4UCSA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucsA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucsA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucsA02
4AQYB 2UXDB 1FVIA 4B3MB 4JI2B 2HVSA 3BA9A 3T1HB 2HVRA 4LFAB 4JI5B 4JI4B 4DV7B 2UUBB 1IBKB 4B3SB 4DUZB 1ZAUA 4UCVA 4DV6B 2UUAB 1XNQB 4JV5B 4B3RB 4DR2B 2HVQA 1I94B 4LH7A 2VQEB 4LF9B 4LH6A 3JSNA 3BAAA 3VNNA 3GDEA 4X64B 5LMNB 4GLXA 1CKMA 1X9NA 3RR5A 2VUGA 1HR0B 3S24A 4CC6A 4LF4B 4DR3B 1XNRB 5DISC 5D1OB 4DR1B 4UCOA 4EEQA 4UFZA 3SGIA 4X62B 3GJXB 4NXMB 5LMUB 4DR7B 3GB8B 4CC5A 4JI6B 4KHPB 1XDNA 3TY5A 3RTXA 3W1GA 4EQ5A 4DR5B 2UXBB 2UUCB 4NXNB 4DV5B 1P8LA 4JI3B 3W1BA 4UCTA 4EFEA 1J5EB 1N33B 2CFMA 3T1YB 1N36B 1VS0A 4PZ7A 3QWUA 3NC0B 4LF6B 2Q2TA 2ZM6B 4TOIA 2HHHB 4DV2B 3L2PA 1CKNB 1IBLB 1N34B 4GKKB 4JI0B 4X66B 4LF7B 5IWAB 4B3TB 4UCRA 3NBYB 3PN1A 4DV3B 2E5LB 1TA8A 5FPOA 2F4VB 3W5OA 1HNXB 4DR4B 4JYAB 5D1OA 4UCUA 4DV4B 5FPRA 4LFCB 4LF8B 1N32B 1P16A 3TY8A 1B04A 1IBMB 1CKNA 3OTOB 4LFBB 4DV0B 1HNWB 4OX9B 1HNZB 1FJGB 4YHHB 3KYHC 4DRFA 4DR6B 4PZ6A 3JSLA 4EFBA 4LF5B 4PZ8A 2HIXA 4E6NA 5D1PA 2OWOA 1A0IA 2UXCB 1V9PA 4JI8B 2VQFB 4JI1B 3TY9A 4X65B 2Q2UA 1XK5A 3NBZB 5BR8B 1XMQB 2UU9B 4DV1B 1CKOA 2HIVA 1TAEA 1XMOB 4DUYB 4JI7B 1S68A 3BA8A 1DGSA 3BABA 4K0KB 4UCSA 4GKJB 4YY3B 3UQ8A
chains in the Genus database with same CATH superfamily
1F4NA 4J10A 2Y0SA 3LDCA 1GN4A 1EN5A 5BPHA 4MVUA 3RBZA 1SEIA 1KC8W 4LFCH 2QGNA 3RAXA 1XMQO 2P6JA 4AI8A 5CMUA 1A48A 5KT3A 3OT7A 1FXHA 3TK1A 5KG4A 3DXRB 1ZAUA 3FB8C 4UCVA 3I5DA 3KXYT 1WRVA 2QK4A 3D36C 4LH7A 3SPHA 3R5HA 3RAQA 2OLSA 4O3QA 3PW2A 3HOUG 4RCNA 5CB4F 5KA5A 2XHBA 1EUCB 3BAAA 3CRQA 3VMMA 3SE7A 3D3IA 3HO8A 4ECTA 3VQXA 4OPAA 3SI8A 1UJWB 5KFMA 5JUMA 3QF7A 1IBKH 2M7WA 3JD0A 3C0FB 1BSMA 3CCQV 5KFDA 4RNNA 4L87A 2YEVB 1TWFA 4JI3O 2QKCA 3SPCA 1NTZH 3E8FA 4LR3A 3ZMSA 3ORRA 4NXNB 4MV1A 4DV5B 3IN5A 1WAZA 4PA3A 3T1YB 1AUVA 4X89A 4JV5O 1EKVA 2EX3A 5TISZ 4IIJF 4ZQIA 3B09A 4O2BB 4DUZO 1XL4A 1S9FA 2W8LA 3IJ4A 3R9RA 1ZL8B 3TGUH 1FAFA 1I5YA 4ECWA 3KALA 1JJ2U 4TUYF 3IGAC 1XMQH 1SQGA 3CCVV 1N36O 3G8DA 2UXBH 1P49A 5JVDA 5JH7F 2X7RB 5C93A 1K8AW 2EIMC 3L75H 3PN1A 1HWYA 2NU6B 5KX5A 3WWJA 1Y74A 2QKAA 3GTJA 4DV6O 2AU0A 1P16A 2IU3A 3HKBA 2HKOA 1IURA 3H3VH 1KJQA 1CKNA 1UC8A 1HW7A 2EIKB 5KFHA 3G6BA 4UV9A 3E86A 5KFJA 3G6XA 3E8HA 4DRFA 3T9AA 2WLJA 3HOZG 3GTGA 2W6JG 2ZCEA 1NTKH 3SYQA 1Y4MA 1JDEA 5D1PA 4DYLA 4H0LB 3UZBA 4QWDA 5BYAA 4WCEV 1BMFG 1K5QA 5CN0A 3HKCA 1IOWA 5D8DA 4B7EA 2UU9B 2YSUB 3NGDA 3DTGA 2J9GA 3B4SA 3SJAC 1N34H 2JIZG 1K97A 5KFRA 4CMFA 2EINB 2X6CA 1OBDA 3W7SA 2WLIB 5GONB 3HBLA 5FNVF 4JI7H 3OEEG 4JI2B 3OGIB 2ZT9B 3T1HB 3KHGA 3CMAV 1EM1A 3K57A 2A7WA 2AHZA 1MZBA 2BQ3A 3JZIA 1QVGU 2Q68A 3E35A 3HKZE 3LQSA 1AI4A 4C5CA 1B6SA 1R3JC 1SCUB 1N56A 3UT5A 4JXUA 3KG2A 5KUMA 1I1MA 2AZ2A 5KG7A 2OH2A 3F7VC 4MSWC 2AQ4A 5K1XA 5BXZA 5LMNB 3OTOH 2VUGA 2DMXA 4Q0YA 4IRDA 3CYOA 5C1PA 4MVMA 4PA4A 1Y6XA 4ZHQB 5BPFA 5LYJF 3T99A 3W1GA 3JCZA 3LWBA 4MV8A 1R3IC 2RGRA 4K35A 4BAYA 3TW6A 3T9EA 5A2QN 4GKJO 1B6RA 1GN6A 3KHHA 2ATLA 5E1AC 3AYHB 4J9RA 1K5SA 3LNNA 3JYCA 3OUFA 1CXZB 3OM3B 4LF6B 2DWEC 3RGXA 2YUAA 5KKNB 3AK3A 2YRXA 3K5LA 3DF7A 4EB6B 4DV1O 1JX9A 1I6UA 3TQTA 3CJHB 3QFFA 2XD4A 2KKWA 3R5XA 4QJFB 1J5EO 2HDKA 3JCUZ 2YEVA 3JAMW 2C2RA 2Q69A 3H1LH 1YJWV 3G6YA 3BHPA 4A3KG 2WLNA 4UUJC 3C90A 4FFMA 2Z3YA 4J80A 4KXRA 1M90W 3CXHF 4JYAB 3M8AA 2YZNA 2JJ1G 4MVOA 2NVYA 1JCHA 3HKEA 4CHIA 2FB9A 3OTOO 2KSWA 2EJ7A 4CZZA 2A06H 4JTCB 5JVLA 1NVPB 1VKZA 3S3XA 3DTFA 4CH5A 4O7WA 1FS0G 3GVMA 5D5QA 4DR6B 4MV6A 2FK3A 5DQHA 4ZI7F 2QEXV 4LF5B 1G1XB 4E6NA 3AG4C 4WFGA 4O7YA 4BR6A 2DZDA 5IE9A 4DV5H 4B3RO 1NI8A 3MWDA 2HFEC 3T9BA 4PELA 4B3SO 1OJHA 2W9BB 1PKXA 4HYKA 3RV3A 2QWQB 1I2LA 2CQYA 1UC9A 4IAJA 3F7YC 2LW7A 5LMNH 4HN2A 3M99B 4ED0A 2X6AA 3K9SA 3JZFA 4UCSA 2IBKA 3CCUV 4CKCA 3U55A 2HR3A 2EILC 1IX9A 2YWVA 5LXTF 2JA5G 5L9XA 4D6TH 4YAKB 4BW9A 3ABLB 3ZJZA 1H2MA 3FB7C 3ABKB 4MVRA 1QR9A 1RM1C 2N04A 2EBOA 1I94B 4A3FG 5KT2A 2COGA 3RYCA 4FFRA 1K83A 3UKMA 3T9CA 4CKBA 4GCZA 1VBHA 5KFPA 2XNDG 3FB5C 2Q0OC 2X6BA 2A1HA 3OUUA 3S24A 2V59A 3QTCA 4CC6A 5LGUA 4LF4B 4RWUA 1FXKC 1QVFU 5F9NA 2DAAA 3PZPA 5B3SC 3BY6A 3RGZA 2DYSC 4QW8A 3BVOA 3CXCU 1KYOF 4LF6O 5LMNO 4BBSG 1G2WA 3CSWA 1SQQH 2M6YA 4FJCC 3TEKA 4GX0A 3EPGA 2EIJC 4UVCA 4O82A 2R92A 3PVXA 4EGQA 5LMUO 2X0SA 4HNVA 5FR9A 3OMAB 2ZM6B 1IBLO 5KG0A 2LFSA 2Q4PA 2ZQMA 4J42A 3OHBA 1HNXH 1D5NA 5EYPA 4L1KA 3OUZA 4XYLB 1M93A 1R6TA 4DV4H 2I8CA 3H1KH 1DAAA 2BSKA 2QA4V 2ZE5A 5LYJB 3JD4A 3RB0A 5HFMA 3WU2Z 2Q7DA 3F8NA 1XREA 3ZMZA 3BPZA 4FS2A 3VOUA 5DG9A 5EZYF 3G4SV 4YIOA 1C30A 1B33N 2VWKA 1RPRA 4FE2A 5KX5F 4Q20A 3U10A 5E79Z 5KFNA 4J9KA 5LGNA 4K0KO 1W93A 4O86A 4I0XB 4QE9A 3JD3A 3N2GB 3EYYA 4BY1G 2F66C 2W8KA 1KTAA 4OX9O 1VQ7V 2EIJB 5FNVA 5IY5B 5I47A 4A93G 3PJSK 4MS2A 3BCCH 2GBOA 2VWJA 5F9LA 4TT3G 2VQDA 1O9GA 2Y0IA 1HNXO 4NZOA 3N41B 4YY3O 4GKJB 4E4TA 2KG7B 2YC0A 3UQ8A 2W70A 4I4TA 4WFHA 1US6A 1KJ9A 2GQSA 3SR2C 4PDRA 2WDTA 5KG3A 1S5HC 3QZ7A 4JI5B 3CEBA 3KCYA 1FKAH 1VF5B 1OCZC 2X0LA 3FFQA 3QG5A 1IBMO 1P7GA 2ZIMA 2Y69C 4ZHQA 4DR1H 5IJ9A 2UUAB 1XNQB 5BZBA 5KA6A 2CUGA 4MTOA 3SPGA 4YR3A 4J9LA 1G4YB 4WHXA 3WB1A 3BRCA 2WAQA 2HHFA 1QU7A 1QBZA 2HJFC 5DG7A 1KU9A 4NTWA 3JZ6A 5K2MA 5DMXA 2GSMB 2NN4A 1J5EH 3T4ZA 1I94O 4CMDA 3JARA 2JA5A 1SESA 4O4HB 3U11A 2PBZA 2CE4A 3DAAA 5L1IA 5KHHA 1XNRB 5DISC 3RB6A 2JA6G 5EZYB 2DABA 1Z5WA 1YTFD 5KHIA 4QWBA 1EZVH 2P06A 3TY5A 1XDNA 3LSQA 1KMIZ 4KHPB 3AG3B 1WH2A 5DGIA 3RYCB 1M57C 2UUCO 1Z2NX 1K7DA 4MTFA 5IP9G 2FKLA 1XOUA 2MK3A 1OBGA 4FU0A 4NZNA 5HNEA 2FMLA 3R23A 2J6TA 2NNUA 1OCRB 2L35A 3UYYA 4KL1A 4J7KA 2XTAA 3T4DA 1I50A 3ZMUA 5DQIA 2C2DA 2PYJA 1IXBA 3ABUA 2XGQA 1WB7A 2FK1A 3JATA 1NQTA 1PD3A 1QR8A 1Y76B 4IIJB 2ODTX 2QB5A 1BGYH 4JPRA 1I1KA 2E5LB 1VBGA 4EEYA 1UPGA 4LF5H 1AROP 4UUGA 3THOA 2R86A 4UV8A 5EOYA 1AP5A 4TM5A 2H8PC 1MNGA 1DV1A 3EVKA 1KC7A 1AJQA 1W0KG 3X2QB 3MFHA 4GKKH 4F4LA 2ZGIA 1TWCA 4O7NA 3PW5A 2NR5A 4O81A 2R93A 5DEDA 2HHHH 4R7CA 4PV1B 4DAAA 3KAJA 1VEWA 2HJDA 3AEIA 4FM1A 2UUAH 3HB3B 4O4JB 2HIXA 1CE8A 4PZ8A 4ED2A 2EJRA 1T3NA 1RJQA 3DXRA 1YCIA 1YTFB 3K5IA 1QLEC 5J2TF 2FTKA 2COJA 4JI8B 2F1MA 2W6NA 4Q8EA 3LP8A 1VQKV 4O2AB 3C3SA 1YJNV 2HEPA 3ZCCA 3ORQA 2JEGA 4NB5A 1QHTA 2FP4B 4FLZA 2YZMA 5IYDG 1K1QA 2UXDO 3N8DA 4DR4O 3W7XA 4UVBA 1AJPA 4CH4A 2HGSA 1NR7A 2UXDB 1FVIA 4B3MB 3J7AK 2XUMA 2Z0AA 3CSXA 3ZX6A 4YR0A 3CJHA 5B1AC 5KS8A 2R72A 4ETSA 4ECUA 3DC5A 4GUNA 4R50A 1MG1A 3CRCA 5C5JA 1JQ0A 4DV2O 4X88A 3SYPA 5KFGA 1Z2PX 5L3GA 5BMVB 4JI4H 1NKDA 2BE3A 3FAVA 4J11A 4LP8A 2ZXWB 5LXTA 5D5PA 2ITCC 5C4XG 4J7JA 3KTMA 1R1BA 4I50F 3CCRV 4J9YB 5HBRB 1S0VA 1YVWA 1HR0B 2FL4A 3HOWG 5IJ0A 2FLPA 3OAAG 2UXCH 1BCCH 1W59A 4KFMA 4DR7B 4XDKA 5KT4A 5ITZB 5CAEB 2XAGA 2R70A 1AJNA 4YAJB 2W9CA 5KHJA 3MWEA 2UVUA 2RCVA 1I3QA 4P9OA 1JPXA 4JI3B 2XIGA 1DTOA 2A0LA 1J5EB 4HBNA 5IYCO 1N33B 5LYJA 5JCOA 4DR2O 1CQIB 5LA6B 4RB1A 4U7NA 4TOIA 1IBKO 1Y67A 2QJ1A 4LF6H 4O2AF 3J80N 4GKKB 1JX4A 3GWKC 4EYHB 4FLWA 5C3EG 2W71A 4O4IF 4PDVA 1WNSA 3ZRVA 4XX0B 3FMAA 4FBTA 1H2GA 3RVYA 4O7ZA 2ZXWC 2QR4A 2FYUH 1IBMB 4FFKA 4FK5C 3H40A 5L3BA 4DV0B 5GONF 2W6IG 4LFAO 4QSHA 1Q7YW 4O7SA 3KYHC 2QM7A 4O84A 3OGCC 1GGOA 4MAMA 4EFBA 3WWIA 2MW2B 1Q6IA 1FFXB 2E2HA 4NR1A 1QQCA 4G3IA 3N6RA 4FVMA 2FJZA 4AHCA 5FLXW 4MW3A 5BR8B 3CE2A 3RYHB 2PI5A 4DRXB 5LP6B 3CWBH 1CQJB 2C2AA 4O83A 4AQYH 1BHBA 3CC2V 1KB9F 2R82A 2Q5ZA 1PK8A 4MW8A 2B5UA 3U0GA 3MD0A 4X1KB 4N23A 3ASOB 3U9SA 3HKDA 4RB3C 4GT1A 3CCMV 4BIUA 2V7QG 4Z1MG 3CCLV 4FFLA 1R9TA 2NU8B 3OEHG 3UFXB 2GTAA 2AGQA 5KFXA 1JA8A 2JA8G 3GTQA 1K34A 4DV7B 4PD4F 5GTHZ 2DWDC 3JD2A 1T5EA 3A0BZ 3KCXA 4DL7A 3APQA 2CZGA 3N6XA 3MFIA 2Y4UA 4LFAH 4YHHH 1HNZH 4LSXA 4LF9O 2R7MA 4A3EG 5JQGA 2QTOA 3N42B 4QWEA 2UVVA 2D2CB 3O65A 4RUCA 3Q8RB 2JA7A 4I55B 2K9PA 5L3EA 3K3WA 4DR3B 4X20B 3GIPA 3N40P 