4UCSA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
b'MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucsA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucsA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucsA02
1A0IA 2HIXA 3KYHC 3T1YB 4PZ6A 4LFCB 4UCTA 2ZM6B 1DGSA 5D1OB 4B3SB 4JI4B 1XMQB 4LF4B 4EEQA 3JSNA 4GLXA 1FJGB 4UCSA 1B04A 4EFBA 4DV6B 4DUZB 4UCOA 4LFBB 4DV4B 4LF7B 2OWOA 2VQEB 4JYAB 1XK5A 2UXBB 3W1GA 4DV3B 3BAAA 1CKOA 1XNQB 1CKNB 3NC0B 5LMNB 4EQ5A 4DV2B 4CC6A 1XNRB 4UCUA 2VQFB 3JSLA 2HVQA 2UXDB 4JI5B 1I94B 4UCVA 4B3MB 1J5EB 2CFMA 4DR3B 4JI7B 4CC5A 3L2PA 4UFZA 3VNNA 4LF8B 2HVRA 1N34B 3TY9A 3NBYB 4TOIA 3NBZB 2Q2UA 2VUGA 2HIVA 4NXMB 4B3RB 2UUCB 4LFAB 1TAEA 1P16A 3PN1A 4X62B 3GB8B 3QWUA 4DUYB 4DR5B 1P8LA 4B3TB 4LF5B 3UQ8A 2UUAB 3RR5A 4EFEA 5IWAB 1N32B 5LMUB 1IBLB 3BA9A 4GKJB 4JI0B 4JI1B 4DV7B 1S68A 1X9NA 4DR7B 3TY8A 3OTOB 1ZAUA 4DV0B 4PZ7A 5FPOA 4K0KB 1CKMA 4JI8B 1IBKB 4E6NA 4DV5B 5BR8B 1IBMB 4JV5B 3GJXB 1N36B 1FVIA 1XDNA 1HR0B 4JI2B 3SGIA 4YY3B 3S24A 3GDEA 5D1OA 4LF9B 2UU9B 4OX9B 4JI6B 4LH6A 4PZ8A 4DR1B 3TY5A 4DV1B 5FPRA 3T1HB 1HNXB 4DR6B 3W1BA 2HVSA 4LF6B 4DR2B 3RTXA 3BABA 4UCRA 3BA8A 1TA8A 1HNWB 4GKKB 1VS0A 2UUBB 4NXNB 2Q2TA 1HNZB 1CKNA 5D1PA 2HHHB 4KHPB 2UXCB 1XMOB 1N33B 2E5LB 4LH7A 4X65B 4X66B 4JI3B 2F4VB 1V9PA 4X64B 4DRFA 4AQYB 4DR4B 4YHHB 5DISC 3W5OA
chains in the Genus database with same CATH superfamily
2YCHA 2YXYA 3B4SA 1A0IA 2DYRB 1N33H 3T1YB 5IYBG 4JI1O 5LBQA 3LSSA 2WB1A 3T1HO 1JPXA 3LMLA 4X64H 4A2BA 1BHBA 3AG4B 1WB8A 3DC6A 2JEJA 2FLLA 2GUZB 4YJ3F 4A3BG 5KFCA 1X59A 3WU2Z 1XK5A 4A3IG 2V59A 2R7ZG 2BTQB 3BACA 4RAZA 2UXXA 4IRCA 2ZNIA 2ATKC 4ZHQB 1DLBA 3CCEV 2OTLV 4Q6GA 1CKOA 2C2RA 4BIUA 3UCSC 4O7YA 4HNTA 2W9CA 2CH7A 4UCUA 3TIIA 1M9NA 4C5AA 4CMFA 5HV6A 3D36C 3UYYA 1Y4MA 1QU7A 3MDSA 2HFEC 2JS5A 2WLJA 2PZSA 3CD6V 3ETEA 3AG3C 5KMGB 4DR3B 2DMXA 3K59A 1VF6C 1RM1C 4DR2O 2GPSA 4TQSA 3M4IA 1H2GA 4XX0B 2Y69B 4JI5H 2M6YA 5KT3A 4JYAO 5BPHA 2A3QA 1WAZA 3STLC 3T9EA 5C8YF 1L2ZA 2R8GA 2BQRA 4CHIA 3CC2V 1P8LA 3GIJA 1JXLA 3K5MA 4O4HA 3JAMW 5KAIZ 2PYJA 2A7WA 4NXMH 1H2SB 3B8NA 1GSAA 3ZRWB 3ETHA 5DN6G 4DUYH 5IP9G 4A3KG 3ZRXA 3TXQA 4B3MO 5LYJA 3TY8A 5K2MA 1ZWIC 5K3WA 4C5BA 4DV0B 3ETGA 5KHGA 2ITCC 4O4LF 4MV8A 1YJ9V 5B5EZ 2CTRA 3U0ZA 3U11A 3RGBA 3CCUV 4LC1A 3T9BA 2UUCO 3HOZG 2Q0AA 4EBDA 5LXTB 4DW1A 3CCLV 1VF5B 5I5WA 3LDCA 4X1IA 1I2KA 3L9DA 4CS3A 3N41B 2J6TA 1KJQA 3OR6C 5LP6C 1ZUQA 1W96A 2R93A 1GRJA 4RB2C 4FFOA 2P5OA 5JJJB 5H6QA 3K79A 2V5AA 2LJ2A 2BQ3A 3FYEB 3HKDA 4JI6H 2ABJA 1PL0A 2Q4PA 1Y1WA 2ZCEA 3HKCA 4RUCA 3I55V 1MZFA 2RCVA 2QYZA 1MOFA 2YIAA 3R23A 2B63G 1QBZA 4QIWA 1DTOA 1QQCA 4LBEC 3GTOA 3ZRVA 3ETDA 5KUKA 4O3OA 5CB4B 3F7VC 3C90A 5B1AC 1VQPV 4NVPA 2UU9O 1PP9H 1Z2PX 2HHHH 3H40A 4LR3A 2Z5UA 3T1CA 3F8NA 1VQKV 2ZM6B 4I55F 4JASA 5KHIA 4LNUA 2QWRB 1K8AW 4LF4B 4I4TF 5FNVF 3RAQA 3HT5A 4IAJA 3PR4A 4CH4A 3MR5A 5LA6F 1SS3A 3WB0A 1PKXA 2E74B 1RSOB 1AI4A 1G8MA 4ED0A 2R7KA 4LF7B 3IN5A 4EB6A 2LFRA 1L1FA 2EJ2A 2Z02A 4GX2A 1VBGA 4LFBH 4X64O 1ZSPA 4AI8A 1XNRB 3HB9A 1YIJV 5F9LA 1RPRA 2C2DA 3JSLA 2Q5ZA 2HP8A 3RF2A 1DAAA 4GZRB 3L74H 4O4JF 4MV7A 2DWEC 1BQZA 1JKJB 5LMNH 5KFHA 2CNQA 3VBBA 4ECSA 5KFQA 5IYZA 2AZ2A 2FL4A 2W57A 3JAKA 1K1SA 2Q7HA 3NBYB 4DL4A 1OCOC 3AW8A 1Q8IA 3E86A 1K7DA 2E76B 4EBCA 3R5FA 2MK3A 3BY6A 3OAAG 4KHPO 2YIDA 5KFVA 4XDLA 3TEKA 1K5SA 2M7WA 4FFKA 5J2UB 1BE3H 2W6PA 2DW4A 1VQNV 1WLEA 1AJQA 2Q7GA 3N27A 3Q4HA 4JI5O 1I7LA 4X62H 2A79B 3H01A 4FVMA 3SPIA 2FLNA 1Y14B 1Z5VA 1XMQO 2C00A 1JFFB 3HPLC 1IBLH 4ECTA 4O2BA 2YDEA 4WFEA 3PW5A 4E6NA 2YW2A 1AUVA 1ZQ7A 4YR3A 3RBZA 3K3PA 3U9SA 4DR7H 4P2ZA 4FU0A 3TQTA 5EYPB 1N36B 4JF3A 4NTYA 1XNQO 4J9NA 2W0XA 3KALA 1V4YA 3PZPA 3BPZA 4JXUA 3SGIA 4YY3B 4R8UB 1JA8A 2OCHA 3RV3A 3ZJZA 2GSMB 4ED6A 3RIZA 4FM1A 2WLNA 4O4LB 1GSHA 3LNNA 1SA0A 2QWNB 1OCRB 3DSQA 3K58A 1AI7A 2H94A 3KAKA 3SPJA 1YJWV 4AYBA 3OGIB 2AHZA 2C2EA 1CXZB 1KTAA 3EPGA 2LFSA 2PTMA 4A2AA 3IGAC 3BQ2A 2OT5A 3UM7A 1NJIW 4JI3B 4F4XA 2ZDQA 5KX5A 1WCMG 2L35A 4I50B 5FD5A 4ZBMA 3Q2OA 3B40A 5KG3A 1OCCC 2IU3A 2VWJA 2WLIB 5E79Z 3Q8SB 3C3SA 2XAHA 3JSNA 1A0GA 2Y0SA 1UFIA 4MTXA 4DV6B 3T1YH 2AGAA 5C1OA 1IBKO 1SFOA 5H6RA 3A0HZ 3K3WA 1K97A 1R3KC 3B77A 2HHHO 3V4ZA 3W1GA 2DQ3A 2HGXA 1TWGA 5BYAA 1JLLB 2RDCA 5J2TA 3QZ8A 2RGRA 1H8EG 4I55B 1S97A 4QE9A 5HFLA 3UZBA 3T54A 5IP7G 2XAFA 4NZNA 4EYHB 3A0RA 4O86A 5LA6B 3T5KA 2YZGA 1TVKB 4A3DG 2YEVA 3ZS8C 2CFMA 1GH6A 5L3DA 1VQ9V 2COJA 2ODTX 2DJVA 4DRXB 2ZXWB 4LFBO 2HVRA 3NR7A 1I6UA 3C0FB 2RDJA 2QTSA 2RDIA 4B3RB 3GTLA 1QR8A 4O3RA 4J80A 4DR3H 1ORQC 3E8GA 3H0GA 2UXCO 1CQJB 3KZIZ 4WFAV 3G8DA 2GPWA 2AXTZ 4O4JB 4EFEA 3CHXA 1YITV 4TV9F 2ZR2A 5B66Z 5KG0A 1AR4A 1OWTA 3RWRD 4X1YA 3OMIB 1W59A 5T14A 4IHJA 2F23A 5DGBA 3HKBA 1B6SA 4BBRG 5B3SC 2Y4TA 1M1KW 1ZAUA 3V6JA 2QWOB 2F93B 1WR2A 2IBKA 1YZBA 2O57A 5BR8B 2YYAA 3VQXA 1MABG 5GONB 4DV0H 5CA0A 1WSCA 4XDJA 1V55C 3FAVA 4O7NA 5KFIA 1M4UA 2XCLA 2F43G 3R5HA 1G2WA 2Z0AA 4TV8F 3S24A 4YJ2F 2ZE7A 1H2KA 5FR9A 1LNQA 1V54C 4DR7O 1YJNV 2I8CA 2VRZA 5JH7F 5FPRA 4DR6B 3K3VA 3PR5B 2HVSA 2EIJB 2R85A 4BXXG 2JGDB 1H2LA 3AG7A 5L3FA 3CCRV 1MZBA 3FMAA 3SYOA 1HNWB 3OT7A 2FK2A 4DIMA 5KFNA 1IYDA 5HFMA 1EZVH 3OM3B 1F51A 1JMKC 3CVZA 1K83A 4EGQA 5EIBD 3HR0A 4ECZA 2JK5C 5F9NA 1S3JA 1I7NA 4PDLA 4YB8B 3RT3C 3SPHA 1YEWA 2Z04A 3KXYT 2Q9LA 5CE8A 2HEPA 1SETA 4GLXA 5JVDF 2ZDIC 3DTGA 3CYOA 1N8RW 1YF2A 4I9WA 3EXAA 3ZEDA 2ZM6H 3K06A 3VPCA 2LQTA 5JQGF 2Q73A 1P4RA 3CPWU 2A1HA 2EULA 3G8CA 1K73W 4LF4H 3RFCA 2WB1E 3ZMTA 1NR7A 4B08A 4RZQA 3BFRA 1ZL8A 3FKIG 2OH2A 3AX6A 4M0JA 4ZOLF 4B7EA 1AJPA 4LF7H 2I87A 4IYIA 2RF4A 5IYBO 5KFGA 5EOYA 3ZHUA 1KP3A 5L1LA 4Q44A 1DV1A 4J9KA 1XNRH 2DN9A 4K6NA 3JAWB 4X89A 1JX4A 2NN4A 5KFPA 3KHLA 3L75H 1BSMA 4ECYA 3CMEV 4TM5A 5E25A 4TOIA 5BMVF 4WCEV 3QZ7A 4MT8A 4BW5A 1VARA 1D5AA 1GK9A 3ZRSA 2KG7B 4OXSA 2UUAB 3RR5A 4GC6A 3TJTA 4FFBB 5JJEB 2NU9B 1YXBA 2QKSA 2YZLA 3OHAA 2ZT9B 2X6BA 4PWQA 3BQ1A 4CKBA 3WNZA 2PF4E 1WA8B 1BS3A 3BJYA 4DR3O 4E2LA 4ED2A 1VMGA 1P49A 4PZ7A 2FMLA 2R7MA 3V4SA 3AG3B 1KJ9A 1RM1B 3DF7A 4WBNF 4DV5B 3H1LH 1OBDA 3ETJA 3RYHB 1AROP 4JV1A 2LW7A 1KKDA 2ITDC 4L8JA 3JD3A 4J7ZA 1N36H 5KMGA 2RN9A 1OCRC 3WWHA 5BPFA 3P3PA 4TVIA 1HNXB 2FYUH 1VP7A 2KSDA 4GCZA 2EZOA 3WB2A 3N6RA 3JAMN 4IYHA 1R6NA 1VQMV 3W7WA 2IA6A 4WFBV 2B1GA 4ABMA 4A3MG 1I5YA 2GDSA 2HGSA 3G6EV 3OMAB 1UJWB 4YJ2B 3CJHA 1V9PA 2BOBC 1I1MA 3ETQA 5EZYF 1DF4A 3S3XA 4APMA 1YSCA 2P90A 4HNAB 4ED3A 1S03G 4JI3H 5LP6B 3CCQV 1RP3B 2YS6A 5IJ0B 4EEQA 4QIWE 3MR2A 2ZE8A 2WDTA 2W6QA 2R9IA 4X20A 4RNNA 5CBHA 3JALB 4DQNA 4QW9A 3CC7V 2YRXA 2R8IA 4PA6A 1WH2A 1BGWA 4Z1MG 4DV6H 2XOKG 1CKNB 1ZX3A 4J9PA 4I9QA 4DV2B 4CC6A 1M56C 1PPJH 3CEBA 4G2KA 2VQFB 1TUEB 4ZHQF 2ZM6O 1I94B 1NR1A 5B1AB 3CXCU 1M5IA 3WWJA 4F6EA 4DYLA 4LF8B 1BNCA 4FFNA 3WO0A 2HVJC 1E79G 1FD9A 2WLHA 4LF7O 1JX9A 2VUGA 3CWBH 2W6OA 2UUBO 4NXNO 4LFAB 4QJFB 3I4MG 3UZOA 1O9GA 4FE2A 1IXBA 2F4VO 1WPBA 1R3LC 1XNRO 2ASJA 1I0HA 2AQ4A 1CQIB 4B3RH 3BG5A 3QO7A 1AP5A 2BE3A 4J7KA 3L4KA 3LP8A 3T2MA 4O82A 2P0AA 4JI4O 5H2FZ 3RYCA 2LGWA 2A0LA 5KG6A 3T99A 3T5JA 5L3BA 4MV1A 5FJ8G 1Y76B 2PMZA 3EVKA 3ORRA 1OCOB 4HNUA 1TUBB 4DL3A 2Q68A 1EYZA 1EUDB 4YJ3A 1W2BU 5BR8H 5LXTF 1VKZA 1O75A 4Q0YA 5IY5C 1I3QA 5KT6A 1Y1VA 3K03A 5GW7A 2Q8VA 4PA7A 2FPGB 2WAMA 4DV1B 4TQDA 4L1KA 3MWEA 3ABLB 5CA1B 2JGUA 3A2FA 4IR9A 3GB7C 1EUCB 1NTKH 4DK1A 2BCCH 2JA6A 1S5HC 1TA8A 4GKKB 4DR6H 3U9TA 4A5UB 1XEQA 1M0WA 5H80A 5D5PA 4X66B 3MWDA 4LSAA 1HNWH 2X7RB 1NQTA 3ORQA 2VWKA 3KHRA 4YHHB 4AYBE 2IMWP 3CE2A 5B1OA 2AHYA 1T36A 1KU9A 3TW7A 4JPRA 5CB4F 5KFXA 5C8YA 1B04A 2EIMC 2IM9A 1RYRA 5EYPA 1DV2A 2YZMA 1OCZC 5LOVB 1F23A 3VQYA 1VQ7V 5EDWA 1Z5WA 3SPCA 2R9RB 1GO3E 1R3IC 3RUPA 3RJ0A 2Y0SE 5BWWA 2JA7A 4JI3O 2YIBD 4CBCA 4DL5A 3HKZE 4O4LA 4A3LG 2PN1A 2QM7A 5DM6V 4IZOA 3TGUH 4MV9A 2HG5C 3ABKC 3ABUA 3RFRA 5DLGA 4RO2A 1JJOA 