4UCSA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA LIGASE
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucsA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucsA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucsA02
2UUCB 1ZAUA 3W5OA 4GLXA 3W1BA 3TY9A 1B04A 2UU9B 4PZ8A 1N34B 4JV5B 3PN1A 4B3TB 4LF4B 4LF7B 3NC0B 4JI3B 4EFBA 5D1OB 3QWUA 1TA8A 1TAEA 4JI8B 1HR0B 3T1HB 4JI1B 5FPOA 1I94B 1HNXB 1HNZB 4LFCB 4CC5A 1FJGB 3NBYB 4LF5B 1XMOB 4UCRA 1A0IA 4PZ6A 4DV1B 4JI7B 2UXBB 4PZ7A 5DISC 2Q2TA 3L2PA 4EQ5A 3VNNA 5D1OA 3T1YB 1DGSA 2UXDB 5LMUB 3BAAA 4JI2B 3RTXA 4DR3B 1IBMB 3BA9A 4TOIA 4NXNB 4YY3B 4DR7B 2ZM6B 1CKMA 2OWOA 4AQYB 4B3MB 1XNQB 3S24A 5FPRA 4X65B 2HIVA 2UUBB 4DV3B 3BABA 3GJXB 1N36B 4E6NA 1XNRB 4OX9B 1IBKB 5LMNB 4DR4B 2E5LB 1V9PA 4UFZA 4EFEA 3OTOB 1J5EB 3TY5A 4UCOA 2VUGA 4UCTA 1N32B 2HVSA 4LF8B 3TY8A 1XMQB 4DV0B 4DV7B 3NBZB 4KHPB 4X64B 2VQEB 4JI5B 2HIXA 4UCUA 4DUZB 1IBLB 1XDNA 4NXMB 4LH7A 4DR2B 4K0KB 4GKJB 2F4VB 4DR1B 3SGIA 4UCVA 3GB8B 4DV5B 4EEQA 1CKNB 4DV6B 4JYAB 4CC6A 1FVIA 2HVQA 1CKOA 1P8LA 4B3SB 4GKKB 4DUYB 1HNWB 4DR5B 5BR8B 2CFMA 2HVRA 3BA8A 3W1GA 2HHHB 3UQ8A 4B3RB 5D1PA 1N33B 2UXCB 3RR5A 4UCSA 2Q2UA 4JI0B 1XK5A 3KYHC 4DR6B 4LF9B 1VS0A 4DV4B 3JSNA 2UUAB 1CKNA 4LF6B 4JI6B 1S68A 5IWAB 3GDEA 1X9NA 4LFBB 1P16A 4DRFA 4DV2B 4X66B 2VQFB 4X62B 4YHHB 4JI4B 4LFAB 3JSLA 4LH6A
chains in the Genus database with same CATH superfamily
3JD1A 2C2EA 2HEPA 4I0XA 4QIWF 3RBDA 2DMXA 1N32O 2MW2B 3WFVA 4L1KA 3PJSK 4QIWA 4MT8A 3NC0B 2DYSC 1B3QA 4JI3B 3RWRD 3P3PA 2Q7DA 3H4DA 4TT3G 2CW8A 4FLYA 3ZHRA 1YITV 2HVKC 2JA6G 2B1IA 3WG7C 4WFHA 4NZMA 2QKSA 5CBHA 3VQWA 1GMGA 1FKAH 3RYFA 2W9BA 2IU0A 4QWCA 1Y4MA 1FJGB 2L35A 1DV2A 4IRDA 2DYSB 4UCRA 4PZ6A 5I5UA 4F4WA 5E79Z 3IC7A 2LGQA 5DN6G 2E5LO 4B3SO 4MV8A 2ASDA 3JRXA 3HKDA 3T1YB 3CC4V 3WG7B 5CAEB 4NKGB 4YJ2F 3F7YC 4JI0O 5KFPA 2UVUA 4JV1A 3ABMC 4EEYA 1E1RG 4YJ2A 3K0DA 3C90A 3G80A 2YZNA 4YIPA 4CZZA 1IDSA 1B6SA 3FB5C 2YU9A 3LDEA 3VBBA 3CCQV 5DGHA 2ETNA 3FX7A 1NU1H 2GTSA 2Q69A 4QWAA 1S0VA 2DJVA 4OX9B 1N34H 1GM9A 1KJ9A 3FKSG 5LMNB 4JXUA 3AG7A 1Q81W 2IH1C 1Q6IA 2DPJA 1I50A 1YSCA 3WWHA 1I94O 1I7NA 1HNZO 2YWVA 4LFBO 4A2AA 4NXMB 3JASA 4CMDA 4ETSA 1EFRG 1MZFA 2UXBO 1K1SA 1L8DA 3ZN1A 1K73W 2M05A 4K35A 1EN5A 1MOFA 2UXDH 4ZI7B 5JH7B 4Q44A 4D7TA 4DV6B 1S5JA 3ETJA 1TWFA 1Y14B 3M8AA 3CCUV 2EINC 3GV8B 4JUZA 3T2MA 2XD4A 5DQGA 1RPOA 3T99A 1N33B 2Y48A 2ZM6O 3OUUA 4DV3H 2R92A 4IWYA 1EHIA 2YW2A 2Y0SA 2PUSA 4IL6Z 1XNRO 4HNTA 2LW7A 2R93A 2EINB 4LNUA 4LF5O 4J10A 4F50A 1IBKH 2ARHA 5KFEA 1GKFA 1UC9A 4O3RA 3JSLA 2COGA 4O7RA 1FFXB 5C1OA 1J5EH 1JMKC 4HYOA 1QLNA 1FYJA 4O4IF 3SPGA 5DAAA 3GIPA 3CJHB 4O4IA 4J9SA 5D5PA 1XMQH 2EZPA 3FYIB 3V4SA 5J2TF 4DV7O 1H8HG 2QM8A 5K1PA 4A3IG 4EB6B 5J2TA 1LNQA 2GBOA 1TVKB 1TA8A 5H6QA 4I55F 2HKOA 1EM1A 4I55A 3T54A 3DXRB 3Q8SB 4JGSA 2FP4B 2W6QA 2QF7A 4PELA 1ET0A 4H44B 2WAQA 5CA3A 4NLGA 1I1MA 4MVZA 4EQ5A 4HZ3A 2QA4V 4J9QA 3ZN0A 4YIOA 1DGSA 5DG7A 2X7RB 2FKXA 5L3BA 1KJ8A 1ZQ7A 4FFMA 1T3NA 4X89A 2W7PA 1KQSU 4A3EG 3F7VC 4FLUA 2VQFH 2WLKA 3H1IH 4EGQA 1RM1B 1NTZH 3GIQA 4LFAO 3FMAA 1B33N 4K3AA 2YICA 4JZGA 4BW9A 3GJXB 3ML0A 3DC5A 4MA5A 2JJ2G 1OBDA 4RAIA 4O84A 5KFCA 1E4FT 3PO2G 1DK1A 4DL3A 3SPCA 4L87A 2CNQA 5JWPA 1SC5B 1KBHA 1IVSA 1GM8A 2FPGB 1KKCA 5IT9N 4UCTA 1S10A 4EG0A 4O7WA 3T1HO 4Q8FA 2Q4PA 5JCOA 3KZIZ 3RYHB 1TUBA 4BAYA 1WPXA 2ZDGA 4LFCH 3GTMA 3PW2A 4IT5A 1SQXH 2DWEC 5I5SA 3T9FA 2R84A 2XIGA 2C28A 1Y1VA 1BGWA 4LWSB 4R6ZA 2LW1A 3HKBB 3PO3G 4IIJB 4MV7A 1GYFA 1YZBA 3ZEDA 4IRKA 3KAJA 4GKKB 1IBMH 5KFBA 3K79A 3OM3B 2WB1A 3M99B 5CN0A 4DR3O 1W0JG 3M9NB 2Q6AA 4I9WA 3E8BA 1EKFA 3R23A 5DQIA 4NXNO 4EGJA 2VA3A 1XNQO 2WLMA 3BPZA 1S97A 1EZJA 1N36O 2IBZH 4FFLA 3L75H 2C2AA 1VQKV 1PL4A 3BACA 5FR9A 3TQTA 3BHPA 4YHHB 4FFOA 3FAVA 1FS0G 5DMXA 3HXLA 3OSNA 4MS2A 2UUCB 1ZLZA 1UJWB 3OTOO 4L8JA 2OCCC 5HNEA 5HFMA 2QWRB 2R9AA 3RN4A 3RAQA 4O83A 3K06A 4FS2A 1H2KA 5KFUA 2VQEO 2WA4A 3JCZA 1R3IC 4TV8B 4O7NA 3BFRA 3SPJA 4CH6A 4GKJO 5H80A 2OCCB 1KMIZ 1XBLA 4IHJF 3TQ1A 1EUCB 3RVYA 2Y0IA 2D2CB 4A3FG 3PR5B 3I56V 3HKEA 1MSWD 4GUNA 1CP9A 2XUMA 4D6TH 2R86A 1JPXA 1I1LA 2XASA 1DF4A 4G28B 2B1GA 1NI8A 1FD9A 2QYZA 4DR6H 4NTYA 2QWNB 3CEIA 3ETDA 4FLTA 3DF7A 5H6RA 1FXKC 5B1NA 4NYEA 3SYOA 5HV6A 5KX5F 2DYRC 4X1KB 2MCTA 1GN6A 2FPIB 5KX5A 2BQ3A 1K3EA 3JARB 4Q20A 1SRYA 5KG5A 1ZX3A 4KUMA 1WA8B 1KUTA 2FPPB 1SZXA 3G6VA 2UU9H 2W6ZA 4O7SA 1FXKB 5KMGB 4R7RA 2DYRB 4FLZA 4LF4H 4WF9V 1RJQA 2P90A 5IYDO 5L3GA 3CYOA 1GTOA 3EHBB 4CHIA 2Z5UA 3TY5A 3B8MA 3NXSA 4CMFA 1T5EA 4GCZA 4ECUA 2JK5C 3K5MA 3F5TA 2YIAA 5CBGA 1I5YA 4DV1H 2F4VB 4B08A 3NUAA 2FMLA 1PP9H 4I7ZB 1K7DA 1XQ8A 4IZOA 3K57A 4JI2O 2ZGIA 1P8LA 4IWXA 5EYPB 1JDEA 5KG0A 5GW7A 2ILMA 1DTOA 4DUYB 5D8DA 3GTOA 4B3RB 4DR7H 4RB2C 4O2BF 2FL4A 3Q8PB 2XC9A 3QO5A 5LYJA 2HJWA 4O2BA 4BIZA 1SA0B 1TGOA 3TIIA 3S3XA 2NU9B 1FFTB 2FTKA 5KFOA 4R8UB 2RQ6A 3AG1C 4R50A 4X66B 3FB6C 4P2ZA 4DRXA 1VQNV 1ZL8B 2E5LH 1IZ3A 1KC8W 4PA6A 3QZ8A 1WB8A 4MV3A 1IOWA 4LH6A 4RNNA 3UFXB 5CA0F 5ITZB 5CA0A 4JI0H 4DV0O 3W7UA 4K6NA 3WWIA 5B3SC 3E5NA 2VOBA 3L74H 2J6TA 4KHPO 4EFBA 2OCHA 1HW7A 2BTOA 2ITCC 3JAMW 3OMAB 2FK1A 1S76D 4FGRA 4DR1O 5FPOA 4YBZB 3GILA 5C3EG 1GM7A 1S5HC 1N8RW 5B3SB 2X6BA 3GWKC 1MZBA 4NZOA 2R7ZG 4JYAO 3UCSC 2AXTZ 2YZLA 2P5OA 5LL6b 3L2PA 1OBGA 4FVMA 1HNWO 1BCCH 2Q7HA 3U9SA 4FLXA 1KC7A 5KUMA 2YRXA 2PY5A 1XILA 1GSAA 4AYBE 4U7OA 1K9MW 1SCUB 3EFFK 1D2DA 5KFZA 3SDLA 4LFBH 1VIBA 5E1AC 5LP6F 4I50F 4X62H 2YRWA 2R7MA 2UXBH 5LP6A 5IJ9B 3S24A 4I50A 4WFGA 4ECTA 2YYAA 1JA8A 1KTAA 3OT7A 2R9RB 4CH5A 5CA1B 3HT5A 1O75A 4PA3A 1BMFG 1P7BA 4QIWE 3ZRVA 1JOYA 5FNVB 5EZYB 4I7HA 4JI3O 4HNUA 3FB7C 1NBMG 1Y74B 4JTCB 2ZKOA 1M4UA 1DLBA 2WAMA 4KL1A 1R73A 2W9AA 5KFKA 1XNRH 2W8LA 4Z1MG 4LF5H 1YIJV 1YEWA 1GO3F 4O4LB 2AZ0A 1K83A 4LP8A 2EULA 2Y69C 3RYCA 3T1YO 3U10A 3ORQA 5BWWA 3JAWB 1M93A 4DL7A 3G4SV 1Q86W 3JAKB 2V9WA 1QHTA 2UVVA 5I5YA 2LFRA 