4EYIB 1VQ8V 2ITDC 2CTRA 3GJXB 1TUBB 5B1OA 2DYRB 1G8MA 4H33A 3HKEB 4DV5O 1BHAA 4YJ3B 2P67A 4FFOA 3LUTB 1FKAO 3TETA 2YRWA 2MCTA 3HXLA 1KT8A 2OCCC 5LL6b 2VQEH 1ZUQA 4JV0A 2YS8A 4WBNA 3J80W 5B1BC 4F4WA 3CCSV 4DV7O 4FLXA 2QE7G 1ULZA 4IZOA 4LF4O 3I4MG 2YZLA 3EPIA 5E25A 4JI0B 4X64O 5C8YF 4LF7B 5JWPA 4R8UB 4I55F 4Q8FA 3C3TA 4ZIBA 3NXSA 2D3OW 4EGJA 4BW5A 2OTLV 3NR7A 4XBFA 1H2SB 4JI6O 4MA0A 2ZIOA 1QLNA 5EYPB 3AG2C 2EIYA 3V6HA 3ML0A 1OCOB 4AILC 4RU9A 1XILA 4J9ZB 4MVSA 3ZRXA 5J2UF 4IWXA 1SERA 2Y69B 2YIDA 2Z5UA 1QCEA 2PF4E 1Y1WG 4JI2O 5KG6A 1NU1H 1FXKA 4C5AA 1KBHA 1BZKA 3IC7A 3TCUA 4PI2A 2NLJC 1ROPA 1HP8A 3PW0A 2ZNJA 5BWTA 3HOXG 3BQ2A 3ABMC 1N48A 4PBCA 5KT5A 4GYCB 2RF4A 1OHHG 2BOBC 2WSSG 3CX5F 4ZKIA 3R5FA 1E4GT 4DV1B 3RB3A 4JI2H 2DYRC 1PM9A 2IJIA 2ZM6H 4ED1A 3ZRWA 2IA6A 2E5LO 1N33O 1V54C 1MA1A 5L3CA 1O9HA 1JVMA 1S0OA 1R6KA 2WA4A 3E8GA 2WE6A 4A3GG 2WLHA 1WP8A 4QGPA 5KMGB 1JDBB 3ASNB 1MSDA 4B3SB 3MAQA 2W0XA 2BR0A 4JV2A 4JV5B 5I5XA 2IU0A 4C2MA 3LMLA 1E4EA 2FMAA 1N0JA 1K33A 3B40A 1Q82W 3DSQA 5F2VO 5HFLA 3CB2A 1MZEA 1N36H 4X1IB 4BIZA 4CS3A 3CC4V 5CBFA 3T9DA 4TV8B 1EKFA 4CC5A 4TVIA 3OD4A 3RTXA 2LFRA 5H9CA 2FK2A 2LJ2A 5LP6C 3OSNA 3JRWA 2CFMA 3ZN0A 4JZ2A 5EBMC 3JALB 3ASNC 4QWCA 1JR9A 1VQ9V 2Q73A 4DV2B 2PN1A 5JQWA 2ASLA 2QWPB 3OE7G 4IR1A 4DV3H 4YJ2F 4R8CA 3TJTA 2ILMA 4O2BA 4FFBA 4B3TB 2XCAA 5KUKA 1B06A 5EBWC 1KUTA 4IHJB 1C3OA 1M6VA 4PWQA 2LGQA 3STZC 4LFCB 3CD6V 4DR6H 3GTKA 3KREA 1GSAA 4Q45A 4CS4A 3DTUB 3TIGA 3CPWU 3I12A 1RM1B 3K04A 3PW7A 2O03A 4F6RA 1VAJA 5L3DA 5KMGA 4CH6A 4DV4O 4R8UA 3GIKA 3RFCA 1I7FA 2ZDGA 2HLDG 4FM9A 4JV5H 2OYQA 3E2EA 4A3BG 2XAJA 3T1CA 5DQGA 1HNZO 2Q2UA 2CTPA 1NR1A 5EWGA 1YSCA 2L6LA 1S03G 5LMUH 2R92G 2UU9O 1VQNV 1CKOA 4O7RA 1RSOA 4O4HA 2X5RA 4GLWA 3OHAA 3SJCC 1GMGA 1PNLA 4TV9B 3BABA 3RGBA 3FKSG 1RYSA 2ZD9A 1EHIA 4MVQA 1XHZA 3H4BA 3WG7C 3H01A 4B7KA 2CK3G 3FD9A 4I9QA 4NXMO 1I2KA 2XOKG 5DAAA 2JEUA 4WFBV 2F23A 3G8CA 5K3WA 1VQMV 2W0FC 4DV6B 1SQVH 1W0JG 4DK0A 2ADQB 2OCHA 2ETNA 5LHGA 2E3CA 1B3QA 5B1AB 5KFCA 4JYBA 2G38A 1H8HG 1OZ0A 5LA6F 5IP7G 4GKKO 4Q4CA 2C35B 5KFBA 3MR6A 2R8JA 3SGIA 2VPQA 4OGQB 4PJ0Z 5IYZF 2F4VH 2DN9A 3E22B 4LBEC 4HR7A 3GIJA 1K9MW 3GTMA 3HB9A 4X65H 1AVMA 3T1HH 3ZS8C 4FGRA 4JASA 5LP6A 3V6JA 2XT9A 3QO5A 2W9BA 4PZ7A 1DF4A 2FB5A 2YXHA 2B9ZA 3H0GG 2IW5A 4UXNA 1PL4A 3GIQA 2F43G 1SYXB 2M05A 3IAYA 1AR5A 2A3QA 3ASOC 1W96A 1RJRA 1Z2GA 4BBRG 4IRCA 1WSCA 2E74B 4M7EA 2DIKA 4O4HF 5LOVA 2QYZA 4O3PA 3HKCB 4HQ6A 3X2QC 3JRXA 4I50B 3NBYB 3RB4A 4U7CA 1E1QG 2QF7A 3I55V 3P3NA 5IWAH 4YXWG 3TINA 4O4IA 5C8YA 1HNWO 1KP2A 1AI7A 3H9VA 3MDSA 2E2IA 1L0LH 1N8RW 3MWMA 1HNZB 1FJGB 4YHHB 5IT9W 5B3SB 4DW1A 2IJKA 2FE3A 2Q7EA 4HAMA 2OWOA 4FFNA 5CA1A 1Y1VG 4DV7H 4DV1H 1WCMG 4Z2WA 2VQFB 2ZDQA 2Q67A 1XMOO 1XK5A 4K6NA 1IVSA 4IL6Z 4U3JB 1IDSA 1BT8A 3N2KA 3AG3C 2HHHO 1XMOB 1A3GA 4I4TF 5JH7A 1KBLA 4DV2H 2IH3C 3K59A 2CTQA 2XASA 3OR7C 1DGSA 1ZQ7A 2V4QA 5IYBO 2VA2A 3T5JA 1JMKC 2QM4A 4RUAA 1Q90D 2C2EA 1JXLA 5CBGA 1XMOH 4ZHQF 1PP9H 2EILB 2W7PA 2JA7G 3ZMVA 5KX5B 1Y14B 3STLC 1P7BA 2QKSA 2V4DA 4JF3A 2IJJA 1UNNC 3RBEA 3E83A 1V55C 3U9TA 2UVWA 2IMWP 1LUVA 4O4LF 3HR0A 3JASA 2ARHA 2JEXA 1OCZB 5CE8A 5LOVF 4Q43A 3L4JA 4EG0A 1K4CC 2AGAA 2Q7GA 3J7AU 2C28A 5IYZA 4QJFA 1YIJV 3VBBA 2FPPB 4JAVA 5CA0A 3B77A 1ZTEA 1SRYA 5JCOC 2CKZB 3K0GA 4LF8H 4DR1B 3LDEA 3K5MA 5LMUB 4JI5H 1WPXA 4BWAA 3CP1A 1SETA 4I0XA 1Q3EA 5H6QA 4A3DG 1FJGH 3IC9A 4YIPA 4O4JF 4EFEA 3K5OA 3RFRA 1M56B 5EBLC 4IHJA 1N36B 1D5AA 1FFTB 1WPBA 1DV2A 1EZ1A 3RUPA 4ICGA 5CB4B 3ZRWB 2HGXA 5IYBG 1BS3A 4UB8Z 3HKZA 1HR0O 4G2KA 2AXTZ 4H37A 1S77D 4Y8VB 1RK5A 3T1YO 2YI8A 2A79B 1NTMH 2RDIA 4ZBMA 1WJZA 1LUWA 4GZRB 5FPOA 2F4VB 4TQRA 5JQGF 4UCUA 4RO2A 4X62O 4MV4A 2WLLA 4X1YA 1N0NA 3LSUA 4RZRA 5KFKA 4RUEA 3AX6A 4H44B 5JJJB 2HHFB 3T2MA 1OCCB 1SS3A 4B3MO 2UXCO 2R6FA 4DL5A 5KG2A 4B3RH 4YJ3F 1XL6A 5IYCG 3IG0A 1PL0A 2UXCB 4UVAA 4I50A 2JS3A 1FJGO 1S0MA 4JI7O 4QE7A 1VQOV 5DGBA 3QVNA 1R3LC 1O75A 2VQFH 1LR1A 3N27A 5KFUA 4I55A 3SDLA 4H13B 5CA0B 4JI7B 4DUYB 4B3MH 1PNKA 1VIBA 3W7WA 2BQUA 3N2GA 1IYEA 1BNCA 2DYSB 1EN4A 4ECRA 2KSDA 3R65A 4YY3B 3JAKA 3T5KA 2UXBO 1EKPA 3LSSA 4EBEA 1MMMA 3GTPA 5KFQA 3RW0A 2EINC 1RFYA 1VF6C 4LSAA 4IIJA 4TV8F 1KKDA 1HDJA 3N2KB 3Q8QB 2Z04A 5J2TB 2HVQA 3G6VA 5CR5A 4ED8A 2V9WA 2VQEB 1Q81W 5BWRA 3ZRSA 2UXXA 2YYAA 5CBHA 3GIDA 3FYIB 4J9PA 1CKMA 4NLGA 4RNOA 2O57A 1TVKA 2EZPA 1H2KA 5LP6F 4YBZB 1M5IA 1Q5OA 4B08A 1XNRO 1Q86W 2FPGB 4JI8H 5EC1C 1S76D 2R9RB 2YL2A 4NXMB 2YIBD 4MTDA 2WTFA 1LNQA 3A2FA 2BOCC 1H38A 2QWRB 2EIKC 2RN9A 3W1BA 4O7VA 5HV6A 4W4LA 2Q2TA 1WCMA 2CGOA 5L1KA 2WB1A 4FM2A 2LGWA 3ZN1A 4DR2H 1S5LZ 1GM7A 4WFEA 3ZEDA 5BR8H 2E5LH 3JAMN 3H1IH 2V58A 1GO3F 1SFOA 3DGEA 2RNBA 1L0NH 1ENVA 4D7TA 1ZX3A 2HVKC 2XAQA 3A0HZ 4M0JA 2ABJA 4DR4B 5D1OA 4X8AA 1SA0B 3RF2A 2E75B 3ABTA 1EZJA 4P30A 5J9PC 4ZOLF 1IOVA 4DV0O 1GN2A 2QWOB 1WA8B 3VQVA 4OX9B 3UCSC 1SQXH 2AW9A 4JI8O 3K3PA 5LL6Y 3CRAA 3H4DA 3B8MA 5LXTB 5I5WA 4YR2A 4F4ZA 4A3IG 1U97A 5I5UA 3Q1KA 4KUMA 4FLVA 4FBUA 2JS5A 3UO3A 4B3TO 2GLTA 4TUYB 1G6UA 2KB1A 3K5HA 3H0GA 1V9PA 1GH6A 3SJBC 3GV5B 3OR6C 4GC6A 2XAFA 2WLLB 4X1YB 4BIOA 5LHHA 3ZHSA 3BG5A 4TWKA 1TAEA 2GUZB 2K1EA 2I87A 4ME6A 4DR3H 4LC1A 2YXLA 2FLLA 2ADPA 2J6SA 4K0KB 2WLKA 3QQMA 1L2ZA 1PV0A 5H5NA 2R8HA 2R84A 2XCLA 5I5YA 3CHXA 4JI3H 2OIGA 2BSKB 4IWYA 2HVRA 4DXWA 3PR4A 3PW4A 2GTSA 2R9AA 1U96A 3J81W 2IJHA 1OCCC 3RV4A 1B6QA 5LHIA 1M56C 4RQFA 2ZM6O 2PTMA 4DW0A 3ZHVA 1NZ6A 4MT8A 4GX1A 2DPJA 1Y66A 2B63G 4ECZA 4LF9B 3FKIA 1KUQA 2CH7A 2CNUA 1EN6A 1F7YA 2GPWA 2ASJA 5DGAA 5EC2C 1XEQA 2R7KA 4ED6A 3H20A 3RR5A 3UZOA 1E4FT 3JAWA 4DR4H 3K79A 4Q6GA 5KT7A 4JI1H 3WWHA 4UFZA 2YICA 5FNVB 2PZSA 1K73W 2Y4RA 4DV6H 4GX5A 1BL8A 1SQPH 3GTLA 2YIBA 4JI6B 3T1HO 5KFLA 1DIKA 4RNMA 1WA8A 3WNZA 4RAZA 2R8KA 2RMKB 4NXNO 1E4EB 3VPDA 1OCOC 3RYHA 1WN7A 1S97A 2KQXA 4O3RA 3K03A 1ZSPA 3ABLC 3T54A 3NC0B 4HZ3A 3WO1A 3H1HH 5H2FZ 3K0DA 1N34B 4IRKA 1TVKB 4AYBA 4DL3A 2YW2A 3HKDB 4BWSC 2AGPA 1OWTA 5I5VA 4EBCA 5FJ8G 4FM0A 1THZA 2W6QA 2GV9A 2COIA 1SQFA 2WPDG 5JJNB 1RK6A 4JAAA 1YJ9V 3N44B 1HNXB 1I08A 2YI9A 1YEWA 1SZXA 1BXRA 3EHBB 4JAUA 1ZHSA 2EIMB 3JARB 2P7TC 3JD1A 4RAYA 5A9GA 1V55B 4YP3A 4BY7G 5KAFZ 2DQ0A 2R7NA 5FL7G 4O4IB 3CCEV 3MJFA 1WR2A 4DL2A 2Q9LA 3JAKB 5EWEA 1I94H 4FLUA 3SYCA 3K3VA 2YCHA 3CC7V 2Q7HA 4K3AA 3SPJA 1EFRG 2QWNB 4I9WA 4YJ2B 4X65B 3TY9A 4M9UA 2EZOA 2ZE6A 4B3TH 3L9DA 1XMQB 4NVPA 4DR7H 3AK1A 3M9OB 4CS2A 4GC7A 3K5NA 1IBLH 4YJ3A 1S3JA 2ZE7A 5J2TA 4X65O 1N32O 1M1KW 1EYZA 2BQRA 5IYDO 4TQFA 2PUSA 1JJOA 2A9HA 1KECA 5FD5A 5KFAA 5A2QW 2P4KA 2HG8A 4AQYB 1OV9A 1R73A 1XBLA 4WF9V 5B1NA 2BTQB 2HVSA 4DLKA 4R7RA 3G67A 4I4TB 4YQWA 2Y0PA 4X9QA 4PHZA 2FKXA 2PI4A 3M9MB 4KHPH 1YZBA 3LNMB 3W7TA 4FMTA 1P4RA 2Y48A 1K3EA 4MTGA 2OTJV 4PDMA 4B3RB 4DR2B 4A3MG 3LDDA 4JYAO 1VQ4V 2Q8VA 2VPSA 2JJ2G 5K1PA 4YB8B 5IWAO 4JTDB 2JEFA 4IT5A 3RYFA 3MR3A 1I7NA 5KFVA 2N74A 2CW8A 4K0KH 2WLMA 1AILA 1SF9A 1X9NA 2PMZA 1N34O 1Q6UA 1AB3A 1K92A 4LWSA 3OW2U 5JQGB 3QNEA 2ASDA 4R6ZA 2UXNA 4PA9A 4ASUG 4F50A 4EQ5A 4DR5B 3A0RA 3MR2A 3AG1B 1KKCA 4MV7A 4NZMA 3QWUA 4FFPA 1TUBA 5KFOA 3BQ1A 2HHHB 4IYHA 5CA1B 3RIZA 1DF5A 1FFXA 1SKVA 4O4LA 1ET0A 3QZ8A 4B3SH 5KFZA 1M4UA 1Z5VA 3GIIA 5KFEA 4PA6A 1S0NA 2B1GA 5CB4A 4NTYA 4X62H 3S3WA 2W6ZA 3KZIZ 1CPYA 5BWWA 4TUYA 3D3QA 3UT5B 5CA0F 4HNTA 5DN6G 5IDJA 2C00A 5JVDF 2XGPA 3D36A 4X1KA 2HVJC 3OTOB 4JI4O 4O7LA 4APMA 2V4RA 3RBDA 1HNWB 3CMEV 1K1SA 3OSPA 3TXQA 4PZ6A 1TGOA 4QIWE 3KHRA 4LF5O 5BYBA 2W9CB 3WG7B 3ZBHA 4X1IA 4ZOLA 1M7JA 1A0IA 3V6KA 4TV9F 3FB6C 4JI1B 1KEEA 1TWGA 3VPBA 3VQWA 4FIPC 1RSOB 4JI5O 4LF7H 2HIVA 2YS7A 4O2AA 4LCUC 4ED3A 1S68A 5IYZB 1ORQC 1R3KC 2IBZH 2I80A 2VA3A 5EWFA 1MZFA 2P5OA 4QPKA 1WB8A 3E8BA 3WB2A 2BTOA 4WD3A 3EFFK 3GIMA 4ECSA 4U6PA 4I7ZB 3FDSA 3K06A 1NT2B 2EULA 4A3CG 3GV7B 2PVPA 2W6PA 4JI0H 5KFIA 5KFSA 2UXDH 3GWOA 2SCUB 4LF8O 