V77A 2ZEGA
chains in the Genus database with same CATH topology
1FY7A 3PP9A 2R7HA 5FVJA 3EC4A 4K30A 2DPSA 1CJWA 1RXTA 3EO4A 5G21A 4NXYA 1VHSA 4JWPA 2JDCA 1P4NA 3TOBA 4PSXA 1I1DA 4OAEA 4LUAA 5H84A 1KZFA 4NCZA 4KOYA 4B12A 2BL1A 1S5KA 5AG4A 1NE9A 2GANA 1MJ9A 3BJ8A 4II9A 4XPLA 5AG7A 2PQ8A 2EUIA 1M4GA 1YREA 4B14A 4CGMA 1Y9KA 2VBQA 3S6KA 3H5ZA 2HUZA 2Z3MA 2HV2A 3F5BA 4MY0A 3JUWA 5HMNA 3DR6A 3F0AA 2G0BA 4KVME 3KKWA 3SXOA 1VKCA 4CYNA 2Z10A 1MK4A 4CAWA 4KOSA 1YVKA 4AG9A 4CAEA 5EC4A 1YX0A 1XMTA 3PZJA 2D4PA 3G3SA 3TT2A 2Q4VA 2YNCC 4H89A 1MJBA 2I00A 4LX9A 4AG7A 4MY3A 4R3LA 4NF1A 3T90A 2ZXVA 4CS0B 4MFLA 2YNEA 4F6AA 4UCMA 1ON0A 4MFQA 2FIAA 4Y49B 2RC4A 1CM0A 3TO9A 4MFPA 4MFKA 2J8MA 4R87A 4ONUA 5DWMA 2H5MA 4CRYB 2D4OA 5C88A 1IICA 1S7LA 3W6SA 4QBJA 4CGOA 3CXPA 3S6HA 2OZGA 4KUAA 4FD5A 1L0CA 4Y49C 4BMHA 2R8VA 4E8OA 1XEBA 2K5TA 1QSRA 4KUBA 5KTAA 2REEA 4CYQA 3QAHA 1B87A 4CYOA 1Y7RA 1Y9WA 1YGHA 5J8FA 2Q4YA 3FB3A 1Q2YA 4B5PB 2B58A 2EVNA 5A27A 4MI4A 1RO5A 3FXTA 3FBUA 1Z4EA 1IYKA 3GY9A 4U9ZA 4KOUA 3IGRA 3IU1A 2BSWA 3DDDA 3K9UA 2GE3A 3IWGA 4HNWB 1R57A 4JJXA 4OLLA 5J8CA 5F48A 4KSFA 4H6UA 4XPKA 3TO6A 4A30A 2PRBA 4YRHA 4AVBA 1S7KA 1GHEA 4F0XA 4MJ8A 4CGPA 1KUVA 4A31A 3IWEA 2R1IA 5AG6A 1S7FA 4B5OA 1XF8A 1M4IA 4JXQA 2CNTA 5GCNA 3TOAA 4YGOA 4UWIA 2PC1A 3FYNA 4QUSA 2Z11A 2C27A 2VEZA 3C26A 4QVTA 2OZUA 5E96A 4Q36A 4JD6A 2ZW6A 3RYOA 4XNHC 3LODA 2QECA 1YK3A 5CNPA 2YNDA 1Z4RA 2BUEA 1YLEA 4KVOE 1YVOA 1S7NA 4UCNA 4H6ZA 2WPXA 4KOXA 1V0CA 3N7ZA 2PSWA 3FRMA 3LD2A 5IB0A 3D2MA 4E2AA 2FT0A 3WR7A 4A32A 3VWDA 2B4BA 4A95A 4PK3A 1YR0A 3G8WA 2DXQA 5EBVA 4AVCA 4X5KA 3GKRA 3TE4A 3SHPA 2B3VA 2VZZA 4IUSA 4UA3A 2OZHA 3S6GA 1MJAA 1UFHA 4E0AA 2P0WA 3OWCA 3PGPA 2WUUA 2QIRA 2IL4A 2Z3OA 1I12A 2J8NA 4C2ZA 4XPDC 4CGLA 4MBUA 4DNCA 2VQYA 3A9LA 3R95A 2ZW4A 4BBHA 2Y0MA 4L8AA 3TO7A 1QSNA 4KLWA 2GIVA 5F46A 4AVAA 4HNXB 4UFXA 3SXNA 2B4DA 2WSAA 5JQ4A 4Q38A 2PR8A 4ZGYB 3D8PA 2Z3NA 3BJ7A 5G1ZA 2P6FA 2I79A 4C7IA 3NE7A 5F49A 4PSWA 3CXSA 5ISVA 2Z3PA 4R9MA 1XE4A 2KCWA 4JXRA 1WK4A 1P0HA 5G22A 2AE6A 4ORFA 2ZW7A 1PUAA 2B5GA 4A33A 1IIDA 4QB9A 1ZO0A 1OZPA 2FS5A 4NEXA 3TFYA 1PU9A 5H86A 4YFJA 2OU2A 3JVNA 1QSTA 4RI1A 2FXFA 2P6GA 4FD6A 4MFJA 2ZW5A 3GYAA 2X7BA 2JDDA 3E0KA 1KUYA 1BO4A 4C68A 3I9SA 2PDOA 4U5YA 2FIWA 4GS4A 1S3ZA 3I3GA 1I21A 4XNHB 2AJ6A 1IB1E 4M85A 4NSQA 3D2PA 5C82A 3VWEA 3DSBA 