4JI7B 4MVUA 1OCCB 2GBOA 2NLJC 4DV6O 3E22B 4JYYA 4OPAA 4C7UA 3CRCA 4R50A 5A2QW 5H9CA 3E35A 3K5LA 3H20A 3PN1A 2IJIA 3LULA 1T5EA 4JYCA 2AGPA 5KFRA 5KFYA 4UV8A 5C5JA 1FFXA 2QJ1A 1N32B 3K9AA 3FKSG 4MTEA 1RYSA 4FM0A 1LR1A 2JA5G 4A3FG 2UUAH 5J2UF 1RK5A 4H44B 4CE5A 2FE3A 3LNMB 1X4TA 2QR4A 1P7BA 2V7QG 4O2AB 3BCCH 3RBDA 4O84A 3PVXA 1Q86W 4DUZO 1KBLA 1AP6A 1WJZA 4JV0A 4O7WA 5DQGA 5D8DA 3KHGA 4NTXA 4NB5A 1C3OA 4JUZA 3ZHSA 4ED1A 2V4DA 4I4TA 3OEHG 3T9FA 5FNVA 3G6YA 4RB1A 4FLVA 1KJIA 3LQSA 2LP7A 5LA6A 1AB3A 4DV5H 1YDXA 4GX0A 4N21A 3HOWG 2CE4A 4J9OA 1LUWA 3GLKA 2ZDHA 5BZBA 4PZ8A 5KFJA 1B3QA 3QG5A 1NH2B 2QE7G 3KG2A 5EWFA 3ZMSA 2X6AA 5B3SB 2HG8A 5BR8O 1HNXH 5KUMA 4XYMB 4O4JA 2PGGA 2NVYA 5ITZA 5L3GA 3OUZA 2E5LB 2XAQA 2OIGA 2Q69A 3TK1A 1S5JA 4X65B 2Q7DA 1EFRG 3APQA 3L72H 4AQYB 2LGQA 5I5UA 2K1EA 2WPDG 3ASOC 5BXZA 5IWAO 1V55B 2LW1A 1E4EA 1BQ0A 1CS0A 5EIBC 4RUEA 1JJ2U 1N56A 4DV7O 4DR6O 5D1OB 1PV0A 4KP4A 1V54B 1YTFD 4I50F 4HAMA 2P67A 1XILA 4O3PA 5KFEA 1KJ8A 2H8PC 2X6CA 5L1IA 2BQUA 1AJNA 4XBFA 4UUJC 4U3JB 5CM0A 1K4CC 4C2MA 4CMDA 2B5UA 5C44G 3T9DA 3UO3A 3RB3A 1NBMG 4DV2H 1J5EB 1QLEB 3IFXA 2VQFH 3H4BA 4FS2A 2QM4A 1G1XB 3RVZA 1I94H 1XUQA 4L87A 1NI8A 4JV2A 3QO5A 3HKEA 2W9BA 4MW3A 4MVZA 3JCZA 4NLGA 3QWUA 2GHYA 3CMAV 1N33O 1SC5B 4LF8H 1WN7A 3ML0A 4DR5B 4B3TB 4JTCB 1R6KA 3AK3A 2XGQA 1N0NA 3SYPA 4LFAH 3BA9A 4GKJB 4FLYA 1K9MW 4GC7A 2R92A 3LDDA 3CS5A 3N2KA 5KG2A 4Z1VA 1VF7A 3K5OA 3DTUB 4D7SA 2QF7A 5FPOA 4TQRA 1US6A 2HR3A 1KC8W 1HW7A 4EKWA 2YL2A 1S0MA 2VUMG 1IBMB 1JQ0A 1IXMA 2VS0A 2X5RA 2HLDG 1Y66A 1ULZA 1Z2OX 3ABTA 4ECRA 2DZDA 1GN4A 4MTDA 3DXRB 1XDNA 2PBZA 1I1KA 5BWRA 2UUAO 2HVKC 2JIZG 2HHFA 4KFMA 2P7TC 1SQFA 2R70A 2X0LA 5GONF 4UB8Z 3IAYA 1COWG 4JAAA 3QO8A 5GTIZ 3VA7A 1V51A 3N40P 3ABLC 2CGNA 4LF6B 3G4SV 1NVPD 1OBGA 4RQEA 2EIYA 3VOTA 3KREA 1W0JG 4O7VA 4DV1H 2XT9A 4UUGA 4NXMO 1BJTA 1HWYA 3ZMZA 3L4JA 1XMOB 4DUYO 4MVQA 5KFWA 1XREA 1FXHA 1Q43A 4ETSA 4FPPA 4GKKH 2IH1C 1WA8A 4DR4B 3QFFA 3FB5C 2HJWA 4KXRA 3KTMA 4W4LA 4J41A 4MW8A 1J95A 4F6RB 4LFCB 5IJ9B 3D3QA 4X66H 4H33A 3P32A 1HNXO 4UV9A 4RZRA 2W7PA 5DG9A 4YHHH 3STZC 1KQSU 3K04A 5LGTA 3RB6A 4TV9A 2AGOA 3UT5B 1RJRA 2LO1A 5A9GA 3T5HA 1I1LA 2ZR3A 3FYIB 3RB4A 2YS7A 2BR0A 1YTFB 1S5LZ 2Y0IA 4DV3B 2HGWA 5KFUA 3GIKA 4RNMA 2B1IA 2CUGA 2PI4A 3ABMB 2YSUB 1BXRA 1N4CA 3RYIA 3N42B 2YWVA 4JI6O 4GYCB 3J80N 1A3GA 3W7SA 2BSKB 4UCVA 1G4YB 2XD4A 4TV8A 3HKZA 2L6LA 4R6ZA 1WRVA 1R9TA 5LHIA 2DLNA 4JI7H 1P16A 4FMTA 1ZHSA 5FLXW 5JH7A 5DGIA 4HNAA 4LF5B 3Q8RB 3MAQA 2DYSC 1Y67A 1WB7A 5LMUB 4G27B 3GWOA 5EK0A 4JI0B 4JI1B 1FFTB 2FTKA 1M56B 1S68A 2W9CB 2CH7B 3ZBHA 3RAXA 3N2GA 5I5TA 1Y74A 1N32H 4I0XA 2W7OA 3JARB 4LF8O 2ZE5A 4FFMA 2P22C 1B06A 3G6VA 4WF9V 1GGOA 3MR3A 5AG2A 4ZI7F 4LFAO 2EJ0A 1DF5A 1EKPA 3JZIA 5BWTA 1EN6A 5KFFA 4J9MA 2AGQA 3CP1A 5BYBA 2YZNA 1Q90D 2Z3YA 3AEIA 5JVDA 1TWAA 3QF7A 5LMNO 4JI2B 5KT7A 2EINC 4IR1A 4O4HB 5JQGA 2PMZE 2OTJV 4DR1B 2J9GA 3TY5A 1MZEA 2W71A 4DR2B 4ZOLA 4LSXA 3PW7A 4O7ZA 2DQ0A 5LYJB 3BA8A 4QJFA 4LWSB 5KKNB 2UXNA 5DEDA 1HNZB 1UC8A 3M9OB 1NVPB 1WP8A 4X62O 2E2IA 2WWWA 2WTFA 5EC1C 4PD4F 3NUAA 5C3EG 3RYFA 1VAJA 2R9AA 3H1JH 3CRQA 3RGXA 2XCAA 1IBLO 4X1IB 3H1KH 4CH3A 5BMVA 2DABA 2HIXA 2V58A 4ME6A 3KYHC 1SQPH 3WWIA 5I5SA 2E5LH 4X65H 3RBEA 3TCUA 4DO2A 2HJFC 4U7CA 2W6ZA 5IY5B 4AQYH 1P7GA 1T94A 2R93G 2OCCC 3THOA 5LP6F 1H2MA 4K3AA 5CBFA 4GKKO 5GTHZ 3JASA 3J7AU 4H0LB 3OGCC 3HKDB 4BWSC 4RB3C 3HKCB 4X66O 3DC5A 4J0MA 1I50A 1Y1WG 1Z2NX 4KUMA 1S76D 3C3TA 5JQWA 4MVSA 4O4IF 2HVQA 4WBNA 3GV8B 2W0FC 1VQLV 1QLEC 2QKAA 1ZETA 2R84A 2FK3A 1RJQA 5FL7G 3CRRA 1S0VA 3SJQC 5JCOA 3CRAA 1PNLA 1SESA 1N34B 3OE7G 4J42A 2JJ2G 3CCMV 2EIMB 4J11A 1J5EH 1OCZB 1EM1A 4RU9A 3JATB 4F50A 3GB8B 2QTOA 2Q7EA 3MD0A 4EB6B 1H2NA 1XOUA 4JZ2A 4O83A 3VPDA 2XGPA 2NNUA 3U54A 1IX9A 1RJPA 2EIKC 3Q8PB 4F4WA 3T1YO 1FXKA 2JEXA 5KT2A 4DR5H 3CCSV 4B3TH 3P3NA 1X9NA 5KFTA 2PVPA 5CAEB 4J9RA 1K5QA 2R7NA 4HN2A 3JD4A 3ABKB 3LSUA 3GIIA 3K9SA 4GKJH 1KUTA 4LCUC 3QQMA 3ZN1A 5EZYA 4JI8B 5DG8A 1C30A 1U97A 3EYYA 2VPSA 5IYZB 4IRKA 3JAKB 1Y6XA 4MV4A 3G6BA 1L0NH 2KKWA 1JR9A 2D2CB 4FZ0A 1S0OA 1XHXA 3IC9A 4DXWA 2FKXA 4OPHA 5L3CA 1K1QA 1IBMH 2N05A 2GQSA 4OX9B 3GTJA 5A2QN 1BZKA 3WG7C 2GUZA 2QA4V 5DAAA 3Q4HB 3R5XA 2R7ZA 4ZI7B 4BIZA 2BTQA 2XC9A 3JD2A 3G6XA 4ZHQA 2MCTA 4O2BB 3QNEA 5CA1F 2VA3A 4LF6H 4H37A 4HYKA 5D1PA 4KHPB 2JEIA 3CX5F 5KG1A 5EWGA 2FPPB 2R6FA 3QTCA 4UB6Z 2XUMA 4A3GG 2VOBA 2EILC 4ECUA 4FLXA 1XMOH 2AU0A 3TQ1A 2N74A 1DGSA 1QVFU 1XMQB 4DR4H 1OJHA 1XQ8A 2UVVA 1K34A 1K33A 4DV0O 1SA0B 4QSHA 1KMIZ 1I5XA 4YAKB 3J81W 1PM9A 3ZMVA 4WHXA 4BW9A 4LFCH 3ZHRA 1VQ6V 5DG7A 3SJAC 3GILA 1ENVA 4BBSG 1H8HG 3CEIA 5LOVF 3ABMC 2E5LO 4X65O 3J80W 2V4RA 1XNQB 3ZRWA 5KA5A 1KD1W 4FLTA 5I5XA 4AQYO 4EQ5A 5LHGA 1RK6A 2R8KA 3ASNC 1OZ0A 3CXHF 1YI2V 3AG1C 2WE6A 5FD6A 4DV3H 3AG2C 4IWXA 4RNOA 1Q7YW 3KHHA 4X1KB 1KEEA 3ASOB 2COIA 2EJ3A 2XHBA 1QCEA 5KX5B 1FAFA 3K5NA 5I60A 2ZE6A 3E8BA 3U55A 5LXTA 1MNGA 3NBZB 5CR5A 3K0GA 3FFQA 2CDYA 2WAQA 2R8JA 3M9NB 2XIGA 1ZLZA 4O4IB 2P4KA 5KG7A 2MW2B 3U0GA 1GYFA 2UVRA 1XBLA 2R87A 1AUXA 1MA1A 3BRCA 5J2TB 4DL6A 1SKVA 4MA0A 1IVSA 4J10A 4P9OA 4LF5H 4CH5A 4D6TH 5FLMG 4PDRA 5CA3A 4LF4O 4NKGB 1IOVA 5LMUH 3OSNA 4JI0H 4JI1H 4NZOA 2YEVB 2B63A 1IBKB 4QPKA 5EWEA 2RMKB 3SYCA 4O2AF 5CB4A 5LL6b 3GTMA 3AYHB 2W6JG 3BHPA 1MG1A 3H0GG 1I7FA 2VR1A 4E4TA 2SCUB 3MJFA 3K5HA 4JI2H 1RSOA 4MVMA 2ZDIA 4GLWA 4X1YB 1Q81W 2HDKA 4IHJB 2ZNJA 3K5IA 1AI5A 3HKBB 4DR1H 1IBMO 4Q20A 1A32A 4DR2H 5EBMC 2UXCB 3OHBA 2RQ6A 2QSAA 2YXHA 4LH7A 2YICA 3N44B 4TUYF 4J9ZB 4FM9A 1F4MA 5CA0B 1HNZH 5IDJA 3FAVB 3TXSA 4R7RA 3GV7B 1SZTA 1DK1A 2DPIA 5C4XG 4FBUA 3GIMA 2WSSG 3QVNA 3OMNB 4B3SB 3N43B 3GIDA 2YRWA 1JCHA 2ZKOA 4IGGA 5DQIA 4FGRA 4YBZB 2I80A 4P9PA 4J9LA 2FKLA 4YQWA 1N36O 3NXSA 1SF9A 2PI5A 5IYCG 2WLMA 2OIEA 3GVMA 5J2UA 4YR2A 1QR9A 4O7SA 3UFXB 4XDKA 2A9HA 1VEWA 4DR4O 3K0DA 4YY3O 1KT8A 2C22A 5KHHA 2UXDB 3CRMA 1JFFA 4LFCO 2H3OA 2WLKA 1R6TA 2DE0X 1S77D 4RUFA 2CW7A 4ED7A 3HO8A 2QWPB 3CB2A 1P84F 1Q5OA 1GN6A 1BGYH 4TWKA 1MSDA 1TAEA 4DV3O 3FB8C 4R8UA 4WFFA 4TT3G 2R72A 1N34H 3UQ8A 2DOSA 3OR7C 4EYIB 3CSXA 5LHHA 4FZ1A 1GM7A 1ZL8B 2CNVA 1EKVA 4ED8A 2V4QA 3R65A 1SERA 3E8HA 4MV6A 3TINA 3ZHTA 4U7OA 3SI8A 2V9WA 4ECVA 2R8HA 3JCUZ 5BWUA 2CTQA 4CS2A 2KB1A 2W9AA 1F4NA 1VQ8V 3GJXB 2PYLA 1DIKA 3HB3B 1EZJA 3PW2A 4JAUA 1WCMA 4GT1A 2WLLB 2VPQA 5KFMA 4JI8H 2ZIMA 3LDEA 4I50A 5EBLC 4UVAA 5LMUO 1EKFA 2D3OW 3GDEA 4JI0O 5IT9W 2WLIA 3E8FA 2DYSB 2RNBA 3P30A 4QWDA 3CC4V 5FLXN 1M6VA 1AI6A 4J9SA 4JGSA 5K1PA 4OX9H 3BABA 1KJJA 3AK1A 2P4VA 1VS0A 2KSWA 4RCNA 2CZGA 4B3RO 1BMFG 4NTWA 3H1HH 1GAXA 2R86A 4I55A 4EGJA 4JI2O 1NT2B 4NYKA 3B09A 1TVKA 4IIJF 4KHPH 3G80A 2IJKA 2FLPA 4DAAA 3JARA 4DR1O 2EINB 3V6KA 4DRXA 1BHAA 1FYJA 4K8ZA 5KHKA 2ZIOA 4PA4A 4CKEA 5IE9A 4UCOA 1OV9A 3JD0A 3ZHQA 4DV4B 2OWOA 1HNZO 1XMQH 4ECXA 4TUYB 1CE8A 4Q8EA 3R66A 5C1PA 3GTKA 5HNEA 2ZGIA 2NU7B 1RFYA 4JAVA 4BR6A 1CEZA 3CJHB 3SDLA 1M90W 5JUMA 1GM9A 2QDOA 2EJRA 2GTAA 4FLZA 3SE7A 1JIHA 3VPBA 3W7TA 1XNQH 4LWSA 4PI2A 1EZ1A 1NTZH 2XNDG 3T5LA 4UFZA 4H13B 4YAJB 1ZTEA 3ICXA 5GONA 4MV3A 4C5CA 3OUSA 1HNWO 3L70H 3L71H 2OCCB 4Y8VB 5B1NA 1AILA 4X20B 4QNHB 1K92A 2JEFA 4PDVA 4PELA 3O9OA 1KBHA 5KG5A 1NU1H 3D8CA 1F7YA 1NZ6A 1U96A 3FB6C 2JGDA 4I7ZB 5DECA 3UO2A 1BT8A 4FLUA 4FFPA 5KFDA 3AK2A 2Y0PA 2PY5A 4UVBA 1N34O 2OLSA 4O3NA 4K0KB 4TQFA 2QWQB 1Q82W 4JV5B 2ZJTA 3IG0A 5IYDG 2ASDA 3Q1KA 1FVIA 4AILC 3OW2U 1HR0B 1IBKH 4RQFA 4PA3A 4FFRA 1JDBB 3MFIA 2Y4RA 4LH6A 3VOUA 4QWCA 4RAYA 3WB1A 4K8XA 2XASA 4HQ6A 2EIKB 3JD1A 4O4HF 1FPOA 4CS4A 1H38A 5B1BC 2QK4A 3GIQA 4ZQIA 3JATA 4JI8O 3FKIA 3VMMA 2JVDA 3RYCB 2UUBB 4NXNB 1BL8A 2QKCA 1ROPA 2NR5A 2BTOA 2Q2TA 4I7HA 1GSOA 4B7KA 3CCVV 3F7YC 5LYJF 4AHCA 5H5NA 1HP8A 3H9VA 1FS0G 2F4VB 1AN7A 4A3JG 2ZDGA 5DISC 3GIPA 4OX9O 2UXCH 2ALZA 4PZ6A 3JAWA 4YJ3B 3BVOA 2F95B 2WA4A 1XI1A 