3APQA 1GN4A 5BR8B 1NTKH 2CTQA 1NR7A 4J7KA 3TGUH 3ETEA 3O9OA 4W4KA 3CCJV 2DABA 1UC8A 5IY5B 2UXCB 5EIBC 4AQYH 2Q2UA 3OEEG 1GGOA 2Y69B 3FB8C 1COWG 5HBRB 4ZQIA 2P7TC 2VPSA 1AP6A 1X9NA 2DQ3A 3WNZA 2QJ1A 4WFBV 3OUSA 1GN3A 2XOKG 5LMNO 1ZAUA 4PJ0Z 3W5OA 2IU3A 1B04A 2WLJA 2BSKA 2KSDA 3P30A 1KUQA 2VUMA 4OGQB 3CVZA 4BY1G 2E76B 2R82A 3R65A 4PI0A 1B6RA 4YR0A 2F95B 1TWHA 5LA6B 3W7XA 4RB1A 3LDDA 1IXBA 3IFXA 4NXMO 4O82A 3PW4A 1HR0B 1T94A 3LNNA 4IYIA 4WFFA 3DTGA 4DL6A 2I80A 2J9GA 4A3CG 3VPDA 3EPGA 1YDXA 4N23A 5LHHA 4CC5A 5J2UB 2CZGA 3HB9A 4DV6O 3LSSA 1JLLB 1QVGU 4RB3C 2IM9A 2Q2TA 4J80A 1YI2V 2HHHH 2W71A 1XUQA 4ECZA 1R3KC 5KHHA 1WN7A 3OHAA 3SJAC 1EZVH 4UB6Z 3CCSV 4XDLA 1ZHQA 4LF6H 4JI6H 2BR0A 3BA9A 4LBEC 4YY3B 4NR1A 4P9PA 5H2FZ 3H3VH 1Q6HA 1AJQA 4NZNA 3HOVG 3PR4A 3FKIG 1H2GA 4TSFG 2XCPA 3F5WC 4DW0A 4FLVA 3BABA 3G8DA 3Q8RB 4GX5A 4E6NA 2XGQA 4JAVA 2K9PA 3GB7C 3CWBH 1MZEA 2CUGA 3OAAG 2ZXWB 4Q45A 2V1DA 4DIMA 3HOYG 2ADPA 4EFEA 2XAHA 1VQ9V 4ABMA 5FD6A 4D7SA 1XNQH 1D5AA 4LF8B 1EUDB 3N6RA 1HNXH 2NUAB 2WAQE 4DUZB 3I4NG 4UUGA 1BXRA 1XMOH 2C2RA 1P49A 2LQTA 2V4RA 4IAJA 3UKMA 3RB0A 2YS8A 2XAGA 3GB8B 2R8GA 3OTOH 2NN4A 4JASA 4J9ZB 1CKNB 1YJ9V 5LMUH 3CCMV 4LSAA 1QVFU 3E89A 3LP8A 5I47A 3RFCA 2QK4A 3CCVV 4DR5B 2CFMA 2RDCA 3T5KA 4FK5C 2R7KA 2XGPA 4FMTA 3RR5A 4GKJH 1XK5A 4ZI7F 1W93A 5JH7F 3AG4C 1SEIA 4DV4B 1HDJA 2JA6A 2JA5G 4ZI7A 5JH7A 3HKCA 1AJPA 1WB7A 4H13B 3TK1A 3OE7G 4JI4B 3MD0A 3OGIB 5IP9G 4GLXA 3ASOC 3SJBC 1TWAA 4A93G 1G6UA 4TQSA 1BJTA 1S0OA 1N34B 1BE3H 4CKEA 1E1QG 3X2QC 4AI8A 3ABLC 2WYOA 3ZRWB 2HP8A 3JYCA 2RF4A 3ASOB 3ZRXA 4JI1B 4A5UB 2A9HA 1Y67A 2GDSA 1O9GA 1SQVH 2X6AA 4UV8A 4YAJB 3CJHA 5C8YB 4J41A 2WB1E 1HP8A 3X2QB 4XDKA 2HGWA 2YC0A 4U7NA 2G38A 4O7VA 5KFQA 2B63A 3J81W 4GKKO 1TVKA 2UXDB 2IH3C 2F1MA 2X6CA 4JYBA 1N56A 2RMKB 4JAAA 3D36C 3OGCC 1VKZA 3DXRA 1KBLA 3QNEA 1PPJH 3ZJZA 5IWAH 2NVYA 2GTAA 1CKMA 1JJ2U 3GIIA 1PV0A 4YHHO 1UPGA 2DN9A 4X65B 4ECYA 4DV3B 2DAAA 3LDCA 2Q5ZA 5L3DA 2UUCO 3J80N 2YS7A 1Q43A 4J7ZA 3VA7A 1AB3A 3G67A 1IBKB 2HHFB 4PDMA 4DR4B 3RB6A 1SQGA 3GVMA 1J5EB 4JI8H 3CRAA 4H0LB 4X20B 1PNMA 3T9BA 2CGOA 1XMQB 1AJNA 4R8CA 3M9MB 3H0GG 4BIUA 1W0KG 3I5DA 2IJJA 1BNCA 5I5VA 2DOSA 3H1KH 4O7TA 3MR5A 1N48A 4C2MA 1U97A 1VQOV 3N42B 4JTDB 2DIKA 2YDEA 2GQRA 3ZCCA 4U3JA 3QZ7A 4JYCA 5F2VO 4MVRA 2HVQA 3RYHA 1R6NA 2IMWP 4O4HB 2WLIA 2EJ2A 4U6PA 4O3QA 5K2MA 5JQGB 4UCSA 2XCLA 2XTAA 3HR0A 1SQFA 2W6NA 4IIJF 3HKZE 4XYMB 2CDYA 4UUJC 1S68A 4IGGA 2EIYA 5TISZ 2ZNJA 1BHAA 2IJHA 4IIJA 4JYAH 2VQFB 1CQIB 2EJ0A 2JRIA 1HNWH 5KLVH 4CE5A 1PM9A 5B1BB 3W1BA 3KHRA 2CGNA 3H20A 1WH2A 1NVPB 5KFLA 3VOUA 5LL6Y 5H5NA 2FYUH 3O65A 2OTLV 4JI5H 3KHLA 5A9GA 2W9CA 2VS0A 5KFJA 4MA0A 5K1XA 1N4CA 2PGGA 3H9VA 3K08A 3UZBA 1BL8A 3T1CA 4A3KG 2F4VO 3GTLA 1KU9A 2YEVB 3JZ6A 2AU0A 1OCRC 3B09A 2Z02A 3N2KB 4WFEA 3LQSA 4ED1A 4LFCB 5KHKA 5FLMG 4NB5A 3SYAA 3SJQC 3ZMUA 4JI7B 4J9LA 1AILA 4DYLA 4TV8F 3RV3A 4JPRA 4IR9A 4F6RB 4DUYO 4QPKA 4TV8A 1DIKA 3E35A 4B3RO 2BE3A 1OCRB 4FBUA 3MWMA 1OCCB 2UUAH 2P4VA 1V4YA 1QBZA 4BW5A 4MVOA 1IBMB 4MV6A 1S0MA 2X5RA 1WP8A 1AI7A 3U9TA 5FLXW 4X66O 4FFBB 3A0BZ 2HIVA 3BG5A 1I2KA 2CE4A 3N40P 3T1YH 1AI5A 2GUZB 3CHXA 1K1QA 1E4EB 1RYSA 2FLNA 4JV5H 3AEIA 3U0GA 4EYHB 4MW3A 1Y76B 2B5UA 4OXSA 4LF7H 4PWQA 3JD3A 3T9CA 4X1KA 1G8MA 5BXZA 1RM1C 1SKVA 2UVRA 4EBDA 3EPIA 2JEIA 5DGIA 4I0XB 1M7JA 3V6HA 1WA8A 4E4EA 2ABJA 1QCEA 1FXKA 3KXYT 3E22A 1XREA 4DV2O 2OH2A 4RNMA 1MA1A 3RYIB 5L1KA 5L3FA 3SGIA 3FD9A 1CEZA 4TUYB 2C35B 1YJNV 3KHGA 5FJ8G 1QR8A 2R6FA 4DV5B 3W7TA 4CH4A 3L9DA 3APOA 1S77D 3CSXA 5KT5A 4MVSA 2ZIMA 2W9BB 1JCHA 3JZFA 1Q5OA 1Q3EA 5IYZB 2QWPB 2LGWA 1KB9F 3HKDB 4B3MH 4DR6B 2R92G 2HFEC 4ZOLF 3SYQA 3P32A 4ECQA 2PZSA 2JJ1G 4ZOLA 2OTJV 2R93G 2X0SA 2ZD9A 5EWFA 3B77A 5EYPA 5KS8A 1VQ6V 3VPCA 3AYHB 4PI2A 1NVPD 5KA5A 4RZRA 4RZQA 1WCMG 2UU9B 2PTMA 5BY1A 4O3PA 5LHGA 1SA0A 4LF4B 3KHHA 1IBLH 1AP5A 5D1OB 4R8UA 5JVDB 4DR2H 4K0KH 2YZGA 1CPYA 4HAMA 2W6OA 1CXZB 3K59A 1VP7A 5ITZA 2BOCC 2JGDA 4QJFA 4WBNF 2W0FC 4A2BA 2PF4E 5I5XA 3VPBA 5GTIZ 1M90W 4WBNA 4DV1B 5KFXA 3KCXA 3E83A 3KCYA 5DGAA 1R6KA 5BR8O 2GLTA 2W6MA 4O81A 1PKXA 3AG3C 2I8CA 1GN2A 2Q68A 4CKCA 2UXCO 1S0NA 2FE3A 4LF9H 2AGAA 3JRWA 4UVBA 4HNAA 1AVMA 2C22A 2JDIG 1AR4A 4CS4A 3AK1A 3R5XA 3L4JA 1F51A 3THOA 1L0NH 4DR7B 4H33A 1M0WA 3AG3B 2QDOA 1VF7A 3LNMB 4JV2A 5FPRA 2R7NA 2UUBB 5L3EA 1XL4A 1YF2A 4NVPA 1R3JC 4IHJA 3PVXA 1K5QA 3DTFA 2AHYA 5IYCO 1SETA 4FM0A 1PL0A 2Y4UA 5DLFA 1RJRA 2E5LB 3LSQA 1VQMV 2VWKA 3R5HA 2VUGA 1HR0O 3TXQA 5CA1F 4C5CA 1DV1A 4I9QA 3TETA 4X64B 5CA1A 2PMZA 2HIXA 5FNVF 5EZYF 1H8EG 1K4DC 5FNVA 5EZYA 3CS5A 4MV4A 1Y1VG 3T4ZA 2E2IA 2ZJTA 4H37A 5KHGA 3GWOA 2CTPA 5BWRA 2HVJC 3IG0A 1R9TA 3NGDA 1JIHA 2JEUA 2FB9A 1ZUQA 3LMLA 2R8HA 4B7KA 4JV0A 3KKYA 4PA9A 3ASNC 4UVCA 5LXTB 1EKVA 4BR6A 1A9XA 3T5LA 1A3GA 4YY3O 5JJEB 2LP7A 2FKLA 1XOUA 2EZOA 2Q8VA 3IN5A 1M5IA 3K5OA 5CM0A 4LFBB 3G6YA 3JAKA 3ASNB 4FBTA 4X62B 1G4YB 5BWVA 5C5JA 3OTFA 2JEJA 4GX0A 3LWBA 3L71H 4HBNA 1SZTA 1Z2NX 3RGZA 3GTQA 3JD4A 1N32H 4PZ8A 3IGAC 4Q4CA 2VA2A 4LF8O 4J9NA 3PN1A 4B3TB 3S3WA 2COIA 4RU9A 4LCUC 1PX2A 4DUZO 3H40A 2WLNA 2R85A 2R87A 1TAEA 1K97A 4G27B 4IRCA 4KP4A 4ECSA 1N0NA 2V5AA 2PI5A 1TWGA 1TUBB 4QE9A 4DLKA 1FAFA 4LF5B 5FD5A 4B3SH 5LA6F 1BSMA 4M9UA 2Q7EA 2ALZA 2A3QA 4DR5O 2F66C 4FIPC 1V51A 5KFGA 3JATB 3C0FB 4FM9A 3TINA 2ZE6A 4I4TF 1DF5A 1M9NA 5LOVF 4FJCC 3H01A 4DV4O 4I4TA 4G3IA 5LOVA 3MFHA 1VF6C 4MW8A 4O7ZA 1H2MA 3BRCA 2IBKA 4XX0B 1GLVA 4JF3A 2ZR3A 3ZHQA 5IJ0B 2W0XA 4AQYB 4JI4O 3HO8A 3HOWG 3RJ0A 3WB1A 4MVUA 4WD3A 5KG3A 5IYBG 2VQDA 2BTQA 4RQFA 5H9CA 1V55C 2WDTA 3A8TA 5JVLA 1ZWIC 5KT4A 3OEHG 3GTKA 1JFFB 4YB8B 4J9YB 3GV7B 5CBFA 4JI1O 1AR1B 4X1IA 2EJ7A 3E86A 1I94H 5B1OA 4APMA 1HNZH 1NTMH 5JJJB 3CRMA 2RDJA 3CCLV 1HWYA 3SR2C 1XDNA 1V55B 5KG2A 4B7EA 2FK2A 3N43B 3CMAV 1XEQA 1PK8A 2WLHA 4TQDA 1JX4A 4GT1A 5IE9A 1ULZA 3CRCA 3RF2A 2M6YA 3STZC 4X1YA 3ZHVA 2UXDO 1EN4A 4CC6A 2CW7A 