4L89A 4R57A 4A2ZA 3BLNA 3S6FA 1XIXA 3TCVA 2WPWA 5IX3A 1N71A 4RS2A 2FSRA 1B6BA 3R96A 2O28A 3H4QA 2ZPAA 1U6MA 3CXQA 4KLVA 2FE7A 2FL4A 4J3GA 3IU2A 4FD7A 4CAXA 3ZZIA 4UFVA 2PR1A 1NSLA 2J8RA 2YNCA 2Z3KA 2VZYA 2ARHA 1M1DA 3TTHA 3W6XA 1QSOA 3ZJ0A 3EFAA 3W91A 4CGNA 3DR8A 2FCKA 5A28A 4F0YA 4B10A 4R3KA 4XPDB 1TIQA 4CRZB 3R9GA 4UCPA 2VI7A 5HH1A 4KVXA 1SQHA 1KUXA 4MFZA 5G20A 2Z3LA 4KS9A 4UBRA 4CAFA 2BEIA 3B8GA 5KTDA 3JTKA 3P2FA 4OADA 3V8IA 5KTCA 4CAVA 5JPHA 2R98A 3R9EA 5BWAB 3R9FA 4KSAA 1J4JA 4JLYA 3D3SA 4C2XA 4KORA 1QSMA 4UFWA 3R1KA 4UWJA 2REFA 2Q0YA 4C2YA 1WWZA 2G3TA 3EXNA 4KOWA 3F8KA 4PV6A 2G3AA 2CNSA 3DNSA 3QB8A 1Z9UA 4C7HA 2Z0ZA 2CY2A 1M44A 5IV0A 1S60A 2B4DB 2HQYA 4HKFA 4B5PA 4FD4A 2OH1A 4I49A 1Q2DA 2B3UA 1IYLA 3UY5A 5AGEA 4M3SA 2Q7BA 1NMTA 5DWNA 2F5IA 2QMLA 2VXKA 4PK2A 1K4JA 1M4DA 2JEVA 3FNCA 2DPTA 4B13A 2A4NA 3FIXA 2JLMA 4EVYA 3MGDA 5I0CA 5AG5A 2OB0A 2CXAA 4U9YA 2ATRA 1BOBA 2YGWA 2B5GB 1LRZA 3P2HA 2CNMA 4CYPA 1Q2CA 4AB7A 2P6EA 4QC6A 5F47A 4B11A 4ZBGA 4KOVA 4KOTA 2Q44A 3T9YA 2NMTA 4KZTA 2Q04A 4MHDA 4HNYB 3EY5A 4IF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AG4 A;  4CYN A;  4C2Z A;  4CGL A;  5AG5 A;  4A32 A;  4A95 A;  4C7H A;  4A30 A;  4CAE A;  5AG7 A;  4CGN A;  4BBH A;  5A27 A;  4C68 A;  4CGO A;  5G21 A;  5A28 A;  4B10 A;  4B14 A;  4C2X A;  4CGM A;  4CYP A;  4CGP A;  4A31 A;  5G22 A;  2YNC C;  4UCP A;  4UFW A;  3IWE A;  5AG6 A;  3IU1 A;  4B11 A;  4UFX A;  2YND A;  2WSA A;  5AGE A;  4A33 A;  3IU2 A;  4C2Y A;  5G20 A;  4CAF A;  2YNE A;  3H5Z A;  4UCM A;  4UFV A;  4UCN A;  3JTK A;  5G1Z A;  4CYQ A;  4B13 A;  2WUU A;  4CYO A;  4B12 A;  2YNC A;  4C7I A;  4A2Z A; 
#chains in the Genus database with same CATH topology
 4NGP A;  1FY7 A;  3PP9 A;  3SJE A;  1CPX A;  2R7H A;  5FVJ A;  2HB6 A;  3KI9 A;  3I1U A;  3IIB A;  3EC4 A;  1GYT A;  4K30 A;  2DPS A;  4DUK A;  1CJW A;  1RXT A;  3EO4 A;  5G21 A;  4NXY A;  1VHS A;  3NH4 A;  1RTQ A;  4JWP A;  2PVW A;  2XEF A;  1Z8W A;  2JDC A;  2FVG A;  3CDX A;  3PFO A;  4FWU A;  1P4N A;  3TOB A;  4PSX A;  1I1D A;  4OAE A;  4NJQ A;  1VHO A;  4ZX9 A;  2ODF A;  4LUA A;  1Z2L A;  2POK A;  3GLJ A;  4NGT A;  5H84 A;  7CPA A;  5THW A;  1KZF A;  5K8N A;  4NCZ A;  4KOY A;  3V7Z A;  4OC2 A;  4B12 A;  2BL1 A;  3HLP A;  1S5K A;  5AG4 A;  2CF4 A;  3B7I A;  1NE9 A;  4WJB A;  2Q51 A;  