4JI4B 2FB9A 4J9QA 4F4YA 1FJGB 3N8DA 5JVLA 4IT5A 1GLVA 3WG7B 2PUSA 1Y1VG 3SYQA 2KQXA 2VQEB 1M57C 4DV5O 2DWCA 4B3SH 2UXBB 2KG7A 2WYOA 4IWYA 4FFBA 2Q0OC 1S10A 4RAIA 1SCUB 3MFHA 2RJZA 4QW8A 4IIJB 2JA6G 3WFVA 4N23A 2OYQA 2IBZH 2V1DA 4XYLB 4A93G 3RB0A 3D36A 4D7TA 4EEYA 4Q8FA 3F5WC 4ZI7A 2ETNA 3KAJA 3FD9A 3PO2G 2EILB 5JCOC 1THZA 4QIWF 3MWMA 4JTAB 1VF6A 4CC5A 4O81A 2UXDH 3VNNA 2ATLA 5C8YB 4FFLA 4UVCA 3RYHA 3X2QB 2FP4B 4GX1A 3VQVA 3DAAA 4Q4CA 5JWPA 1KC7A 4DLKA 4G28B 3H4DA 3HOXG 3V6HA 2F1MA 1M0TA 3J81N 1S9FA 1EBOA 3GV5B 2WAQE 1VBHA 1B33N 4ICGA 2JA7G 1FXKC 3ASNB 1M93A 1SQBH 2C35B 2ZD9A 4JYBA 3AG1B 4R7CA 4MTFA 4F4LA 3AG2B 5KFZA 1LUVA 3OTOB 2FB5A 5KA6A 3Q8QB 2J6UA 1KKCA 1K4DC 3T4ZA 5BWVA 4YJ2A 4PI0A 3E2EA 2RGVA 1Z2GA 1WP7A 1D2DA 4PDBA 2XAJA 5LGNA 4FJCC 5IYZF 2DYRC 4X1KA 4DV2O 4WFHA 5LP6A 4FLWA 4LF9B 2W70A 5IJ0A 2VQFO 1SYXB 3AG4C 4YIPA 1FFXB 1RPOA 1I94O 4MVOA 3T1HB 3JALA 5TISZ 1UC9A 1FKAH 4U3FH 1ZHQA 5KT5A 3RTXA 3SNOA 1M7JA 1XL4A 2W6MA 1PL4A 4O4IA 4RB0A 2HJDA 2XCPA 1CKNA 3OD4A 2JS3A 2QEXV 4BAYA 3RGZA 5KFLA 2QGNA 4O2BF 2UVUA 2YUAA 1JDEA 4O3QA 5KFOA 4CZZA 4I4TB 5FNVB 1SRYA 4UCTA 2Y69C 4HNVA 3M9MB 4FK5C 4UCSA 4IL6Z 4M9UA 4EFBA 4O3SA 4FM2A 4DUZB 2XAGA 4YIOA 1PK8A 1EHIA 4JYAB 2VQDA 3H3VH 2JJ1G 2Y4UA 2X0SA 2M05A 3W7UA 1Q6IA 4Q4DA 4QGPA 3SPGA 4DV4H 5ITZB 2IP4A 1CP9A 2W8KA 4UXNA 1SEIA 5L1JA 3RW0A 2CQYA 4R8CA 4B3SO 1E4EB 4B3MB 1IOWA 4DV1O 3JYCA 1B6RA 3PW0A 3I56V 1Y76A 4OGQB 3APOA 5DLFA 1PX2A 4JZGA 4E4EA 5IYCO 5KX5F 1KECA 4LMYA 2HIVA 1TUBA 4PDMA 3FDSA 1GO3F 2UUCB 1R3JC 1BCCH 4QWAA 2ILMA 2A06H 3PJSK 2CKZB 3ZX6A 2CW8A 5IWAB 5L1KA 2NVXA 4YHHO 2FK1A 2UXDO 4MTGA 2CTPA 5CA1A 5J9PC 4DV7B 1WPXA 3HXLA 1KYOF 2Q6AA 2GQRA 3MHHC 1SQXH 2EX3A 4NYEA 5J2TF 4U6PA 5KS8A 3M99B 4LNUB 2XTAA 3N6XA 4MSWC 1R73A 3DTFA 5KLVH 5F2VO 4PBCA 3HBLA 4K0KH 4QPJA 3HKEB 2W9BB 1N48A 3KKYA 4JV5H 1VIBA 3OUFA 4X9QA 2UU9B 1JOYA 2GTSA 1TGOA 1A48A 1HR0H 5CMUA 5C93A 2JA8G 5LOVA 3EFFK 5KAFZ 4HYOA 3GQCA 4JI7O 1GTOA 3KCXA 4GX5A 3GTQA 3G67A 3N2KB 5CN0A 3ZMUA 3EHBB 5E1AC 1GKFA 3BQ0A 2R92G 3RV4A 4IHJF 1IDSA 1N33B 4W4KA 3M8AA 4QE7A 2YI9A 2QB5A 3JRWA 4DK0A 4X64B 1N0JA 3RVYA 1L8DA 4XZ3B 1UPGA 1FKAO 5D5QA 2UUBH 4NXNH 2IJJA 1N32O 3TW6A 4J7JA 2IU0A 4DL7A 2HHFB 4M7EA 2YS8A 3A8TA 3PFFA 5KFSA 1URFA 2F4VH 1TWFA 5CA0F 3DGEA 1K3EA 1NKDA 3CQZA 3H1IH 3E22A 2AW9A 2AZ0A 3W7XA 2HKOA 1NTMH 5IT9N 2WLLA 4U7NA 4O7TA 4JI4H 1IYEA 1SQGA 4QWEA 1FJGH 2CTWA 3FB7C 1E4GT 5KFBA 3RN4A 5KFKA 2JA5A 5L3EA 3GWKC 4MAMA 1XDCA 3PO3G 4NR1A 1GM8A 2VQEH 3MR6A 1MMMA 2UXBH 2N04A 3G71V 1W93A 4RWUA 3CCJV 1L0LH 1E4FT 2CK3G 3PW4A 4JI5B 1G6UA 2FMAA 2IJHA 4ZIBA 4O2AA 1W0KG 5BWXA 1GMGA 1D5NA 2EZPA 2P6JA 5K1XA 3X2QC 5HBRB 4ECQA 2C28A 1TWCA 3T9CA 2DIKA 3OEEG 3TY9A 1I2LA 4DV4O 4LP8A 4Q45A 1HDJA 3L73H 2Q2UA 4HZ3A 4NXMB 2E3CA 3E5NA 4TV9B 1CPYA 3HOUG 2NU8B 3BEHA 4ASUG 4DUYB 4FBTA 3T9AA 3OUUA 2GV9A 4PHZA 2R7LA 5I5VA 2VA2A 4TSFG 1S72V 2NU6B 4X8AA 1YHQV 1ET0A 5DGAA 3RYIB 5KHJA 5LGUA 5DGHA 3FX7A 2ADQB 4TUYA 2ZQMA 1VQ5V 3MHSC 1CKMA 1NS1A 1XHZA 3HOVG 4CKCA 4MTOA 4TV8B 1IZ3A 3O65A 3OTOH 3ZN0A 2JEUA 2YU9A 2C2AA 1UNNC 2EBOA 3HOYG 2DPJA 4A3CG 1E1QG 1EN4A 5JH7B 5D1OA 2G38A 2YXLA 4JI6B 4PJ0Z 3I4NG 2COGA 3D3IA 2ASLA 3W1BA 2EJ7A 1QLNA 3J7AK 1J5EO 4G3IA 4J9YB 4LF9H 4DW0A 3JZFA 2IW5A 3N2GB 4K0KO 3LWBA 2YC0A 3A0BZ 4UCRA 1PNMA 5LL6Y 1Y74B 4GUNA 5IYDO 4I0XB 4O7RA 4JV5O 3T1HH 2ADPA 3I12A 4U3JA 4FIPC 3JZ6A 2HHHB 1GN3A 4Q43A 3I5DA 3TIGA 1HR0O 5KG4A 4DR5O 4F4ZA 4B3TO 3F5TA 3U10A 2W6NA 2YIBA 3T4DA 3SJCC 4ZKIA 5JVDB 4GKJO 2P06A 4YP3A 2JRIA 3CSWA 1QVGU 1GN2A 4KL1A 3ZHVA 3NGDA 1VQ4V 5L9XA 2ZXWC 1AR5A 5JQGB 1I08A 4LFBB 5I5YA 4ZOLB 1KUQA 5B1BB 2E2HA 3SYAA 2B9ZA 5EC2C 2WA3A 3BAAA 4YY3H 1E1RG 1KB9F 4DUZH 4EBEA 1IURA 3NC0B 5LMNB 4BY1G 3JRXA 2UVWA 4JYAH 5EBWC 2NUAB 4RUAA 2ZINA 4MS2A 2CGOA 4YXWG 3TETA 4O7LA 5DMXA 4HBNA 3RYFB 5JJNB 1T3NA 2VUMA 1QHTA 4X88A 5BMVB 5KFAA 4WFGA 4MA5A 4PA9A 4LF6O 1FJGO 3UKMA 3T7AA 4EG0A 4YR0A 3L2PA 1YVWA 2E75B 2JDIG 4K35A 1OHHG 2FPIB 1PD3A 1S0NA 4CH6A 4WD3A 2VQEO 4B3MH 3DXRA 4BY7G 2UXBO 3LUTB 3SR2C 1PNKA 1SQVH 4X62B 2JEGA 4QWBA 3JASB 3IC7A 5BY1A 1XMOO 1M57B 4JTDB 1NH2D 2CNUA 1IBLB 2UUCH 1B6QA 3EPIA 3WO1A 1A9XA 4DL2A 2EIJC 2IH3C 3B2EE 2CAZC 3VQWA 1AR1B 3LSQA 4DR7B 3R9RA 4A3EG 1R1BA 4WBNB 1FXVA 3K57A 4NZMA 5IWAH 1Q3EA 2Q67A 2R82A 4FS1A 4IRDA 1TWHA 1QNMA 2W6IG 4DV7H 3SJBC 3OFNG 4IIJA 1JVMA 4PV1B 4MVRA 2J6SA 4ECWA 1WNSA 2BOCC 2F66C 4Z2WA 3GTPA 1EN5A 1KP2A 1O9HA 3M7MX 4BIOA 3S3WA 3OTFA 1SQQH 2ARHA 2DWDC 4F6RA 5IJ9A 4I5SA 2K9PA 3KCYA 2YI8A 5DQHA 3OSPA 5KT4A 3GTGA 2QM8A 1YCIA 4HR7A 3ZIAG 2O03A 1VQOV 1AVMA 1Q6HA 2Y48A 4BWAA 2FJZA 3UT5A 3E83A 1XL6A 3K08A 1FXKB 3OTOO 2UU9H 2W8LA 3ZCCA 1MSWD 1Q6UA 2GLTA 3B8MA 3E89A 5EZYB 1SZXA 2ODMA 3IJ4A 4P30A 5CBGA 4LF5O 2DAAA 5I47A 4DRFA 4LF9O 2BSKA 3W5OA
chains in the Genus database with same CATH topology
4X1IB 4CH3A 4HNAB 5BMVA 2YCHA 1A0IA 2HIXA 2UXCH 3KYHC 1N33H 3T1YB 3JAWA 4PZ6A 4YJ3B 4X65H 2E5LH 1S03G 2F95B 1XI1A 5LP6B 4JI3H 3LMLA 4X64H 4JI4B 4A2BA 5IJ0B 4AQYH 4EEQA 1FJGB 3THOA 2PUSA 2WDTA 4X20A 3JALB 3JASA 1XK5A 2VQEB 4B3SH 3HKDB 2UXBB 2BTQB 4RAZA 4BWSC 2WYOA 4RB3C 1WH2A 4FFBA 2ZNIA 1BGWA 4ZHQB 3HKCB 4DV6H 4Q6GA 2RJZA 1CKOA 4IIJB 1CKNB 4J0MA 1Z2NX 4I9QA 4DV2B 4CC6A 2OYQA 4UCUA 2VQFB 4D7TA 2HVQA 4WBNA 4ZI7A 1I94B 3KAJA 2JS5A 2PZSA 5KMGB 5JCOA 1M5IA 5JCOC 4DR3B 3MWMA 3K59A 4CC5A 3M4IA 2UXDH 3VNNA 4LF8B 4JI5H 1N34B 5C8YB 3RYHA 3VQVA 2VUGA 1J5EH 4LFAB 3JATB 3GB8B 2Q7EA 1L2ZA 1O9GA 4EB6B 1P8LA 2F1MA 3K5MA 4O4HA 3JAMW 1WPBA 1M0TA 2PYJA 4NXMH 1H2SB 4B3RH 4DUYH 4DR5H 1M93A 3L4KA 4B3TH 1X9NA 5LYJA 3TY8A 3RYCA 3OTOB 4DV0B 5KHGA 4GKJH 5EZYA 4JI8B 3U0ZA 3U11A 3RGBA 3EYYA 4YJ2A 2VPSA 4PI0A 5IYZB 2RGVA 3JAKB 2Q0AA 4PDBA 5LXTB 2KKWA 1TUBB 4X1IA 1XHXA 4CS3A 4X1KA 3N41B 4YJ3A 5BR8H 1IBMH 1O75A 5LP6C 5LP6A 4FLWA 4LF9B 5IJ0A 4Q0YA 4OX9B 1SYXB 1FFXB 4RB2C 4DV1B 3T1HB 5JJJB 2P5OA 4TQDA 3JALA 1FKAH 1ZHQA 5CA1B 2JGUA 3A2FA 3RTXA 4ZI7B 4JI6H 3HKDA 2BTQA 4DK1A 1TA8A 4O4IA 2ZCEA 3HKCA 4O2BB 4ZHQA 4GKKB 2MCTA 4RB0A 4DR6H 1CKNA 4LF6H 1M0WA 5D1PA 4KHPB 3RGZA 2YIAA 5D5PA 4X66B 1QQCA 4LSAA 3QTCA 1HNWH 2VWKA 5CB4B 4YHHB 4I4TB 4NVPA 5FNVB 1Z2PX 2VOBA 2HHHH 4FLXA 1XMOH 4LR3A 1KU9A 3F8NA 4UCTA 2ZM6B 1DGSA 5KHIA 4LNUA 1XMQB 5C8YA 4DR4H 4LF4B 1XQ8A 4UCSA 1B04A 4IAJA 4EFBA 2IM9A 4FM2A 5EYPA 4CH4A 1SA0B 1KMIZ 3WB0A 5LOVB 4DUZB 3J81W 4LFCH 4BW9A 3VQYA 4LF7B 4JYAB 1Z5WA 4EB6A 3SJAC 3J80W 3RJ0A 2YIBD 1XNQB 4LFBH 4FLTA 4DV4H 5ITZB 4O4LA 4EQ5A 1XNRB 2WE6A 3JSLA 5FD6A 4DV3H 4MV9A 3RF2A 1SEIA 4MV7A 4X1KB 3RFRA 2XHBA 5KX5B 4B3MB 5LMNH 3K5NA 1JJOA 4JI7B 5IYZA 2W57A 3JAKA 5LXTA 2Q7HA 3NBYB 3NBZB 3FFQA 3E22B 1Q8IA 4LMYA 2HIVA 1TUBA 5A2QW 2UUCB 3H20A 3K5LA 2XIGA 3PN1A 4O4IB 1T5EA 1GYFA 2CW8A 5J2UB 1FFXA 5IWAB 2QJ1A 1N32B 2Q7GA 3BRCA 4MTEA 4X62H 4FM0A 5J2TB 1SKVA 4FVMA 5CA1A 4DV7B 3HXLA 4LF5H 4CH5A 2UUAH 1Z5VA 2FE3A 1JFFB 2EX3A 5LMUH 1X4TA 1IBLH 4O2BA 4O2AB 4JI0H 4JI1H 4LNUB 1IBKB 4E6NA 3N6XA 4DR7H 5EYPB 1N36B 5CB4A 2V4DA 4I4TA 4K0KH 5FNVA 4RB1A 4FLVA 5LL6b 3HKEB 3KALA 3BPZA 5LA6A 4DV5H 3SGIA 4YY3B 4JV5H 3BHPA 2UU9B 1I7FA 1TGOA 4FM1A 3RIZA 4PZ8A 4O4LB 1HR0H 3LNNA 1SA0A 3QG5A 5LOVA 1RSOA 4JI2H 3DSQA 4X1YB 3K58A 3KAKA 4IHJB 2ZNJA 3HKBB 3N2KB 4DR1H 1HNXH 4O4JA 2PTMA 2PGGA 4DR2H 5ITZA 2UXCB 4A2AA 2RQ6A 1N33B 2E5LB 4LH7A 4X65B 2YI9A 1S5JA 4JI3B 3N44B 4DK0A 4X64B 1L8DA 4FM9A 4AQYB 5D5QA 2UUBH 5CA0B 1HNZH 4NXNH 5KX5A 4R7RA 4I50B 5FD5A 5EIBC 4M7EA 2F4VH 2VWJA 5D1OB 4B3SB 3N43B 3JSNA 3E22A 4DV6B 3T1YH 4JI4H 1SQGA 1FJGH 3W1GA 1E4GT 5J2UA 4U3JB 5J2TA 2VQEH 2RGRA 2UXBH 4I55B 5KHHA 1E4FT 2UXDB 4JI5B 1JFFA 1G6UA 4ZIBA 4O2AA 5LA6B 1TVKB 4DV2H 1J5EB 3ZS8C 2CFMA 5K1XA 2CW7A 2VQFH 2QM4A 4DRXB 2HVRA 3TY9A 1I6UA 3C0FB 3CB2A 1I94H 1Q5OA 2Q2UA 4NXMB 4B3RB 2E3CA 4DR3H 1TAEA 3HKEA 4TV9B 3QWUA 4DUYB 4LF8H 1WN7A 2R72A 4DR5B 4B3TB 1N34H 3UQ8A 4O4JB 4EFEA 