3M9NB 2JDIG 3HT5A 2ZR3A 3FAVB 3ZHQA 3WB0A 1A0GA 4A2AA 2PYLA 1X59A 4DL6A 3JSNA 5T14A 2R8IA 4PDLA 5DGHA 3VNNA 3MR5A 3L71H 4X64B 4A2BA 4ECXA 4K8ZA 1QLEB 1MOFA 5IJ0B 4DR5H 3LULA 2GQRA 1K4DC 3CRRA 2RJZA 3VPCA 1ZWIC 2ATKC 4TSFG 2KG7A 4DUZH 5FLMG 1N4CA 4CE5A 4JZGA 1N33H 3AG7A 2YXYA 1SQBH 3CRMA 4EKWA 1XQ8A 2ALZA 3B8NA 3MHSC 3ETDA 2YU9A 2WYOA 1P8LA 2VQEO 2ZJTA 3GTOA 1VS0A 3L70H 1IYDA 1YITV 4I7HA 4TV9A 2QSAA 4MV3A 3L2PA 1F4MA 4LWSB 2CNQA 2Y4TA 1S5JA 4UB6Z 5KFWA 4TQSA 2R7LA 3PR5B 4A3JG 2HG5C 3CCJV 1I5XA 3F5WC 4D7SA 4JGSA 3DC6A 4DV3B 3RJ0A 2WAMA 1OCRC 2IH1C 5KG5A 2ODMA 4NTXA 5I5SA 1XUQA 1GTOA 3G6EV 4DV4B 1AR1B 4CKEA 1XNQO 5KHGA 1JKJB 4FZ1A 4ABMA 3TY8A 1B04A 1PPJH 2UUBO 1M57B 3KHLA 4LFBB 3W7UA 2JEJA 4O3OA 4J9MA 2AHYA 1HNWH 1I7LA 3KKYA 2ZDIC 2CDYA 3M4IA 4LF9H 1H2NA 3JSLA 4E4EA 2DQ3A 3QO8A 1IBMH 3VA7A 4J7ZA 1CP9A 1AR4A 2R7ZA 1ZL8A 4O3NA 2LQTA 4JYAH 3ETQA 4JUZA 4WBNF 3L4KA 4J41A 1XNRH 1AN7A 4CBCA 3NBZB 3AG2B 1NBMG 1M0WA 4J9QA 3RYIA 3BJYA 4DRXA 2DWCA 2ZKOA 3ZMTA 2HP8A 2EJ0A 5LBQA 2EJ2A 3KAKA 3HOYG 1RPOA 2N05A 4DK1A 1GRJA 3U0ZA 4FS1A 4QIWA 5B5EZ 4JTAB 5B1BB 3GB7C 4LFAB 2GHYA 5DM6V 4J9SA 1GSOA 5J2UB 2ZE8A 2LP7A 1GKFA 4MTXA 2UUBB 4RUFA 2C22A 3BEHA 4FZ0A 3JALA 4LFCO 3JASB 1MABG 2LO1A 1GK9A 4BXXG 3GLKA 1YXBA 2QTSA 5IY5C 2VOBA 3R66A 4OX9H 1AI6A 5DG8A 5GTIZ 3F5TA 4DUYH 3P30A 4LFBH 4RB2C 3TQ1A 3GDEA 2Z02A 3APOA 5GW7A 1YHQV 4WFFA 4XDJA 5C8YB 2P0AA 4XZ3B 3FX7A 1VQ5V 2BCCH 1GM8A 5D1OB 1TWAA 1E79G 4IHJF 3E5NA 1T94A 4QWAA 2DOSA 4MA5A 1I0HA 3GQCA 4ZI7B 4AQYO 2UUCB 3ETJA 3RWRD 1E1RG 3D8CA 4GX2A 3NUAA 1F23A 2RDCA 4U3JA 1RP3B 1MSWD 5BWXA 2UUAO 1F51A 3T5HA 3E22A 2PY5A 1Y1VA 1JOYA 5EIBD 1IBLB 3OUSA 4RQEA 2JVDA 3GV8B 4DV0H 1GLVA 2R87A 1Y74B 5DLGA 1NS1A 1UFIA 2CW7A 2R93G 1W2BU 1ZHQA 3VOTA 5IWAB 2VUMA 5EIBC 4E2LA 1NVPD 1H2LA 2W7OA 1XHXA 2GUZA 2YIAA 2Q6AA 4KP4A 4DUYO 1TUEB 5BWVA 4G28B 5EK0A 5CA1F 2DPIA 3PO2G 2DJVA 5BR8O 4DIMA 4QW9A 4A3LG 3L72H 4TV8A 4NYKA 1M9NA 1XDCA 3ICXA 3L74H 1FXKB 4EB6A 3ETGA 2H94A 1GAXA 1KJJA 2Y0SE 3WO0A 4I5SA 4U7OA 4Q4DA 1WLEA 2JGDA 5KLVH 1BJTA 3B2EE 5FD6A 3P32A 5KG1A 5AG2A 2B63A 4FPPA 1SA0A 4NYEA 3SYAA 3G71V 1COWG 4L8JA 5EDWA 1CEZA 4RAIA 3CEIA 3ABKC 4YJ2A 1FXVA 1KQSU 5KHKA 4XDLA 5I5TA 3CVZA 4TQDA 3JATB 5KT6A 2JA6A 2ZDHA 4ECQA 3BACA 2FLNA 3BA9A 3V4SA 4OPHA 4O4LB 2P90A 4JI6H 1Z2OX 1JLLB 4JI4B 2NVXA 1CS0A 1IBKB 1JFFA 4DR3O 4O3SA 4Z1VA 4JI1O 4IYIA 1A9XA 3PFFA 5L3FA 3RYIB 2OT5A 4HNAB 1NJIW 3N43B 1BE3H 3TW7A 1VQLV 4LH6A 4WFAV 3P3PA 1NH2B 3V4ZA 4Q44A 5B66Z 4DR6O 3T1YH 2F93B 1YF2A 4YHHO 1H8EG 5BMVF 2JEIA 2R9IA 2NU7B 2RGVA 3T7AA 4O4JA 3RVZA 4LFBO 2CGNA 3AG4B 1EBOA 1Q8IA 3BFRA 3AW8A 5KFFA 4AYBE 2R8GA 4UCOA 3ZIAG 4X62B 1XNQH 2XCPA 2DLNA 5J2UA 4LNUA 5LA6A 4W4KA 2UUBH 4HNUA 2IP4A 5I60A 2W9AA 1KJIA 3A8TA 4P9PA 4UCTA 2NU9B 4JYYA 2EJ3A 1GO3E 3OMIB 4PI0A 4X66O 4DR7O 5FLXN 4QNHB 2CH7B 2V1DA 1ZLZA 4CH3A 3U54A 4GKJH 2VUMG 5C1OA 3O9OA 1VF6A 1FD9A 1L1FA 3H1JH 3OMNB 1S10A 4MV9A 3JAWB 4DO2A 4F6EA 1A32A 3EXAA 5JJEB 2VQFO 3L73H 4N21A 4ECYA 2JRIA 3K08A 1Y76A 2E76B 4DR5O 4FFBB 2H3OA 1TA8A 1T36A 1S72V 3W5OA 4KHPO 2RQ6A 3Q2OA 1ZETA 3RN4A 3Q4HA 4LF8B 1VP7A 4DR1O 3AG1C 2CNVA 2DE0X 1L8DA 1NH2D 1QNMA 2AZ0A 4F6RB 4O7TA 2XC9A 1V4YA 4LMYA 2ZNIA 2AGOA 2CTWA 5L1LA 2UVRA 1N32H 2Q0AA 5DECA 2JGUA 4MVZA 4G27B 5ITZA 4NXNH 3I56V 2IM9A 4LF7O 2W6MA 1I1LA 2CAZC 3IFXA 1GM9A 3E89A 4X66H 3HKBB 3AK2A 4NXMH 1DK1A 4QIWF 1Q43A 4IR9A 2VS0A 1VF7A 4FLYA 3BA8A 1M0TA 2NUAB 3SJQC 3SYOA 1D2DA 5C44G 4JYCA 3OTFA 4DV3O 5LOVB 3UM7A 3ZHTA 1RJPA 3PO3G 5BWUA 4J9OA 1KP3A 4FLTA 2ZINA 3ETEA 4QPJA 1VMGA 4JI0O 2QM8A 2UU9H 5H80A 2JGDB 2R85A 4JV1A 3FKIG 4DUZB 2ZDIA 3K58A 3CQZA 4RZQA 2FPIB 1FYJA 1SC5B 2V5AA 2DW4A 3Q8PB 5BMVA 1GSHA 3MHHC 4O2BF 4LF4H 4J9NA 3OFNG 1FPOA 5DLFA 4X64H 3I4NG 1PX2A 1AUXA 5CA3A 4MTEA 4EBDA 4GLXA 2VRZA 1P84F 3ETHA 2YS6A 3BQ0A 2R7ZG 3T9FA 2BTQA 4C5BA 4ECVA 1GYFA 3Q8SB 1V54B 4DL4A 1VARA 1AP6A 4EEQA 1JFFB 3SPIA 1VQPV 2WB1E 2P22C 3GB8B 1DLBA 2B1IA 4P2ZA 1BQZA 5LGTA 5KFYA 5JVDB 5JH7B 4F4XA 4C7UA 2UXBB 1IZ3A 4XYMB 1KD1W 4HNAA 2VR1A 3HOVG 2J6UA 5KAIZ 5IJ9B 4YY3H 4U3FH 3ABMB 4PDBA 1HR0H 3RYFB 2HGWA 4ZOLB 1CKNB 1X4TA 4IGGA 2W57A 4PA7A 2OIEA 2PGGA 3SNOA 4X66B 2HJWA 1Y1WA 2YDEA 2UUCH 4RB0A 1WP7A 1IXMA 2GPSA 1BQ0A 4LNUB 4UCRA 1URFA 2P4VA 4OXSA 3G80A 5EZYA 4DQNA 5FPRA 1N32B 1KJ8A 1V51A 2QDOA 3J81N 3TIIA 2RDJA 3GILA 4A5UB 3RT3C 2XAHA 3FYEB 3ZHRA 2W6OA 2LW1A 4NKGB 1BGWA 3T5LA 2YZGA 1PNMA 5IT9N 4J0MA 1YDXA 3UO2A 4HYOA 2GDSA 1YI2V 4X20A 1AI5A 1VQ6V 3CS5A 1XI1A 3WFVA 2F4VO 3VQYA 4ED7A 1SZTA 1GN3A 2WLIA 5GONA 3TXSA 3HPLC 1R6NA 1EUDB 2WAQE 2OCCB 5BY1A 2WWWA 4F4YA 3K9AA 5L1JA 3ZHUA 2WA3A 1Q6HA 3M7MX 5CM0A 1RYRA 4K8XA 3QO7A 3Q4HB 2ZR2A 2JK5C 4ZI7A 2F95B 2PMZE 5H6RA 4WBNB 1TWHA 1J95A 5KFTA 1JIHA
chains in the Genus database with same CATH topology
2BTOA 2UXDB 1XMOH 1FVIA 4B3MB 3J7AK 3CSXA 5KX5B 1NT2B 2R72A 1SEIA 4ETSA 4LFCH 2V4DA 4JI0H 2UXDH 1Z2PX 1ZAUA 4UCVA 3KXYT 5BMVB 4JI4H 4LH7A 3JASA 3WB0A 4A2AA 2PYLA 5LXTA 5D5PA 3JSNA 3L4JA 2XHBA 3BAAA 2Q7GA 3VNNA 5IYZA 4X64B 4A2BA 4K8ZA 5CA0A 3VQXA 5IJ0B 1HR0B 4DR5H 5IJ0A 2RJZA 5JCOC 4LF8H 4DR1B 4DUZH 3QF7A 1IBKH 2UXCH 3C0FB 1N33H 3K5MA 5LMUB 4DR7B 4JI5H 1XQ8A 4BWAA 5ITZB 2R70A 5KHJA 1Q3EA 4LR3A 4NXNB 2WYOA 1FJGH 4DV5B 1P8LA 4JI3B 2XIGA 4EFEA 3K5OA 1J5EB 4HBNA 3RFRA 1N33B 3T1YB 4IHJA 5LYJA 1N36B 1VS0A 5JCOA 2ZJTA 1D5AA 1WPBA 2EX3A 5LA6B 4RB1A 4O2BB 4TOIA 5CB4B 4TV9A 4I7HA 3L2PA 4LF6H 2QJ1A 3KALA 4GKKB 1XMQH 1SQGA 1S5JA 4FLWA 2YI8A 2UXBH 1P49A 5JVDA 1WNSA 4D7SA 3FMAA 3PN1A 4DV3B 5FPOA 2F4VB 3RJ0A 5KX5A 4UCUA 4DV4B 4X1YA 5KHGA 1P16A 3TY8A 1B04A 3HKBA 1IBMB 1CKNA 1HW7A 4LFBB 4DV0B 5JJJB 1HNWH 3KYHC 4DRFA 3M4IA 4LF9H 3JSLA 1IBMH 4B3RH 4EFBA 2ZCEA 3IG0A 5D1PA 1FFXB 4JYAH 2UXCB 3ETQA 1QQCA 3L4KA 4I50A 4FVMA 1XNRH 1AN7A 3NBZB 4AHCA 5FLXW 3HKCA 1O75A 2VQFH 5BR8B 3RYHB 2UU9B 4DRXB 5LP6B 1M0WA 3RYIA 4DRXA 4I55A 4B3MH 5CA0B 4JI7B 4DUYB 4AQYH 3SJAC 1N34H 3KAKA 3N2GA 4YY3B 4X1KB 3JAKA 5GONB 4DK1A 3HKDA 4RB3C 4JI7H 3U0ZA 4JI2B 3T1HB 4LFAB 3K57A 5J2UB 4DV7B 2UUBB 1MZBA 4LSAA 4IIJA 1T5EA 3N2KB 3JALA 5J2TB 2HVQA 3JASB 3N6XA 4LFAH 4YHHH 2VQEB 1HNZH 3UT5A 2VOBA 4LSXA 4OX9H 4DUYH 4LFBH 5JQGA 3N42B 4RB2C 3GDEA 5K1XA 5LMNB 5C8YB 3OTOH 4I55B 1CKMA 2VUGA 4Q0YA 1TVKA 4DR3B 4X20B 1M5IA 1Q5OA 4B08A 5D1OB 4JI8H 3N40P 4ZHQB 3GJXB 4NXMB 2YIBD 4MTDA 3A2FA 1TUBB 3W1GA 3HKEB 4ZI7B 2UUCB 4YJ3B 2RGRA 3RWRD 3W1BA 4U3JA 2MCTA 3HXLA 3LNNA 4LF6B 5LL6b 2VQEH 2Q2TA 3E22A 2PY5A 3RGXA 4WBNA 3J80W 5EIBD 3K5LA 4FLXA 4EB6B 2JVDA 4FM2A 1IBLB 3DF7A 4DR2H 1I6UA 4DV0H 3ZEDA 2KKWA 4JI0B 5BR8H 2E5LH 4LF7B 2CW7A 4ZIBA 1ZHQA 3JAMW 5IWAB 3BHPA 5EIBC 4D7TA 1H2SB 1XHXA 4DR4B 4JYAB 5D1OA 2ZIOA 2YIAA 5EYPB 1SA0B 3RF2A 3HKEA 4AILC 2KSWA 3VQVA 4OX9B 4CH5A 4TV8A 5LXTB 5D5QA 4DR6B 3ICXA 4FLVA 2JS5A 4LF5B 4E6NA 4EB6A 4PI2A 4TUYB 1G6UA 2ZNJA 4DV5H 1V9PA 3SJBC 1BJTA 3B2EE 5FD6A 4GYCB 1E4GT 4DV1B 5LMNH 4X1YB 4IAJA 1SA0A 1TAEA 4JI2H 4L8JA 4DR3H 2ZM6H 2YXLA 4YJ2A 5KHKA 4UCSA 4K0KB 3CVZA 4TQDA 3JATB 1O9HA 1L2ZA 2WE6A 3CHXA 3BA9A 4O4LB 4JI3H 2HVRA 4JI6H 1Z2OX 2R9AA 5KMGB 4JI4B 3J81W 4BW9A 1IBKB 4B3SB 1JFFA 3MAQA 2PTMA 4JV5B 3RYIB 1I94B 3LMLA 4HNAB 3N43B 3DSQA 3RYCA 4LF9B 4LH6A 3CB2A 3T1YH 2F93B 1N36H 4X1IB 3H20A 2RGVA 3RR5A 3S24A 4O4JA 1E4FT 4CS3A 3QTCA 4CC6A 1Q8IA 3JAWA 4LF4B 4DR4H 4Q6GA 4JI1H 4UCOA 4UFZA 5FNVB 2PZSA 4TV8B 3RGZA 4DV6H 4X62B 1XNQH 5J2UA 2YIBA 4LNUA 4JI6B 5LA6A 4CC5A 3RTXA 2UUBH 4RAZA 5LP6C 4UCTA 3RYHA 1WN7A 2CFMA 3JALB 4PI0A 3NC0B 2ZM6B 4CH3A 4GKJH 4DV2B 1N34B 4MV9A 1TVKB 1HNXH 3JAWB 5EYPA 4DV3H 3HKDB 5JJEB 4BWSC 1M93A 4FM0A 4DV4H 4O2BA 4FFBA 2GV9A 4B3TB 1SQFA 5JJNB 4FFBB 1TA8A 3W5OA 3N44B 1HNXB 4IHJB 2RQ6A 2YI9A 5LYJB 1YEWA 4LFCB 4DR6H 4LF8B 4CS4A 3F8NA 1ZHSA 1L8DA 3JARB 3BPZA 4F6RB 4RAYA 2O03A 4LMYA 4F6RA 2ZNIA 5KMGA 2VWKA 4CH6A 1N32H 2Q0AA 3U10A 4O4IB 1I7FA 4FM9A 4JV5H 