3LMS A;  2GAN A;  1MJ9 A;  3BJ8 A;  3BXM A;  3QNV A;  4II9 A;  2I3C A;  4AXV A;  4XPL A;  5AG7 A;  2PQ8 A;  3PBE A;  2EUI A;  8CPA A;  2EO8 A;  5K8P A;  3PB8 X;  1TKJ A;  1M4G A;  1YRE A;  2F7V A;  4B14 A;  4CGM A;  3PFE A;  1Y9K A;  3NH5 A;  3FEE A;  2VBQ A;  3S6K A;  3H5Z A;  2IJZ A;  2HUZ A;  2Z3M A;  2HV2 A;  3F5B A;  4MY0 A;  2ZEE A;  3JUW A;  5HMN A;  3DR6 A;  3F0A A;  2G0B A;  3RBU A;  4KVM E;  3KKW A;  3SXO A;  1BPM A;  1Z5R A;  3K9T A;  4R6T A;  3IEH A;  1VKC A;  2HC9 A;  2PE3 A;  3KR4 A;  2Z10 A;  1MK4 A;  2BOA A;  3LAC A;  4B6Z A;  2V8H A;  4CAW A;  4KOS A;  1YVK A;  4ZI6 A;  4ZY2 A;  1CP6 A;  3H8E A;  4AG9 A;  4CAE A;  5D8N A;  5EC4 A;  1YX0 A;  1XMT A;  2PJ9 A;  1ARL A;  2D4P A;  3G3S A;  3L2N A;  3PZJ A;  4TNU A;  3TT2 A;  2Q4V A;  1TF8 A;  3PB7 X;  4BD9 A;  4CPA A;  4PXC A;  3D7G A;  2YNC C;  4H89 A;  1MJB A;  2I00 A;  2JBK A;  4OKO A;  4LX9 A;  4AG7 A;  4MY3 A;  1Q7L A;  4W9Y A;  2PIY A;  4R3L A;  4NF1 A;  3T90 A;  2ZXV A;  4CS0 B;  4MFL A;  2PJ6 A;  3KR5 A;  2YNE A;  1DTD A;  4F6A A;  4UCM A;  5F09 A;  1ON0 A;  4MFQ A;  2FIA A;  4Y49 B;  1CX8 A;  2RC4 A;  1LAN A;  1CM0 A;  4FBE A;  3TO9 A;  1CG2 A;  4MFP A;  4MFK A;  5HVG A;  2J8M A;  4R87 A;  2O4H A;  2BCO A;  4ONU A;  2H5M A;  5DWM A;  4CRY B;  4LQ6 A;  4OC0 A;  2D4O A;  2CIJ A;  3RAM A;  5C88 A;  4M6I A;  3SI1 A;  1IIC A;  3B3S A;  1S7L A;  4HPS A;  3W6S A;  4QBJ A;  4CGO A;  3CXP A;  3S6H A;  1A2Z A;  2OZG A;  3RNZ A;  1IOF A;  4KUA A;  1ZG9 A;  4FD5 A;  4P4B A;  1L0C A;  1LAP A;  4Y49 C;  4BMH A;  4MCS A;  2R8V A;  3IO1 A;  4E8O A;  1XEB A;  4BIN A;  2K5T A;  4YU9 A;  1QSR A;  3CZX A;  4KUB A;  5KTA A;  2REE A;  4CYQ A;  3QAH A;  3TX8 A;  1B87 A;  4OC5 A;  4CYO A;  1Y7R A;  1Y9W A;  2ABZ A;  1YGH A;  1HEE A;  1F57 A;  3N5F A;  3NH8 A;  4FUU A;  5J8F A;  2Q4Y A;  3FB3 A;  1Q2Y A;  3H8F A;  3WC6 A;  5HXD A;  4MHZ A;  2B58 A;  3HUV A;  3V38 A;  4B5P B;  1JQG A;  3KL9 A;  4M6G A;  4NGR A;  2EVN A;  2ZED A;  1VHE A;  4PQA A;  4X3R A;  5A27 A;  2J9A A;  4MI4 A;  1RO5 A;  4OC1 A;  1TKF A;  3FXT A;  3FBU A;  2EBJ A;  2GLF A;  1Z4E A;  1HDU A;  1IYK A;  3GY9 A;  2AFS A;  4U9Z A;  4KOU A;  3IGR A;  3IU1 A;  3PBB A;  2BSW A;  1OBR A;  3FEC A;  3WC7 A;  3DDD A;  4IAV A;  3K9U A;  1X10 A;  2GE3 A;  3IWG A;  4HNW B;  1R57 A;  3B3T A;  4JJX