2GV9A 3CHXA 4PHZA 3CSXA 4LFAH 3BA9A 4GKJB 4FLYA 3RWRD 4X1YA 4IHJA 3RYIB 5KHJA 3HKBA 3N2KA 1ZAUA 4TUYA 1VF7A 3K5OA 4D7SA 5FPOA 4CS2A 1CKMA 1HW7A 2F93B 1XHZA 5BR8B 1IBMB 3GJXB 4TV8B 2PYLA 3VQXA 1Z2OX 5GONB 3OTOH 4DV0H 5CA0A 4MTDA 1XDNA 4JI8H 2ZIMA 4I50A 1M4UA 5JH7B 1SQFA 2R70A 3S24A 3GDEA 5D1OA 3IAYA 5IT9W 2YXLA 4JI6B 3N40P 3K3VA 5FPRA 4DR6B 3W1BA 2HVSA 4LF6B 3J7AK 5K1PA 4LF9H 4OX9H 3N2GB 3BABA 4UCRA 1MZBA 3FMAA 1HNWB 1VS0A 2KSWA 4DV1H 3T1HH 4U3JA 1BJTA 2HHHB 3L4JA 1XMOB 4I55A 1JMKC 1Q43A 3CVZA 4ETSA 4GKKH 1NT2B 5EIBD 3U10A 4DR4B 2YIBA 1TVKA 3SJCC 5JVDB 4KHPH 1YEWA 4F6RB 3JARA 4LFCB 5IJ9B 3KXYT 4X66H 4KL1A 4DRXA 4K8ZA 5JQGB 2HEPA 4GLXA 4YHHH 5KHKA 2ZIOA 4TV9A 4UCOA 4LFBB 3ZEDA 3UT5B 2ZM6H 4DV4B 4ZOLB 2OWOA 1XMQH 4LF4H 4TUYB 4DV3B 3BAAA 4B08A 4RZQA 4DUZH 3NC0B 5LMNB 4LF7H 4JYAH 2ZINA 3RYIA 3N42B 5EOYA 4HBNA 3RYFB 4GYCB 4FLZA 5JJNB 1XNQH 1QHTA 4UCVA 5BMVB 4PI2A 1XNRH 3JAWB 3L2PA 4UFZA 4TV8A 3ICXA 5GONA 4TOIA 4CH6A 4B3MH 3SR2C 4JI7H 4X20B 1P16A 1ZHSA 1D5AA 4X62B 5JH7A 5FLXW 3JASB 4HNAA 4LF5B 3MAQA 2UUAB 3RR5A 4FFBB 5JJEB 5LMUB 1IBLB 2UUCH 4JI0B 3B2EE 4JI1B 1S68A 2CAZC 3VQWA 3N2GA 4DR7B 4FLUA 4WBNB 3K57A 5IWAH 1N32H 1Q3EA 1P49A 2PY5A 4PZ7A 3JARB 2P22C 4K0KB 4DV7H 3SJBC 4TQFA 4IIJA 3DF7A 4DV5B 4JV5B 2ZJTA 3IG0A 1WNSA 2F66C 3RYHB 1FVIA 4AILC 1O9HA 3M7MX 5JVDA 1HR0B 3OTFA 1IBKH 4L8JA 3QF7A 4JI2B 4F6RA 5IJ9A 1N36H 5KMGA 2YI8A 4O4HB 5JQGA 4LH6A 2O03A 4RAYA 4DR1B 4BWAA 3TY5A 3WB1A 1HNXB 4K8XA 4YY3H 3UT5A 3WB2A 4DR2B 4CS4A 4ZOLA 4LSXA 2UU9H 5LYJB 3JATA 3BA8A 2JVDA 3RYCB 2UUBB 4NXNB 2Q2TA 1HNZB 2HGSA 2BTOA 5EZYB 4I7HA 4YJ2B 4AHCA 2F4VB 1V9PA 1AN7A 3RYFA 2R9AA 4DRFA 3ETQA 3RGXA 4APMA 5DISC 3W5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A0I A;  2HIX A;  3KYH C;  3T1Y B;  4PZ6 A;  4LFC B;  4UCT A;  2ZM6 B;  1DGS A;  5D1O B;  4B3S B;  4JI4 B;  1XMQ B;  4LF4 B;  4EEQ A;  3JSN A;  4GLX A;  1FJG B;  4UCS A;  1B04 A;  4EFB A;  4DV6 B;  4DUZ B;  4UCO A;  4LFB B;  4DV4 B;  4LF7 B;  2OWO A;  2VQE B;  4JYA B;  1XK5 A;  2UXB B;  3W1G A;  4DV3 B;  3BAA A;  1CKO A;  1XNQ B;  1CKN B;  3NC0 B;  5LMN B;  4EQ5 A;  4DV2 B;  4CC6 A;  1XNR B;  4UCU A;  2VQF B;  3JSL A;  2HVQ A;  2UXD B;  4JI5 B;  1I94 B;  4UCV A;  4B3M B;  1J5E B;  2CFM A;  4DR3 B;  4JI7 B;  4CC5 A;  3L2P A;  4UFZ A;  3VNN A;  4LF8 B;  2HVR A;  1N34 B;  3TY9 A;  3NBY B;  4TOI A;  3NBZ B;  2Q2U A;  2VUG A;  2HIV A;  4NXM B;  4B3R B;  2UUC B;  4LFA B;  1TAE A;  1P16 A;  3PN1 A;  4X62 B;  3GB8 B;  3QWU A;  4DUY B;  4DR5 B;  1P8L A;  4B3T B;  4LF5 B;  3UQ8 A;  2UUA B;  3RR5 A;  4EFE A;  5IWA B;  1N32 B;  5LMU B;  1IBL B;  3BA9 A;  4GKJ B;  4JI0 B;  4JI1 B;  4DV7 B;  1S68 A;  1X9N A;  4DR7 B;  3TY8 A;  3OTO B;  1ZAU A;  4DV0 B;  4PZ7 A;  5FPO A;  4K0K B;  1CKM A;  4JI8 B;  1IBK B;  4E6N A;  4DV5 B;  5BR8 B;  1IBM B;  4JV5 B;  3GJX B;  1N36 B;  1FVI A;  1XDN A;  1HR0 B;  4JI2 B;  3SGI A;  4YY3 B;  3S24 A;  3GDE A;  5D1O A;  4LF9 B;  2UU9 B;  4OX9 B;  4JI6 B;  4LH6 A;  4PZ8 A;  4DR1 B;  3TY5 A;  4DV1 B;  5FPR A;  3T1H B;  1HNX B;  4DR6 B;  3W1B A;  2HVS A;  4LF6 B;  4DR2 B;  3RTX A;  3BAB A;  4UCR A;  3BA8 A;  1TA8 A;  1HNW B;  4GKK B;  1VS0 A;  2UUB B;  4NXN B;  2Q2T A;  1HNZ B;  1CKN A;  5D1P A;  2HHH B;  4KHP B;  2UXC B;  1XMO B;  1N33 B;  2E5L B;  4LH7 A;  4X65 B;  4X66 B;  4JI3 B;  2F4V B;  1V9P A;  4X64 B;  4DRF A;  4AQY B;  4DR4 B;  4YHH B;  5DIS C;  3W5O A; 
#chains in the Genus database with same CATH topology
 2YCH A;  2YXY A;  3B4S A;  1A0I A;  2DYR B;  1N33 H;  3T1Y B;  5IYB G;  4JI1 O;  5LBQ A;  3LSS A;  2WB1 A;  3T1H O;  1JPX A;  3LML A;  4X64 H;  4A2B A;  1BHB A;  3AG4 B;  1WB8 A;  3DC6 A;  2JEJ A;  2FLL A;  2GUZ B;  4YJ3 F;  4A3B G;  5KFC A;  1X59 A;  3WU2 Z;  1XK5 A;  4A3I G;  2V59 A;  2R7Z G;  2BTQ B;  3BAC A;  4RAZ A;  2UXX A;  4IRC A;  2ZNI A;  2ATK C;  4ZHQ B;  1DLB A;  3CCE V;  2OTL V;  4Q6G A;  1CKO A;  2C2R A;  4BIU A;  3UCS C;  4O7Y A;  4HNT A;  2W9C A;  2CH7 A;  4UCU A;  3TII A;  1M9N A;  4C5A A;  4CMF A;  5HV6 A;  3D36 C;  3UYY A;  1Y4M A;  1QU7 A;  3MDS A;  2HFE C;  2JS5 A;  2WLJ A;  2PZS A;  3CD6 V;  3ETE A;  3AG3 C;  5KMG B;  4DR3 B;  2DMX A;  3K59 A;  1VF6 C;  1RM1 C;  4DR2 O;  2GPS A;  4TQS A;  3M4I A;  1H2G A;  4XX0 B;  2Y69 B;  4JI5 H;  2M6Y A;  5KT3 A;  4JYA O;  5BPH A;  2A3Q A;  1WAZ A;  3STL C;  3T9E A;  5C8Y F;  1L2Z A;  2R8G A;  2BQR A;  4CHI A;  3CC2 V;  1P8L A;  3GIJ A;  1JXL A;  3K5M A;  4O4H A;  3JAM W;  5KAI Z;  2PYJ A;  2A7W A;  4NXM H;  1H2S B;  3B8N A;  1GSA A;  3ZRW B;  3ETH A;  5DN6 G;  4DUY H;  5IP9 G;  4A3K G;  3ZRX A;  3TXQ A;  4B3M O;  5LYJ A;  3TY8 A;  5K2M A;  1ZWI C;  5K3W A;  4C5B A;  4DV0 B;  3ETG A;  5KHG A;  2ITC C;  4O4L F;  4MV8 A;  1YJ9 V;  5B5E Z;  2CTR A;  3U0Z A;  3U11 A;  3RGB A;  3CCU V;  4LC1 A;  3T9B A;  2UUC O;  3HOZ G;  2Q0A A;  4EBD A;  5LXT B;  4DW1 A;  3CCL V;  1VF5 B;  5I5W A;  3LDC A;  4X1I A;  1I2K A;  3L9D A;  4CS3 A;  3N41 B;  2J6T A;  1KJQ A;  3OR6 C;  5LP6 C;  1ZUQ A;  1W96 A;  2R93 A;  1GRJ A;  4RB2 C;  4FFO A;  2P5O A;  5JJJ B;  5H6Q A;  3K79 A;  2V5A A;  2LJ2 A;  2BQ3 A;  3FYE B;  3HKD A;  4JI6 H;  2ABJ A;  1PL0 A;  2Q4P A;  1Y1W A;  2ZCE A;  3HKC A;  4RUC A;  3I55 V;  1MZF A;  2RCV A;  2QYZ A;  1MOF A;  2YIA A;  3R23 A;  2B63 G;  1QBZ A;  4QIW A;  1DTO A;  1QQC A;  4LBE C;  3GTO A;  3ZRV A;  3ETD A;  5KUK A;  4O3O A;  5CB4 B;  3F7V C;  3C90 A;  5B1A C;  1VQP V;  4NVP A;  2UU9 O;  1PP9 H;  1Z2P X;  2HHH H;  3H40 A;  4LR3 A;  2Z5U A;  3T1C A;  3F8N A;  1VQK V;  2ZM6 B;  4I55 F;  4JAS A;  5KHI A;  4LNU A;  2QWR B;  1K8A W;  4LF4 B;  4I4T F;  5FNV F;  3RAQ A;  3HT5 A;  4IAJ A;  3PR4 A;  4CH4 A;  3MR5 A;  5LA6 F;  1SS3 A;  3WB0 A;  1PKX A;  2E74 B;  1RSO B;  1AI4 A;  1G8M A;  4ED0 A;  2R7K A;  4LF7 B;  3IN5 A;  4EB6 A;  2LFR A;  1L1F A;  2EJ2 A;  2Z02 A;  4GX2 A;  1VBG A;  4LFB H;  4X64 O;  1ZSP A;  4AI8 A;  1XNR B;  3HB9 A;  1YIJ V;  5F9L A;  1RPR A;  2C2D A;  3JSL A;  2Q5Z A;  2HP8 A;  3RF2 A;  1DAA A;  4GZR B;  3L74 H;  4O4J F;  4MV7 A;  2DWE C;  1BQZ A;  1JKJ B;  5LMN H;  5KFH A;  2CNQ A;  3VBB A;  4ECS A;  5KFQ A;  5IYZ A;  2AZ2 A;  2FL4 A;  2W57 A;  3JAK A;  1K1S A;  2Q7H A;  3NBY B;  4DL4 A;  1OCO C;  3AW8 A;  1Q8I A;  3E86 A;  1K7D A;  2E76 B;  4EBC A;  3R5F A;  2MK3 A;  3BY6 A;  3OAA G;  4KHP O;  2YID A;  5KFV A;  4XDL A;  3TEK A;  1K5S A;  2M7W A;  4FFK A;  5J2U B;  1BE3 H;  2W6P A;  2DW4 A;  1VQN V;  1WLE A;  1AJQ A;  2Q7G A;  3N27 A;  3Q4H A;  4JI5 O;  1I7L A;  4X62 H;  2A79 B;  3H01 A;  4FVM A;  3SPI A;  2FLN A;  1Y14 B;  1Z5V A;  1XMQ O;  2C00 A;  1JFF B;  3HPL C;  1IBL H;  4ECT A;  4O2B A;  2YDE A;  4WFE A;  3PW5 A;  4E6N A;  2YW2 A;  1AUV A;  1ZQ7 A;  4YR3 A;  3RBZ A;  3K3P A;  3U9S A;  4DR7 H;  4P2Z A;  4FU0 A;  3TQT A;  5EYP B;  1N36 B;  4JF3 A;  4NTY A;  1XNQ O;  4J9N A;  2W0X A;  3KAL A;  1V4Y A;  3PZP A;  3BPZ A;  4JXU A;  3SGI A;  4YY3 B;  4R8U B;  1JA8 A;  2OCH A;  3RV3 A;  3ZJZ A;  2GSM B;  4ED6 A;  3RIZ A;  4FM1 A;  2WLN A;  4O4L B;  1GSH A;  3LNN A;  1SA0 A;  2QWN B;  1OCR B;  3DSQ A;  3K58 A;  1AI7 A;  2H94 A;  3KAK A;  3SPJ A;  1YJW V;  4AYB A;  3OGI B;  2AHZ A;  2C2E A;  1CXZ B;  1KTA A;  3EPG A;  2LFS A;  2PTM A;  4A2A A;  3IGA C;  3BQ2 A;  2OT5 A;  3UM7 A;  1NJI W;  4JI3 B;  4F4X A;  2ZDQ A;  5KX5 A;  1WCM G;  2L35 A;  4I50 B;  5FD5 A;  4ZBM A;  3Q2O A;  3B40 A;  5KG3 A;  1OCC C;  2IU3 A;  2VWJ A;  2WLI B;  5E79 Z;  3Q8S B;  3C3S A;  2XAH A;  3JSN A;  1A0G A;  2Y0S A;  1UFI A;  4MTX A;  4DV6 B;  3T1Y H;  2AGA A;  5C1O A;  1IBK O;  1SFO A;  5H6R A;  3A0H Z;  3K3W A;  1K97 A;  1R3K C;  3B77 A;  2HHH O;  3V4Z A;  3W1G A;  2DQ3 A;  2HGX A;  1TWG A;  5BYA A;  1JLL B;  2RDC A;  5J2T A;  3QZ8 A;  2RGR A;  1H8E G;  4I55 B;  1S97 A;  4QE9 A;  