3G6XA 1A48A 5FL7G 1LUVA 5KUKA 3HKEB 1MG1A 2OT5A 3RFRA 2NU7B 3K3PA 2QEXV 4U7CA 3AW8A 2HHHB 3CD6V 1Z2PX 2ZM6H 1CE8A 4DQNA 4TV9F 2ATLA 2XAQA 3ICXA 1WR2A 1M56C 1WPBA 3TJTA 1JKJB 2ZDHA 3KYHC 4TV9A 4X65O 4ECXA 3K03A 4DV3O 2NVXA 1CKNA 2ZDIC 4PDLA 4JYYA 4JI6B 4LF6B 2ASLA 3GDEA 2AGQA 1FJGO 1TWCA 2MK3A 2N04A 1A0GA 2BQRA 5LGNA 2YI9A 1Q90D 2QM7A 5KX5B 1IBKO 2V58A 5K3WA 2LO1A 4DR4O 5IY5C 4DUYH 4YXWG 5EDWA 1M56B 5KG4A 2K1EA 2Z3YA 1J5EO 5BZBA 3U0ZA 1MSDA 3T9DA 4ED2A 1U96A 4DV7H 2XAFA 1XMQO 1R3LC 3N2GB 3R9RA 2W6PA 2YIBD 4C7UA 2R70A 5KG1A 4DL2A 3SJCC 1NZ6A 1PD3A 2AGPA 2CKZB 1Z2OX 1HNXB 5E25A 3STLC 4X9QA 2ZE7A 4OX9O 1M0TA 1S03G 1XMOB 1A0IA 1SYXB 5IYDG 5IT9W 3M9OB 3ETQA 4TWKA 1Q82W 3VOTA 2R72A 1IYDA 5LMUB 4F4XA 5C1PA 3BAAA 5C8YF 1KJQA 3N6XA 4XDJA 2Y0PA 5DQHA 2W6JG 4O3OA 3RTXA 3RIZA 5C8YA 2RCVA 4O2AB 1RSOB 4TOIA 2ODTX 1KJIA 4DV2H 5F9NA 2FJZA 5I5WA 2HG5C 2KG7A 4WFAV 2VQFO 3D3QA 1BHBA 4LFAH 2JA7A 2GSMB 2NNUA 1S5LZ 3G71V 5CE8A 5KT6A 4Z1VA 5LYJB 3Q4HB 3OR7C 1AN7A 3I55V 4YJ3B 4G2KA 4ED3A 2WSSG 3CPWU 4OPAA 3VMMA 1YTFB 1N33O 2Y0SE 2WWWA 3T1HH 3CXHF 1RJPA 3IC9A 3TY8A 4U3FH 5IDJA 3D36A 2ZXWC 1QNMA 3HOZG 2JA5A 4GX2A 5BMVB 4LFCO 1YCIA 2YSUB 2VPQA 2W8KA 3JALB 1E4GT 4JI7O 2DQ0A 4UCVA 4X20A 2AGOA 2V4QA 3UO2A 4DR3H 4PDBA 3MDSA 1R1BA 2QM4A 1IBMO 4NXNH 2A79B 3ZHTA 2GHYA 3UQ8A 5D1PA 3RB4A 3AK3A 5GONB 1AI6A 3ZMSA 3RB3A 2Z0AA 1SQBH 1N36H 2ZNIA 3MWDA 5KKNB 1JX9A 2H8PC 5EC2C 5IWAB 4Q43A 3MHHC 1I1KA 1BGYH 2V4DA 5KFAA 2RDIA 4C5BA 4LSXA 1QU7A 5LP6B 1LR1A 2YXHA 4I50B 2HGSA 5BR8H 3G8CA 3QVNA 2E75B 5KFVA 2VUMG 2ZIOA 1GH6A 2Q7GA 1L1FA 1WNSA 3L70H 2VQEH 4FFNA 3HOXG 1GAXA 3JD0A 1Y1WG 3QO7A 1VQLV 1VAJA 4PA4A 2Y4TA 4JI8B 3K5NA 2FB5A 3CXCU 2B9ZA 1Q6UA 1URFA 1SQQH 4DV5O 1YJWV 3TEKA 1SESA 3AG2B 4DW1A 3ZS8C 4X88A 1GK9A 5DISC 4PDRA 4UVAA 3VNNA 1I2LA 5BPHA 2RGRA 2YI8A 2ZQMA 4RUEA 4EBEA 1OCZB 2C2DA 1JVMA 3L72H 2YEVA 2WLLB 4DR6O 1MABG 3R66A 4ICGA 1RFYA 1F23A 4RCNA 3SE7A 1KP2A 4ZKIA 2C00A 3MR2A 3QQMA 1FFXA 2RN9A 3ZX6A 5KG6A 4F6RA 4O7LA 5JQWA 3HOUG 4CH3A 2PYJA 2A0LA 2PBZA 1I08A 5CR5A 2HR3A 5DG9A 3ZMZA 4E2LA 1S72V 3MFIA 3T5JA 3OFNG 1ZHSA 1YTFD 4A3LG 4DXWA 4J11A 4EB6A 3T9AA 1VQ5V 1ZTEA 2QGNA 2VWJA 2UXXA 5F9LA 3C3SA 2PYLA 4BIOA 1R6TA 3R5FA 2BSKB 3OR6C 1WAZA 5AG2A 2GUZA 3SNOA 4JI5B 1BQZA 5DM6V 1F7YA 5EBWC 4MV1A 3CB2A 2F93B 3TXSA 4GZRB 3RT3C 1OZ0A 4YAKB 2A06H 4XBFA 4JAUA 2OIGA 5CMUA 1G1XB 3GLKA 4JI2H 4J9RA 4O4JB 4LF8H 4QW8A 3MJFA 5BPFA 4M7EA 1MNGA 4DUZH 4FS1A 5C93A 4LR3A 4MVQA 3UT5B 4FLWA 4TUYF 4BWAA 4HNVA 4RUAA 3RYIA 4DR7O 4TUYA 3E8FA 1FXHA 3L73H 2YL2A 2UUBO 3CE2A 3RUPA 4RAYA 2UUAB 3CMEV 4KXRA 1P16A 3QTCA 5L1LA 5IYZF 3PFFA 2KQXA 4W4LA 2FMAA 1ENVA 5JUMA 1VBGA 2Q9LA 5IYZA 4Q8EA 2OYQA 4DR5H 2DE0X 3ABTA 3EVKA 2W57A 3CRRA 2PMZE 3F8NA 4DV0H 3BVOA 4JV5B 1Q8IA 4RO2A 4DV4H 2QWOB 1W96A 4KHPH 2IJKA 3K9AA 4X64O 4LF7B 1A32A 2R7LA 3M7MX 1H38A 1S3JA 4DR1H 4JI4H 5B1BC 4LWSA 1ORQC 4UXNA 2HJDA 4ZHQB 4BWSC 5KFWA 2ZT9B 3HKBA 2Z04A 2R8JA 3ABMB 3NBYB 2V59A 3GTGA 2B63G 1AUXA 5JVDF 3ZRSA 5D1OA 5EWGA 5JVDA 2JS3A 5EWEA 3TW6A 3RBZA 3P3NA 2HGXA 4JI1H 4GYCB 2Y4RA 2ZR2A 3B8NA 3K5LA 2J6UA 1H2LA 1S9FA 1W59A 4X62O 3BQ0A 3H1HH 4J7JA 4B3MB 4ED6A 3A0HZ 3IAYA 3K3VA 3JAMN 1OCCC 3QO8A 1VF5B 2D3OW 4Q4DA 3HKCB 1VQPV 2ITDC 1VMGA 3AK2A 1RK5A 5LGUA 5KG7A 2E74B 4B3TO 3K58A 4JI3H 4QGPA 1EBOA 1FXVA 5CB4B 3CSWA 2SCUB 1XI1A 3U55A 5KFHA 5KFIA 4FM2A 2OIEA 2DWCA 5KFRA 4BBRG 5DG8A 2HVSA 4X65H 4YQWA 1M6VA 1P84F 2VRZA 1NS1A 4UCUA 1FJGH 1K5SA 1IBLB 3N41B 4J9KA 5I5TA 4HN2A 3N27A 4TM5A 4DR2B 1VQ7V 4K0KB 3KAKA 3LULA 2DPIA 4DR4H 2ASJA 4ED0A 4O86A 3UM7A 1XL6A 4X8AA 3PZPA 1WCMA 2WA3A 2CH7B 1VARA 3BJYA 5KFFA 3WB0A 2XNDG 3JARA 5GTHZ 1FPOA 4YR3A 2QKCA 3WB2A 4AQYO 4LF9B 1VS0A 4EYIB 1X59A 1WJZA 1D5NA 3JSNA 3QFFA 1THZA 4P30A 5KMGA 3OMIB 2H94A 4OX9H 3GTPA 3RAXA 5LXTF 5LMNH 2EJRA 3B2EE 4RUFA 4PD4F 2XT9A 3ORRA 1WP7A 5LXTA 3WO1A 3RYFB 1YVWA 1BQ0A 1QR9A 2EIJC 5KFYA 1X4TA 1YHQV 2W70A 4NXMH 2HG8A 1M1KW 2AW9A 1M57C 5L3CA 1EKPA 2AQ4A 4F4YA 1KJJA 2YIDA 4I5SA 2EX3A 4O7YA 4YJ2B 3GIJA 2EIJB 1KKDA 4DV6H 1J95A 3MWEA 4Z2WA 4PDVA 3CEBA 3HBLA 3Q1KA 2NLJC 1AR5A 1M57B 2QR4A 2CTWA 1N33H 2YIBA 3LSUA 4N21A 2HHHO 3GIMA 4U3JB 3HPLC 4R7CA 2ZE5A 2YS6A 1ZSPA 1BT8A 2V7QG 4QE7A 4LF6O 2WLIB 4JI6O 1E79G 2XCAA 3UO3A 1GO3E 3FYEB 1ZL8A 3QF7A 2OWOA 2GQSA 4FZ1A 4JI7H 3PW5A 2DW4A 4IYHA 4MTFA 4OPHA 4CBCA 4WCEV 4GC6A 3JATA 1UNNC 1WLEA 3V4ZA 1RYRA 2P0AA 1JJOA 5IYBO 3UZOA 2ZCEA 3JASB 5I60A 4O3SA 3B40A 5A2QW 1EYZA 3ZBHA 3CCEV 3ABKC 3A2FA 4UCOA 5B5EZ 5IJ0A 4EBCA 1N32B 3OSPA 2JA8G 4MTGA 5JJNB 1HNXO 4HQ6A 5BWTA 2EIKC 4DL4A 1VF6A 2FLLA 2E2HA 3J7AU 3ABUA 2W9CB 1XMOO 4MTOA 3ABKB 4JZ2A 2BOBC 3ETHA 2XAJA 2CQYA 4MTDA 4RAZA 3L4KA 3VQVA 1JFFA 3E8HA 5LMUO 2EIKB 4LNUB 2X0LA 1B6QA 4B3SB 5HFLA 4UV9A 1IX9A 4LMYA 3BA8A 2R8KA 3W7SA 5IJ9A 4HYKA 4JI0B 2W6IG 4GLWA 4O4IB 4DO2A 2ODMA 4ZBMA 5EBLC 5LGTA 1NH2B 4DV5H 1L2ZA 2JGUA 1VBHA 1US6A 4E4TA 5J2TB 2VR1A 5LBQA 1KEEA 2ATKC 2NR5A 4RB0A 2W7OA 4QWDA 1AI4A 1MMMA 1Y74A 2JVDA 4I55B 3SYPA 5KFDA 3ZHUA 1K34A 2N74A 1NJIW 2EJ3A 3I12A 3TY9A 2RJZA 3ZHSA 3V6JA 2DZDA 2NU6B 3JD2A 1F4MA 2GPSA 3FFQA 4QSHA 2GPWA 4O4LF 2R9IA 4FFPA 3RBEA 3QWUA 3CP1A 1K33A 3A0RA 4O4LA 4FU0A 3J80W 4CS2A 4CS3A 4KFMA 4QPJA 2HDKA 5DLGA 1I0HA 3T9EA 4J9OA 5KHIA 1K4CC 3JAWA 1I94B 3MR6A 1NQTA 1HNZB 4NTWA 2ZDIA 1IURA 2R7ZA 3E22B 3N2GA 2UXBB 4PZ7A 4GKKH 3HKZA 2CAZC 1P7GA 3ZMTA 4YP3A 4XZ3B 2HJFC 4RNOA 2I87A 5JCOC 1OCOC 3N8DA 2KB1A 2J6SA 5C4XG 2O03A 1QLEC 1Z5WA 4QW9A 5IWAO 1B06A 4PA7A 2ZM6B 4Q0YA 1JR9A 4YHHH 1BZKA 4RQEA 2P22C 2UUCH 4GX1A 2JEGA 5BYBA 1OCOB 1FKAO 4J9PA 1XNRB 5KHJA 3E2EA 4ZOLB 3GV5B 4O2AF 2YUAA 1QLEB 1YXBA 1K8AW 1CQJB 5KFSA 1I6UA 2OLSA 3SPHA 4O2AA 4UFZA 5LA6A 1RSOA 2RNBA 3TCUA 1XDCA 3J7AK 3JZIA 5LYJF 3DSQA 4DK0A 3J81N 4JI8O 4MV9A 5J2UF 2KSWA 2UUBH 2ZINA 1RK6A 4DV7B 3NBZB 2YXYA 3Q8QB 1Z5VA 3Q4HA 2CK3G 5J2UA 3CCRV 4YJ3F 1OJHA 1L0LH 1VQ8V 3W7WA 4LH7A 2UVWA 1W2BU 4RWUA 4YJ3A 2PI4A 