A;  4OLL A;  5J8C A;  5F48 A;  4KSF A;  1CPS A;  4ZY1 A;  3MN8 A;  1TKH A;  1YSJ A;  1FNO A;  4H6U A;  4XPK A;  4MMO A;  3TO6 A;  1PCA A;  4A30 A;  2GU2 A;  4UIA A;  2PRB A;  4NGM A;  4O23 A;  4YRH A;  4AVB A;  2ZEL A;  3WAB A;  1S7K A;  1GHE A;  1YME A;  2XEJ A;  4F8Z A;  3PB6 X;  4F0X A;  4MJ8 A;  4CGP A;  1KUV A;  4A31 A;  1IU8 A;  2VL1 A;  2ZEO A;  5LRJ A;  3ISZ A;  3IWE A;  2R1I A;  5LRG A;  5AG6 A;  1CBX A;  1AUG A;  1S7F A;  4B5O A;  1M4L A;  1XF8 A;  4X2T A;  1M4I A;  4P4E A;  4JXQ A;  2CNT A;  4NFR A;  2QJ8 A;  5GCN A;  4YGO A;  4UWI A;  3TOA A;  2PC1 A;  1TF9 A;  2OR4 A;  3FYN A;  1ZLI A;  3KHZ A;  4QUS A;  3VH9 A;  2Z11 A;  2C27 A;  3GUX A;  2QYV A;  4OC4 A;  2VEZ A;  3C26 A;  4QVT A;  2OZU A;  4ONW A;  4P4I A;  5E96 A;  4Q36 A;  2PJ8 A;  3K2K A;  1XJO A;  2ZW6 A;  4JD6 A;  3RYO A;  3NA6 A;  3LOD A;  4XNH C;  1ZG8 A;  4LQG A;  2QEC A;  4OIW A;  2PJ3 A;  1YK3 A;  5CNP A;  4A37 A;  2YND A;  1Z4R A;  2BUE A;  1QMU A;  4RN7 A;  2PJB A;  1YLE A;  3D67 A;  4KVO E;  4OP4 A;  1YVO A;  1NSA A;  3KQX A;  1S7N A;  4UCN A;  2XEI A;  2WPX A;  4H6Z A;  1V0C A;  4KOX A;  3WT4 A;  3N7Z A;  1BLL E;  2PSW A;  3FRM A;  1LCP A;  4JZ0 A;  3LD2 A;  5IB0 A;  3D2M A;  3KQZ A;  2FT0 A;  3WR7 A;  4A32 A;  3VWD A;  4E2A A;  2B4B A;  4A95 A;  4PK3 A;  1YR0 A;  3G8W A;  2DXQ A;  4ZX8 A;  5EBV A;  4AVC A;  4X5K A;  3GKR A;  3SJG A;  4IK2 A;  3TE4 A;  2ZEH A;  3SHP A;  2B3V A;  3JRU A;  5LYI A;  2VZZ A;  4IUS A;  4UA3 A;  2OZH A;  2C6G A;  3S6G A;  1MJA A;  1UFH A;  4E0A A;  3FVL A;  5JM6 A;  3IC1 A;  2P0W A;  3OWC A;  3IJ3 A;  3PGP A;  2RFH A;  1AYE A;  1IGB A;  3LWU A;  3BHX A;  3BI1 A;  2WUU A;  1ELL P;  2QIR A;  3RO0 A;  2IL4 A;  2Z3O A;  3TC8 A;  1LAM A;  3D7D A;  4ZY0 A;  1BPN A;  4G1P A;  1I12 A;  1Z8X A;  2J8N A;  4XPD C;  4C2Z A;  4CGL A;  4MBU A;  4DNC A;  2VQY A;  2PJ2 A;  3A9L A;  1ELM P;  3GB0 A;  5LYD A;  3R95 A;  1UWY A;  2ZW4 A;  2JEW A;  2PJ5 A;  4MHP A;  4MRI A;  4BBH A;  4A38 A;  1LFW A;  3SI0 A;  1QQ9 A;  1R3N A;  2PVV A;  2Y0M A;  5ELY A;  1VIX A;  4L8A A;  5LRK A;  5EMI A;  3TO7 A;  1QSN A;  1LOK A;  2GIV A;  4KLW A;  2OOT A;  3WC5 A;  5F46 A;  4AVA A;  4HNX B;  4UFX A;  3SXN A;  2B4D A;  2WSA A;  5I4M A;  5JQ4 A;  4Q38 A;  2PR8 A;  4UEZ A;  4PXB A;  4P45 A;  4ZGY B;  3D8P A;  2Z3N A;  3BJ7 A;  4A39 