5HFL A;  3UZB A;  3T54 A;  5IP7 G;  2XAF A;  4NZN A;  4EYH B;  3A0R A;  4O86 A;  5LA6 B;  3T5K A;  2YZG A;  1TVK B;  4A3D G;  2YEV A;  3ZS8 C;  2CFM A;  1GH6 A;  5L3D A;  1VQ9 V;  2COJ A;  2ODT X;  2DJV A;  4DRX B;  2ZXW B;  4LFB O;  2HVR A;  3NR7 A;  1I6U A;  3C0F B;  2RDJ A;  2QTS A;  2RDI A;  4B3R B;  3GTL A;  1QR8 A;  4O3R A;  4J80 A;  4DR3 H;  1ORQ C;  3E8G A;  3H0G A;  2UXC O;  1CQJ B;  3KZI Z;  4WFA V;  3G8D A;  2GPW A;  2AXT Z;  4O4J B;  4EFE A;  3CHX A;  1YIT V;  4TV9 F;  2ZR2 A;  5B66 Z;  5KG0 A;  1AR4 A;  1OWT A;  3RWR D;  4X1Y A;  3OMI B;  1W59 A;  5T14 A;  4IHJ A;  2F23 A;  5DGB A;  3HKB A;  1B6S A;  4BBR G;  5B3S C;  2Y4T A;  1M1K W;  1ZAU A;  3V6J A;  2QWO B;  2F93 B;  1WR2 A;  2IBK A;  1YZB A;  2O57 A;  5BR8 B;  2YYA A;  3VQX A;  1MAB G;  5GON B;  4DV0 H;  5CA0 A;  1WSC A;  4XDJ A;  1V55 C;  3FAV A;  4O7N A;  5KFI A;  1M4U A;  2XCL A;  2F43 G;  3R5H A;  1G2W A;  2Z0A A;  4TV8 F;  3S24 A;  4YJ2 F;  2ZE7 A;  1H2K A;  5FR9 A;  1LNQ A;  1V54 C;  4DR7 O;  1YJN V;  2I8C A;  2VRZ A;  5JH7 F;  5FPR A;  4DR6 B;  3K3V A;  3PR5 B;  2HVS A;  2EIJ B;  2R85 A;  4BXX G;  2JGD B;  1H2L A;  3AG7 A;  5L3F A;  3CCR V;  1MZB A;  3FMA A;  3SYO A;  1HNW B;  3OT7 A;  2FK2 A;  4DIM A;  5KFN A;  1IYD A;  5HFM A;  1EZV H;  3OM3 B;  1F51 A;  1JMK C;  3CVZ A;  1K83 A;  4EGQ A;  5EIB D;  3HR0 A;  4ECZ A;  2JK5 C;  5F9N A;  1S3J A;  1I7N A;  4PDL A;  4YB8 B;  3RT3 C;  3SPH A;  1YEW A;  2Z04 A;  3KXY T;  2Q9L A;  5CE8 A;  2HEP A;  1SET A;  4GLX A;  5JVD F;  2ZDI C;  3DTG A;  3CYO A;  1N8R W;  1YF2 A;  4I9W A;  3EXA A;  3ZED A;  2ZM6 H;  3K06 A;  3VPC A;  2LQT A;  5JQG F;  2Q73 A;  1P4R A;  3CPW U;  2A1H A;  2EUL A;  3G8C A;  1K73 W;  4LF4 H;  3RFC A;  2WB1 E;  3ZMT A;  1NR7 A;  4B08 A;  4RZQ A;  3BFR A;  1ZL8 A;  3FKI G;  2OH2 A;  3AX6 A;  4M0J A;  4ZOL F;  4B7E A;  1AJP A;  4LF7 H;  2I87 A;  4IYI A;  2RF4 A;  5IYB O;  5KFG A;  5EOY A;  3ZHU A;  1KP3 A;  5L1L A;  4Q44 A;  1DV1 A;  4J9K A;  1XNR H;  2DN9 A;  4K6N A;  3JAW B;  4X89 A;  1JX4 A;  2NN4 A;  5KFP A;  3KHL A;  3L75 H;  1BSM A;  4ECY A;  3CME V;  4TM5 A;  5E25 A;  4TOI A;  5BMV F;  4WCE V;  3QZ7 A;  4MT8 A;  4BW5 A;  1VAR A;  1D5A A;  1GK9 A;  3ZRS A;  2KG7 B;  4OXS A;  2UUA B;  3RR5 A;  4GC6 A;  3TJT A;  4FFB B;  5JJE B;  2NU9 B;  1YXB A;  2QKS A;  2YZL A;  3OHA A;  2ZT9 B;  2X6B A;  4PWQ A;  3BQ1 A;  4CKB A;  3WNZ A;  2PF4 E;  1WA8 B;  1BS3 A;  3BJY A;  4DR3 O;  4E2L A;  4ED2 A;  1VMG A;  1P49 A;  4PZ7 A;  2FML A;  2R7M A;  3V4S A;  3AG3 B;  1KJ9 A;  1RM1 B;  3DF7 A;  4WBN F;  4DV5 B;  3H1L H;  1OBD A;  3ETJ A;  3RYH B;  1ARO P;  4JV1 A;  2LW7 A;  1KKD A;  2ITD C;  4L8J A;  3JD3 A;  4J7Z A;  1N36 H;  5KMG A;  2RN9 A;  1OCR C;  3WWH A;  5BPF A;  3P3P A;  4TVI A;  1HNX B;  2FYU H;  1VP7 A;  2KSD A;  4GCZ A;  2EZO A;  3WB2 A;  3N6R A;  3JAM N;  4IYH A;  1R6N A;  1VQM V;  3W7W A;  2IA6 A;  4WFB V;  2B1G A;  4ABM A;  4A3M G;  1I5Y A;  2GDS A;  2HGS A;  3G6E V;  3OMA B;  1UJW B;  4YJ2 B;  3CJH A;  1V9P A;  2BOB C;  1I1M A;  3ETQ A;  5EZY F;  1DF4 A;  3S3X A;  4APM A;  1YSC A;  2P90 A;  4HNA B;  4ED3 A;  1S03 G;  4JI3 H;  5LP6 B;  3CCQ V;  1RP3 B;  2YS6 A;  5IJ0 B;  4EEQ A;  4QIW E;  3MR2 A;  2ZE8 A;  2WDT A;  2W6Q A;  2R9I A;  4X20 A;  4RNN A;  5CBH A;  3JAL B;  4DQN A;  4QW9 A;  3CC7 V;  2YRX A;  2R8I A;  4PA6 A;  1WH2 A;  1BGW A;  4Z1M G;  4DV6 H;  2XOK G;  1CKN B;  1ZX3 A;  4J9P A;  4I9Q A;  4DV2 B;  4CC6 A;  1M56 C;  1PPJ H;  3CEB A;  4G2K A;  2VQF B;  1TUE B;  4ZHQ F;  2ZM6 O;  1I94 B;  1NR1 A;  5B1A B;  3CXC U;  1M5I A;  3WWJ A;  4F6E A;  4DYL A;  4LF8 B;  1BNC A;  4FFN A;  3WO0 A;  2HVJ C;  1E79 G;  1FD9 A;  2WLH A;  4LF7 O;  1JX9 A;  2VUG A;  3CWB H;  2W6O A;  2UUB O;  4NXN O;  4LFA B;  4QJF B;  3I4M G;  3UZO A;  1O9G A;  4FE2 A;  1IXB A;  2F4V O;  1WPB A;  1R3L C;  1XNR O;  2ASJ A;  1I0H A;  2AQ4 A;  1CQI B;  4B3R H;  3BG5 A;  3QO7 A;  1AP5 A;  2BE3 A;  4J7K A;  3L4K A;  3LP8 A;  3T2M A;  4O82 A;  2P0A A;  4JI4 O;  5H2F Z;  3RYC A;  2LGW A;  2A0L A;  5KG6 A;  3T99 A;  3T5J A;  5L3B A;  4MV1 A;  5FJ8 G;  1Y76 B;  2PMZ A;  3EVK A;  3ORR A;  1OCO B;  4HNU A;  1TUB B;  4DL3 A;  2Q68 A;  1EYZ A;  1EUD B;  4YJ3 A;  1W2B U;  5BR8 H;  5LXT F;  1VKZ A;  1O75 A;  4Q0Y A;  5IY5 C;  1I3Q A;  5KT6 A;  1Y1V A;  3K03 A;  5GW7 A;  2Q8V A;  4PA7 A;  2FPG B;  2WAM A;  4DV1 B;  4TQD A;  4L1K A;  3MWE A;  3ABL B;  5CA1 B;  2JGU A;  3A2F A;  4IR9 A;  3GB7 C;  1EUC B;  1NTK H;  4DK1 A;  2BCC H;  2JA6 A;  1S5H C;  1TA8 A;  4GKK B;  4DR6 H;  3U9T A;  4A5U B;  1XEQ A;  1M0W A;  5H80 A;  5D5P A;  4X66 B;  3MWD A;  4LSA A;  1HNW H;  2X7R B;  1NQT A;  3ORQ A;  2VWK A;  3KHR A;  4YHH B;  4AYB E;  2IMW P;  3CE2 A;  5B1O A;  2AHY A;  1T36 A;  1KU9 A;  3TW7 A;  4JPR A;  5CB4 F;  5KFX A;  5C8Y A;  1B04 A;  2EIM C;  2IM9 A;  1RYR A;  5EYP A;  1DV2 A;  2YZM A;  1OCZ C;  5LOV B;  1F23 A;  3VQY A;  1VQ7 V;  5EDW A;  1Z5W A;  3SPC A;  2R9R B;  1GO3 E;  1R3I C;  3RUP A;  3RJ0 A;  2Y0S E;  5BWW A;  2JA7 A;  4JI3 O;  2YIB D;  4CBC A;  4DL5 A;  3HKZ E;  4O4L A;  4A3L G;  2PN1 A;  2QM7 A;  5DM6 V;  4IZO A;  3TGU H;  4MV9 A;  2HG5 C;  3ABK C;  3ABU A;  3RFR A;  5DLG A;  4RO2 A;  1JJO A;  4JI7 B;  4MVU A;  1OCC B;  2GBO A;  2NLJ C;  4DV6 O;  3E22 B;  4JYY A;  4OPA A;  4C7U A;  3CRC A;  4R50 A;  5A2Q W;  5H9C A;  3E35 A;  3K5L A;  3H20 A;  3PN1 A;  2IJI A;  3LUL A;  1T5E A;  4JYC A;  2AGP A;  5KFR A;  5KFY A;  4UV8 A;  5C5J A;  1FFX A;  2QJ1 A;  1N32 B;  3K9A A;  3FKS G;  4MTE A;  1RYS A;  4FM0 A;  1LR1 A;  2JA5 G;  4A3F G;  2UUA H;  5J2U F;  1RK5 A;  4H44 B;  4CE5 A;  2FE3 A;  3LNM B;  1X4T A;  2QR4 A;  1P7B A;  2V7Q G;  4O2A B;  3BCC H;  3RBD A;  4O84 A;  3PVX A;  1Q86 W;  4DUZ O;  1KBL A;  1AP6 A;  1WJZ A;  4JV0 A;  4O7W A;  5DQG A;  5D8D A;  3KHG A;  4NTX A;  4NB5 A;  1C3O A;  4JUZ A;  3ZHS A;  4ED1 A;  2V4D A;  4I4T A;  3OEH G;  3T9F A;  5FNV A;  3G6Y A;  4RB1 A;  4FLV A;  1KJI A;  3LQS A;  2LP7 A;  5LA6 A;  1AB3 A;  4DV5 H;  1YDX A;  4GX0 A;  4N21 A;  3HOW G;  2CE4 A;  4J9O A;  1LUW A;  3GLK A;  2ZDH A;  5BZB A;  4PZ8 A;  5KFJ A;  1B3Q A;  3QG5 A;  1NH2 B;  2QE7 G;  3KG2 A;  5EWF A;  3ZMS A;  2X6A A;  5B3S B;  2HG8 A;  5BR8 O;  1HNX H;  5KUM A;  4XYM B;  4O4J A;  2PGG A;  2NVY A;  5ITZ A;  5L3G A;  3OUZ A;  2E5L B;  2XAQ A;  2OIG A;  2Q69 A;  3TK1 A;  1S5J A;  4X65 B;  2Q7D A;  1EFR G;  3APQ A;  3L72 H;  4AQY B;  2LGQ A;  5I5U A;  2K1E A;  2WPD G;  3ASO C;  5BXZ A;  5IWA O;  1V55 B;  2LW1 A;  1E4E A;  1BQ0 A;  1CS0 A;  5EIB C;  4RUE A;  1JJ2 U;  1N56 A;  4DV7 O;  4DR6 O;  5D1O B;  1PV0 A;  4KP4 A;  1V54 B;  1YTF D;  4I50 F;  4HAM A;  2P67 A;  1XIL A;  4O3P A;  5KFE A;  1KJ8 A;  2H8P C;  2X6C A;  5L1I A;  2BQU A;  1AJN A;  4XBF A;  4UUJ C;  4U3J B;  5CM0 A;  1K4C C;  4C2M A;  4CMD A;  2B5U A;  5C44 G;  3T9D A;  3UO3 A;  3RB3 A;  1NBM G;  4DV2 H;  1J5E B;  1QLE B;  3IFX A;  2VQF H;  3H4B A;  4FS2 A;  2QM4 A;  1G1X B;  3RVZ A;  1I94 H;  1XUQ A;  4L87 A;  1NI8 A;  4JV2 A;  3QO5 A;  3HKE A;  2W9B A;  4MW3 A;  4MVZ A;  3JCZ A;  4NLG A;  3QWU A;  2GHY A;  3CMA V;  1N33 O;  1SC5 B;  4LF8 H;  1WN7 A;  3ML0 A;  4DR5 B;  4B3T B;  4JTC B;  1R6K A;  3AK3 A;  2XGQ A;  1N0N A;  3SYP A;  4LFA H;  3BA9 A;  4GKJ B;  4FLY A;  1K9M W;  4GC7 A;  2R92 A;  3LDD A;  3CS5 A;  3N2K A;  5KG2 A;  4Z1V A;  1VF7 A;  3K5O A;  3DTU B;  4D7S A;  2QF7 A;  5FPO A;  4TQR A;  1US6 A;  2HR3 A;  1KC8 W;  1HW7 A;  4EKW A;  2YL2 A;  1S0M A;  2VUM G;  1IBM B;  1JQ0 A;  1IXM A;  2VS0 A;  2X5R A;  2HLD G;  1Y66 A;  1ULZ A;  1Z2O X;  3ABT A;  4ECR A;  2DZD A;  1GN4 A;  4MTD A;  3DXR B;  1XDN A;  2PBZ A;  1I1K A;  5BWR A;  2UUA O;  2HVK C;  2JIZ G;  2HHF A;  4KFM A;  2P7T C;  1SQF A;  2R70 A;  2X0L A;  5GON F;  