5EBMC 2PN1A 5BWXA 1SERA 4NYKA 3V6KA 4IR1A 1KYOF 2JGDB 4QJFB 5B66Z 1JQ0A 1N34O 1OWTA 4A3BG 2EIMC 4JTAB 1CKOA 1RPRA 5BMVF 4WBNB 3AG1B 1Q7YW 4X64H 3DTUB 4F6EA 1I7FA 3FAVB 2YXLA 5BMVA 3W1GA 1DAAA 2IW5A 3M4IA 3JALA 1NH2D 3RGXA 5L1JA 2Q0AA 1H2NA 3D3IA 2IA6A 4HNAB 2EIMB 3IJ4A 2P06A 4MVMA 1SQPH 4DV2B 1XHXA 4ED7A 2EILC 2COJA 1SF9A 4LFAB 2WPDG 2BQUA 5GONF 1KD1W 5GONA 3ZMVA 2DWDC 3PW0A 4IHJB 3E8GA 3FDSA 3K5IA 3HB3B 1SS3A 5KT2A 1LUWA 2EILB 4JI5O 2P67A 2EBOA 5KA6A 2LJ2A 3DGEA 4ECRA 2F4VH 4TQFA 3T1HB 3U11A 3G6BA 5KAFZ 3CC7V 3GQCA 1RP3B 2E3CA 5IYCG 2Q0OC 3UYYA 4ECWA 3C3TA 2AZ2A 2JEFA 3PW7A 2O57A 3ZIAG 3ETGA 1IOVA 3N44B 4B3TH 1WSCA 4MTXA 4QNHB 1V54C 1TUEB 4B3RH 5DEDA 3U54A 1OHHG 5DGBA 3SI8A 3K5HA 3OMNB 2AHZA 1PNLA 3B4SA 3SPIA 1NT2B 4PBCA 3RVZA 4DR3B 2UUAO 3CQZA 4NXNB 5L1IA 3OUZA 4X66H 4GC7A 1V54B 4C5AA 3GIKA 1XNQB 4WHXA 5KFMA 2JS5A 4DL5A 3EYYA 4A3DG 5BYAA 2R8IA 1NKDA 3FKIA 4A3JG 4ASUG 2QTOA 2NU8B 1N36B 4FE2A 1UFIA 4Q6GA 4A3GG 2L6LA 5DECA 4TQRA 2WLLA 4JV5O 2BCCH 3MR3A 2KKWA 3BCCH 2CNUA 5EOYA 1C30A 2QTSA 1JDBB 4F4ZA 4LF7O 3AX6A 3ZRWA 3OTOB 5B1AC 4A3MG 1Y6XA 2GV9A 3OW2U 2DLNA 3H1LH 1EZ1A 2P4KA 4Y8VB 2H3OA 3DC6A 2VQEB 3RW0A 3KREA 1VEWA 4PHZA 1H2SB 4J0MA 2IJIA 4QWEA 5KT3A 4GKJB 5B1AB 3H4BA 4O2BB 4MAMA 2A7WA 5FLXN 4EEQA 3OD4A 2QWQB 3WU2Z 4BY7G 2M7WA 1FVIA 1CS0A 1QQCA 4DRXB 4FZ0A 2ZDQA 5T14A 5C44G 2IP4A 4FM1A 2QB5A 2YZMA 4BBSG 4XYLB 3GTJA 1Y1WA 1NR1A 5KT7A 3RV4A 5CA0B 4B3MO 2LFSA 2RGVA 1Z2GA 4F4LA 4K8ZA 1AUVA 4ED8A 4O4JF 4I4TB 5LOVB 3Q2OA 4DRFA 2HHFA 4O4JA 5L9XA 4FFRA 4FPPA 1T36A 5EC1C 2CTRA 3VQXA 2WTFA 1O9HA 2P6JA 3UT5A 3GIDA 1GSHA 3LUTB 1KP3A 3CX5F 2BTQB 3BQ1A 1P4RA 3MAQA 4AHCA 1IBLO 5LP6C 1IYEA 5D5QA 4DR2O 4K0KO 4EKWA 3K04A 2ADQB 4X1IB 4QWBA 4O4HF 2Q73A 4FFKA 3CRQA 4RUCA 3OHBA 4O4HA 1KT8A 2QKAA 1AROP 5JQGF 1GRJA 3I4MG 2N05A 5JQGA 2UXCH 3KALA 4ZHQF 4DK1A 4ECVA 4X1YB 4JI2B 4LF9O 4UB8Z 1BS3A 3AG2C 4ZHQA 4ZIBA 2A1HA 5KFNA 3MHSC 3KG2A 4CKBA 1I3QA 4YR2A 1GSOA 2JA7G 1ROPA 2JEXA 3JCUZ 3D8CA 1OCZC 4AILC 4TV9B 2Q67A 2CNVA 4ME6A 1SFOA 3H1JH 3K3WA 2UXNA 4PV1B 1V9PA 1G2WA 2QE7G 2F23A 2FLPA 3RYCB 1HR0H 1C3OA 1I5XA 5IP7G 4MTEA 1K92A 1PNKA 2WE6A 5A2QN 4DV0B 1OV9A 3N2KA 1I7LA 3BQ2A 4LC1A 1VQ4V 4KHPB 3H0GA 2PVPA 3WO0A 5EK0A 3T7AA 4BXXG 3G6EV 1ZETA 3QG5A 5EIBD 1WRVA 2JIZG 5CB4F 4J9MA 5KAIZ 4HR7A 1JXLA 5KFTA 4DR1B 4J42A 5CB4A 3T5HA 4MSWC 2F43G 4TVIA 1F4NA 3VQYA 3CC2V 5BWUA 3AG4B 2UU9O 3NR7A 4JYAB 1N0JA 3K0GA 3DAAA 1XHZA 3EXAA 4LF4O 2FK3A 5J9PC 1HNWB 2HVRA 2YCHA 4FFBA 4NTXA 2ZE8A 4YY3H 1KECA 1Y66A 4DAAA 4O3NA 3SYCA 3K9SA 3T4DA 2HLDG 1E4EA 3TW7A 4P9OA 1IXMA 3TIGA 3BEHA 4K8XA 4AYBA 3KTMA 3OUFA 2QSAA 1EN6A 1Y76A 3WWJA 3BY6A 2XHBA 4DV1O 3ABLB 4M0JA 2KG7B 2CH7A 5LHIA 3RGBA
chains in the Genus database with same CATH topology
4HBNA 1ZAUA 3W5OA 1Z2NX 3RGZA 3RYFB 2HEPA 1B04A 1N32H 4PZ8A 3CVZA 1X4TA 3PN1A 4B3TB 4PI0A 3NC0B 2F95B 4JI3B 3RWRD 4NXMH 5LA6B 4RB1A 1TAEA 2CW8A 4FLYA 1HR0B 3LNNA 2EX3A 4YJ2B 3VQWA 1FKAH 3RYFA 4DV6H 1TUBB 4CC5A 5J2UB 1FJGB 4LF5B 4UCRA 4PZ6A 5FD5A 4B3SH 4RB3C 2IM9A 2Q2TA 2Q7EA 2F66C 2HHHH 3HKDA 3T1YB 1N33H 3JATB 2YIBA 3C0FB 4FM9A 4U3JB 5KHHA 1WN7A 3SJAC 4YJ2A 4I4TA 1ZHQA 4LF6H 5LOVA 4JI6H 3BA9A 3BRCA 4YY3B 3QF7A 2OWOA 5IJ0B 4JI7H 4AQYB 4FLVA 3BABA 3RJ0A 3WB1A 3JATA 4E6NA 4OX9B 1JJOA 1N34H 2ZCEA 3JASB 5LMNB 2BTQA 5A2QW 2WDTA 4EFEA 3A2FA 4UCOA 5IJ0A 4D7SA 5FD6A 1JFFB 1XNQH 1D5AA 1N32B 4LF8B 4X1IA 1I94H 1HNXH 4APMA 1HNZH 5JJJB 5JJNB 4DUZB 4A2AA 3SR2C 1XDNA 4NXMB 1XMOH 3JASA 1P49A 3N43B 4IAJA 4ETSA 4TQDA 1L8DA 3GB8B 4MTDA 3RF2A 4RAZA 4ZI7B 3OTOH 3L4KA 5JH7B 4X1YA 3VQVA 1CKNB 5LMUH 1JFFA 4D7TA 4DV6B 1S5JA 4CC6A 2CW7A 4LNUB 4LSAA 3HKEB 3RFRA 4B3SB 2CFMA 4DR5B 4LMYA 3BA8A 2HHHB 1Z2PX 2ZM6H 5IJ9A 1N33B 3RR5A 4GKJH 3ICXA 4JI0B 1XK5A 1WPBA 4O4IB 3KYHC 4DV3H 1SEIA 4TV9A 4DV4B 4ZI7A 4DV5H 5JH7A 1CKNA 3HKCA 2PUSA 4JI6B 4LF6B 1L2ZA 2JGUA 3GDEA 5J2TB 4LNUA 1IBKH 2YI9A 4RB0A 5KX5B 4JI4B 3JSLA 4DUYH 4I55B 1FFXB 2JVDA 1J5EH 1JMKC 4GLXA 3SJBC 3U0ZA 1G6UA 3TY9A 2RJZA 4O4IA 1BJTA 5D5PA 1XMQH 1N34B 4DV7H 3N2GB 3FFQA 2YIBD 5K1PA 4EB6B 5J2TA 2R70A 3QWUA 2WYOA 1TVKB 1TA8A 4O4LA 3J80W 3SJCC 4CS2A 4CS3A 4JI1B 4I55A 5KHIA 1O9GA 1Z2OX 3JAWA 1I94B 1HNXB 5C8YB 1HNZB 1M0TA 1S03G 1XMOB 1A0IA 1SYXB 3E22B 3N2GA 2UXBB 4PZ7A 4GKKH 2CAZC 3J81W 5IT9W 4EQ5A 3ETQA 1TVKA 1DGSA 2UXDB 2F1MA 2R72A 5LMUB 3BAAA 3N6XA 5JCOC 3RTXA 3RIZA 5C8YA 4O2AB 5IWAH 2O03A 1Z5WA 4FLUA 4TOIA 4DV2H 2VQFH 4Q0YA 2ZM6B 1CKMA 4YHHH 4LFAH 4X65B 3FMAA 4DV3B 2P22C 2UUCH 4BW9A 5LYJB 3GJXB 1XNRB 5KHJA 1AN7A 4ZOLB 1Q43A 1E4FT 1I6UA 1IBKB 4YJ3B 4DR4B 4O2AA 1SQGA 4UFZA 5LA6A 1RSOA 3J7AK 1J5EB 4JI8H 3T1HH 3DSQA 4X20B 4DK0A 4UCTA 4MV9A 3TY8A 1XMQB 2ZINA 2KSWA 4DV7B 3NBZB 2UUBH 5JCOA 1Z5VA 3RYHB 1TUBA 5J2UA 4LFCH 5BMVB 4LH7A 4YJ3A 3JALB 1E4GT 2XIGA 3N42B 1BGWA 4UCVA 4U3JA 4X20A 3HKBB 4IIJB 4MV7A 1GYFA 3ZEDA 2HVQA 1CKOA 3KAJA 3RYHA 4GKKB 4WBNB 4O4HB 4DR3H 1IBMH 4X64H 4PDBA 2QM4A 1I7FA 4NXNH 2YXLA 5BMVA 3W1GA 3UQ8A 5D1PA 3M4IA 5GONB 5JQGB 4UCSA 3JALA 3RGXA 1SQFA 2Q0AA 3BPZA 1N36H 2ZNIA 4HNAB 1S68A 2ZNJA 5IWAB 4IIJA 4JYAH 4DV2B 2VQFB 1XHXA 2V4DA 3BHPA 4YHHB 4LFAB 4LSXA 5LP6B 1HNWH 2HGSA 4I50B 3HXLA 5BR8H 2UUCB 5GONA 3W1BA 4L8JA 2R9AA 4IHJB 3H20A 2ZIOA 1WH2A 2Q7GA 1WNSA 2VQEH 4JI5H 4TV8B 5K1XA 2PGGA 4CH6A 3K5NA 4TQFA 4JI8B 3T1HB 3U11A 2F4VH 1KU9A 1KMIZ 2E3CA 3N2KB 4LFCB 3ZS8C 5KHKA 3HKEA 4JI7B 5DISC 3N44B 4B3TH 4F6RB 3VNNA 2RGRA 4B3RH 4TV8A 2YI8A 4DR6H 3MWMA 1NT2B 2UUAH 4FLTA 3DF7A 4DR3B 1IBMB 4X1KB 4NXNB 2MCTA 4X66H 5KX5A 5FLXW 4FFBB 1XNQB 1FFXA 2JS5A 3JARB 2HIVA 4F6RA 3EYYA 3N40P 3T1YH 1N36B 4Q6GA 3CHXA 4CH3A 2PYJA 2UU9H 5KMGB 4JV5H 4R7RA 4FLZA 1ZHSA 4LF4H 2KKWA 4LF7H 5EOYA 4EB6A 4X1KA 1SKVA 3OTOB 2VWJA 3TY5A 2GV9A 1T5EA 2PYLA 2VQEB 4JI5B 3K5MA 4PHZA 2YIAA 3E22A 1H2SB 3KXYT 4J0MA 4DV1H 4GKJB 3CB2A 3RYIB 2F4VB 2F93B 4B08A 3SGIA 4TUYB 4O2BB 1XQ8A 4DV5B 4CH4A 4EEQA 3CSXA 4JI2H 2ZIMA 3K57A 1FVIA 4O4JB 