A;  4WWV A;  5G1Z A;  3QAY A;  2P6F A;  2I79 A;  4C7I A;  3NE7 A;  5F49 A;  4PSW A;  2NYQ A;  2O53 A;  1H8L A;  4A94 A;  5HVF A;  3CXS A;  5ISV A;  2Z3P A;  4R9M A;  1XE4 A;  2KCW A;  2GLJ A;  4JXR A;  1WK4 A;  4UIB A;  1P0H A;  3DLJ A;  5G22 A;  2IQ6 A;  2Q43 A;  4R7M A;  2AE6 A;  2WYR A;  2ZW7 A;  1PUA A;  4ORF A;  4TWE A;  5LYL A;  2IMO A;  2B5G A;  4A33 A;  4FAI A;  5D29 A;  2AFW A;  2EK8 A;  1IID A;  4QB9 A;  2V8G A;  1ZO0 A;  1OZP A;  2FS5 A;  3FED A;  4GXH A;  3D7F A;  4NEX A;  4EWT A;  3TFY A;  3FF3 A;  1PU9 A;  1XMB A;  5H86 A;  4YFJ A;  2OU2 A;  3IWW A;  1DE4 C;  3JVN A;  1QST A;  4NGQ A;  2FXF A;  4RI1 A;  2P6G A;  4FD6 A;  4MFJ A;  2ZW5 A;  2C6P A;  4K3N A;  1VGY A;  3GYA A;  2X7B A;  3MRU A;  2JDD A;  3E0K A;  1KUY A;  1BO4 A;  4JYW A;  4C68 A;  3I9S A;  4OID A;  3PRT A;  2PDO A;  5K8M A;  1IOI A;  4U5Y A;  2PJA A;  1X12 A;  3NFZ A;  2XEG A;  2FIW A;  4GS4 A;  1S3Z A;  4MHN A;  3S9M A;  3I3G A;  5K8O A;  1I21 A;  3B2Y A;  2AJ6 A;  4XNH B;  1IB1 E;  4M85 A;  4NSQ A;  2ZEP A;  3D2P A;  3CT9 A;  5C82 A;  3VWE A;  5LYF A;  3DSB A;  4L89 A;  4R57 A;  4A2Z A;  4M6H A;  3BLN A;  4RUH A;  3S6F A;  1XIX A;  2PJ0 A;  3SJX A;  3TCV A;  2WPW A;  5IX3 A;  1N71 A;  4RS2 A;  2FSR A;  1B6B A;  1R43 A;  3R96 A;  2O28 A;  3H4Q A;  4PPZ A;  3VAT A;  2ZPA A;  1U6M A;  3CXQ A;  1Z8T A;  2EWB A;  1CP7 A;  4NJR A;  4GM5 A;  4KLV A;  2PJ7 A;  2FE7 A;  2FL4 A;  1JWQ A;  4J3G A;  3KAS A;  2ZEN A;  3CPX A;  3IU2 A;  4FD7 A;  3GIU A;  2PIZ A;  4CAX A;  4Q7A A;  1Y0Y A;  1ZLH A;  2DF5 A;  4UFV A;  3ZZI A;  1ZG7 A;  3B3V A;  4OC3 A;  4UF4 A;  1XBU A;  2PR1 A;  2J8R A;  4KSI A;  2YNC A;  3FX6 A;  1NSL A;  2VZY A;  2Z3K A;  2GRE A;  2ARH A;  1M1D A;  1YW4 A;  3TTH A;  2F8H A;  3KHX A;  2ZEM A;  3W6X A;  1TXR A;  3KZW A;  4F9U A;  3BI0 A;  1QSO A;  3ZJ0 A;  3EFA A;  3W91 A;  4CGN A;  2GFQ A;  1KWM A;  2C6C A;  3DR8 A;  2FCK A;  5A28 A;  4F0Y A;  4B10 A;  4R3K A;  2V8D A;  4XPD B;  3VAR A;  1TIQ A;  4CRZ B;  5HVH A;  2CTB A;  3R9G A;  4UCP A;  4NGS A;  2VI7 A;  5HH1 A;  4H2K A;  4X8I A;  3T8W A;  1IY7 A;  3B35 A;  4KVX A;  4OME A;  2AFO A;  1SQH A;  1KUX A;  3D7H A;  2PRQ A;  2Z3L A;  4KS9 A;  4MFZ A;  4UBR A;  2BEI A;  5G20 A;  3B8G A;  4CAF A;  4Z65 A;  1EE3 P;  2BO9 A;  5KTD A;  4MCR A;  3JTK A;  3P2F A;  4OAD A;  3V8I