4UB8 Z;  3IAY A;  1COW G;  4JAA A;  3QO8 A;  5GTI Z;  3VA7 A;  1V51 A;  3N40 P;  3ABL C;  2CGN A;  4LF6 B;  3G4S V;  1NVP D;  1OBG A;  4RQE A;  2EIY A;  3VOT A;  3KRE A;  1W0J G;  4O7V A;  4DV1 H;  2XT9 A;  4UUG A;  4NXM O;  1BJT A;  1HWY A;  3ZMZ A;  3L4J A;  1XMO B;  4DUY O;  4MVQ A;  5KFW A;  1XRE A;  1FXH A;  1Q43 A;  4ETS A;  4FPP A;  4GKK H;  2IH1 C;  1WA8 A;  4DR4 B;  3QFF A;  3FB5 C;  2HJW A;  4KXR A;  3KTM A;  4W4L A;  4J41 A;  4MW8 A;  1J95 A;  4F6R B;  4LFC B;  5IJ9 B;  3D3Q A;  4X66 H;  4H33 A;  3P32 A;  1HNX O;  4UV9 A;  4RZR A;  2W7P A;  5DG9 A;  4YHH H;  3STZ C;  1KQS U;  3K04 A;  5LGT A;  3RB6 A;  4TV9 A;  2AGO A;  3UT5 B;  1RJR A;  2LO1 A;  5A9G A;  3T5H A;  1I1L A;  2ZR3 A;  3FYI B;  3RB4 A;  2YS7 A;  2BR0 A;  1YTF B;  1S5L Z;  2Y0I A;  4DV3 B;  2HGW A;  5KFU A;  3GIK A;  4RNM A;  2B1I A;  2CUG A;  2PI4 A;  3ABM B;  2YSU B;  1BXR A;  1N4C A;  3RYI A;  3N42 B;  2YWV A;  4JI6 O;  4GYC B;  3J80 N;  1A3G A;  3W7S A;  2BSK B;  4UCV A;  1G4Y B;  2XD4 A;  4TV8 A;  3HKZ A;  2L6L A;  4R6Z A;  1WRV A;  1R9T A;  5LHI A;  2DLN A;  4JI7 H;  1P16 A;  4FMT A;  1ZHS A;  5FLX W;  5JH7 A;  5DGI A;  4HNA A;  4LF5 B;  3Q8R B;  3MAQ A;  2DYS C;  1Y67 A;  1WB7 A;  5LMU B;  4G27 B;  3GWO A;  5EK0 A;  4JI0 B;  4JI1 B;  1FFT B;  2FTK A;  1M56 B;  1S68 A;  2W9C B;  2CH7 B;  3ZBH A;  3RAX A;  3N2G A;  5I5T A;  1Y74 A;  1N32 H;  4I0X A;  2W7O A;  3JAR B;  4LF8 O;  2ZE5 A;  4FFM A;  2P22 C;  1B06 A;  3G6V A;  4WF9 V;  1GGO A;  3MR3 A;  5AG2 A;  4ZI7 F;  4LFA O;  2EJ0 A;  1DF5 A;  1EKP A;  3JZI A;  5BWT A;  1EN6 A;  5KFF A;  4J9M A;  2AGQ A;  3CP1 A;  5BYB A;  2YZN A;  1Q90 D;  2Z3Y A;  3AEI A;  5JVD A;  1TWA A;  3QF7 A;  5LMN O;  4JI2 B;  5KT7 A;  2EIN C;  4IR1 A;  4O4H B;  5JQG A;  2PMZ E;  2OTJ V;  4DR1 B;  2J9G A;  3TY5 A;  1MZE A;  2W71 A;  4DR2 B;  4ZOL A;  4LSX A;  3PW7 A;  4O7Z A;  2DQ0 A;  5LYJ B;  3BA8 A;  4QJF A;  4LWS B;  5KKN B;  2UXN A;  5DED A;  1HNZ B;  1UC8 A;  3M9O B;  1NVP B;  1WP8 A;  4X62 O;  2E2I A;  2WWW A;  2WTF A;  5EC1 C;  4PD4 F;  3NUA A;  5C3E G;  3RYF A;  1VAJ A;  2R9A A;  3H1J H;  3CRQ A;  3RGX A;  2XCA A;  1IBL O;  4X1I B;  3H1K H;  4CH3 A;  5BMV A;  2DAB A;  2HIX A;  2V58 A;  4ME6 A;  3KYH C;  1SQP H;  3WWI A;  5I5S A;  2E5L H;  4X65 H;  3RBE A;  3TCU A;  4DO2 A;  2HJF C;  4U7C A;  2W6Z A;  5IY5 B;  4AQY H;  1P7G A;  1T94 A;  2R93 G;  2OCC C;  3THO A;  5LP6 F;  1H2M A;  4K3A A;  5CBF A;  4GKK O;  5GTH Z;  3JAS A;  3J7A U;  4H0L B;  3OGC C;  3HKD B;  4BWS C;  4RB3 C;  3HKC B;  4X66 O;  3DC5 A;  4J0M A;  1I50 A;  1Y1W G;  1Z2N X;  4KUM A;  1S76 D;  3C3T A;  5JQW A;  4MVS A;  4O4I F;  2HVQ A;  4WBN A;  3GV8 B;  2W0F C;  1VQL V;  1QLE C;  2QKA A;  1ZET A;  2R84 A;  2FK3 A;  1RJQ A;  5FL7 G;  3CRR A;  1S0V A;  3SJQ C;  5JCO A;  3CRA A;  1PNL A;  1SES A;  1N34 B;  3OE7 G;  4J42 A;  2JJ2 G;  3CCM V;  2EIM B;  4J11 A;  1J5E H;  1OCZ B;  1EM1 A;  4RU9 A;  3JAT B;  4F50 A;  3GB8 B;  2QTO A;  2Q7E A;  3MD0 A;  4EB6 B;  1H2N A;  1XOU A;  4JZ2 A;  4O83 A;  3VPD A;  2XGP A;  2NNU A;  3U54 A;  1IX9 A;  1RJP A;  2EIK C;  3Q8P B;  4F4W A;  3T1Y O;  1FXK A;  2JEX A;  5KT2 A;  4DR5 H;  3CCS V;  4B3T H;  3P3N A;  1X9N A;  5KFT A;  2PVP A;  5CAE B;  4J9R A;  1K5Q A;  2R7N A;  4HN2 A;  3JD4 A;  3ABK B;  3LSU A;  3GII A;  3K9S A;  4GKJ H;  1KUT A;  4LCU C;  3QQM A;  3ZN1 A;  5EZY A;  4JI8 B;  5DG8 A;  1C30 A;  1U97 A;  3EYY A;  2VPS A;  5IYZ B;  4IRK A;  3JAK B;  1Y6X A;  4MV4 A;  3G6B A;  1L0N H;  2KKW A;  1JR9 A;  2D2C B;  4FZ0 A;  1S0O A;  1XHX A;  3IC9 A;  4DXW A;  2FKX A;  4OPH A;  5L3C A;  1K1Q A;  1IBM H;  2N05 A;  2GQS A;  4OX9 B;  3GTJ A;  5A2Q N;  1BZK A;  3WG7 C;  2GUZ A;  2QA4 V;  5DAA A;  3Q4H B;  3R5X A;  2R7Z A;  4ZI7 B;  4BIZ A;  2BTQ A;  2XC9 A;  3JD2 A;  3G6X A;  4ZHQ A;  2MCT A;  4O2B B;  3QNE A;  5CA1 F;  2VA3 A;  4LF6 H;  4H37 A;  4HYK A;  5D1P A;  4KHP B;  2JEI A;  3CX5 F;  5KG1 A;  5EWG A;  2FPP B;  2R6F A;  3QTC A;  4UB6 Z;  2XUM A;  4A3G G;  2VOB A;  2EIL C;  4ECU A;  4FLX A;  1XMO H;  2AU0 A;  3TQ1 A;  2N74 A;  1DGS A;  1QVF U;  1XMQ B;  4DR4 H;  1OJH A;  1XQ8 A;  2UVV A;  1K34 A;  1K33 A;  4DV0 O;  1SA0 B;  4QSH A;  1KMI Z;  1I5X A;  4YAK B;  3J81 W;  1PM9 A;  3ZMV A;  4WHX A;  4BW9 A;  4LFC H;  3ZHR A;  1VQ6 V;  5DG7 A;  3SJA C;  3GIL A;  1ENV A;  4BBS G;  1H8H G;  3CEI A;  5LOV F;  3ABM C;  2E5L O;  4X65 O;  3J80 W;  2V4R A;  1XNQ B;  3ZRW A;  5KA5 A;  1KD1 W;  4FLT A;  5I5X A;  4AQY O;  4EQ5 A;  5LHG A;  1RK6 A;  2R8K A;  3ASN C;  1OZ0 A;  3CXH F;  1YI2 V;  3AG1 C;  2WE6 A;  5FD6 A;  4DV3 H;  3AG2 C;  4IWX A;  4RNO A;  1Q7Y W;  3KHH A;  4X1K B;  1KEE A;  3ASO B;  2COI A;  2EJ3 A;  2XHB A;  1QCE A;  5KX5 B;  1FAF A;  3K5N A;  5I60 A;  2ZE6 A;  3E8B A;  3U55 A;  5LXT A;  1MNG A;  3NBZ B;  5CR5 A;  3K0G A;  3FFQ A;  2CDY A;  2WAQ A;  2R8J A;  3M9N B;  2XIG A;  1ZLZ A;  4O4I B;  2P4K A;  5KG7 A;  2MW2 B;  3U0G A;  1GYF A;  2UVR A;  1XBL A;  2R87 A;  1AUX A;  1MA1 A;  3BRC A;  5J2T B;  4DL6 A;  1SKV A;  4MA0 A;  1IVS A;  4J10 A;  4P9O A;  4LF5 H;  4CH5 A;  4D6T H;  5FLM G;  4PDR A;  5CA3 A;  4LF4 O;  4NKG B;  1IOV A;  5LMU H;  3OSN A;  4JI0 H;  4JI1 H;  4NZO A;  2YEV B;  2B63 A;  1IBK B;  4QPK A;  5EWE A;  2RMK B;  3SYC A;  4O2A F;  5CB4 A;  5LL6 b;  3GTM A;  3AYH B;  2W6J G;  3BHP A;  1MG1 A;  3H0G G;  1I7F A;  2VR1 A;  4E4T A;  2SCU B;  3MJF A;  3K5H A;  4JI2 H;  1RSO A;  4MVM A;  2ZDI A;  4GLW A;  4X1Y B;  1Q81 W;  2HDK A;  4IHJ B;  2ZNJ A;  3K5I A;  1AI5 A;  3HKB B;  4DR1 H;  1IBM O;  4Q20 A;  1A32 A;  4DR2 H;  5EBM C;  2UXC B;  3OHB A;  2RQ6 A;  2QSA A;  2YXH A;  4LH7 A;  2YIC A;  3N44 B;  4TUY F;  4J9Z B;  4FM9 A;  1F4M A;  5CA0 B;  1HNZ H;  5IDJ A;  3FAV B;  3TXS A;  4R7R A;  3GV7 B;  1SZT A;  1DK1 A;  2DPI A;  5C4X G;  4FBU A;  3GIM A;  2WSS G;  3QVN A;  3OMN B;  4B3S B;  3N43 B;  3GID A;  2YRW A;  1JCH A;  2ZKO A;  4IGG A;  5DQI A;  4FGR A;  4YBZ B;  2I80 A;  4P9P A;  4J9L A;  2FKL A;  4YQW A;  1N36 O;  3NXS A;  1SF9 A;  2PI5 A;  5IYC G;  2WLM A;  2OIE A;  3GVM A;  5J2U A;  4YR2 A;  1QR9 A;  4O7S A;  3UFX B;  4XDK A;  2A9H A;  1VEW A;  4DR4 O;  3K0D A;  4YY3 O;  1KT8 A;  2C22 A;  5KHH A;  2UXD B;  3CRM A;  1JFF A;  4LFC O;  2H3O A;  2WLK A;  1R6T A;  2DE0 X;  1S77 D;  4RUF A;  2CW7 A;  4ED7 A;  3HO8 A;  2QWP B;  3CB2 A;  1P84 F;  1Q5O A;  1GN6 A;  1BGY H;  4TWK A;  1MSD A;  1TAE A;  4DV3 O;  3FB8 C;  4R8U A;  4WFF A;  4TT3 G;  2R72 A;  1N34 H;  3UQ8 A;  2DOS A;  3OR7 C;  4EYI B;  3CSX A;  5LHH A;  4FZ1 A;  1GM7 A;  1ZL8 B;  2CNV A;  1EKV A;  4ED8 A;  2V4Q A;  3R65 A;  1SER A;  3E8H A;  4MV6 A;  3TIN A;  3ZHT A;  4U7O A;  3SI8 A;  2V9W A;  4ECV A;  2R8H A;  3JCU Z;  5BWU A;  2CTQ A;  4CS2 A;  2KB1 A;  2W9A A;  1F4N A;  1VQ8 V;  3GJX B;  2PYL A;  1DIK A;  3HB3 B;  1EZJ A;  3PW2 A;  4JAU A;  1WCM A;  4GT1 A;  2WLL B;  2VPQ A;  5KFM A;  4JI8 H;  2ZIM A;  3LDE A;  4I50 A;  5EBL C;  4UVA A;  5LMU O;  1EKF A;  2D3O W;  3GDE A;  4JI0 O;  5IT9 W;  2WLI A;  3E8F A;  2DYS B;  2RNB A;  3P30 A;  4QWD A;  3CC4 V;  5FLX N;  1M6V A;  1AI6 A;  4J9S A;  4JGS A;  5K1P A;  4OX9 H;  3BAB A;  1KJJ A;  3AK1 A;  2P4V A;  1VS0 A;  2KSW A;  4RCN A;  2CZG A;  4B3R O;  1BMF G;  4NTW A;  3H1H H;  1GAX A;  2R86 A;  4I55 A;  4EGJ A;  4JI2 O;  1NT2 B;  4NYK A;  3B09 A;  1TVK A;  4IIJ F;  4KHP H;  3G80 A;  2IJK A;  2FLP A;  4DAA A;  3JAR A;  4DR1 O;  2EIN B;  3V6K A;  4DRX A;  1BHA A;  1FYJ A;  4K8Z A;  5KHK A;  2ZIO A;  4PA4 A;  4CKE A;  5IE9 A;  4UCO A;  1OV9 A;  3JD0 A;  3ZHQ A;  4DV4 B;  2OWO A;  1HNZ O;  1XMQ H;  4ECX A;  4TUY B;  1CE8 A;  4Q8E A;  3R66 A;  5C1P A;  3GTK A;  5HNE A;  2ZGI A;  2NU7 B;  1RFY A;  4JAV A;  4BR6 A;  1CEZ A;  3CJH B;  3SDL A;  1M90 W;  5JUM A;  1GM9 