2JGUA 2OYQA 3JAKB 1I94H 4FLUA 3K3VA 2YCHA 5ITZA 4NXNH 2Q7HA 2IM9A 3N2GB 3EYYA 4YJ2B 2F66C 4X65B 3TY9A 2Q2UA 2CAZC 4B3TH 5FNVA 4X66H 1S03G 3HKBB 4NVPA 1XMQB 5LMUH 4NXMH 4DR7H 4CS2A 1CKOA 1Q43A 3K5NA 1RSOA 4O4HA 4YJ3A 1IBLH 5J2TA 3SJCC 1VF7A 2VWJA 3BA8A 4FLYA 1M0TA 4TV9B 4TQFA 2PUSA 3BABA 1O9GA 1JJOA 3RGBA 3OTFA 3N41B 4GKJB 5FD5A 5A2QW 5LOVB 3UQ8A 4AQYB 1XHZA 4I4TA 2BTQB 2HVSA 3SR2C 4I4TB 2ZINA 4FLTA 4R7RA 4I9QA 2WDTA 4PHZA 2UU9H 4KHPH 4JI5B 1FKAH 3FFQA 3QG5A 2ZIMA 4DUZB 4ZHQA 3K58A 4DR1H 5IJ9A 2UUAB 4DV6B 1XNQB 4B3RB 4RZQA 4DR2B 4DK0A 5BMVA 2VPSA 4LF4H 3WB1A 5K1PA 3BRCA 4X64H 2E3CA 3RYFA 1J5EH 1KU9A 2CW8A 4MTEA 4K0KH 3JARA 4GLXA 4O4HB 3U11A 1X9NA 2BTQA 5KHHA 1XNRB 5DISC 1GYFA 4EEQA 5EZYB 3SGIA 1JFFB 1Z5WA 5JQGB 5KHIA 2P22C 3GB8B 3TY5A 1XDNA 4KHPB 1KMIZ 3E22B 2F4VH 5JVDB 5JH7B 4EQ5A 4DR5B 1WH2A 4X65H 2UXBB 3RYCB 1Z2NX 4HNAA 3T1HH 3ZS8C 4MV7A 5LP6A 5IJ9B 4YY3H 4PZ7A 4PDBA 3QWUA 1HR0H 1TUBA 3RYFB 2HHHB 4ZOLB 5CA1B 4KL1A 1CKNB 3RIZA 1X4TA 2W57A 1FFXA 1SKVA 1SYXB 2PGGA 4O4LA 2PYJA 3IAYA 4B3SH 4X66B 4M7EA 5LOVA 2UUCH 3JATA 4RB0A 1M4UA 1Z5VA 3HKCB 4IIJB 5CB4A 4X62H 4LNUB 4UCRA 4I50B 3NBYB 2E5LB 4TUYA 5EZYA 4LF5H 3UT5B 3THOA 5IWAH 5EOYA 5FPRA 1N32B 4O4IA 5C8YA 1BGWA 4X1KA 3OTOB 4APMA 4GKKH 1HNWB 4J0MA 3MWMA 1HNZB 1FJGB 4YHHB 5IT9W 2HHHH 4X20A 4PZ6A 3KAJA 1TGOA 4FM1A 1XI1A 2UUAH 3VQYA 2FE3A 4O4JB 2HIXA 2Q7EA 4PZ8A 5GONA 2OWOA 4X1IA 4ZOLA 5CA1A 4DV7H 1A0IA 4DV1H 4JI8B 2VQFB 2F1MA 4JI1B 1XK5A 4U3JB 3VQWA 3M7MX 4K8XA 4O2AB 4LF7H 2HIVA 2HEPA 4O2AA 4ZI7A 3N2KA 1QHTA 2F95B 1XMOB 4FLZA 4DV2H 5JH7A 1S68A 5IYZB 3K59A 4WBNB 1DGSA 2P5OA 1JMKC 2QM4A 4CH4A 2HGSA 3WB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AQY B;  2UXD B;  1FVI A;  4B3M B;  4JI2 B;  2HVS A;  3BA9 A;  3T1H B;  2HVR A;  4LFA B;  4JI5 B;  4JI4 B;  4DV7 B;  2UUB B;  1IBK B;  4B3S B;  4DUZ B;  1ZAU A;  4UCV A;  4DV6 B;  2UUA B;  1XNQ B;  4JV5 B;  4B3R B;  4DR2 B;  2HVQ A;  1I94 B;  4LH7 A;  2VQE B;  4LF9 B;  4LH6 A;  3JSN A;  3BAA A;  3VNN A;  3GDE A;  4X64 B;  5LMN B;  4GLX A;  1CKM A;  1X9N A;  3RR5 A;  2VUG A;  1HR0 B;  3S24 A;  4CC6 A;  4LF4 B;  4DR3 B;  1XNR B;  5DIS C;  5D1O B;  4DR1 B;  4UCO A;  4EEQ A;  4UFZ A;  3SGI A;  4X62 B;  3GJX B;  4NXM B;  5LMU B;  4DR7 B;  3GB8 B;  4CC5 A;  4JI6 B;  4KHP B;  1XDN A;  3TY5 A;  3RTX A;  3W1G A;  4EQ5 A;  4DR5 B;  2UXB B;  2UUC B;  4NXN B;  4DV5 B;  1P8L A;  4JI3 B;  3W1B A;  4UCT A;  4EFE A;  1J5E B;  1N33 B;  2CFM A;  3T1Y B;  1N36 B;  1VS0 A;  4PZ7 A;  3QWU A;  3NC0 B;  4LF6 B;  2Q2T A;  2ZM6 B;  4TOI A;  2HHH B;  4DV2 B;  3L2P A;  1CKN B;  1IBL B;  1N34 B;  4GKK B;  4JI0 B;  4X66 B;  4LF7 B;  5IWA B;  4B3T B;  4UCR A;  3NBY B;  3PN1 A;  4DV3 B;  2E5L B;  1TA8 A;  5FPO A;  2F4V B;  3W5O A;  1HNX B;  4DR4 B;  4JYA B;  5D1O A;  4UCU A;  4DV4 B;  5FPR A;  4LFC B;  4LF8 B;  1N32 B;  1P16 A;  3TY8 A;  1B04 A;  1IBM B;  1CKN A;  3OTO B;  4LFB B;  4DV0 B;  1HNW B;  4OX9 B;  1HNZ B;  1FJG B;  4YHH B;  3KYH C;  4DRF A;  4DR6 B;  4PZ6 A;  3JSL A;  4EFB A;  4LF5 B;  4PZ8 A;  2HIX A;  4E6N A;  5D1P A;  2OWO A;  1A0I A;  2UXC B;  1V9P A;  4JI8 B;  2VQF B;  4JI1 B;  3TY9 A;  4X65 B;  2Q2U A;  1XK5 A;  3NBZ B;  5BR8 B;  1XMQ B;  2UU9 B;  4DV1 B;  1CKO A;  2HIV A;  1TAE A;  1XMO B;  4DUY B;  4JI7 B;  1S68 A;  3BA8 A;  1DGS A;  3BAB A;  4K0K B;  4UCS A;  4GKJ B;  4YY3 B;  3UQ8 A; 
#chains in the Genus database with same CATH topology
 1F4N A;  4J10 A;  2Y0S A;  3LDC A;  1GN4 A;  1EN5 A;  5BPH A;  4MVU A;  3RBZ A;  1SEI A;  1KC8 W;  4LFC H;  2QGN A;  3RAX A;  1XMQ O;  2P6J A;  4AI8 A;  5CMU A;  1A48 A;  5KT3 A;  3OT7 A;  1FXH A;  3TK1 A;  5KG4 A;  3DXR B;  1ZAU A;  3FB8 C;  4UCV A;  3I5D A;  3KXY T;  1WRV A;  2QK4 A;  3D36 C;  4LH7 A;  3SPH A;  3R5H A;  3RAQ A;  2OLS A;  4O3Q A;  3PW2 A;  3HOU G;  4RCN A;  5CB4 F;  5KA5 A;  2XHB A;  1EUC B;  3BAA A;  3CRQ A;  3VMM A;  3SE7 A;  3D3I A;  3HO8 A;  4ECT A;  3VQX A;  4OPA A;  3SI8 A;  1UJW B;  5KFM A;  5JUM A;  3QF7 A;  1IBK H;  2M7W A;  3JD0 A;  3C0F B;  1BSM A;  3CCQ V;  5KFD A;  4RNN A;  4L87 A;  2YEV B;  1TWF A;  4JI3 O;  2QKC A;  3SPC A;  1NTZ H;  3E8F A;  4LR3 A;  3ZMS A;  3ORR A;  4NXN B;  4MV1 A;  4DV5 B;  3IN5 A;  1WAZ A;  4PA3 A;  3T1Y B;  1AUV A;  4X89 A;  4JV5 O;  1EKV A;  2EX3 A;  5TIS Z;  4IIJ F;  4ZQI A;  3B09 A;  4O2B B;  4DUZ O;  1XL4 A;  1S9F A;  2W8L A;  3IJ4 A;  3R9R A;  1ZL8 B;  3TGU H;  1FAF A;  1I5Y A;  4ECW A;  3KAL A;  1JJ2 U;  4TUY F;  3IGA C;  1XMQ H;  1SQG A;  3CCV V;  1N36 O;  3G8D A;  2UXB H;  1P49 A;  5JVD A;  5JH7 F;  2X7R B;  5C93 A;  1K8A W;  2EIM C;  3L75 H;  3PN1 A;  1HWY A;  2NU6 B;  5KX5 A;  3WWJ A;  1Y74 A;  2QKA A;  3GTJ A;  4DV6 O;  2AU0 A;  1P16 A;  2IU3 A;  3HKB A;  2HKO A;  1IUR A;  3H3V H;  1KJQ A;  1CKN A;  1UC8 A;  1HW7 A;  2EIK B;  5KFH A;  3G6B A;  4UV9 A;  3E86 A;  5KFJ A;  3G6X A;  3E8H A;  4DRF A;  3T9A A;  2WLJ A;  3HOZ G;  3GTG A;  2W6J G;  2ZCE A;  1NTK H;  3SYQ A;  1Y4M A;  1JDE A;  5D1P A;  4DYL A;  4H0L B;  3UZB A;  4QWD A;  5BYA A;  4WCE V;  1BMF G;  1K5Q A;  5CN0 A;  3HKC A;  1IOW A;  5D8D A;  4B7E A;  2UU9 B;  2YSU B;  3NGD A;  3DTG A;  2J9G A;  3B4S A;  3SJA C;  1N34 H;  2JIZ G;  1K97 A;  5KFR A;  4CMF A;  2EIN B;  2X6C A;  1OBD A;  3W7S A;  2WLI B;  5GON B;  3HBL A;  5FNV F;  4JI7 H;  3OEE G;  4JI2 B;  3OGI B;  2ZT9 B;  3T1H B;  3KHG A;  3CMA V;  1EM1 A;  3K57 A;  2A7W A;  2AHZ A;  1MZB A;  2BQ3 A;  3JZI A;  1QVG U;  2Q68 A;  3E35 A;  3HKZ E;  3LQS A;  1AI4 A;  4C5C A;  1B6S A;  1R3J C;  1SCU B;  1N56 A;  3UT5 A;  4JXU A;  3KG2 A;  5KUM A;  1I1M A;  2AZ2 A;  5KG7 A;  2OH2 A;  3F7V C;  4MSW C;  2AQ4 A;  5K1X A;  5BXZ A;  5LMN B;  3OTO H;  2VUG A;  2DMX A;  4Q0Y A;  4IRD A;  3CYO A;  5C1P A;  4MVM A;  4PA4 A;  1Y6X A;  4ZHQ B;  5BPF A;  5LYJ F;  3T99 A;  3W1G A;  3JCZ A;  3LWB A;  4MV8 A;  1R3I C;  2RGR A;  4K35 A;  4BAY A;  3TW6 A;  3T9E A;  5A2Q N;  4GKJ O;  1B6R A;  1GN6 A;  3KHH A;  2ATL A;  5E1A C;  3AYH B;  4J9R A;  1K5S A;  3LNN A;  3JYC A;  3OUF A;  1CXZ B;  3OM3 B;  4LF6 B;  2DWE C;  3RGX A;  2YUA A;  5KKN B;  3AK3 A;  2YRX A;  3K5L A;  3DF7 A;  4EB6 B;  4DV1 O;  1JX9 A;  1I6U A;  3TQT A;  3CJH B;  3QFF A;  2XD4 A;  2KKW A;  3R5X A;  4QJF B;  1J5E O;  2HDK A;  3JCU Z;  2YEV A;  3JAM W;  2C2R A;  2Q69 A;  3H1L H;  1YJW V;  3G6Y A;  3BHP A;  4A3K G;  2WLN A;  4UUJ C;  3C90 A;  4FFM A;  2Z3Y A;  4J80 A;  4KXR A;  1M90 W;  3CXH F;  4JYA B;  3M8A A;  2YZN A;  2JJ1 G;  4MVO A;  2NVY A;  1JCH A;  3HKE A;  4CHI A;  2FB9 A;  3OTO O;  2KSW A;  2EJ7 A;  4CZZ A;  2A06 H;  4JTC B;  5JVL A;  1NVP B;  1VKZ A;  3S3X A;  3DTF A;  4CH5 A;  4O7W A;  1FS0 G;  3GVM A;  5D5Q A;  4DR6 B;  4MV6 A;  2FK3 A;  5DQH A;  4ZI7 F;  2QEX V;  4LF5 B;  1G1X B;  4E6N A;  3AG4 C;  4WFG A;  4O7Y A;  4BR6 A;  2DZD A;  5IE9 A;  4DV5 H;  4B3R O;  1NI8 A;  3MWD A;  2HFE C;  3T9B A;  4PEL A;  4B3S O;  1OJH A;  2W9B B;  1PKX A;  4HYK A;  3RV3 A;  2QWQ B;  1I2L A;  2CQY A;  1UC9 A;  4IAJ A;  3F7Y C;  2LW7 A;  5LMN H;  4HN2 A;  3M99 B;  4ED0 A;  2X6A A;  3K9S A;  3JZF A;  4UCS A;  2IBK A;  3CCU V;  4CKC A;  3U55 A;  2HR3 A;  2EIL C;  1IX9 A;  2YWV A;  5LXT F;  2JA5 G;  5L9X A;  4D6T H;  4YAK B;  4BW9 A;  3ABL B;  3ZJZ A;  1H2M A;  3FB7 C;  3ABK B;  4MVR A;  1QR9 A;  1RM1 C;  2N04 A;  2EBO A;  1I94 B;  4A3F G;  5KT2 A;  2COG A;  3RYC A;  4FFR A;  1K83 A;  3UKM A;  3T9C A;  4CKB A;  4GCZ A;  1VBH A;  5KFP A;  2XND G;  3FB5 C;  2Q0O C;  2X6B A;  2A1H A;  3OUU A;  3S24 A;  2V59 A;  3QTC A;  4CC6 A;  5LGU A;  4LF4 B;  4RWU A;  1FXK C;  1QVF U;  5F9N A;  2DAA A;  3PZP A;  5B3S C;  3BY6 A;  3RGZ A;  2DYS C;  4QW8 A;  3BVO A;  3CXC U;  1KYO F;  4LF6 O;  5LMN O;  4BBS G;  1G2W A;  3CSW A;  1SQQ H;  2M6Y A;  4FJC C;  3TEK A;  