A;  5KTC A;  2DEA A;  4CAV A;  5JPH A;  4NGN A;  2R98 A;  3R9E A;  3D66 A;  1FT7 A;  2QVP A;  2G9D A;  5BWA B;  2Q4Z A;  3R9F A;  5JGF A;  3D68 A;  4KSA A;  2AFZ A;  3SJF A;  1J4J A;  4MXU A;  3S9L A;  4JLY A;  4P44 A;  4MCQ A;  3D3S A;  4C2X A;  4P4D A;  4KOR A;  1QSM A;  4UFW A;  3R1K A;  4UWJ A;  1F2P A;  2REF A;  2Q0Y A;  5DS0 A;  2PJC A;  4C2Y A;  3DGV A;  1WWZ A;  3SI2 A;  2G3T A;  3ISX A;  3FJU A;  3EXN A;  3NE8 A;  1XOV A;  4KOW A;  3F8K A;  4PV6 A;  4P10 A;  2AFM A;  2ZOF A;  3FMC A;  5JH9 A;  4EFD A;  4PXD A;  2G3A A;  3S9N A;  1AMP A;  2CNS A;  3DNS A;  3QB8 A;  1Z9U A;  4C7H A;  2Z0Z A;  1YLO A;  2CY2 A;  1M44 A;  4P4F A;  5IV0 A;  1S60 A;  1BAV A;  2ZOG A;  3PB9 X;  2B4D B;  4PXE A;  4YWY A;  2HQY A;  4HKF A;  4B5P A;  4FD4 A;  3FH4 A;  1XFO A;  2OH1 A;  2AFU A;  4I49 A;  1Q2D A;  2B3U A;  1ARM A;  4MHY A;  4CYN A;  1IYL A;  2V8V A;  3UY5 A;  3B3W A;  5AGE A;  2RB7 A;  4M3S A;  2C1C A;  3B3C A;  1NMT A;  5DWN A;  2CTC A;  3IFE A;  2Q7B A;  6CPA A;  1XRY A;  2F5I A;  2AFX A;  1YW6 A;  2PCU A;  4IHM A;  2QML A;  2VXK A;  4DYO A;  4PK2 A;  1K4J A;  4EME A;  1M4D A;  2JEV A;  5J1Q A;  2JBJ A;  2PJ4 A;  3FNC A;  3CPA A;  1Z8L A;  2DPT A;  4UEE A;  4B13 A;  2A4N A;  4P6Y A;  3FIX A;  2WZN A;  3D4U A;  2JLM A;  4F9V A;  3H8G A;  4EVY A;  4ZYQ A;  3MGD A;  3PB4 X;  1HDQ A;  2ANP A;  3RZA A;  5I0C A;  4R76 A;  2OB0 A;  5AG5 A;  2PJ1 A;  2CXA A;  4MCP A;  4U9Y A;  3PEI A;  2ATR A;  5CPA A;  1F2O A;  1BOB A;  2YGW A;  4P4J A;  2B5G B;  1LRZ A;  3P2H A;  2CNM A;  2Q7S A;  4CYP A;  1Q2C A;  5CBM A;  1PYT B;  4DJL A;  4AB7 A;  2P6E A;  4QC6 A;  5F47 A;  4B11 A;  4ZBG A;  5IB9 A;  4KOV A;  1Y7E A;  4KOT A;  2ZEF A;  1Y0R A;  2NSM A;  2Q44 A;  3T9Y A;  2EK9 A;  2NMT A;  4KZT A;  2Q04 A;  4R8F A;  4MHD A;  3KGQ A;  4HNY B;  1YQE A;  4UEF A;  3EY5 A;  4IF5 A;  2V77 A;  2ZEG A; 
#chains in the Genus database with same CATH homology
 1FY7 A;  3PP9 A;  2R7H A;  5FVJ A;  3EC4 A;  4K30 A;  2DPS A;  1CJW A;  1RXT A;  3EO4 A;  5G21 A;  4NXY A;  1VHS A;  4JWP A;  2JDC A;  1P4N A;  3TOB A;  4PSX A;  1I1D A;  4OAE A;  4LUA A;  5H84 A;  1KZF A;  4NCZ A;  4KOY A;  4B12 A;  2BL1 A;  1S5K A;  5AG4 A;  1NE9 A;  2GAN A;  1MJ9 A;  3BJ8 A;  4II9 A;  4XPL A;  5AG7 A;  2PQ8 A;  2EUI A;  1M4G A;  1YRE A;  4B14 A;  4CGM A;  