A;  2QDO A;  2EJR A;  2GTA A;  4FLZ A;  3SE7 A;  1JIH A;  3VPB A;  3W7T A;  1XNQ H;  4LWS A;  4PI2 A;  1EZ1 A;  1NTZ H;  2XND G;  3T5L A;  4UFZ A;  4H13 B;  4YAJ B;  1ZTE A;  3ICX A;  5GON A;  4MV3 A;  4C5C A;  3OUS A;  1HNW O;  3L70 H;  3L71 H;  2OCC B;  4Y8V B;  5B1N A;  1AIL A;  4X20 B;  4QNH B;  1K92 A;  2JEF A;  4PDV A;  4PEL A;  3O9O A;  1KBH A;  5KG5 A;  1NU1 H;  3D8C A;  1F7Y A;  1NZ6 A;  1U96 A;  3FB6 C;  2JGD A;  4I7Z B;  5DEC A;  3UO2 A;  1BT8 A;  4FLU A;  4FFP A;  5KFD A;  3AK2 A;  2Y0P A;  2PY5 A;  4UVB A;  1N34 O;  2OLS A;  4O3N A;  4K0K B;  4TQF A;  2QWQ B;  1Q82 W;  4JV5 B;  2ZJT A;  3IG0 A;  5IYD G;  2ASD A;  3Q1K A;  1FVI A;  4AIL C;  3OW2 U;  1HR0 B;  1IBK H;  4RQF A;  4PA3 A;  4FFR A;  1JDB B;  3MFI A;  2Y4R A;  4LH6 A;  3VOU A;  4QWC A;  4RAY A;  3WB1 A;  4K8X A;  2XAS A;  4HQ6 A;  2EIK B;  3JD1 A;  4O4H F;  1FPO A;  4CS4 A;  1H38 A;  5B1B C;  2QK4 A;  3GIQ A;  4ZQI A;  3JAT A;  4JI8 O;  3FKI A;  3VMM A;  2JVD A;  3RYC B;  2UUB B;  4NXN B;  1BL8 A;  2QKC A;  1ROP A;  2NR5 A;  2BTO A;  2Q2T A;  4I7H A;  1GSO A;  4B7K A;  3CCV V;  3F7Y C;  5LYJ F;  4AHC A;  5H5N A;  1HP8 A;  3H9V A;  1FS0 G;  2F4V B;  1AN7 A;  4A3J G;  2ZDG A;  5DIS C;  3GIP A;  4OX9 O;  2UXC H;  2ALZ A;  4PZ6 A;  3JAW A;  4YJ3 B;  3BVO A;  2F95 B;  2WA4 A;  1XI1 A;  4JI4 B;  2FB9 A;  4J9Q A;  4F4Y A;  1FJG B;  3N8D A;  5JVL A;  4IT5 A;  1GLV A;  3WG7 B;  2PUS A;  1Y1V G;  3SYQ A;  2KQX A;  2VQE B;  1M57 C;  4DV5 O;  2DWC A;  4B3S H;  2UXB B;  2KG7 A;  2WYO A;  4IWY A;  4FFB A;  2Q0O C;  1S10 A;  4RAI A;  1SCU B;  3MFH A;  2RJZ A;  4QW8 A;  4IIJ B;  2JA6 G;  3WFV A;  4N23 A;  2OYQ A;  2IBZ H;  2V1D A;  4XYL B;  4A93 G;  3RB0 A;  3D36 A;  4D7T A;  4EEY A;  4Q8F A;  3F5W C;  4ZI7 A;  2ETN A;  3KAJ A;  3FD9 A;  3PO2 G;  2EIL B;  5JCO C;  1THZ A;  4QIW F;  3MWM A;  4JTA B;  1VF6 A;  4CC5 A;  4O81 A;  2UXD H;  3VNN A;  2ATL A;  5C8Y B;  4FFL A;  4UVC A;  3RYH A;  3X2Q B;  2FP4 B;  4GX1 A;  3VQV A;  3DAA A;  4Q4C A;  5JWP A;  1KC7 A;  4DLK A;  4G28 B;  3H4D A;  3HOX G;  3V6H A;  2F1M A;  1M0T A;  3J81 N;  1S9F A;  1EBO A;  3GV5 B;  2WAQ E;  1VBH A;  1B33 N;  4ICG A;  2JA7 G;  1FXK C;  3ASN B;  1M93 A;  1SQB H;  2C35 B;  2ZD9 A;  4JYB A;  3AG1 B;  4R7C A;  4MTF A;  4F4L A;  3AG2 B;  5KFZ A;  1LUV A;  3OTO B;  2FB5 A;  5KA6 A;  3Q8Q B;  2J6U A;  1KKC A;  1K4D C;  3T4Z A;  5BWV A;  4YJ2 A;  4PI0 A;  3E2E A;  2RGV A;  1Z2G A;  1WP7 A;  1D2D A;  4PDB A;  2XAJ A;  5LGN A;  4FJC C;  5IYZ F;  2DYR C;  4X1K A;  4DV2 O;  4WFH A;  5LP6 A;  4FLW A;  4LF9 B;  2W70 A;  5IJ0 A;  2VQF O;  1SYX B;  3AG4 C;  4YIP A;  1FFX B;  1RPO A;  1I94 O;  4MVO A;  3T1H B;  3JAL A;  5TIS Z;  1UC9 A;  1FKA H;  4U3F H;  1ZHQ A;  5KT5 A;  3RTX A;  3SNO A;  1M7J A;  1XL4 A;  2W6M A;  1PL4 A;  4O4I A;  4RB0 A;  2HJD A;  2XCP A;  1CKN A;  3OD4 A;  2JS3 A;  2QEX V;  4BAY A;  3RGZ A;  5KFL A;  2QGN A;  4O2B F;  2UVU A;  2YUA A;  1JDE A;  4O3Q A;  5KFO A;  4CZZ A;  4I4T B;  5FNV B;  1SRY A;  4UCT A;  2Y69 C;  4HNV A;  3M9M B;  4FK5 C;  4UCS A;  4IL6 Z;  4M9U A;  4EFB A;  4O3S A;  4FM2 A;  4DUZ B;  2XAG A;  4YIO A;  1PK8 A;  1EHI A;  4JYA B;  2VQD A;  3H3V H;  2JJ1 G;  2Y4U A;  2X0S A;  2M05 A;  3W7U A;  1Q6I A;  4Q4D A;  4QGP A;  3SPG A;  4DV4 H;  5ITZ B;  2IP4 A;  1CP9 A;  2W8K A;  4UXN A;  1SEI A;  5L1J A;  3RW0 A;  2CQY A;  4R8C A;  4B3S O;  1E4E B;  4B3M B;  1IOW A;  4DV1 O;  3JYC A;  1B6R A;  3PW0 A;  3I56 V;  1Y76 A;  4OGQ B;  3APO A;  5DLF A;  1PX2 A;  4JZG A;  4E4E A;  5IYC O;  5KX5 F;  1KEC A;  4LMY A;  2HIV A;  1TUB A;  4PDM A;  3FDS A;  1GO3 F;  2UUC B;  1R3J C;  1BCC H;  4QWA A;  2ILM A;  2A06 H;  3PJS K;  2CKZ B;  3ZX6 A;  2CW8 A;  5IWA B;  5L1K A;  2NVX A;  4YHH O;  2FK1 A;  2UXD O;  4MTG A;  2CTP A;  5CA1 A;  5J9P C;  4DV7 B;  1WPX A;  3HXL A;  1KYO F;  2Q6A A;  2GQR A;  3MHH C;  1SQX H;  2EX3 A;  4NYE A;  5J2T F;  4U6P A;  5KS8 A;  3M99 B;  4LNU B;  2XTA A;  3N6X A;  4MSW C;  1R73 A;  3DTF A;  5KLV H;  5F2V O;  4PBC A;  3HBL A;  4K0K H;  4QPJ A;  3HKE B;  2W9B B;  1N48 A;  3KKY A;  4JV5 H;  1VIB A;  3OUF A;  4X9Q A;  2UU9 B;  1JOY A;  2GTS A;  1TGO A;  1A48 A;  1HR0 H;  5CMU A;  5C93 A;  2JA8 G;  5LOV A;  3EFF K;  5KAF Z;  4HYO A;  3GQC A;  4JI7 O;  1GTO A;  3KCX A;  4GX5 A;  3GTQ A;  3G67 A;  3N2K B;  5CN0 A;  3ZMU A;  3EHB B;  5E1A C;  1GKF A;  3BQ0 A;  2R92 G;  3RV4 A;  4IHJ F;  1IDS A;  1N33 B;  4W4K A;  3M8A A;  4QE7 A;  2YI9 A;  2QB5 A;  3JRW A;  4DK0 A;  4X64 B;  1N0J A;  3RVY A;  1L8D A;  4XZ3 B;  1UPG A;  1FKA O;  5D5Q A;  2UUB H;  4NXN H;  2IJJ A;  1N32 O;  3TW6 A;  4J7J A;  2IU0 A;  4DL7 A;  2HHF B;  4M7E A;  2YS8 A;  3A8T A;  3PFF A;  5KFS A;  1URF A;  2F4V H;  1TWF A;  5CA0 F;  3DGE A;  1K3E A;  1NKD A;  3CQZ A;  3H1I H;  3E22 A;  2AW9 A;  2AZ0 A;  3W7X A;  2HKO A;  1NTM H;  5IT9 N;  2WLL A;  4U7N A;  4O7T A;  4JI4 H;  1IYE A;  1SQG A;  4QWE A;  1FJG H;  2CTW A;  3FB7 C;  1E4G T;  5KFB A;  3RN4 A;  5KFK A;  2JA5 A;  5L3E A;  3GWK C;  4MAM A;  1XDC A;  3PO3 G;  4NR1 A;  1GM8 A;  2VQE H;  3MR6 A;  1MMM A;  2UXB H;  2N04 A;  3G71 V;  1W93 A;  4RWU A;  3CCJ V;  1L0L H;  1E4F T;  2CK3 G;  3PW4 A;  4JI5 B;  1G6U A;  2FMA A;  2IJH A;  4ZIB A;  4O2A A;  1W0K G;  5BWX A;  1GMG A;  1D5N A;  2EZP A;  2P6J A;  5K1X A;  3X2Q C;  5HBR B;  4ECQ A;  2C28 A;  1TWC A;  3T9C A;  2DIK A;  3OEE G;  3TY9 A;  1I2L A;  4DV4 O;  4LP8 A;  4Q45 A;  1HDJ A;  3L73 H;  2Q2U A;  4HZ3 A;  4NXM B;  2E3C A;  3E5N A;  4TV9 B;  1CPY A;  3HOU G;  2NU8 B;  3BEH A;  4ASU G;  4DUY B;  4FBT A;  3T9A A;  3OUU A;  2GV9 A;  4PHZ A;  2R7L A;  5I5V A;  2VA2 A;  4TSF G;  1S72 V;  2NU6 B;  4X8A A;  1YHQ V;  1ET0 A;  5DGA A;  3RYI B;  5KHJ A;  5LGU A;  5DGH A;  3FX7 A;  2ADQ B;  4TUY A;  2ZQM A;  1VQ5 V;  3MHS C;  1CKM A;  1NS1 A;  1XHZ A;  3HOV G;  4CKC A;  4MTO A;  4TV8 B;  1IZ3 A;  3O65 A;  3OTO H;  3ZN0 A;  2JEU A;  2YU9 A;  2C2A A;  1UNN C;  2EBO A;  3HOY G;  2DPJ A;  4A3C G;  1E1Q G;  1EN4 A;  5JH7 B;  5D1O A;  2G38 A;  2YXL A;  4JI6 B;  4PJ0 Z;  3I4N G;  2COG A;  3D3I A;  2ASL A;  3W1B A;  2EJ7 A;  1QLN A;  3J7A K;  1J5E O;  4G3I A;  4J9Y B;  4LF9 H;  4DW0 A;  3JZF A;  2IW5 A;  3N2G B;  4K0K O;  3LWB A;  2YC0 A;  3A0B Z;  4UCR A;  1PNM A;  5LL6 Y;  1Y74 B;  4GUN A;  5IYD O;  4I0X B;  4O7R A;  4JV5 O;  3T1H H;  2ADP A;  3I12 A;  4U3J A;  4FIP C;  3JZ6 A;  2HHH B;  1GN3 A;  4Q43 A;  3I5D A;  3TIG A;  1HR0 O;  5KG4 A;  4DR5 O;  4F4Z A;  4B3T O;  3F5T A;  3U10 A;  2W6N A;  2YIB A;  3T4D A;  3SJC C;  4ZKI A;  5JVD B;  4GKJ O;  2P06 A;  4YP3 A;  2JRI A;  3CSW A;  1QVG U;  1GN2 A;  4KL1 A;  3ZHV A;  3NGD A;  1VQ4 V;  5L9X A;  2ZXW C;  1AR5 A;  5JQG B;  1I08 A;  4LFB B;  5I5Y A;  4ZOL B;  1KUQ A;  5B1B B;  2E2H A;  3SYA A;  2B9Z A;  5EC2 C;  2WA3 A;  3BAA A;  4YY3 H;  1E1R G;  1KB9 F;  4DUZ H;  4EBE A;  1IUR A;  3NC0 B;  5LMN B;  4BY1 G;  3JRX A;  2UVW A;  4JYA H;  5EBW C;  2NUA B;  4RUA A;  2ZIN A;  4MS2 A;  2CGO A;  4YXW G;  3TET A;  4O7L A;  5DMX A;  4HBN A;  3RYF B;  5JJN B;  1T3N A;  2VUM A;  1QHT A;  4X88 A;  5BMV B;  5KFA A;  4WFG A;  4MA5 A;  4PA9 A;  4LF6 O;  1FJG O;  3UKM A;  3T7A A;  4EG0 A;  4YR0 A;  3L2P A;  1YVW A;  2E75 B;  2JDI G;  4K35 A;  1OHH G;  2FPI B;  1PD3 A;  1S0N A;  4CH6 A;  4WD3 A;  2VQE O;  4B3M H;  3DXR A;  4BY7 G;  2UXB O;  3LUT B;  3SR2 C;  1PNK A;  1SQV H;  4X62 B;  2JEG A;  4QWB A;  3JAS B;  3IC7 A;  5BY1 A;  1XMO O;  1M57 B;  4JTD B;  1NH2 D;  2CNU A;  1IBL B;  2UUC H;  1B6Q A;  3EPI A;  3WO1 A;  1A9X A;  4DL2 A;  2EIJ C;  2IH3 C;  3B2E E;  2CAZ C;  3VQW A;  1AR1 B;  3LSQ A;  4DR7 B;  3R9R A;  4A3E G;  1R1B A;  4WBN B;  1FXV A;  3K57 A;  4NZM A;  5IWA H;  1Q3E A;  2Q67 A;  2R82 A;  4FS1 A;  4IRD A;  1TWH A;  1QNM A;  2W6I G;  4DV7 H;  3SJB C;  3OFN G;  4IIJ A;  1JVM A;  4PV1 B;  4MVR A;  2J6S A;  4ECW A;  1WNS A;  2BOC C;  2F66 C;  4Z2W A;  3GTP A;  1EN5 A;  1KP2 A;  1O9H A;  3M7M X;  4BIO A;  3S3W A;  3OTF A;  1SQQ H;  2ARH A;  2DWD C;  4F6R A;  5IJ9 A;  4I5S A;  2K9P A;  3KCY A;  2YI8 A;  5DQH A;  3OSP A;  5KT4 A;  3GTG A;  2QM8 A;  1YCI A;  4HR7 A;  3ZIA G;  2O03 A;  1VQO V;  1AVM A;  1Q6H A;  2Y48 A;  4BWA A;  2FJZ A;  3UT5 A;  3E83 A;  1XL6 A;  3K08 A;  1FXK B;  3OTO O;  2UU9 H;  2W8L A;  3ZCC A;  1MSW D;  1Q6U A;  2GLT A;  3B8M A;  3E89 A;  5EZY B;  1SZX A;  2ODM A;  3IJ4 A;  4P30 A;  5CBG A;  4LF5 O;  2DAA A;  5I47 A;  4DRF A;  4LF9 O;  2BSK A;  3W5O A; 