4LF8H 1QQCA 4DRXB 1P8LA 5EYPB 4M7EA 4DUYB 1Q5OA 1Q3EA 5IYZB 4FM1A 4DUZH 4LR3A 3UT5B 4FLWA 4B3RB 4DR7H 4BWAA 4RB2C 3HKDB 3RYIA 4B3MH 4DR6B 4TUYA 5CA0B 5LYJA 2RGVA 4O2BA 2PZSA 4K8ZA 1SA0B 4RAYA 1TGOA 2UUAB 4ZOLA 4I4TB 5LOVB 1P16A 3QTCA 4DRFA 2RQ6A 4O4JA 4X66B 4DRXA 5EYPA 2E5LH 5IYZA 3VQXA 2OYQA 4DR5H 4PI2A 4LH6A 1O9HA 3UT5A 5ITZB 2W57A 4RZQA 5CA0A 2UU9B 2PTMA 3F8NA 4JI0H 4DV0H 4JV5B 1Q8IA 4DV4H 1SA0A 4KHPH 4LF4B 2VOBA 4LF7B 2BTQB 1IBLH 4EFBA 3MAQA 5D1OB 1HW7A 5JVDB 2BTOA 3M7MX 4AHCA 3JAMW 5LP6C 4DR2H 4K0KH 5D5QA 4DR1H 4JI4H 5FPOA 3K59A 4ZHQB 5ITZA 4BWSC 4X1IB 3HKBA 3NBYB 1MZBA 4A2BA 4WBNA 4O4HA 4DV1B 2P5OA 5LL6b 3L2PA 4FVMA 5D1OA 2Q7HA 5JQGA 5JVDA 4FLXA 2UXCH 2PY5A 3KALA 4DK1A 2FE3A 4LF9H 4X1YB 4JI2B 4JI1H 4HNAA 4GYCB 4ZHQA 4ZIBA 3K5LA 4LFBH 4CS4A 3L4JA 4X62H 3THOA 4DR7B 1M0WA 2UXBH 5LP6A 5IJ9B 4B3MB 1VF7A 4I50A 3S24A 5FPRA 2UUBB 4AILC 3IAYA 4NVPA 4TV9B 3K3VA 4IHJA 5CA1B 4CH5A 1O75A 3HKCB 4FM0A 5FNVB 5EZYB 2E5LB 3K58A 1V9PA 4JI3H 4I7HA 5CB4B 2VWKA 3RYCB 1XI1A 1HR0H 4FM2A 2VUGA 4MTEA 1M4UA 2HVSA 2WE6A 4KL1A 4X65H 4DV0B 3N2KA 4I9QA 4KHPB 4X64B 5CA1A 2HIXA 4UCUA 1XNRH 1FJGH 1IBLB 3N41B 4LF5H 3QG5A 5EIBD 4DR2B 5FNVA 4K0KB 3KAKA 1YEWA 5EZYA 4O4LB 4DR4H 4DR1B 5CB4A 2ZJTA 5KHGA 2UXDH 3RYCA 3VQYA 3U10A 3JAWB 1M93A 3IG0A 4JYAB 3LMLA 3JAKB 1XHZA 1QHTA 1HNWB 5BR8B 5LXTB 2HVRA 2YCHA 3WB0A 4FFBA 4YY3H 2UXCB 3JARA 5EIBC 5JJEB 2Q2UA 4AQYH 3WB2A 4LF9B 1VS0A 1M5IA 3JSNA 2VPSA 3K5OA 4K8XA 5KMGA 1X9NA 4OX9H 4LFBB 3JAKA 2QJ1A 4X62B 2XHBA 5LMNH 3B2EE 3OTFA 5LXTA 3RGBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC B;  1ZAU A;  3W5O A;  4GLX A;  3W1B A;  3TY9 A;  1B04 A;  2UU9 B;  4PZ8 A;  1N34 B;  4JV5 B;  3PN1 A;  4B3T B;  4LF4 B;  4LF7 B;  3NC0 B;  4JI3 B;  4EFB A;  5D1O B;  3QWU A;  1TA8 A;  1TAE A;  4JI8 B;  1HR0 B;  3T1H B;  4JI1 B;  5FPO A;  1I94 B;  1HNX B;  1HNZ B;  4LFC B;  4CC5 A;  1FJG B;  3NBY B;  4LF5 B;  1XMO B;  4UCR A;  1A0I A;  4PZ6 A;  4DV1 B;  4JI7 B;  2UXB B;  4PZ7 A;  5DIS C;  2Q2T A;  3L2P A;  4EQ5 A;  3VNN A;  5D1O A;  3T1Y B;  1DGS A;  2UXD B;  5LMU B;  3BAA A;  4JI2 B;  3RTX A;  4DR3 B;  1IBM B;  3BA9 A;  4TOI A;  4NXN B;  4YY3 B;  4DR7 B;  2ZM6 B;  1CKM A;  2OWO A;  4AQY B;  4B3M B;  1XNQ B;  3S24 A;  5FPR A;  4X65 B;  2HIV A;  2UUB B;  4DV3 B;  3BAB A;  3GJX B;  1N36 B;  4E6N A;  1XNR B;  4OX9 B;  1IBK B;  5LMN B;  4DR4 B;  2E5L B;  1V9P A;  4UFZ A;  4EFE A;  3OTO B;  1J5E B;  3TY5 A;  4UCO A;  2VUG A;  4UCT A;  1N32 B;  2HVS A;  4LF8 B;  3TY8 A;  1XMQ B;  4DV0 B;  4DV7 B;  3NBZ B;  4KHP B;  4X64 B;  2VQE B;  4JI5 B;  2HIX A;  4UCU A;  4DUZ B;  1IBL B;  1XDN A;  4NXM B;  4LH7 A;  4DR2 B;  4K0K B;  4GKJ B;  2F4V B;  4DR1 B;  3SGI A;  4UCV A;  3GB8 B;  4DV5 B;  4EEQ A;  1CKN B;  4DV6 B;  4JYA B;  4CC6 A;  1FVI A;  2HVQ A;  1CKO A;  1P8L A;  4B3S B;  4GKK B;  4DUY B;  1HNW B;  4DR5 B;  5BR8 B;  2CFM A;  2HVR A;  3BA8 A;  3W1G A;  2HHH B;  3UQ8 A;  4B3R B;  5D1P A;  1N33 B;  2UXC B;  3RR5 A;  4UCS A;  2Q2U A;  4JI0 B;  1XK5 A;  3KYH C;  4DR6 B;  4LF9 B;  1VS0 A;  4DV4 B;  3JSN A;  2UUA B;  1CKN A;  4LF6 B;  4JI6 B;  1S68 A;  5IWA B;  3GDE A;  1X9N A;  4LFB B;  1P16 A;  4DRF A;  4DV2 B;  4X66 B;  2VQF B;  4X62 B;  4YHH B;  4JI4 B;  4LFA B;  3JSL A;  4LH6 A; 
#chains in the Genus database with same CATH topology
 3JD1 A;  2C2E A;  2HEP A;  4I0X A;  4QIW F;  3RBD A;  2DMX A;  1N32 O;  2MW2 B;  3WFV A;  4L1K A;  3PJS K;  4QIW A;  4MT8 A;  3NC0 B;  2DYS C;  1B3Q A;  4JI3 B;  3RWR D;  3P3P A;  2Q7D A;  3H4D A;  4TT3 G;  2CW8 A;  4FLY A;  3ZHR A;  1YIT V;  2HVK C;  2JA6 G;  2B1I A;  3WG7 C;  4WFH A;  4NZM A;  2QKS A;  5CBH A;  3VQW A;  1GMG A;  1FKA H;  3RYF A;  2W9B A;  2IU0 A;  4QWC A;  1Y4M A;  1FJG B;  2L35 A;  1DV2 A;  4IRD A;  2DYS B;  4UCR A;  4PZ6 A;  5I5U A;  4F4W A;  5E79 Z;  3IC7 A;  2LGQ A;  5DN6 G;  2E5L O;  4B3S O;  4MV8 A;  2ASD A;  3JRX A;  3HKD A;  3T1Y B;  3CC4 V;  3WG7 B;  5CAE B;  4NKG B;  4YJ2 F;  3F7Y C;  4JI0 O;  5KFP A;  2UVU A;  4JV1 A;  3ABM C;  4EEY A;  1E1R G;  4YJ2 A;  3K0D A;  3C90 A;  3G80 A;  2YZN A;  4YIP A;  4CZZ A;  1IDS A;  1B6S A;  3FB5 C;  2YU9 A;  3LDE A;  3VBB A;  3CCQ V;  5DGH A;  2ETN A;  3FX7 A;  1NU1 H;  2GTS A;  2Q69 A;  4QWA A;  1S0V A;  2DJV A;  4OX9 B;  1N34 H;  1GM9 A;  1KJ9 A;  3FKS G;  5LMN B;  4JXU A;  3AG7 A;  1Q81 W;  2IH1 C;  1Q6I A;  2DPJ A;  1I50 A;  1YSC A;  3WWH A;  1I94 O;  1I7N A;  1HNZ O;  2YWV A;  4LFB O;  4A2A A;  4NXM B;  3JAS A;  4CMD A;  4ETS A;  1EFR G;  1MZF A;  2UXB O;  1K1S A;  1L8D A;  3ZN1 A;  1K73 W;  2M05 A;  4K35 A;  1EN5 A;  1MOF A;  2UXD H;  4ZI7 B;  5JH7 B;  4Q44 A;  4D7T A;  4DV6 B;  1S5J A;  3ETJ A;  1TWF A;  1Y14 B;  3M8A A;  3CCU V;  2EIN C;  3GV8 B;  4JUZ A;  3T2M A;  2XD4 A;  5DQG A;  1RPO A;  3T99 A;  1N33 B;  2Y48 A;  2ZM6 O;  3OUU A;  4DV3 H;  2R92 A;  4IWY A;  1EHI A;  2YW2 A;  2Y0S A;  2PUS A;  4IL6 Z;  1XNR O;  4HNT A;  2LW7 A;  2R93 A;  2EIN B;  4LNU A;  4LF5 O;  4J10 A;  4F50 A;  1IBK H;  2ARH A;  5KFE A;  1GKF A;  1UC9 A;  4O3R A;  3JSL A;  2COG A;  4O7R A;  1FFX B;  5C1O A;  1J5E H;  1JMK C;  4HYO A;  1QLN A;  1FYJ A;  4O4I F;  3SPG A;  5DAA A;  3GIP A;  3CJH B;  4O4I A;  4J9S A;  5D5P A;  1XMQ H;  2EZP A;  3FYI B;  3V4S A;  5J2T F;  4DV7 O;  1H8H G;  2QM8 A;  5K1P A;  4A3I G;  4EB6 B;  5J2T A;  1LNQ A;  2GBO A;  1TVK B;  1TA8 A;  5H6Q A;  4I55 F;  2HKO A;  1EM1 A;  4I55 A;  3T54 A;  3DXR B;  3Q8S B;  4JGS A;  2FP4 B;  2W6Q A;  2QF7 A;  4PEL A;  1ET0 A;  4H44 B;  2WAQ A;  5CA3 A;  4NLG A;  1I1M A;  4MVZ A;  4EQ5 A;  4HZ3 A;  2QA4 V;  4J9Q A;  3ZN0 A;  4YIO A;  1DGS A;  5DG7 A;  2X7R B;  2FKX A;  5L3B A;  1KJ8 A;  1ZQ7 A;  4FFM A;  1T3N A;  4X89 A;  2W7P A;  1KQS U;  4A3E G;  3F7V C;  4FLU A;  2VQF H;  2WLK A;  3H1I H;  4EGQ A;  1RM1 B;  1NTZ H;  3GIQ A;  4LFA O;  3FMA A;  1B33 N;  4K3A A;  2YIC A;  