1Y9K A;  2VBQ A;  3S6K A;  3H5Z A;  2HUZ A;  2Z3M A;  2HV2 A;  3F5B A;  4MY0 A;  3JUW A;  5HMN A;  3DR6 A;  3F0A A;  2G0B A;  4KVM E;  3KKW A;  3SXO A;  1VKC A;  4CYN A;  2Z10 A;  1MK4 A;  4CAW A;  4KOS A;  1YVK A;  4AG9 A;  4CAE A;  5EC4 A;  1YX0 A;  1XMT A;  3PZJ A;  2D4P A;  3G3S A;  3TT2 A;  2Q4V A;  2YNC C;  4H89 A;  1MJB A;  2I00 A;  4LX9 A;  4AG7 A;  4MY3 A;  4R3L A;  4NF1 A;  3T90 A;  2ZXV A;  4CS0 B;  4MFL A;  2YNE A;  4F6A A;  4UCM A;  1ON0 A;  4MFQ A;  2FIA A;  4Y49 B;  2RC4 A;  1CM0 A;  3TO9 A;  4MFP A;  4MFK A;  2J8M A;  4R87 A;  4ONU A;  5DWM A;  2H5M A;  4CRY B;  2D4O A;  5C88 A;  1IIC A;  1S7L A;  3W6S A;  4QBJ A;  4CGO A;  3CXP A;  3S6H A;  2OZG A;  4KUA A;  4FD5 A;  1L0C A;  4Y49 C;  4BMH A;  2R8V A;  4E8O A;  1XEB A;  2K5T A;  1QSR A;  4KUB A;  5KTA A;  2REE A;  4CYQ A;  3QAH A;  1B87 A;  4CYO A;  1Y7R A;  1Y9W A;  1YGH A;  5J8F A;  2Q4Y A;  3FB3 A;  1Q2Y A;  4B5P B;  2B58 A;  2EVN A;  5A27 A;  4MI4 A;  1RO5 A;  3FXT A;  3FBU A;  1Z4E A;  1IYK A;  3GY9 A;  4U9Z A;  4KOU A;  3IGR A;  3IU1 A;  2BSW A;  3DDD A;  3K9U A;  2GE3 A;  3IWG A;  4HNW B;  1R57 A;  4JJX A;  4OLL A;  5J8C A;  5F48 A;  4KSF A;  4H6U A;  4XPK A;  3TO6 A;  4A30 A;  2PRB A;  4YRH A;  4AVB A;  1S7K A;  1GHE A;  4F0X A;  4MJ8 A;  4CGP A;  1KUV A;  4A31 A;  3IWE A;  2R1I A;  5AG6 A;  1S7F A;  4B5O A;  1XF8 A;  1M4I A;  4JXQ A;  2CNT A;  5GCN A;  3TOA A;  4YGO A;  4UWI A;  2PC1 A;  3FYN A;  4QUS A;  2Z11 A;  2C27 A;  2VEZ A;  3C26 A;  4QVT A;  2OZU A;  5E96 A;  4Q36 A;  4JD6 A;  2ZW6 A;  3RYO A;  4XNH C;  3LOD A;  2QEC A;  1YK3 A;  5CNP A;  2YND A;  1Z4R A;  2BUE A;  1YLE A;  4KVO E;  1YVO A;  1S7N A;  4UCN A;  4H6Z A;  2WPX A;  4KOX A;  1V0C A;  3N7Z A;  2PSW A;  3FRM A;  3LD2 A;  5IB0 A;  3D2M A;  4E2A A;  2FT0 A;  3WR7 A;  4A32 A;  3VWD A;  2B4B A;  4A95 A;  4PK3 A;  1YR0 A;  3G8W A;  2DXQ A;  5EBV A;  4AVC A;  4X5K A;  3GKR A;  3TE4 A;  3SHP A;  2B3V A;  2VZZ A;  4IUS A;  4UA3 A;  2OZH A;  3S6G A;  1MJA A;  1UFH A;  4E0A A;  2P0W A;  3OWC A;  3PGP A;  2WUU A;  2QIR A;  2IL4 A;  2Z3O A;  1I12 A;  2J8N A;  4C2Z A;  4XPD C;  4CGL A;  4MBU A;  4DNC A;  2VQY A;  3A9L A;  3R95 A;  2ZW4 A;  4BBH A;  2Y0M A;  4L8A A;  3TO7 A;  1QSN A;  4KLW A;  2GIV A;  5F46 A;  4AVA A;  4HNX B;  4UFX A;  3SXN A;  2B4D A;  2WSA A;  5JQ4 