#chains in the Genus database with same CATH homology
 4X1I B;  4CH3 A;  4HNA B;  5BMV A;  2YCH A;  1A0I A;  2HIX A;  2UXC H;  3KYH C;  1N33 H;  3T1Y B;  3JAW A;  4PZ6 A;  4YJ3 B;  4X65 H;  2E5L H;  1S03 G;  2F95 B;  1XI1 A;  5LP6 B;  4JI3 H;  3LML A;  4X64 H;  4JI4 B;  4A2B A;  5IJ0 B;  4AQY H;  4EEQ A;  1FJG B;  3THO A;  2PUS A;  2WDT A;  4X20 A;  3JAL B;  3JAS A;  1XK5 A;  2VQE B;  4B3S H;  3HKD B;  2UXB B;  2BTQ B;  4RAZ A;  4BWS C;  2WYO A;  4RB3 C;  1WH2 A;  4FFB A;  2ZNI A;  1BGW A;  4ZHQ B;  3HKC B;  4DV6 H;  4Q6G A;  2RJZ A;  1CKO A;  4IIJ B;  1CKN B;  4J0M A;  1Z2N X;  4I9Q A;  4DV2 B;  4CC6 A;  2OYQ A;  4UCU A;  2VQF B;  4D7T A;  2HVQ A;  4WBN A;  4ZI7 A;  1I94 B;  3KAJ A;  2JS5 A;  2PZS A;  5KMG B;  5JCO A;  1M5I A;  5JCO C;  4DR3 B;  3MWM A;  3K59 A;  4CC5 A;  3M4I A;  2UXD H;  3VNN A;  4LF8 B;  4JI5 H;  1N34 B;  5C8Y B;  3RYH A;  3VQV A;  2VUG A;  1J5E H;  4LFA B;  3JAT B;  3GB8 B;  2Q7E A;  1L2Z A;  1O9G A;  4EB6 B;  1P8L A;  2F1M A;  3K5M A;  4O4H A;  3JAM W;  1WPB A;  1M0T A;  2PYJ A;  4NXM H;  1H2S B;  4B3R H;  4DUY H;  4DR5 H;  1M93 A;  3L4K A;  4B3T H;  1X9N A;  5LYJ A;  3TY8 A;  3RYC A;  3OTO B;  4DV0 B;  5KHG A;  4GKJ H;  5EZY A;  4JI8 B;  3U0Z A;  3U11 A;  3RGB A;  3EYY A;  4YJ2 A;  2VPS A;  4PI0 A;  5IYZ B;  2RGV A;  3JAK B;  2Q0A A;  4PDB A;  5LXT B;  2KKW A;  1TUB B;  4X1I A;  1XHX A;  4CS3 A;  4X1K A;  3N41 B;  4YJ3 A;  5BR8 H;  1IBM H;  1O75 A;  5LP6 C;  5LP6 A;  4FLW A;  4LF9 B;  5IJ0 A;  4Q0Y A;  4OX9 B;  1SYX B;  1FFX B;  4RB2 C;  4DV1 B;  3T1H B;  5JJJ B;  2P5O A;  4TQD A;  3JAL A;  1FKA H;  1ZHQ A;  5CA1 B;  2JGU A;  3A2F A;  3RTX A;  4ZI7 B;  4JI6 H;  3HKD A;  2BTQ A;  4DK1 A;  1TA8 A;  4O4I A;  2ZCE A;  3HKC A;  4O2B B;  4ZHQ A;  4GKK B;  2MCT A;  4RB0 A;  4DR6 H;  1CKN A;  4LF6 H;  1M0W A;  5D1P A;  4KHP B;  3RGZ A;  2YIA A;  5D5P A;  4X66 B;  1QQC A;  4LSA A;  3QTC A;  1HNW H;  2VWK A;  5CB4 B;  4YHH B;  4I4T B;  4NVP A;  5FNV B;  1Z2P X;  2VOB A;  2HHH H;  4FLX A;  1XMO H;  4LR3 A;  1KU9 A;  3F8N A;  4UCT A;  2ZM6 B;  1DGS A;  5KHI A;  4LNU A;  1XMQ B;  5C8Y A;  4DR4 H;  4LF4 B;  1XQ8 A;  4UCS A;  1B04 A;  4IAJ A;  4EFB A;  2IM9 A;  4FM2 A;  5EYP A;  4CH4 A;  1SA0 B;  1KMI Z;  3WB0 A;  5LOV B;  4DUZ B;  3J81 W;  4LFC H;  4BW9 A;  3VQY A;  4LF7 B;  4JYA B;  1Z5W A;  4EB6 A;  3SJA C;  3J80 W;  3RJ0 A;  2YIB D;  1XNQ B;  4LFB H;  4FLT A;  4DV4 H;  5ITZ B;  4O4L A;  4EQ5 A;  1XNR B;  2WE6 A;  3JSL A;  5FD6 A;  4DV3 H;  4MV9 A;  3RF2 A;  1SEI A;  4MV7 A;  4X1K B;  3RFR A;  2XHB A;  5KX5 B;  4B3M B;  5LMN H;  3K5N A;  1JJO A;  4JI7 B;  5IYZ A;  2W57 A;  3JAK A;  5LXT A;  2Q7H A;  3NBY B;  3NBZ B;  3FFQ A;  3E22 B;  1Q8I A;  4LMY A;  2HIV A;  1TUB A;  5A2Q W;  2UUC B;  3H20 A;  3K5L A;  2XIG A;  3PN1 A;  4O4I B;  1T5E A;  1GYF A;  2CW8 A;  5J2U B;  1FFX A;  5IWA B;  2QJ1 A;  1N32 B;  2Q7G A;  3BRC A;  4MTE A;  4X62 H;  4FM0 A;  5J2T B;  1SKV A;  4FVM A;  5CA1 A;  4DV7 B;  3HXL A;  4LF5 H;  4CH5 A;  2UUA H;  1Z5V A;  2FE3 A;  1JFF B;  2EX3 A;  5LMU H;  1X4T A;  1IBL H;  4O2B A;  4O2A B;  4JI0 H;  4JI1 H;  4LNU B;  1IBK B;  4E6N A;  3N6X A;  4DR7 H;  5EYP B;  1N36 B;  5CB4 A;  2V4D A;  4I4T A;  4K0K H;  5FNV A;  4RB1 A;  4FLV A;  5LL6 b;  3HKE B;  3KAL A;  3BPZ A;  5LA6 A;  4DV5 H;  3SGI A;  4YY3 B;  4JV5 H;  3BHP A;  2UU9 B;  1I7F A;  1TGO A;  4FM1 A;  3RIZ A;  4PZ8 A;  4O4L B;  1HR0 H;  3LNN A;  1SA0 A;  3QG5 A;  5LOV A;  1RSO A;  4JI2 H;  3DSQ A;  4X1Y B;  3K58 A;  3KAK A;  4IHJ B;  2ZNJ A;  3HKB B;  3N2K B;  4DR1 H;  1HNX H;  4O4J A;  2PTM A;  2PGG A;  4DR2 H;  5ITZ A;  2UXC B;  4A2A A;  2RQ6 A;  1N33 B;  2E5L B;  4LH7 A;  4X65 B;  2YI9 A;  1S5J A;  4JI3 B;  3N44 B;  4DK0 A;  4X64 B;  1L8D A;  4FM9 A;  4AQY B;  5D5Q A;  2UUB H;  5CA0 B;  1HNZ H;  4NXN H;  5KX5 A;  4R7R A;  4I50 B;  5FD5 A;  5EIB C;  4M7E A;  2F4V H;  2VWJ A;  5D1O B;  4B3S B;  3N43 B;  3JSN A;  3E22 A;  4DV6 B;  3T1Y H;  4JI4 H;  1SQG A;  1FJG H;  3W1G A;  1E4G T;  5J2U A;  4U3J B;  5J2T A;  2VQE H;  2RGR A;  2UXB H;  4I55 B;  5KHH A;  1E4F T;  2UXD B;  4JI5 B;  1JFF A;  1G6U A;  4ZIB A;  4O2A A;  5LA6 B;  1TVK B;  4DV2 H;  1J5E B;  3ZS8 C;  2CFM A;  5K1X A;  2CW7 A;  2VQF H;  2QM4 A;  4DRX B;  2HVR A;  3TY9 A;  1I6U A;  3C0F B;  3CB2 A;  1I94 H;  1Q5O A;  2Q2U A;  4NXM B;  4B3R B;  2E3C A;  4DR3 H;  1TAE A;  3HKE A;  4TV9 B;  3QWU A;  4DUY B;  4LF8 H;  1WN7 A;  2R72 A;  4DR5 B;  4B3T B;  1N34 H;  3UQ8 A;  4O4J B;  4EFE A;  2GV9 A;  3CHX A;  4PHZ A;  3CSX A;  4LFA H;  3BA9 A;  4GKJ B;  4FLY A;  3RWR D;  4X1Y A;  4IHJ A;  3RYI B;  5KHJ A;  3HKB A;  3N2K A;  1ZAU A;  4TUY A;  1VF7 A;  3K5O A;  4D7S A;  5FPO A;  4CS2 A;  1CKM A;  1HW7 A;  2F93 B;  1XHZ A;  5BR8 B;  1IBM B;  3GJX B;  4TV8 B;  2PYL A;  3VQX A;  1Z2O X;  5GON B;  3OTO H;  4DV0 H;  5CA0 A;  4MTD A;  1XDN A;  4JI8 H;  2ZIM A;  4I50 A;  1M4U A;  5JH7 B;  1SQF A;  2R70 A;  3S24 A;  3GDE A;  5D1O A;  3IAY A;  5IT9 W;  2YXL A;  4JI6 B;  3N40 P;  3K3V A;  5FPR A;  4DR6 B;  3W1B A;  2HVS A;  4LF6 B;  3J7A K;  5K1P A;  4LF9 H;  4OX9 H;  3N2G B;  3BAB A;  4UCR A;  1MZB A;  3FMA A;  1HNW B;  1VS0 A;  2KSW A;  4DV1 H;  3T1H H;  4U3J A;  1BJT A;  2HHH B;  3L4J A;  1XMO B;  4I55 A;  1JMK C;  1Q43 A;  3CVZ A;  4ETS A;  4GKK H;  1NT2 B;  5EIB D;  3U10 A;  4DR4 B;  2YIB A;  1TVK A;  3SJC C;  5JVD B;  4KHP H;  1YEW A;  4F6R B;  3JAR A;  4LFC B;  5IJ9 B;  3KXY T;  4X66 H;  4KL1 A;  4DRX A;  4K8Z A;  5JQG B;  2HEP A;  4GLX A;  4YHH H;  5KHK A;  2ZIO A;  4TV9 A;  4UCO A;  4LFB B;  3ZED A;  3UT5 B;  2ZM6 H;  4DV4 B;  4ZOL B;  2OWO A;  1XMQ H;  4LF4 H;  4TUY B;  4DV3 B;  3BAA A;  4B08 A;  4RZQ A;  4DUZ H;  3NC0 B;  5LMN B;  4LF7 H;  4JYA H;  2ZIN A;  3RYI A;  3N42 B;  5EOY A;  4HBN A;  3RYF B;  4GYC B;  4FLZ A;  5JJN B;  1XNQ H;  1QHT A;  4UCV A;  5BMV B;  4PI2 A;  1XNR H;  3JAW B;  3L2P A;  4UFZ A;  4TV8 A;  3ICX A;  5GON A;  4TOI A;  4CH6 A;  4B3M H;  3SR2 C;  4JI7 H;  4X20 B;  1P16 A;  1ZHS A;  1D5A A;  4X62 B;  5JH7 A;  5FLX W;  3JAS B;  4HNA A;  4LF5 B;  3MAQ A;  2UUA B;  3RR5 A;  4FFB B;  5JJE B;  5LMU B;  1IBL B;  2UUC H;  4JI0 B;  3B2E E;  4JI1 B;  1S68 A;  2CAZ C;  3VQW A;  3N2G A;  4DR7 B;  4FLU A;  4WBN B;  3K57 A;  5IWA H;  1N32 H;  1Q3E A;  1P49 A;  2PY5 A;  4PZ7 A;  3JAR B;  2P22 C;  4K0K B;  4DV7 H;  3SJB C;  4TQF A;  4IIJ A;  3DF7 A;  4DV5 B;  4JV5 B;  2ZJT A;  3IG0 A;  1WNS A;  2F66 C;  3RYH B;  1FVI A;  4AIL C;  1O9H A;  3M7M X;  5JVD A;  1HR0 B;  3OTF A;  1IBK H;  4L8J A;  3QF7 A;  4JI2 B;  4F6R A;  5IJ9 A;  1N36 H;  5KMG A;  2YI8 A;  4O4H B;  5JQG A;  4LH6 A;  2O03 A;  4RAY A;  4DR1 B;  4BWA A;  3TY5 A;  3WB1 A;  1HNX B;  4K8X A;  4YY3 H;  3UT5 A;  3WB2 A;  4DR2 B;  4CS4 A;  4ZOL A;  4LSX A;  2UU9 H;  5LYJ B;  3JAT A;  3BA8 A;  2JVD A;  3RYC B;  2UUB B;  4NXN B;  2Q2T A;  1HNZ B;  2HGS A;  2BTO A;  5EZY B;  4I7H A;  4YJ2 B;  4AHC A;  2F4V B;  1V9P A;  1AN7 A;  3RYF A;  2R9A A;  4DRF A;  3ETQ A;  3RGX A;  4APM A;  5DIS C;  3W5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...