4GX0 A;  3EPG A;  2EIJ C;  4UVC A;  4O82 A;  2R92 A;  3PVX A;  4EGQ A;  5LMU O;  2X0S A;  4HNV A;  5FR9 A;  3OMA B;  2ZM6 B;  1IBL O;  5KG0 A;  2LFS A;  2Q4P A;  2ZQM A;  4J42 A;  3OHB A;  1HNX H;  1D5N A;  5EYP A;  4L1K A;  3OUZ A;  4XYL B;  1M93 A;  1R6T A;  4DV4 H;  2I8C A;  3H1K H;  1DAA A;  2BSK A;  2QA4 V;  2ZE5 A;  5LYJ B;  3JD4 A;  3RB0 A;  5HFM A;  3WU2 Z;  2Q7D A;  3F8N A;  1XRE A;  3ZMZ A;  3BPZ A;  4FS2 A;  3VOU A;  5DG9 A;  5EZY F;  3G4S V;  4YIO A;  1C30 A;  1B33 N;  2VWK A;  1RPR A;  4FE2 A;  5KX5 F;  4Q20 A;  3U10 A;  5E79 Z;  5KFN A;  4J9K A;  5LGN A;  4K0K O;  1W93 A;  4O86 A;  4I0X B;  4QE9 A;  3JD3 A;  3N2G B;  3EYY A;  4BY1 G;  2F66 C;  2W8K A;  1KTA A;  4OX9 O;  1VQ7 V;  2EIJ B;  5FNV A;  5IY5 B;  5I47 A;  4A93 G;  3PJS K;  4MS2 A;  3BCC H;  2GBO A;  2VWJ A;  5F9L A;  4TT3 G;  2VQD A;  1O9G A;  2Y0I A;  1HNX O;  4NZO A;  3N41 B;  4YY3 O;  4GKJ B;  4E4T A;  2KG7 B;  2YC0 A;  3UQ8 A;  2W70 A;  4I4T A;  4WFH A;  1US6 A;  1KJ9 A;  2GQS A;  3SR2 C;  4PDR A;  2WDT A;  5KG3 A;  1S5H C;  3QZ7 A;  4JI5 B;  3CEB A;  3KCY A;  1FKA H;  1VF5 B;  1OCZ C;  2X0L A;  3FFQ A;  3QG5 A;  1IBM O;  1P7G A;  2ZIM A;  2Y69 C;  4ZHQ A;  4DR1 H;  5IJ9 A;  2UUA B;  1XNQ B;  5BZB A;  5KA6 A;  2CUG A;  4MTO A;  3SPG A;  4YR3 A;  4J9L A;  1G4Y B;  4WHX A;  3WB1 A;  3BRC A;  2WAQ A;  2HHF A;  1QU7 A;  1QBZ A;  2HJF C;  5DG7 A;  1KU9 A;  4NTW A;  3JZ6 A;  5K2M A;  5DMX A;  2GSM B;  2NN4 A;  1J5E H;  3T4Z A;  1I94 O;  4CMD A;  3JAR A;  2JA5 A;  1SES A;  4O4H B;  3U11 A;  2PBZ A;  2CE4 A;  3DAA A;  5L1I A;  5KHH A;  1XNR B;  5DIS C;  3RB6 A;  2JA6 G;  5EZY B;  2DAB A;  1Z5W A;  1YTF D;  5KHI A;  4QWB A;  1EZV H;  2P06 A;  3TY5 A;  1XDN A;  3LSQ A;  1KMI Z;  4KHP B;  3AG3 B;  1WH2 A;  5DGI A;  3RYC B;  1M57 C;  2UUC O;  1Z2N X;  1K7D A;  4MTF A;  5IP9 G;  2FKL A;  1XOU A;  2MK3 A;  1OBG A;  4FU0 A;  4NZN A;  5HNE A;  2FML A;  3R23 A;  2J6T A;  2NNU A;  1OCR B;  2L35 A;  3UYY A;  4KL1 A;  4J7K A;  2XTA A;  3T4D A;  1I50 A;  3ZMU A;  5DQI A;  2C2D A;  2PYJ A;  1IXB A;  3ABU A;  2XGQ A;  1WB7 A;  2FK1 A;  3JAT A;  1NQT A;  1PD3 A;  1QR8 A;  1Y76 B;  4IIJ B;  2ODT X;  2QB5 A;  1BGY H;  4JPR A;  1I1K A;  2E5L B;  1VBG A;  4EEY A;  1UPG A;  4LF5 H;  1ARO P;  4UUG A;  3THO A;  2R86 A;  4UV8 A;  5EOY A;  1AP5 A;  4TM5 A;  2H8P C;  1MNG A;  1DV1 A;  3EVK A;  1KC7 A;  1AJQ A;  1W0K G;  3X2Q B;  3MFH A;  4GKK H;  4F4L A;  2ZGI A;  1TWC A;  4O7N A;  3PW5 A;  2NR5 A;  4O81 A;  2R93 A;  5DED A;  2HHH H;  4R7C A;  4PV1 B;  4DAA A;  3KAJ A;  1VEW A;  2HJD A;  3AEI A;  4FM1 A;  2UUA H;  3HB3 B;  4O4J B;  2HIX A;  1CE8 A;  4PZ8 A;  4ED2 A;  2EJR A;  1T3N A;  1RJQ A;  3DXR A;  1YCI A;  1YTF B;  3K5I A;  1QLE C;  5J2T F;  2FTK A;  2COJ A;  4JI8 B;  2F1M A;  2W6N A;  4Q8E A;  3LP8 A;  1VQK V;  4O2A B;  3C3S A;  1YJN V;  2HEP A;  3ZCC A;  3ORQ A;  2JEG A;  4NB5 A;  1QHT A;  2FP4 B;  4FLZ A;  2YZM A;  5IYD G;  1K1Q A;  2UXD O;  3N8D A;  4DR4 O;  3W7X A;  4UVB A;  1AJP A;  4CH4 A;  2HGS A;  1NR7 A;  2UXD B;  1FVI A;  4B3M B;  3J7A K;  2XUM A;  2Z0A A;  3CSX A;  3ZX6 A;  4YR0 A;  3CJH A;  5B1A C;  5KS8 A;  2R72 A;  4ETS A;  4ECU A;  3DC5 A;  4GUN A;  4R50 A;  1MG1 A;  3CRC A;  5C5J A;  1JQ0 A;  4DV2 O;  4X88 A;  3SYP A;  5KFG A;  1Z2P X;  5L3G A;  5BMV B;  4JI4 H;  1NKD A;  2BE3 A;  3FAV A;  4J11 A;  4LP8 A;  2ZXW B;  5LXT A;  5D5P A;  2ITC C;  5C4X G;  4J7J A;  3KTM A;  1R1B A;  4I50 F;  3CCR V;  4J9Y B;  5HBR B;  1S0V A;  1YVW A;  1HR0 B;  2FL4 A;  3HOW G;  5IJ0 A;  2FLP A;  3OAA G;  2UXC H;  1BCC H;  1W59 A;  4KFM A;  4DR7 B;  4XDK A;  5KT4 A;  5ITZ B;  5CAE B;  2XAG A;  2R70 A;  1AJN A;  4YAJ B;  2W9C A;  5KHJ A;  3MWE A;  2UVU A;  2RCV A;  1I3Q A;  4P9O A;  1JPX A;  4JI3 B;  2XIG A;  1DTO A;  2A0L A;  1J5E B;  4HBN A;  5IYC O;  1N33 B;  5LYJ A;  5JCO A;  4DR2 O;  1CQI B;  5LA6 B;  4RB1 A;  4U7N A;  4TOI A;  1IBK O;  1Y67 A;  2QJ1 A;  4LF6 H;  4O2A F;  3J80 N;  4GKK B;  1JX4 A;  3GWK C;  4EYH B;  4FLW A;  5C3E G;  2W71 A;  4O4I F;  4PDV A;  1WNS A;  3ZRV A;  4XX0 B;  3FMA A;  4FBT A;  1H2G A;  3RVY A;  4O7Z A;  2ZXW C;  2QR4 A;  2FYU H;  1IBM B;  4FFK A;  4FK5 C;  3H40 A;  5L3B A;  4DV0 B;  5GON F;  2W6I G;  4LFA O;  4QSH A;  1Q7Y W;  4O7S A;  3KYH C;  2QM7 A;  4O84 A;  3OGC C;  1GGO A;  4MAM A;  4EFB A;  3WWI A;  2MW2 B;  1Q6I A;  1FFX B;  2E2H A;  4NR1 A;  1QQC A;  4G3I A;  3N6R A;  4FVM A;  2FJZ A;  4AHC A;  5FLX W;  4MW3 A;  5BR8 B;  3CE2 A;  3RYH B;  2PI5 A;  4DRX B;  5LP6 B;  3CWB H;  1CQJ B;  2C2A A;  4O83 A;  4AQY H;  1BHB A;  3CC2 V;  1KB9 F;  2R82 A;  2Q5Z A;  1PK8 A;  4MW8 A;  2B5U A;  3U0G A;  3MD0 A;  4X1K B;  4N23 A;  3ASO B;  3U9S A;  3HKD A;  4RB3 C;  4GT1 A;  3CCM V;  4BIU A;  2V7Q G;  4Z1M G;  3CCL V;  4FFL A;  1R9T A;  2NU8 B;  3OEH G;  3UFX B;  2GTA A;  2AGQ A;  5KFX A;  1JA8 A;  2JA8 G;  3GTQ A;  1K34 A;  4DV7 B;  4PD4 F;  5GTH Z;  2DWD C;  3JD2 A;  1T5E A;  3A0B Z;  3KCX A;  4DL7 A;  3APQ A;  2CZG A;  3N6X A;  3MFI A;  2Y4U A;  4LFA H;  4YHH H;  1HNZ H;  4LSX A;  4LF9 O;  2R7M A;  4A3E G;  5JQG A;  2QTO A;  3N42 B;  4QWE A;  2UVV A;  2D2C B;  3O65 A;  4RUC A;  3Q8R B;  2JA7 A;  4I55 B;  2K9P A;  5L3E A;  3K3W A;  4DR3 B;  4X20 B;  3GIP A;  3N40 P;  4EYI B;  1VQ8 V;  2ITD C;  2CTR A;  3GJX B;  1TUB B;  5B1O A;  2DYR B;  1G8M A;  4H33 A;  3HKE B;  4DV5 O;  1BHA A;  4YJ3 B;  2P67 A;  4FFO A;  3LUT B;  1FKA O;  3TET A;  2YRW A;  2MCT A;  3HXL A;  1KT8 A;  2OCC C;  5LL6 b;  2VQE H;  1ZUQ A;  4JV0 A;  2YS8 A;  4WBN A;  3J80 W;  5B1B C;  4F4W A;  3CCS V;  4DV7 O;  4FLX A;  2QE7 G;  1ULZ A;  4IZO A;  4LF4 O;  3I4M G;  2YZL A;  3EPI A;  5E25 A;  4JI0 B;  4X64 O;  5C8Y F;  4LF7 B;  5JWP A;  4R8U B;  4I55 F;  4Q8F A;  3C3T A;  4ZIB A;  3NXS A;  2D3O W;  4EGJ A;  4BW5 A;  2OTL V;  3NR7 A;  4XBF A;  1H2S B;  4JI6 O;  4MA0 A;  2ZIO A;  1QLN A;  5EYP B;  3AG2 C;  2EIY A;  3V6H A;  3ML0 A;  1OCO B;  4AIL C;  4RU9 A;  1XIL A;  4J9Z B;  4MVS A;  3ZRX A;  5J2U F;  4IWX A;  1SER A;  2Y69 B;  2YID A;  2Z5U A;  1QCE A;  2PF4 E;  1Y1W G;  4JI2 O;  5KG6 A;  1NU1 H;  1FXK A;  4C5A A;  1KBH A;  1BZK A;  3IC7 A;  3TCU A;  4PI2 A;  2NLJ C;  1ROP A;  1HP8 A;  3PW0 A;  2ZNJ A;  5BWT A;  3HOX G;  3BQ2 A;  3ABM C;  1N48 A;  4PBC A;  5KT5 A;  4GYC B;  2RF4 A;  1OHH G;  2BOB C;  2WSS G;  3CX5 F;  4ZKI A;  3R5F A;  1E4G T;  4DV1 B;  3RB3 A;  4JI2 H;  2DYR C;  1PM9 A;  2IJI A;  2ZM6 H;  4ED1 A;  3ZRW A;  2IA6 A;  2E5L O;  1N33 O;  1V54 C;  1MA1 A;  5L3C A;  1O9H A;  1JVM A;  1S0O A;  1R6K A;  2WA4 A;  3E8G A;  2WE6 A;  4A3G G;  2WLH A;  1WP8 A;  4QGP A;  5KMG B;  1JDB B;  3ASN B;  1MSD A;  4B3S B;  3MAQ A;  2W0X A;  2BR0 A;  4JV2 A;  4JV5 B;  5I5X A;  2IU0 A;  4C2M A;  3LML A;  1E4E A;  2FMA A;  1N0J A;  1K33 A;  3B40 A;  1Q82 W;  3DSQ A;  5F2V O;  5HFL A;  3CB2 A;  1MZE A;  1N36 H;  4X1I B;  4BIZ A;  4CS3 A;  3CC4 V;  5CBF A;  3T9D A;  4TV8 B;  1EKF A;  4CC5 A;  4TVI A;  3OD4 A;  3RTX A;  2LFR A;  5H9C A;  2FK2 A;  2LJ2 A;  5LP6 C;  3OSN A;  3JRW A;  2CFM A;  3ZN0 A;  4JZ2 A;  5EBM C;  3JAL B;  3ASN C;  4QWC A;  1JR9 A;  1VQ9 V;  2Q73 A;  4DV2 B;  2PN1 A;  5JQW A;  2ASL A;  2QWP B;  3OE7 G;  4IR1 A;  4DV3 H;  4YJ2 F;  4R8C A;  3TJT A;  2ILM A;  4O2B A;  4FFB A;  4B3T B;  2XCA A;  5KUK A;  1B06 A;  5EBW C;  1KUT A;  4IHJ B;  1C3O A;  1M6V A;  4PWQ A;  2LGQ A;  3STZ C;  4LFC B;  3CD6 V;  4DR6 H;  3GTK A;  3KRE A;  1GSA A;  4Q45 A;  4CS4 A;  3DTU B;  3TIG A;  3CPW U;  3I12 A;  1RM1 B;  3K04 A;  3PW7 A;  2O03 A;  4F6R A;  1VAJ A;  5L3D A;  5KMG A;  4CH6 A;  4DV4 O;  4R8U A;  3GIK A;  3RFC A;  1I7F A;  2ZDG A;  2HLD G;  4FM9 A;  4JV5 H;  2OYQ A;  3E2E A;  4A3B G;  2XAJ A;  3T1C A;  5DQG A;  1HNZ O;  2Q2U A;  2CTP A;  1NR1 