A;  4Q38 A;  2PR8 A;  4ZGY B;  3D8P A;  2Z3N A;  3BJ7 A;  5G1Z A;  2P6F A;  2I79 A;  4C7I A;  3NE7 A;  5F49 A;  4PSW A;  3CXS A;  5ISV A;  2Z3P A;  4R9M A;  1XE4 A;  2KCW A;  4JXR A;  1WK4 A;  1P0H A;  5G22 A;  2AE6 A;  4ORF A;  2ZW7 A;  1PUA A;  2B5G A;  4A33 A;  1IID A;  4QB9 A;  1ZO0 A;  1OZP A;  2FS5 A;  4NEX A;  3TFY A;  1PU9 A;  5H86 A;  4YFJ A;  2OU2 A;  3JVN A;  1QST A;  4RI1 A;  2FXF A;  2P6G A;  4FD6 A;  4MFJ A;  2ZW5 A;  3GYA A;  2X7B A;  2JDD A;  3E0K A;  1KUY A;  1BO4 A;  4C68 A;  3I9S A;  2PDO A;  4U5Y A;  2FIW A;  4GS4 A;  1S3Z A;  3I3G A;  1I21 A;  4XNH B;  2AJ6 A;  1IB1 E;  4M85 A;  4NSQ A;  3D2P A;  5C82 A;  3VWE A;  3DSB A;  4L89 A;  4R57 A;  4A2Z A;  3BLN A;  3S6F A;  1XIX A;  3TCV A;  2WPW A;  5IX3 A;  1N71 A;  4RS2 A;  2FSR A;  1B6B A;  3R96 A;  2O28 A;  3H4Q A;  2ZPA A;  1U6M A;  3CXQ A;  4KLV A;  2FE7 A;  2FL4 A;  4J3G A;  3IU2 A;  4FD7 A;  4CAX A;  3ZZI A;  4UFV A;  2PR1 A;  1NSL A;  2J8R A;  2YNC A;  2Z3K A;  2VZY A;  2ARH A;  1M1D A;  3TTH A;  3W6X A;  1QSO A;  3ZJ0 A;  3EFA A;  3W91 A;  4CGN A;  3DR8 A;  2FCK A;  5A28 A;  4F0Y A;  4B10 A;  4R3K A;  4XPD B;  1TIQ A;  4CRZ B;  3R9G A;  4UCP A;  2VI7 A;  5HH1 A;  4KVX A;  1SQH A;  1KUX A;  4MFZ A;  5G20 A;  2Z3L A;  4KS9 A;  4UBR A;  4CAF A;  2BEI A;  3B8G A;  5KTD A;  3JTK A;  3P2F A;  4OAD A;  3V8I A;  5KTC A;  4CAV A;  5JPH A;  2R98 A;  3R9E A;  5BWA B;  3R9F A;  4KSA A;  1J4J A;  4JLY A;  3D3S A;  4C2X A;  4KOR A;  1QSM A;  4UFW A;  3R1K A;  4UWJ A;  2REF A;  2Q0Y A;  4C2Y A;  1WWZ A;  2G3T A;  3EXN A;  4KOW A;  3F8K A;  4PV6 A;  2G3A A;  2CNS A;  3DNS A;  3QB8 A;  1Z9U A;  4C7H A;  2Z0Z A;  2CY2 A;  1M44 A;  5IV0 A;  1S60 A;  2B4D B;  2HQY A;  4HKF A;  4B5P A;  4FD4 A;  2OH1 A;  4I49 A;  1Q2D A;  2B3U A;  1IYL A;  3UY5 A;  5AGE A;  4M3S A;  2Q7B A;  1NMT A;  5DWN A;  2F5I A;  2QML A;  2VXK A;  4PK2 A;  1K4J A;  1M4D A;  2JEV A;  3FNC A;  2DPT A;  4B13 A;  2A4N A;  3FIX A;  2JLM A;  4EVY A;  3MGD A;  5I0C A;  5AG5 A;  2OB0 A;  2CXA A;  4U9Y A;  2ATR A;  1BOB A;  2YGW A;  2B5G B;  1LRZ A;  3P2H A;  2CNM A;  4CYP A;  1Q2C A;  4AB7 A;  2P6E A;  4QC6 A;  5F47 A;  4B11 A;  4ZBG A;  4KOV A;  4KOT A;  2Q44 A;  3T9Y A;  2NMT A;  4KZT A;  2Q04 A;  4MHD A;  4HNY B;  3EY5 A;  4IF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...