4JZG A;  4BW9 A;  3GJX B;  3ML0 A;  3DC5 A;  4MA5 A;  2JJ2 G;  1OBD A;  4RAI A;  4O84 A;  5KFC A;  1E4F T;  3PO2 G;  1DK1 A;  4DL3 A;  3SPC A;  4L87 A;  2CNQ A;  5JWP A;  1SC5 B;  1KBH A;  1IVS A;  1GM8 A;  2FPG B;  1KKC A;  5IT9 N;  4UCT A;  1S10 A;  4EG0 A;  4O7W A;  3T1H O;  4Q8F A;  2Q4P A;  5JCO A;  3KZI Z;  3RYH B;  1TUB A;  4BAY A;  1WPX A;  2ZDG A;  4LFC H;  3GTM A;  3PW2 A;  4IT5 A;  1SQX H;  2DWE C;  5I5S A;  3T9F A;  2R84 A;  2XIG A;  2C28 A;  1Y1V A;  1BGW A;  4LWS B;  4R6Z A;  2LW1 A;  3HKB B;  3PO3 G;  4IIJ B;  4MV7 A;  1GYF A;  1YZB A;  3ZED A;  4IRK A;  3KAJ A;  4GKK B;  1IBM H;  5KFB A;  3K79 A;  3OM3 B;  2WB1 A;  3M99 B;  5CN0 A;  4DR3 O;  1W0J G;  3M9N B;  2Q6A A;  4I9W A;  3E8B A;  1EKF A;  3R23 A;  5DQI A;  4NXN O;  4EGJ A;  2VA3 A;  1XNQ O;  2WLM A;  3BPZ A;  1S97 A;  1EZJ A;  1N36 O;  2IBZ H;  4FFL A;  3L75 H;  2C2A A;  1VQK V;  1PL4 A;  3BAC A;  5FR9 A;  3TQT A;  3BHP A;  4YHH B;  4FFO A;  3FAV A;  1FS0 G;  5DMX A;  3HXL A;  3OSN A;  4MS2 A;  2UUC B;  1ZLZ A;  1UJW B;  3OTO O;  4L8J A;  2OCC C;  5HNE A;  5HFM A;  2QWR B;  2R9A A;  3RN4 A;  3RAQ A;  4O83 A;  3K06 A;  4FS2 A;  1H2K A;  5KFU A;  2VQE O;  2WA4 A;  3JCZ A;  1R3I C;  4TV8 B;  4O7N A;  3BFR A;  3SPJ A;  4CH6 A;  4GKJ O;  5H80 A;  2OCC B;  1KMI Z;  1XBL A;  4IHJ F;  3TQ1 A;  1EUC B;  3RVY A;  2Y0I A;  2D2C B;  4A3F G;  3PR5 B;  3I56 V;  3HKE A;  1MSW D;  4GUN A;  1CP9 A;  2XUM A;  4D6T H;  2R86 A;  1JPX A;  1I1L A;  2XAS A;  1DF4 A;  4G28 B;  2B1G A;  1NI8 A;  1FD9 A;  2QYZ A;  4DR6 H;  4NTY A;  2QWN B;  3CEI A;  3ETD A;  4FLT A;  3DF7 A;  5H6R A;  1FXK C;  5B1N A;  4NYE A;  3SYO A;  5HV6 A;  5KX5 F;  2DYR C;  4X1K B;  2MCT A;  1GN6 A;  2FPI B;  5KX5 A;  2BQ3 A;  1K3E A;  3JAR B;  4Q20 A;  1SRY A;  5KG5 A;  1ZX3 A;  4KUM A;  1WA8 B;  1KUT A;  2FPP B;  1SZX A;  3G6V A;  2UU9 H;  2W6Z A;  4O7S A;  1FXK B;  5KMG B;  4R7R A;  2DYR B;  4FLZ A;  4LF4 H;  4WF9 V;  1RJQ A;  2P90 A;  5IYD O;  5L3G A;  3CYO A;  1GTO A;  3EHB B;  4CHI A;  2Z5U A;  3TY5 A;  3B8M A;  3NXS A;  4CMF A;  1T5E A;  4GCZ A;  4ECU A;  2JK5 C;  3K5M A;  3F5T A;  2YIA A;  5CBG A;  1I5Y A;  4DV1 H;  2F4V B;  4B08 A;  3NUA A;  2FML A;  1PP9 H;  4I7Z B;  1K7D A;  1XQ8 A;  4IZO A;  3K57 A;  4JI2 O;  2ZGI A;  1P8L A;  4IWX A;  5EYP B;  1JDE A;  5KG0 A;  5GW7 A;  2ILM A;  1DTO A;  4DUY B;  5D8D A;  3GTO A;  4B3R B;  4DR7 H;  4RB2 C;  4O2B F;  2FL4 A;  3Q8P B;  2XC9 A;  3QO5 A;  5LYJ A;  2HJW A;  4O2B A;  4BIZ A;  1SA0 B;  1TGO A;  3TII A;  3S3X A;  2NU9 B;  1FFT B;  2FTK A;  5KFO A;  4R8U B;  2RQ6 A;  3AG1 C;  4R50 A;  4X66 B;  3FB6 C;  4P2Z A;  4DRX A;  1VQN V;  1ZL8 B;  2E5L H;  1IZ3 A;  1KC8 W;  4PA6 A;  3QZ8 A;  1WB8 A;  4MV3 A;  1IOW A;  4LH6 A;  4RNN A;  3UFX B;  5CA0 F;  5ITZ B;  5CA0 A;  4JI0 H;  4DV0 O;  3W7U A;  4K6N A;  3WWI A;  5B3S C;  3E5N A;  2VOB A;  3L74 H;  2J6T A;  4KHP O;  4EFB A;  2OCH A;  1HW7 A;  2BTO A;  2ITC C;  3JAM W;  3OMA B;  2FK1 A;  1S76 D;  4FGR A;  4DR1 O;  5FPO A;  4YBZ B;  3GIL A;  5C3E G;  1GM7 A;  1S5H C;  1N8R W;  5B3S B;  2X6B A;  3GWK C;  1MZB A;  4NZO A;  2R7Z G;  4JYA O;  3UCS C;  2AXT Z;  2YZL A;  2P5O A;  5LL6 b;  3L2P A;  1OBG A;  4FVM A;  1HNW O;  1BCC H;  2Q7H A;  3U9S A;  4FLX A;  1KC7 A;  5KUM A;  2YRX A;  2PY5 A;  1XIL A;  1GSA A;  4AYB E;  4U7O A;  1K9M W;  1SCU B;  3EFF K;  1D2D A;  5KFZ A;  3SDL A;  4LFB H;  1VIB A;  5E1A C;  5LP6 F;  4I50 F;  4X62 H;  2YRW A;  2R7M A;  2UXB H;  5LP6 A;  5IJ9 B;  3S24 A;  4I50 A;  4WFG A;  4ECT A;  2YYA A;  1JA8 A;  1KTA A;  3OT7 A;  2R9R B;  4CH5 A;  5CA1 B;  3HT5 A;  1O75 A;  4PA3 A;  1BMF G;  1P7B A;  4QIW E;  3ZRV A;  1JOY A;  5FNV B;  5EZY B;  4I7H A;  4JI3 O;  4HNU A;  3FB7 C;  1NBM G;  1Y74 B;  4JTC B;  2ZKO A;  1M4U A;  1DLB A;  2WAM A;  4KL1 A;  1R73 A;  2W9A A;  5KFK A;  1XNR H;  2W8L A;  4Z1M G;  4LF5 H;  1YIJ V;  1YEW A;  1GO3 F;  4O4L B;  2AZ0 A;  1K83 A;  4LP8 A;  2EUL A;  2Y69 C;  3RYC A;  3T1Y O;  3U10 A;  3ORQ A;  5BWW A;  3JAW B;  1M93 A;  4DL7 A;  3G4S V;  1Q86 W;  3JAK B;  2V9W A;  1QHT A;  2UVV A;  5I5Y A;  2LFR A;  3APQ A;  1GN4 A;  5BR8 B;  1NTK H;  2CTQ A;  1NR7 A;  4J7K A;  3TGU H;  3ETE A;  3O9O A;  4W4K A;  3CCJ V;  2DAB A;  1UC8 A;  5IY5 B;  2UXC B;  5EIB C;  4AQY H;  2Q2U A;  3OEE G;  1GGO A;  2Y69 B;  3FB8 C;  1COW G;  5HBR B;  4ZQI A;  2P7T C;  2VPS A;  1AP6 A;  1X9N A;  2DQ3 A;  3WNZ A;  2QJ1 A;  4WFB V;  3OUS A;  1GN3 A;  2XOK G;  5LMN O;  1ZAU A;  4PJ0 Z;  3W5O A;  2IU3 A;  1B04 A;  2WLJ A;  2BSK A;  2KSD A;  3P30 A;  1KUQ A;  2VUM A;  4OGQ B;  3CVZ A;  4BY1 G;  2E76 B;  2R82 A;  3R65 A;  4PI0 A;  1B6R A;  4YR0 A;  2F95 B;  1TWH A;  5LA6 B;  3W7X A;  4RB1 A;  3LDD A;  1IXB A;  3IFX A;  4NXM O;  4O82 A;  3PW4 A;  1HR0 B;  1T94 A;  3LNN A;  4IYI A;  4WFF A;  3DTG A;  4DL6 A;  2I80 A;  2J9G A;  4A3C G;  3VPD A;  3EPG A;  1YDX A;  4N23 A;  5LHH A;  4CC5 A;  5J2U B;  2CZG A;  3HB9 A;  4DV6 O;  3LSS A;  1JLL B;  1QVG U;  4RB3 C;  2IM9 A;  2Q2T A;  4J80 A;  1YI2 V;  2HHH H;  2W71 A;  1XUQ A;  4ECZ A;  1R3K C;  5KHH A;  1WN7 A;  3OHA A;  3SJA C;  1EZV H;  4UB6 Z;  3CCS V;  4XDL A;  1ZHQ A;  4LF6 H;  4JI6 H;  2BR0 A;  3BA9 A;  4LBE C;  4YY3 B;  4NR1 A;  4P9P A;  5H2F Z;  3H3V H;  1Q6H A;  1AJQ A;  4NZN A;  3HOV G;  3PR4 A;  3FKI G;  1H2G A;  4TSF G;  2XCP A;  3F5W C;  4DW0 A;  4FLV A;  3BAB A;  3G8D A;  3Q8R B;  4GX5 A;  4E6N A;  2XGQ A;  4JAV A;  2K9P A;  3GB7 C;  3CWB H;  1MZE A;  2CUG A;  3OAA G;  2ZXW B;  4Q45 A;  2V1D A;  4DIM A;  3HOY G;  2ADP A;  4EFE A;  2XAH A;  1VQ9 V;  4ABM A;  5FD6 A;  4D7S A;  1XNQ H;  1D5A A;  4LF8 B;  1EUD B;  3N6R A;  1HNX H;  2NUA B;  2WAQ E;  4DUZ B;  3I4N G;  4UUG A;  1BXR A;  1XMO H;  2C2R A;  1P49 A;  2LQT A;  2V4R A;  4IAJ A;  3UKM A;  3RB0 A;  2YS8 A;  2XAG A;  3GB8 B;  2R8G A;  3OTO H;  2NN4 A;  4JAS A;  