A;  5EWG A;  1YSC A;  2L6L A;  1S03 G;  5LMU H;  2R92 G;  2UU9 O;  1VQN V;  1CKO A;  4O7R A;  1RSO A;  4O4H A;  2X5R A;  4GLW A;  3OHA A;  3SJC C;  1GMG A;  1PNL A;  4TV9 B;  3BAB A;  3RGB A;  3FKS G;  1RYS A;  2ZD9 A;  1EHI A;  4MVQ A;  1XHZ A;  3H4B A;  3WG7 C;  3H01 A;  4B7K A;  2CK3 G;  3FD9 A;  4I9Q A;  4NXM O;  1I2K A;  2XOK G;  5DAA A;  2JEU A;  4WFB V;  2F23 A;  3G8C A;  5K3W A;  1VQM V;  2W0F C;  4DV6 B;  1SQV H;  1W0J G;  4DK0 A;  2ADQ B;  2OCH A;  2ETN A;  5LHG A;  2E3C A;  1B3Q A;  5B1A B;  5KFC A;  4JYB A;  2G38 A;  1H8H G;  1OZ0 A;  5LA6 F;  5IP7 G;  4GKK O;  4Q4C A;  2C35 B;  5KFB A;  3MR6 A;  2R8J A;  3SGI A;  2VPQ A;  4OGQ B;  4PJ0 Z;  5IYZ F;  2F4V H;  2DN9 A;  3E22 B;  4LBE C;  4HR7 A;  3GIJ A;  1K9M W;  3GTM A;  3HB9 A;  4X65 H;  1AVM A;  3T1H H;  3ZS8 C;  4FGR A;  4JAS A;  5LP6 A;  3V6J A;  2XT9 A;  3QO5 A;  2W9B A;  4PZ7 A;  1DF4 A;  2FB5 A;  2YXH A;  2B9Z A;  3H0G G;  2IW5 A;  4UXN A;  1PL4 A;  3GIQ A;  2F43 G;  1SYX B;  2M05 A;  3IAY A;  1AR5 A;  2A3Q A;  3ASO C;  1W96 A;  1RJR A;  1Z2G A;  4BBR G;  4IRC A;  1WSC A;  2E74 B;  4M7E A;  2DIK A;  4O4H F;  5LOV A;  2QYZ A;  4O3P A;  3HKC B;  4HQ6 A;  3X2Q C;  3JRX A;  4I50 B;  3NBY B;  3RB4 A;  4U7C A;  1E1Q G;  2QF7 A;  3I55 V;  3P3N A;  5IWA H;  4YXW G;  3TIN A;  4O4I A;  5C8Y A;  1HNW O;  1KP2 A;  1AI7 A;  3H9V A;  3MDS A;  2E2I A;  1L0L H;  1N8R W;  3MWM A;  1HNZ B;  1FJG B;  4YHH B;  5IT9 W;  5B3S B;  4DW1 A;  2IJK A;  2FE3 A;  2Q7E A;  4HAM A;  2OWO A;  4FFN A;  5CA1 A;  1Y1V G;  4DV7 H;  4DV1 H;  1WCM G;  4Z2W A;  2VQF B;  2ZDQ A;  2Q67 A;  1XMO O;  1XK5 A;  4K6N A;  1IVS A;  4IL6 Z;  4U3J B;  1IDS A;  1BT8 A;  3N2K A;  3AG3 C;  2HHH O;  1XMO B;  1A3G A;  4I4T F;  5JH7 A;  1KBL A;  4DV2 H;  2IH3 C;  3K59 A;  2CTQ A;  2XAS A;  3OR7 C;  1DGS A;  1ZQ7 A;  2V4Q A;  5IYB O;  2VA2 A;  3T5J A;  1JMK C;  2QM4 A;  4RUA A;  1Q90 D;  2C2E A;  1JXL A;  5CBG A;  1XMO H;  4ZHQ F;  1PP9 H;  2EIL B;  2W7P A;  2JA7 G;  3ZMV A;  5KX5 B;  1Y14 B;  3STL C;  1P7B A;  2QKS A;  2V4D A;  4JF3 A;  2IJJ A;  1UNN C;  3RBE A;  3E83 A;  1V55 C;  3U9T A;  2UVW A;  2IMW P;  1LUV A;  4O4L F;  3HR0 A;  3JAS A;  2ARH A;  2JEX A;  1OCZ B;  5CE8 A;  5LOV F;  4Q43 A;  3L4J A;  4EG0 A;  1K4C C;  2AGA A;  2Q7G A;  3J7A U;  2C28 A;  5IYZ A;  4QJF A;  1YIJ V;  3VBB A;  2FPP B;  4JAV A;  5CA0 A;  3B77 A;  1ZTE A;  1SRY A;  5JCO C;  2CKZ B;  3K0G A;  4LF8 H;  4DR1 B;  3LDE A;  3K5M A;  5LMU B;  4JI5 H;  1WPX A;  4BWA A;  3CP1 A;  1SET A;  4I0X A;  1Q3E A;  5H6Q A;  4A3D G;  1FJG H;  3IC9 A;  4YIP A;  4O4J F;  4EFE A;  3K5O A;  3RFR A;  1M56 B;  5EBL C;  4IHJ A;  1N36 B;  1D5A A;  1FFT B;  1WPB A;  1DV2 A;  1EZ1 A;  3RUP A;  4ICG A;  5CB4 B;  3ZRW B;  2HGX A;  5IYB G;  1BS3 A;  4UB8 Z;  3HKZ A;  1HR0 O;  4G2K A;  2AXT Z;  4H37 A;  1S77 D;  4Y8V B;  1RK5 A;  3T1Y O;  2YI8 A;  2A79 B;  1NTM H;  2RDI A;  4ZBM A;  1WJZ A;  1LUW A;  4GZR B;  5FPO A;  2F4V B;  4TQR A;  5JQG F;  4UCU A;  4RO2 A;  4X62 O;  4MV4 A;  2WLL A;  4X1Y A;  1N0N A;  3LSU A;  4RZR A;  5KFK A;  4RUE A;  3AX6 A;  4H44 B;  5JJJ B;  2HHF B;  3T2M A;  1OCC B;  1SS3 A;  4B3M O;  2UXC O;  2R6F A;  4DL5 A;  5KG2 A;  4B3R H;  4YJ3 F;  1XL6 A;  5IYC G;  3IG0 A;  1PL0 A;  2UXC B;  4UVA A;  4I50 A;  2JS3 A;  1FJG O;  1S0M A;  4JI7 O;  4QE7 A;  1VQO V;  5DGB A;  3QVN A;  1R3L C;  1O75 A;  2VQF H;  1LR1 A;  3N27 A;  5KFU A;  4I55 A;  3SDL A;  4H13 B;  5CA0 B;  4JI7 B;  4DUY B;  4B3M H;  1PNK A;  1VIB A;  3W7W A;  2BQU A;  3N2G A;  1IYE A;  1BNC A;  2DYS B;  1EN4 A;  4ECR A;  2KSD A;  3R65 A;  4YY3 B;  3JAK A;  3T5K A;  2UXB O;  1EKP A;  3LSS A;  4EBE A;  1MMM A;  3GTP A;  5KFQ A;  3RW0 A;  2EIN C;  1RFY A;  1VF6 C;  4LSA A;  4IIJ A;  4TV8 F;  1KKD A;  1HDJ A;  3N2K B;  3Q8Q B;  2Z04 A;  5J2T B;  2HVQ A;  3G6V A;  5CR5 A;  4ED8 A;  2V9W A;  2VQE B;  1Q81 W;  5BWR A;  3ZRS A;  2UXX A;  2YYA A;  5CBH A;  3GID A;  3FYI B;  4J9P A;  1CKM A;  4NLG A;  4RNO A;  2O57 A;  1TVK A;  2EZP A;  1H2K A;  5LP6 F;  4YBZ B;  1M5I A;  1Q5O A;  4B08 A;  1XNR O;  1Q86 W;  2FPG B;  4JI8 H;  5EC1 C;  1S76 D;  2R9R B;  2YL2 A;  4NXM B;  2YIB D;  4MTD A;  2WTF A;  1LNQ A;  3A2F A;  2BOC C;  1H38 A;  2QWR B;  2EIK C;  2RN9 A;  3W1B A;  4O7V A;  5HV6 A;  4W4L A;  2Q2T A;  1WCM A;  2CGO A;  5L1K A;  2WB1 A;  4FM2 A;  2LGW A;  3ZN1 A;  4DR2 H;  1S5L Z;  1GM7 A;  4WFE A;  3ZED A;  5BR8 H;  2E5L H;  3JAM N;  3H1I H;  2V58 A;  1GO3 F;  1SFO A;  3DGE A;  2RNB A;  1L0N H;  1ENV A;  4D7T A;  1ZX3 A;  2HVK C;  2XAQ A;  3A0H Z;  4M0J A;  2ABJ A;  4DR4 B;  5D1O A;  4X8A A;  1SA0 B;  3RF2 A;  2E75 B;  3ABT A;  1EZJ A;  4P30 A;  5J9P C;  4ZOL F;  1IOV A;  4DV0 O;  1GN2 A;  2QWO B;  1WA8 B;  3VQV A;  4OX9 B;  3UCS C;  1SQX H;  2AW9 A;  4JI8 O;  3K3P A;  5LL6 Y;  3CRA A;  3H4D A;  3B8M A;  5LXT B;  5I5W A;  4YR2 A;  4F4Z A;  4A3I G;  1U97 A;  5I5U A;  3Q1K A;  4KUM A;  4FLV A;  4FBU A;  2JS5 A;  3UO3 A;  4B3T O;  2GLT A;  4TUY B;  1G6U A;  2KB1 A;  3K5H A;  3H0G A;  1V9P A;  1GH6 A;  3SJB C;  3GV5 B;  3OR6 C;  4GC6 A;  2XAF A;  2WLL B;  4X1Y B;  4BIO A;  5LHH A;  3ZHS A;  3BG5 A;  4TWK A;  1TAE A;  2GUZ B;  2K1E A;  2I87 A;  4ME6 A;  4DR3 H;  4LC1 A;  2YXL A;  2FLL A;  2ADP A;  2J6S A;  4K0K B;  2WLK A;  3QQM A;  1L2Z A;  1PV0 A;  5H5N A;  2R8H A;  2R84 A;  2XCL A;  5I5Y A;  3CHX A;  4JI3 H;  2OIG A;  2BSK B;  4IWY A;  2HVR A;  4DXW A;  3PR4 A;  3PW4 A;  2GTS A;  2R9A A;  1U96 A;  3J81 W;  2IJH A;  1OCC C;  3RV4 A;  1B6Q A;  5LHI A;  1M56 C;  4RQF A;  2ZM6 O;  2PTM A;  4DW0 A;  3ZHV A;  1NZ6 A;  4MT8 A;  4GX1 A;  2DPJ A;  1Y66 A;  2B63 G;  4ECZ A;  4LF9 B;  3FKI A;  1KUQ A;  2CH7 A;  2CNU A;  1EN6 A;  1F7Y A;  2GPW A;  2ASJ A;  5DGA A;  5EC2 C;  1XEQ A;  2R7K A;  4ED6 A;  3H20 A;  3RR5 A;  3UZO A;  1E4F T;  3JAW A;  4DR4 H;  3K79 A;  4Q6G A;  5KT7 A;  4JI1 H;  3WWH A;  4UFZ A;  2YIC A;  5FNV B;  2PZS A;  1K73 W;  2Y4R A;  4DV6 H;  4GX5 A;  1BL8 A;  1SQP H;  3GTL A;  2YIB A;  4JI6 B;  3T1H O;  5KFL A;  1DIK A;  4RNM A;  1WA8 A;  3WNZ A;  4RAZ A;  2R8K A;  2RMK B;  4NXN O;  1E4E B;  3VPD A;  1OCO C;  3RYH A;  1WN7 A;  1S97 A;  2KQX A;  4O3R A;  3K03 A;  1ZSP A;  3ABL C;  3T54 A;  3NC0 B;  4HZ3 A;  3WO1 A;  3H1H H;  5H2F Z;  3K0D A;  1N34 B;  4IRK A;  1TVK B;  4AYB A;  4DL3 A;  2YW2 A;  3HKD B;  4BWS C;  2AGP A;  1OWT A;  5I5V A;  4EBC A;  5FJ8 G;  4FM0 A;  1THZ A;  2W6Q A;  2GV9 A;  2COI A;  1SQF A;  2WPD G;  5JJN B;  1RK6 A;  4JAA A;  1YJ9 V;  3N44 B;  1HNX B;  1I08 A;  2YI9 A;  1YEW A;  1SZX A;  1BXR A;  3EHB B;  4JAU A;  1ZHS A;  2EIM B;  3JAR B;  2P7T C;  3JD1 A;  4RAY A;  5A9G A;  1V55 B;  4YP3 A;  4BY7 G;  5KAF Z;  2DQ0 A;  2R7N A;  5FL7 G;  4O4I B;  3CCE V;  3MJF A;  1WR2 A;  4DL2 A;  2Q9L A;  3JAK B;  5EWE A;  1I94 H;  4FLU A;  3SYC A;  3K3V A;  2YCH A;  3CC7 V;  2Q7H A;  4K3A A;  3SPJ A;  1EFR G;  2QWN B;  4I9W A;  4YJ2 B;  4X65 B;  3TY9 A;  4M9U A;  2EZO A;  2ZE6 A;  4B3T H;  3L9D A;  1XMQ B;  4NVP A;  4DR7 H;  3AK1 A;  3M9O B;  4CS2 A;  4GC7 A;  3K5N A;  1IBL H;  4YJ3 A;  1S3J A;  2ZE7 A;  5J2T A;  4X65 O;  1N32 O;  1M1K W;  1EYZ A;  2BQR A;  5IYD O;  4TQF A;  2PUS A;  1JJO A;  2A9H A;  1KEC A;  5FD5 A;  5KFA A;  5A2Q W;  2P4K A;  2HG8 A;  4AQY B;  1OV9 A;  1R73 A;  1XBL A;  4WF9 V;  5B1N A;  2BTQ B;  2HVS A;  4DLK A;  4R7R A;  3G67 A;  4I4T B;  4YQW A;  2Y0P A;  4X9Q A;  4PHZ A;  2FKX A;  2PI4 A;  3M9M B;  4KHP H;  1YZB A;  3LNM B;  3W7T A;  4FMT A;  1P4R A;  2Y48 A;  1K3E A;  4MTG A;  2OTJ V;  4PDM A;  4B3R B;  4DR2 B;  4A3M G;  3LDD A;  4JYA O;  1VQ4 V;  2Q8V A;  2VPS A;  2JJ2 G;  5K1P A;  4YB8 B;  5IWA O;  4JTD B;  2JEF A;  4IT5 A;  3RYF A;  3MR3 A;  1I7N A;  5KFV A;  2N74 A;  2CW8 A;  4K0K H;  2WLM A;  1AIL A;  1SF9 A;  1X9N A;  2PMZ A;  1N34 O;  1Q6U A;  1AB3 A;  1K92 A;  4LWS A;  3OW2 U;  5JQG B;  3QNE A;  2ASD A;  4R6Z A;  2UXN A;  4PA9 A;  4ASU G;  4F50 A;  4EQ5 A;  4DR5 B;  3A0R A;  3MR2 A;  3AG1 B;  1KKC A;  4MV7 A;  4NZM A;  3QWU A;  4FFP A;  1TUB A;  5KFO A;  3BQ1 A;  2HHH B;  4IYH A;  5CA1 B;  3RIZ A;  1DF5 A;  1FFX A;  1SKV A;  4O4L A;  1ET0 A;  3QZ8 A;  4B3S H;  5KFZ A;  1M4U A;  1Z5V A;  3GII A;  5KFE A;  4PA6 A;  1S0N A;  2B1G A;  5CB4 A;  4NTY A;  4X62 H;  3S3W A;  2W6Z A;  3KZI Z;  1CPY A;  5BWW A;  4TUY A;  3D3Q A;  3UT5 B;  5CA0 F;  4HNT A;  5DN6 G;  5IDJ A;  2C00 A;  5JVD F;  2XGP A;  3D36 A;  4X1K A;  2HVJ C;  3OTO B;  4JI4 O;  4O7L A;  4APM A;  2V4R A;  3RBD A;  1HNW B;  3CME V;  1K1S A;  3OSP A;  3TXQ A;  4PZ6 A;  1TGO A;  4QIW E;  3KHR A;  4LF5 O;  5BYB A;  2W9C B;  3WG7 B;  3ZBH A;  4X1I A;  4ZOL A;  1M7J A;  1A0I A;  3V6K A;  4TV9 F;  3FB6 C;  4JI1 B;  1KEE A;  1TWG A;  3VPB A;  3VQW A;  4FIP C;  1RSO B;  4JI5 O;  4LF7 H;  2HIV A;  2YS7 A;  4O2A A;  4LCU C;  4ED3 A;  1S68 A;  5IYZ B;  1ORQ C;  1R3K C;  2IBZ H;  2I80 A;  2VA3 A;  5EWF A;  1MZF A;  2P5O A;  4QPK A;  1WB8 A;  3E8B A;  3WB2 A;  2BTO A;  4WD3 A;  3EFF K;  3GIM A;  4ECS A;  4U6P A;  4I7Z B;  3FDS A;  3K06 A;  1NT2 B;  2EUL A;  4A3C G;  3GV7 B;  2PVP A;  2W6P A;  4JI0 H;  5KFI A;  5KFS A;  2UXD H;  3GWO A;  2SCU B;  4LF8 O;  3M9N B;  2JDI G;  3HT5 A;  2ZR3 A;  3FAV B;  3ZHQ A;  3WB0 A;  1A0G A;  4A2A A;  2PYL A;  1X59 A;  4DL6 A;  3JSN A;  5T14 A;  2R8I A;  4PDL A;  5DGH A;  3VNN A;  3MR5 A;  3L71 H;  4X64 B;  4A2B A;  4ECX A;  4K8Z A;  1QLE B;  1MOF A;  5IJ0 B;  4DR5 H;  3LUL A;  2GQR A;  1K4D C;  3CRR A;  2RJZ A;  3VPC A;  1ZWI C;  2ATK C;  4TSF G;  2KG7 A;  4DUZ H;  5FLM G;  1N4C A;  4CE5 A;  4JZG A;  1N33 H;  3AG7 A;  2YXY A;  1SQB H;  3CRM A;  4EKW A;  1XQ8 A;  2ALZ A;  3B8N A;  3MHS C;  3ETD A;  2YU9 A;  2WYO A;  1P8L A;  2VQE O;  2ZJT A;  3GTO A;  1VS0 A;  3L70 H;  1IYD A;  1YIT V;  4I7H A;  4TV9 A;  2QSA A;  4MV3 A;  3L2P A;  1F4M A;  4LWS B;  2CNQ A;  2Y4T A;  1S5J A;  4UB6 Z;  5KFW A;  4TQS A;  2R7L A;  3PR5 B;  4A3J G;  2HG5 C;  3CCJ V;  1I5X A;  3F5W C;  4D7S A;  4JGS A;  3DC6 A;  4DV3 B;  3RJ0 A;  2WAM A;  1OCR C;  2IH1 C;  5KG5 A;  2ODM A;  4NTX A;  5I5S A;  1XUQ A;  1GTO A;  3G6E V;  4DV4 B;  1AR1 B;  4CKE A;  1XNQ O;  5KHG A;  1JKJ B;  4FZ1 A;  4ABM A;  3TY8 A;  1B04 A;  1PPJ H;  2UUB O;  1M57 B;  3KHL A;  4LFB B;  3W7U A;  2JEJ A;  4O3O A;  4J9M A;  2AHY A;  1HNW H;  1I7L A;  3KKY A;  2ZDI C;  2CDY A;  3M4I A;  4LF9 H;  1H2N A;  3JSL A;  4E4E A;  2DQ3 A;  3QO8 A;  1IBM H;  3VA7 A;  4J7Z A;  1CP9 A;  1AR4 A;  2R7Z A;  1ZL8 A;  4O3N A;  2LQT A;  4JYA H;  3ETQ A;  4JUZ A;  4WBN F;  3L4K A;  4J41 A;  1XNR H;  1AN7 A;  4CBC A;  3NBZ B;  3AG2 B;  1NBM G;  1M0W A;  4J9Q A;  3RYI A;  3BJY A;  4DRX A;  2DWC A;  2ZKO A;  3ZMT A;  2HP8 A;  2EJ0 A;  5LBQ A;  2EJ2 A;  3KAK A;  3HOY G;  1RPO A;  2N05 A;  4DK1 A;  1GRJ A;  3U0Z A;  4FS1 A;  4QIW A;  5B5E Z;  4JTA B;  5B1B B;  3GB7 C;  4LFA B;  2GHY A;  5DM6 V;  4J9S A;  1GSO A;  5J2U B;  2ZE8 A;  2LP7 A;  1GKF A;  4MTX A;  2UUB B;  4RUF A;  2C22 A;  3BEH A;  4FZ0 A;  3JAL A;  4LFC O;  3JAS B;  1MAB G;  2LO1 A;  1GK9 A;  4BXX G;  3GLK A;  1YXB A;  2QTS A;  5IY5 C;  2VOB A;  3R66 A;  4OX9 H;  1AI6 A;  5DG8 A;  5GTI Z;  3F5T A;  4DUY H;  3P30 A;  4LFB H;  4RB2 C;  3TQ1 A;  3GDE A;  2Z02 A;  3APO A;  5GW7 A;  1YHQ V;  4WFF A;  4XDJ A;  5C8Y B;  2P0A A;  4XZ3 B;  3FX7 A;  1VQ5 V;  2BCC H;  1GM8 A;  5D1O B;  1TWA A;  1E79 G;  4IHJ F;  3E5N A;  1T94 A;  4QWA A;  2DOS A;  4MA5 A;  1I0H A;  3GQC A;  4ZI7 B;  4AQY O;  2UUC B;  3ETJ A;  3RWR D;  1E1R G;  3D8C A;  4GX2 A;  3NUA A;  1F23 A;  2RDC A;  4U3J A;  1RP3 B;  1MSW D;  5BWX A;  2UUA O;  1F51 A;  3T5H A;  3E22 A;  2PY5 A;  1Y1V A;  1JOY A;  5EIB D;  1IBL B;  3OUS A;  4RQE A;  2JVD A;  3GV8 B;  4DV0 H;  1GLV A;  2R87 A;  1Y74 B;  5DLG A;  1NS1 A;  1UFI A;  2CW7 A;  2R93 G;  1W2B U;  1ZHQ A;  3VOT A;  5IWA B;  2VUM A;  5EIB C;  4E2L A;  1NVP D;  1H2L A;  2W7O A;  1XHX A;  2GUZ A;  2YIA A;  2Q6A A;  4KP4 A;  4DUY O;  1TUE B;  5BWV A;  4G28 B;  5EK0 A;  5CA1 F;  2DPI A;  3PO2 G;  2DJV A;  5BR8 O;  4DIM A;  4QW9 A;  4A3L G;  3L72 H;  4TV8 A;  4NYK A;  1M9N A;  1XDC A;  3ICX A;  3L74 H;  1FXK B;  4EB6 A;  3ETG A;  2H94 A;  1GAX A;  1KJJ A;  2Y0S E;  3WO0 A;  4I5S A;  4U7O A;  4Q4D A;  1WLE A;  2JGD A;  5KLV H;  1BJT A;  3B2E E;  5FD6 A;  3P32 A;  5KG1 A;  5AG2 A;  2B63 A;  4FPP A;  1SA0 A;  4NYE A;  3SYA A;  3G71 V;  1COW G;  4L8J A;  5EDW A;  1CEZ A;  4RAI A;  3CEI A;  3ABK C;  4YJ2 A;  1FXV A;  1KQS U;  5KHK A;  4XDL A;  5I5T A;  3CVZ A;  4TQD A;  3JAT B;  5KT6 A;  2JA6 A;  2ZDH A;  4ECQ A;  3BAC A;  2FLN A;  3BA9 A;  3V4S A;  4OPH A;  4O4L B;  2P90 A;  4JI6 H;  1Z2O X;  1JLL B;  4JI4 B;  2NVX A;  1CS0 A;  1IBK B;  1JFF A;  4DR3 O;  4O3S A;  4Z1V A;  4JI1 O;  4IYI A;  1A9X A;  3PFF A;  5L3F A;  3RYI B;  2OT5 A;  4HNA B;  1NJI W;  3N43 B;  1BE3 H;  3TW7 A;  1VQL V;  4LH6 A;  4WFA V;  3P3P A;  1NH2 B;  3V4Z A;  4Q44 A;  5B66 Z;  4DR6 O;  3T1Y H;  2F93 B;  1YF2 A;  4YHH O;  1H8E G;  5BMV F;  2JEI A;  2R9I A;  2NU7 B;  2RGV A;  3T7A A;  4O4J A;  3RVZ A;  4LFB O;  2CGN A;  3AG4 B;  1EBO A;  1Q8I A;  3BFR A;  3AW8 A;  5KFF A;  4AYB E;  2R8G A;  4UCO A;  3ZIA G;  4X62 B;  1XNQ H;  2XCP A;  2DLN A;  5J2U A;  4LNU A;  5LA6 A;  4W4K A;  2UUB H;  4HNU A;  2IP4 A;  5I60 A;  2W9A A;  1KJI A;  3A8T A;  4P9P A;  4UCT A;  2NU9 B;  4JYY A;  2EJ3 A;  1GO3 E;  3OMI B;  4PI0 A;  4X66 O;  4DR7 O;  5FLX N;  4QNH B;  2CH7 B;  2V1D A;  1ZLZ A;  4CH3 A;  3U54 A;  4GKJ H;  2VUM G;  5C1O A;  3O9O A;  1VF6 A;  1FD9 A;  1L1F A;  3H1J H;  3OMN B;  1S10 A;  4MV9 A;  3JAW B;  4DO2 A;  4F6E A;  1A32 A;  3EXA A;  5JJE B;  2VQF O;  3L73 H;  4N21 A;  4ECY A;  2JRI A;  3K08 A;  1Y76 A;  2E76 B;  4DR5 O;  4FFB B;  2H3O A;  1TA8 A;  1T36 A;  1S72 V;  3W5O A;  4KHP O;  2RQ6 A;  3Q2O A;  1ZET A;  3RN4 A;  3Q4H A;  4LF8 B;  1VP7 A;  4DR1 O;  3AG1 C;  2CNV A;  2DE0 X;  1L8D A;  1NH2 D;  1QNM A;  2AZ0 A;  4F6R B;  4O7T A;  2XC9 A;  1V4Y A;  4LMY A;  2ZNI A;  2AGO A;  2CTW A;  5L1L A;  2UVR A;  1N32 H;  2Q0A A;  5DEC A;  2JGU A;  4MVZ A;  4G27 B;  5ITZ A;  4NXN H;  3I56 V;  2IM9 A;  4LF7 O;  2W6M A;  1I1L A;  2CAZ C;  3IFX A;  1GM9 A;  3E89 A;  4X66 H;  3HKB B;  3AK2 A;  4NXM H;  1DK1 A;  4QIW F;  1Q43 A;  4IR9 A;  2VS0 A;  1VF7 A;  4FLY A;  3BA8 A;  1M0T A;  2NUA B;  3SJQ C;  3SYO A;  1D2D A;  5C44 G;  4JYC A;  3OTF A;  4DV3 O;  5LOV B;  3UM7 A;  3ZHT A;  1RJP A;  3PO3 G;  5BWU A;  4J9O A;  1KP3 A;  4FLT A;  2ZIN A;  3ETE A;  4QPJ A;  1VMG A;  4JI0 O;  2QM8 A;  2UU9 H;  5H80 A;  2JGD B;  2R85 A;  4JV1 A;  3FKI G;  4DUZ B;  2ZDI A;  3K58 A;  3CQZ A;  4RZQ A;  2FPI B;  1FYJ A;  1SC5 B;  2V5A A;  2DW4 A;  3Q8P B;  5BMV A;  1GSH A;  3MHH C;  4O2B F;  4LF4 H;  4J9N A;  3OFN G;  1FPO A;  5DLF A;  4X64 H;  3I4N G;  1PX2 A;  1AUX A;  5CA3 A;  4MTE A;  4EBD A;  4GLX A;  2VRZ A;  1P84 F;  3ETH A;  2YS6 A;  3BQ0 A;  2R7Z G;  3T9F A;  2BTQ A;  4C5B A;  4ECV A;  1GYF A;  3Q8S B;  1V54 B;  4DL4 A;  1VAR A;  1AP6 A;  4EEQ A;  1JFF B;  3SPI A;  1VQP V;  2WB1 E;  2P22 C;  3GB8 B;  1DLB A;  2B1I A;  4P2Z A;  1BQZ A;  5LGT A;  5KFY A;  5JVD B;  5JH7 B;  4F4X A;  4C7U A;  2UXB B;  1IZ3 A;  4XYM B;  1KD1 W;  4HNA A;  2VR1 A;  3HOV G;  2J6U A;  5KAI Z;  5IJ9 B;  4YY3 H;  4U3F H;  3ABM B;  4PDB A;  1HR0 H;  3RYF B;  2HGW A;  4ZOL B;  1CKN B;  1X4T A;  4IGG A;  2W57 A;  4PA7 A;  2OIE A;  2PGG A;  3SNO A;  4X66 B;  2HJW A;  1Y1W A;  2YDE A;  2UUC H;  4RB0 A;  1WP7 A;  1IXM A;  2GPS A;  1BQ0 A;  4LNU B;  4UCR A;  1URF A;  2P4V A;  4OXS A;  3G80 A;  5EZY A;  4DQN A;  5FPR A;  1N32 B;  1KJ8 A;  1V51 A;  2QDO A;  3J81 N;  3TII A;  2RDJ A;  3GIL A;  4A5U B;  3RT3 C;  2XAH A;  3FYE B;  3ZHR A;  2W6O A;  2LW1 A;  4NKG B;  1BGW A;  3T5L A;  2YZG A;  1PNM A;  5IT9 N;  4J0M A;  1YDX A;  3UO2 A;  4HYO A;  2GDS A;  1YI2 V;  4X20 A;  1AI5 A;  1VQ6 V;  3CS5 A;  1XI1 A;  3WFV A;  2F4V O;  3VQY A;  4ED7 A;  1SZT A;  1GN3 A;  2WLI A;  5GON A;  3TXS A;  3HPL C;  1R6N A;  1EUD B;  2WAQ E;  2OCC B;  5BY1 A;  2WWW A;  4F4Y A;  3K9A A;  5L1J A;  3ZHU A;  2WA3 A;  1Q6H A;  3M7M X;  5CM0 A;  1RYR A;  4K8X A;  3QO7 A;  3Q4H B;  2ZR2 A;  2JK5 C;  4ZI7 A;  2F95 B;  2PMZ E;  5H6R A;  4WBN B;  1TWH A;  1J95 A;  5KFT A;  1JIH A; 