4J9Z B;  1CKN B;  1YJ9 V;  5LMU H;  3CCM V;  4LSA A;  1QVF U;  3E89 A;  3LP8 A;  5I47 A;  3RFC A;  2QK4 A;  3CCV V;  4DR5 B;  2CFM A;  2RDC A;  3T5K A;  4FK5 C;  2R7K A;  2XGP A;  4FMT A;  3RR5 A;  4GKJ H;  1XK5 A;  4ZI7 F;  1W93 A;  5JH7 F;  3AG4 C;  1SEI A;  4DV4 B;  1HDJ A;  2JA6 A;  2JA5 G;  4ZI7 A;  5JH7 A;  3HKC A;  1AJP A;  1WB7 A;  4H13 B;  3TK1 A;  3OE7 G;  4JI4 B;  3MD0 A;  3OGI B;  5IP9 G;  4GLX A;  3ASO C;  3SJB C;  1TWA A;  4A93 G;  1G6U A;  4TQS A;  1BJT A;  1S0O A;  1N34 B;  1BE3 H;  4CKE A;  1E1Q G;  3X2Q C;  4AI8 A;  3ABL C;  2WYO A;  3ZRW B;  2HP8 A;  3JYC A;  2RF4 A;  3ASO B;  3ZRX A;  4JI1 B;  4A5U B;  2A9H A;  1Y67 A;  2GDS A;  1O9G A;  1SQV H;  2X6A A;  4UV8 A;  4YAJ B;  3CJH A;  5C8Y B;  4J41 A;  2WB1 E;  1HP8 A;  3X2Q B;  4XDK A;  2HGW A;  2YC0 A;  4U7N A;  2G38 A;  4O7V A;  5KFQ A;  2B63 A;  3J81 W;  4GKK O;  1TVK A;  2UXD B;  2IH3 C;  2F1M A;  2X6C A;  4JYB A;  1N56 A;  2RMK B;  4JAA A;  3D36 C;  3OGC C;  1VKZ A;  3DXR A;  1KBL A;  3QNE A;  1PPJ H;  3ZJZ A;  5IWA H;  2NVY A;  2GTA A;  1CKM A;  1JJ2 U;  3GII A;  1PV0 A;  4YHH O;  1UPG A;  2DN9 A;  4X65 B;  4ECY A;  4DV3 B;  2DAA A;  3LDC A;  2Q5Z A;  5L3D A;  2UUC O;  3J80 N;  2YS7 A;  1Q43 A;  4J7Z A;  3VA7 A;  1AB3 A;  3G67 A;  1IBK B;  2HHF B;  4PDM A;  4DR4 B;  3RB6 A;  1SQG A;  3GVM A;  1J5E B;  4JI8 H;  3CRA A;  4H0L B;  4X20 B;  1PNM A;  3T9B A;  2CGO A;  1XMQ B;  1AJN A;  4R8C A;  3M9M B;  3H0G G;  4BIU A;  1W0K G;  3I5D A;  2IJJ A;  1BNC A;  5I5V A;  2DOS A;  3H1K H;  4O7T A;  3MR5 A;  1N48 A;  4C2M A;  1U97 A;  1VQO V;  3N42 B;  4JTD B;  2DIK A;  2YDE A;  2GQR A;  3ZCC A;  4U3J A;  3QZ7 A;  4JYC A;  5F2V O;  4MVR A;  2HVQ A;  3RYH A;  1R6N A;  2IMW P;  4O4H B;  2WLI A;  2EJ2 A;  4U6P A;  4O3Q A;  5K2M A;  5JQG B;  4UCS A;  2XCL A;  2XTA A;  3HR0 A;  1SQF A;  2W6N A;  4IIJ F;  3HKZ E;  4XYM B;  2CDY A;  4UUJ C;  1S68 A;  4IGG A;  2EIY A;  5TIS Z;  2ZNJ A;  1BHA A;  2IJH A;  4IIJ A;  4JYA H;  2VQF B;  1CQI B;  2EJ0 A;  2JRI A;  1HNW H;  5KLV H;  4CE5 A;  1PM9 A;  5B1B B;  3W1B A;  3KHR A;  2CGN A;  3H20 A;  1WH2 A;  1NVP B;  5KFL A;  3VOU A;  5LL6 Y;  5H5N A;  2FYU H;  3O65 A;  2OTL V;  4JI5 H;  3KHL A;  5A9G A;  2W9C A;  2VS0 A;  5KFJ A;  4MA0 A;  5K1X A;  1N4C A;  2PGG A;  3H9V A;  3K08 A;  3UZB A;  1BL8 A;  3T1C A;  4A3K G;  2F4V O;  3GTL A;  1KU9 A;  2YEV B;  3JZ6 A;  2AU0 A;  1OCR C;  3B09 A;  2Z02 A;  3N2K B;  4WFE A;  3LQS A;  4ED1 A;  4LFC B;  5KHK A;  5FLM G;  4NB5 A;  3SYA A;  3SJQ C;  3ZMU A;  4JI7 B;  4J9L A;  1AIL A;  4DYL A;  4TV8 F;  3RV3 A;  4JPR A;  4IR9 A;  4F6R B;  4DUY O;  4QPK A;  4TV8 A;  1DIK A;  3E35 A;  4B3R O;  2BE3 A;  1OCR B;  4FBU A;  3MWM A;  1OCC B;  2UUA H;  2P4V A;  1V4Y A;  1QBZ A;  4BW5 A;  4MVO A;  1IBM B;  4MV6 A;  1S0M A;  2X5R A;  1WP8 A;  1AI7 A;  3U9T A;  5FLX W;  4X66 O;  4FFB B;  3A0B Z;  2HIV A;  3BG5 A;  1I2K A;  2CE4 A;  3N40 P;  3T1Y H;  1AI5 A;  2GUZ B;  3CHX A;  1K1Q A;  1E4E B;  1RYS A;  2FLN A;  4JV5 H;  3AEI A;  3U0G A;  4EYH B;  4MW3 A;  1Y76 B;  2B5U A;  4OXS A;  4LF7 H;  4PWQ A;  3JD3 A;  3T9C A;  4X1K A;  1G8M A;  5BXZ A;  1RM1 C;  1SKV A;  2UVR A;  4EBD A;  3EPI A;  2JEI A;  5DGI A;  4I0X B;  1M7J A;  3V6H A;  1WA8 A;  4E4E A;  2ABJ A;  1QCE A;  1FXK A;  3KXY T;  3E22 A;  1XRE A;  4DV2 O;  2OH2 A;  4RNM A;  1MA1 A;  3RYI B;  5L1K A;  5L3F A;  3SGI A;  3FD9 A;  1CEZ A;  4TUY B;  2C35 B;  1YJN V;  3KHG A;  5FJ8 G;  1QR8 A;  2R6F A;  4DV5 B;  3W7T A;  4CH4 A;  3L9D A;  3APO A;  1S77 D;  3CSX A;  5KT5 A;  4MVS A;  2ZIM A;  2W9B B;  1JCH A;  3JZF A;  1Q5O A;  1Q3E A;  5IYZ B;  2QWP B;  2LGW A;  1KB9 F;  3HKD B;  4B3M H;  4DR6 B;  2R92 G;  2HFE C;  4ZOL F;  3SYQ A;  3P32 A;  4ECQ A;  2PZS A;  2JJ1 G;  4ZOL A;  2OTJ V;  2R93 G;  2X0S A;  2ZD9 A;  5EWF A;  3B77 A;  5EYP A;  5KS8 A;  1VQ6 V;  3VPC A;  3AYH B;  4PI2 A;  1NVP D;  5KA5 A;  4RZR A;  4RZQ A;  1WCM G;  2UU9 B;  2PTM A;  5BY1 A;  4O3P A;  5LHG A;  1SA0 A;  4LF4 B;  3KHH A;  1IBL H;  1AP5 A;  5D1O B;  4R8U A;  5JVD B;  4DR2 H;  4K0K H;  2YZG A;  1CPY A;  4HAM A;  2W6O A;  1CXZ B;  3K59 A;  1VP7 A;  5ITZ A;  2BOC C;  2JGD A;  4QJF A;  4WBN F;  2W0F C;  4A2B A;  2PF4 E;  5I5X A;  3VPB A;  5GTI Z;  1M90 W;  4WBN A;  4DV1 B;  5KFX A;  3KCX A;  3E83 A;  3KCY A;  5DGA A;  1R6K A;  5BR8 O;  2GLT A;  2W6M A;  4O81 A;  1PKX A;  3AG3 C;  2I8C A;  1GN2 A;  2Q68 A;  4CKC A;  2UXC O;  1S0N A;  2FE3 A;  4LF9 H;  2AGA A;  3JRW A;  4UVB A;  4HNA A;  1AVM A;  2C22 A;  2JDI G;  1AR4 A;  4CS4 A;  3AK1 A;  3R5X A;  3L4J A;  1F51 A;  3THO A;  1L0N H;  4DR7 B;  4H33 A;  1M0W A;  3AG3 B;  2QDO A;  1VF7 A;  3LNM B;  4JV2 A;  5FPR A;  2R7N A;  2UUB B;  5L3E A;  1XL4 A;  1YF2 A;  4NVP A;  1R3J C;  4IHJ A;  3PVX A;  1K5Q A;  3DTF A;  2AHY A;  5IYC O;  1SET A;  4FM0 A;  1PL0 A;  2Y4U A;  5DLF A;  1RJR A;  2E5L B;  3LSQ A;  1VQM V;  2VWK A;  3R5H A;  2VUG A;  1HR0 O;  3TXQ A;  5CA1 F;  4C5C A;  1DV1 A;  4I9Q A;  3TET A;  4X64 B;  5CA1 A;  2PMZ A;  2HIX A;  5FNV F;  5EZY F;  1H8E G;  1K4D C;  5FNV A;  5EZY A;  3CS5 A;  4MV4 A;  1Y1V G;  3T4Z A;  2E2I A;  2ZJT A;  4H37 A;  5KHG A;  3GWO A;  2CTP A;  5BWR A;  2HVJ C;  3IG0 A;  1R9T A;  3NGD A;  1JIH A;  2JEU A;  2FB9 A;  1ZUQ A;  3LML A;  2R8H A;  4B7K A;  4JV0 A;  3KKY A;  4PA9 A;  3ASN C;  4UVC A;  5LXT B;  1EKV A;  4BR6 A;  1A9X A;  3T5L A;  1A3G A;  4YY3 O;  5JJE B;  2LP7 A;  2FKL A;  1XOU A;  2EZO A;  2Q8V A;  3IN5 A;  1M5I A;  3K5O A;  5CM0 A;  4LFB B;  3G6Y A;  3JAK A;  3ASN B;  4FBT A;  4X62 B;  1G4Y B;  5BWV A;  5C5J A;  3OTF A;  2JEJ A;  4GX0 A;  3LWB A;  3L71 H;  4HBN A;  1SZT A;  1Z2N X;  3RGZ A;  3GTQ A;  3JD4 A;  1N32 H;  4PZ8 A;  3IGA C;  4Q4C A;  2VA2 A;  4LF8 O;  4J9N A;  3PN1 A;  4B3T B;  3S3W A;  2COI A;  4RU9 A;  4LCU C;  1PX2 A;  4DUZ O;  3H40 A;  2WLN A;  2R85 A;  2R87 