#chains in the Genus database with same CATH homology
 2BTO A;  2UXD B;  1XMO H;  1FVI A;  4B3M B;  3J7A K;  3CSX A;  5KX5 B;  1NT2 B;  2R72 A;  1SEI A;  4ETS A;  4LFC H;  2V4D A;  4JI0 H;  2UXD H;  1Z2P X;  1ZAU A;  4UCV A;  3KXY T;  5BMV B;  4JI4 H;  4LH7 A;  3JAS A;  3WB0 A;  4A2A A;  2PYL A;  5LXT A;  5D5P A;  3JSN A;  3L4J A;  2XHB A;  3BAA A;  2Q7G A;  3VNN A;  5IYZ A;  4X64 B;  4A2B A;  4K8Z A;  5CA0 A;  3VQX A;  5IJ0 B;  1HR0 B;  4DR5 H;  5IJ0 A;  2RJZ A;  5JCO C;  4LF8 H;  4DR1 B;  4DUZ H;  3QF7 A;  1IBK H;  2UXC H;  3C0F B;  1N33 H;  3K5M A;  5LMU B;  4DR7 B;  4JI5 H;  1XQ8 A;  4BWA A;  5ITZ B;  2R70 A;  5KHJ A;  1Q3E A;  4LR3 A;  4NXN B;  2WYO A;  1FJG H;  4DV5 B;  1P8L A;  4JI3 B;  2XIG A;  4EFE A;  3K5O A;  1J5E B;  4HBN A;  3RFR A;  1N33 B;  3T1Y B;  4IHJ A;  5LYJ A;  1N36 B;  1VS0 A;  5JCO A;  2ZJT A;  1D5A A;  1WPB A;  2EX3 A;  5LA6 B;  4RB1 A;  4O2B B;  4TOI A;  5CB4 B;  4TV9 A;  4I7H A;  3L2P A;  4LF6 H;  2QJ1 A;  3KAL A;  4GKK B;  1XMQ H;  1SQG A;  1S5J A;  4FLW A;  2YI8 A;  2UXB H;  1P49 A;  5JVD A;  1WNS A;  4D7S A;  3FMA A;  3PN1 A;  4DV3 B;  5FPO A;  2F4V B;  3RJ0 A;  5KX5 A;  4UCU A;  4DV4 B;  4X1Y A;  5KHG A;  1P16 A;  3TY8 A;  1B04 A;  3HKB A;  1IBM B;  1CKN A;  1HW7 A;  4LFB B;  4DV0 B;  5JJJ B;  1HNW H;  3KYH C;  4DRF A;  3M4I A;  4LF9 H;  3JSL A;  1IBM H;  4B3R H;  4EFB A;  2ZCE A;  3IG0 A;  5D1P A;  1FFX B;  4JYA H;  2UXC B;  3ETQ A;  1QQC A;  3L4K A;  4I50 A;  4FVM A;  1XNR H;  1AN7 A;  3NBZ B;  4AHC A;  5FLX W;  3HKC A;  1O75 A;  2VQF H;  5BR8 B;  3RYH B;  2UU9 B;  4DRX B;  5LP6 B;  1M0W A;  3RYI A;  4DRX A;  4I55 A;  4B3M H;  5CA0 B;  4JI7 B;  4DUY B;  4AQY H;  3SJA C;  1N34 H;  3KAK A;  3N2G A;  4YY3 B;  4X1K B;  3JAK A;  5GON B;  4DK1 A;  3HKD A;  4RB3 C;  4JI7 H;  3U0Z A;  4JI2 B;  3T1H B;  4LFA B;  3K57 A;  5J2U B;  4DV7 B;  2UUB B;  1MZB A;  4LSA A;  4IIJ A;  1T5E A;  3N2K B;  3JAL A;  5J2T B;  2HVQ A;  3JAS B;  3N6X A;  4LFA H;  4YHH H;  2VQE B;  1HNZ H;  3UT5 A;  2VOB A;  4LSX A;  4OX9 H;  4DUY H;  4LFB H;  5JQG A;  3N42 B;  4RB2 C;  3GDE A;  5K1X A;  5LMN B;  5C8Y B;  3OTO H;  4I55 B;  1CKM A;  2VUG A;  4Q0Y A;  1TVK A;  4DR3 B;  4X20 B;  1M5I A;  1Q5O A;  4B08 A;  5D1O B;  4JI8 H;  3N40 P;  4ZHQ B;  3GJX B;  4NXM B;  2YIB D;  4MTD A;  3A2F A;  1TUB B;  3W1G A;  3HKE B;  4ZI7 B;  2UUC B;  4YJ3 B;  2RGR A;  3RWR D;  3W1B A;  4U3J A;  2MCT A;  3HXL A;  3LNN A;  4LF6 B;  5LL6 b;  2VQE H;  2Q2T A;  3E22 A;  2PY5 A;  3RGX A;  4WBN A;  3J80 W;  5EIB D;  3K5L A;  4FLX A;  4EB6 B;  2JVD A;  4FM2 A;  1IBL B;  3DF7 A;  4DR2 H;  1I6U A;  4DV0 H;  3ZED A;  2KKW A;  4JI0 B;  5BR8 H;  2E5L H;  4LF7 B;  2CW7 A;  4ZIB A;  1ZHQ A;  3JAM W;  5IWA B;  3BHP A;  5EIB C;  4D7T A;  1H2S B;  1XHX A;  4DR4 B;  4JYA B;  5D1O A;  2ZIO A;  2YIA A;  5EYP B;  1SA0 B;  3RF2 A;  3HKE A;  4AIL C;  2KSW A;  3VQV A;  4OX9 B;  4CH5 A;  4TV8 A;  5LXT B;  5D5Q A;  4DR6 B;  3ICX A;  4FLV A;  2JS5 A;  4LF5 B;  4E6N A;  4EB6 A;  4PI2 A;  4TUY B;  1G6U A;  2ZNJ A;  4DV5 H;  1V9P A;  3SJB C;  1BJT A;  3B2E E;  5FD6 A;  4GYC B;  1E4G T;  4DV1 B;  5LMN H;  4X1Y B;  4IAJ A;  1SA0 A;  1TAE A;  4JI2 H;  4L8J A;  4DR3 H;  2ZM6 H;  2YXL A;  4YJ2 A;  5KHK A;  4UCS A;  4K0K B;  3CVZ A;  4TQD A;  3JAT B;  1O9H A;  1L2Z A;  2WE6 A;  3CHX A;  3BA9 A;  4O4L B;  4JI3 H;  2HVR A;  4JI6 H;  1Z2O X;  2R9A A;  5KMG B;  4JI4 B;  3J81 W;  4BW9 A;  1IBK B;  4B3S B;  1JFF A;  3MAQ A;  2PTM A;  4JV5 B;  3RYI B;  1I94 B;  3LML A;  4HNA B;  3N43 B;  3DSQ A;  3RYC A;  4LF9 B;  4LH6 A;  3CB2 A;  3T1Y H;  2F93 B;  1N36 H;  4X1I B;  3H20 A;  2RGV A;  3RR5 A;  3S24 A;  4O4J A;  1E4F T;  4CS3 A;  3QTC A;  4CC6 A;  1Q8I A;  3JAW A;  4LF4 B;  4DR4 H;  4Q6G A;  4JI1 H;  4UCO A;  4UFZ A;  5FNV B;  2PZS A;  4TV8 B;  3RGZ A;  4DV6 H;  4X62 B;  1XNQ H;  5J2U A;  2YIB A;  4LNU A;  4JI6 B;  5LA6 A;  4CC5 A;  3RTX A;  2UUB H;  4RAZ A;  5LP6 C;  4UCT A;  3RYH A;  1WN7 A;  2CFM A;  3JAL B;  4PI0 A;  3NC0 B;  2ZM6 B;  4CH3 A;  4GKJ H;  4DV2 B;  1N34 B;  4MV9 A;  1TVK B;  1HNX H;  3JAW B;  5EYP A;  4DV3 H;  3HKD B;  5JJE B;  4BWS C;  1M93 A;  4FM0 A;  4DV4 H;  4O2B A;  4FFB A;  2GV9 A;  4B3T B;  1SQF A;  5JJN B;  4FFB B;  1TA8 A;  3W5O A;  3N44 B;  1HNX B;  4IHJ B;  2RQ6 A;  2YI9 A;  5LYJ B;  1YEW A;  4LFC B;  4DR6 H;  4LF8 B;  4CS4 A;  3F8N A;  1ZHS A;  1L8D A;  3JAR B;  3BPZ A;  4F6R B;  4RAY A;  2O03 A;  4LMY A;  4F6R A;  2ZNI A;  5KMG A;  2VWK A;  4CH6 A;  1N32 H;  2Q0A A;  3U10 A;  4O4I B;  1I7F A;  4FM9 A;  4JV5 H;  2JGU A;  2OYQ A;  3JAK B;  1I94 H;  4FLU A;  3K3V A;  2YCH A;  5ITZ A;  4NXN H;  2Q7H A;  2IM9 A;  3N2G B;  3EYY A;  4YJ2 B;  2F66 C;  4X65 B;  3TY9 A;  2Q2U A;  2CAZ C;  4B3T H;  5FNV A;  4X66 H;  1S03 G;  3HKB B;  4NVP A;  1XMQ B;  5LMU H;  4NXM H;  4DR7 H;  4CS2 A;  1CKO A;  1Q43 A;  3K5N A;  1RSO A;  4O4H A;  4YJ3 A;  1IBL H;  5J2T A;  3SJC C;  1VF7 A;  2VWJ A;  3BA8 A;  4FLY A;  1M0T A;  4TV9 B;  4TQF A;  2PUS A;  3BAB A;  1O9G A;  1JJO A;  3RGB A;  3OTF A;  3N41 B;  4GKJ B;  5FD5 A;  5A2Q W;  5LOV B;  3UQ8 A;  4AQY B;  1XHZ A;  4I4T A;  2BTQ B;  2HVS A;  3SR2 C;  4I4T B;  2ZIN A;  4FLT A;  4R7R A;  4I9Q A;  2WDT A;  4PHZ A;  2UU9 H;  4KHP H;  4JI5 B;  1FKA H;  3FFQ A;  3QG5 A;  2ZIM A;  4DUZ B;  4ZHQ A;  3K58 A;  4DR1 H;  5IJ9 A;  2UUA B;  4DV6 B;  1XNQ B;  4B3R B;  4RZQ A;  4DR2 B;  4DK0 A;  5BMV A;  2VPS A;  4LF4 H;  3WB1 A;  5K1P A;  3BRC A;  4X64 H;  2E3C A;  3RYF A;  1J5E H;  1KU9 A;  2CW8 A;  4MTE A;  4K0K H;  3JAR A;  4GLX A;  4O4H B;  3U11 A;  1X9N A;  2BTQ A;  5KHH A;  1XNR B;  5DIS C;  1GYF A;  4EEQ A;  5EZY B;  3SGI A;  1JFF B;  1Z5W A;  5JQG B;  5KHI A;  2P22 C;  3GB8 B;  3TY5 A;  1XDN A;  4KHP B;  1KMI Z;  3E22 B;  2F4V H;  5JVD B;  5JH7 B;  4EQ5 A;  4DR5 B;  1WH2 A;  4X65 H;  2UXB B;  3RYC B;  1Z2N X;  4HNA A;  3T1H H;  3ZS8 C;  4MV7 A;  5LP6 A;  5IJ9 B;  4YY3 H;  4PZ7 A;  4PDB A;  3QWU A;  1HR0 H;  1TUB A;  3RYF B;  2HHH B;  4ZOL B;  5CA1 B;  4KL1 A;  1CKN B;  3RIZ A;  1X4T A;  2W57 A;  1FFX A;  1SKV A;  1SYX B;  2PGG A;  4O4L A;  2PYJ A;  3IAY A;  4B3S H;  4X66 B;  4M7E A;  5LOV A;  2UUC H;  3JAT A;  4RB0 A;  1M4U A;  1Z5V A;  3HKC B;  4IIJ B;  5CB4 A;  4X62 H;  4LNU B;  4UCR A;  4I50 B;  3NBY B;  2E5L B;  4TUY A;  5EZY A;  4LF5 H;  3UT5 B;  3THO A;  5IWA H;  5EOY A;  5FPR A;  1N32 B;  4O4I A;  5C8Y A;  1BGW A;  4X1K A;  3OTO B;  4APM A;  4GKK H;  1HNW B;  4J0M A;  3MWM A;  1HNZ B;  1FJG B;  4YHH B;  5IT9 W;  2HHH H;  4X20 A;  4PZ6 A;  3KAJ A;  1TGO A;  4FM1 A;  1XI1 A;  2UUA H;  3VQY A;  2FE3 A;  4O4J B;  2HIX A;  2Q7E A;  4PZ8 A;  5GON A;  2OWO A;  4X1I A;  4ZOL A;  5CA1 A;  4DV7 H;  1A0I A;  4DV1 H;  4JI8 B;  2VQF B;  2F1M A;  4JI1 B;  1XK5 A;  4U3J B;  3VQW A;  3M7M X;  4K8X A;  4O2A B;  4LF7 H;  2HIV A;  2HEP A;  4O2A A;  4ZI7 A;  3N2K A;  1QHT A;  2F95 B;  1XMO B;  4FLZ A;  4DV2 H;  5JH7 A;  1S68 A;  5IYZ B;  3K59 A;  4WBN B;  1DGS A;  2P5O A;  1JMK C;  2QM4 A;  4CH4 A;  2HGS A;  3WB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...