A;  1TAE A;  1K97 A;  4G27 B;  4IRC A;  4KP4 A;  4ECS A;  1N0N A;  2V5A A;  2PI5 A;  1TWG A;  1TUB B;  4QE9 A;  4DLK A;  1FAF A;  4LF5 B;  5FD5 A;  4B3S H;  5LA6 F;  1BSM A;  4M9U A;  2Q7E A;  2ALZ A;  2A3Q A;  4DR5 O;  2F66 C;  4FIP C;  1V51 A;  5KFG A;  3JAT B;  3C0F B;  4FM9 A;  3TIN A;  2ZE6 A;  4I4T F;  1DF5 A;  1M9N A;  5LOV F;  4FJC C;  3H01 A;  4DV4 O;  4I4T A;  4G3I A;  5LOV A;  3MFH A;  1VF6 C;  4MW8 A;  4O7Z A;  1H2M A;  3BRC A;  2IBK A;  4XX0 B;  1GLV A;  4JF3 A;  2ZR3 A;  3ZHQ A;  5IJ0 B;  2W0X A;  4AQY B;  4JI4 O;  3HO8 A;  3HOW G;  3RJ0 A;  3WB1 A;  4MVU A;  4WD3 A;  5KG3 A;  5IYB G;  2VQD A;  2BTQ A;  4RQF A;  5H9C A;  1V55 C;  2WDT A;  3A8T A;  5JVL A;  1ZWI C;  5KT4 A;  3OEH G;  3GTK A;  1JFF B;  4YB8 B;  4J9Y B;  3GV7 B;  5CBF A;  4JI1 O;  1AR1 B;  4X1I A;  2EJ7 A;  3E86 A;  1I94 H;  5B1O A;  4APM A;  1HNZ H;  1NTM H;  5JJJ B;  3CRM A;  2RDJ A;  3CCL V;  1HWY A;  3SR2 C;  1XDN A;  1V55 B;  5KG2 A;  4B7E A;  2FK2 A;  3N43 B;  3CMA V;  1XEQ A;  1PK8 A;  2WLH A;  4TQD A;  1JX4 A;  4GT1 A;  5IE9 A;  1ULZ A;  3CRC A;  3RF2 A;  2M6Y A;  3STZ C;  4X1Y A;  3ZHV A;  2UXD O;  1EN4 A;  4CC6 A;  2CW7 A;  3G6X A;  1A48 A;  5FL7 G;  1LUV A;  5KUK A;  3HKE B;  1MG1 A;  2OT5 A;  3RFR A;  2NU7 B;  3K3P A;  2QEX V;  4U7C A;  3AW8 A;  2HHH B;  3CD6 V;  1Z2P X;  2ZM6 H;  1CE8 A;  4DQN A;  4TV9 F;  2ATL A;  2XAQ A;  3ICX A;  1WR2 A;  1M56 C;  1WPB A;  3TJT A;  1JKJ B;  2ZDH A;  3KYH C;  4TV9 A;  4X65 O;  4ECX A;  3K03 A;  4DV3 O;  2NVX A;  1CKN A;  2ZDI C;  4PDL A;  4JYY A;  4JI6 B;  4LF6 B;  2ASL A;  3GDE A;  2AGQ A;  1FJG O;  1TWC A;  2MK3 A;  2N04 A;  1A0G A;  2BQR A;  5LGN A;  2YI9 A;  1Q90 D;  2QM7 A;  5KX5 B;  1IBK O;  2V58 A;  5K3W A;  2LO1 A;  4DR4 O;  5IY5 C;  4DUY H;  4YXW G;  5EDW A;  1M56 B;  5KG4 A;  2K1E A;  2Z3Y A;  1J5E O;  5BZB A;  3U0Z A;  1MSD A;  3T9D A;  4ED2 A;  1U96 A;  4DV7 H;  2XAF A;  1XMQ O;  1R3L C;  3N2G B;  3R9R A;  2W6P A;  2YIB D;  4C7U A;  2R70 A;  5KG1 A;  4DL2 A;  3SJC C;  1NZ6 A;  1PD3 A;  2AGP A;  2CKZ B;  1Z2O X;  1HNX B;  5E25 A;  3STL C;  4X9Q A;  2ZE7 A;  4OX9 O;  1M0T A;  1S03 G;  1XMO B;  1A0I A;  1SYX B;  5IYD G;  5IT9 W;  3M9O B;  3ETQ A;  4TWK A;  1Q82 W;  3VOT A;  2R72 A;  1IYD A;  5LMU B;  4F4X A;  5C1P A;  3BAA A;  5C8Y F;  1KJQ A;  3N6X A;  4XDJ A;  2Y0P A;  5DQH A;  2W6J G;  4O3O A;  3RTX A;  3RIZ A;  5C8Y A;  2RCV A;  4O2A B;  1RSO B;  4TOI A;  2ODT X;  1KJI A;  4DV2 H;  5F9N A;  2FJZ A;  5I5W A;  2HG5 C;  2KG7 A;  4WFA V;  2VQF O;  3D3Q A;  1BHB A;  4LFA H;  2JA7 A;  2GSM B;  2NNU A;  1S5L Z;  3G71 V;  5CE8 A;  5KT6 A;  4Z1V A;  5LYJ B;  3Q4H B;  3OR7 C;  1AN7 A;  3I55 V;  4YJ3 B;  4G2K A;  4ED3 A;  2WSS G;  3CPW U;  4OPA A;  3VMM A;  1YTF B;  1N33 O;  2Y0S E;  2WWW A;  3T1H H;  3CXH F;  1RJP A;  3IC9 A;  3TY8 A;  4U3F H;  5IDJ A;  3D36 A;  2ZXW C;  1QNM A;  3HOZ G;  2JA5 A;  4GX2 A;  5BMV B;  4LFC O;  1YCI A;  2YSU B;  2VPQ A;  2W8K A;  3JAL B;  1E4G T;  4JI7 O;  2DQ0 A;  4UCV A;  4X20 A;  2AGO A;  2V4Q A;  3UO2 A;  4DR3 H;  4PDB A;  3MDS A;  1R1B A;  2QM4 A;  1IBM O;  4NXN H;  2A79 B;  3ZHT A;  2GHY A;  3UQ8 A;  5D1P A;  3RB4 A;  3AK3 A;  5GON B;  1AI6 A;  3ZMS A;  3RB3 A;  2Z0A A;  1SQB H;  1N36 H;  2ZNI A;  3MWD A;  5KKN B;  1JX9 A;  2H8P C;  5EC2 C;  5IWA B;  4Q43 A;  3MHH C;  1I1K A;  1BGY H;  2V4D A;  5KFA A;  2RDI A;  4C5B A;  4LSX A;  1QU7 A;  5LP6 B;  1LR1 A;  2YXH A;  4I50 B;  2HGS A;  5BR8 H;  3G8C A;  3QVN A;  2E75 B;  5KFV A;  2VUM G;  2ZIO A;  1GH6 A;  2Q7G A;  1L1F A;  1WNS A;  3L70 H;  2VQE H;  4FFN A;  3HOX G;  1GAX A;  3JD0 A;  1Y1W G;  3QO7 A;  1VQL V;  1VAJ A;  4PA4 A;  2Y4T A;  4JI8 B;  3K5N A;  2FB5 A;  3CXC U;  2B9Z A;  1Q6U A;  1URF A;  1SQQ H;  4DV5 O;  1YJW V;  3TEK A;  1SES A;  3AG2 B;  4DW1 A;  3ZS8 C;  4X88 A;  1GK9 A;  5DIS C;  4PDR A;  4UVA A;  3VNN A;  1I2L A;  5BPH A;  2RGR A;  2YI8 A;  2ZQM A;  4RUE A;  4EBE A;  1OCZ B;  2C2D A;  1JVM A;  3L72 H;  2YEV A;  2WLL B;  4DR6 O;  1MAB G;  3R66 A;  4ICG A;  1RFY A;  1F23 A;  4RCN A;  3SE7 A;  1KP2 A;  4ZKI A;  2C00 A;  3MR2 A;  3QQM A;  1FFX A;  2RN9 A;  3ZX6 A;  5KG6 A;  4F6R A;  4O7L A;  5JQW A;  3HOU G;  4CH3 A;  2PYJ A;  2A0L A;  2PBZ A;  1I08 A;  5CR5 A;  2HR3 A;  5DG9 A;  3ZMZ A;  4E2L A;  1S72 V;  3MFI A;  3T5J A;  3OFN G;  1ZHS A;  1YTF D;  4A3L G;  4DXW A;  4J11 A;  4EB6 A;  3T9A A;  1VQ5 V;  1ZTE A;  2QGN A;  2VWJ A;  2UXX A;  5F9L A;  3C3S A;  2PYL A;  4BIO A;  1R6T A;  3R5F A;  2BSK B;  3OR6 C;  1WAZ A;  5AG2 A;  2GUZ A;  3SNO A;  4JI5 B;  1BQZ A;  5DM6 V;  1F7Y A;  5EBW C;  4MV1 A;  3CB2 A;  2F93 B;  3TXS A;  4GZR B;  3RT3 C;  1OZ0 A;  4YAK B;  2A06 H;  4XBF A;  4JAU A;  2OIG A;  5CMU A;  1G1X B;  3GLK A;  4JI2 H;  4J9R A;  4O4J B;  4LF8 H;  4QW8 A;  3MJF A;  5BPF A;  4M7E A;  1MNG A;  4DUZ H;  4FS1 A;  5C93 A;  4LR3 A;  4MVQ A;  3UT5 B;  4FLW A;  4TUY F;  4BWA A;  4HNV A;  4RUA A;  3RYI A;  4DR7 O;  4TUY A;  3E8F A;  1FXH A;  3L73 H;  2YL2 A;  2UUB O;  3CE2 A;  3RUP A;  4RAY A;  2UUA B;  3CME V;  4KXR A;  1P16 A;  3QTC A;  5L1L A;  5IYZ F;  3PFF A;  2KQX A;  4W4L A;  2FMA A;  1ENV A;  5JUM A;  1VBG A;  2Q9L A;  5IYZ A;  4Q8E A;  2OYQ A;  4DR5 H;  2DE0 X;  3ABT A;  3EVK A;  2W57 A;  3CRR A;  2PMZ E;  3F8N A;  4DV0 H;  3BVO A;  4JV5 B;  1Q8I A;  4RO2 A;  4DV4 H;  2QWO B;  1W96 A;  4KHP H;  2IJK A;  3K9A A;  4X64 O;  4LF7 B;  1A32 A;  2R7L A;  3M7M X;  1H38 A;  1S3J A;  4DR1 H;  4JI4 H;  5B1B C;  4LWS A;  1ORQ C;  4UXN A;  2HJD A;  4ZHQ B;  4BWS C;  5KFW A;  2ZT9 B;  3HKB A;  2Z04 A;  2R8J A;  3ABM B;  3NBY B;  2V59 A;  3GTG A;  2B63 G;  1AUX A;  5JVD F;  3ZRS A;  5D1O A;  5EWG A;  5JVD A;  2JS3 A;  5EWE A;  3TW6 A;  3RBZ A;  3P3N A;  2HGX A;  4JI1 H;  4GYC B;  2Y4R A;  2ZR2 A;  3B8N A;  3K5L A;  2J6U A;  1H2L A;  1S9F A;  1W59 A;  4X62 O;  3BQ0 A;  3H1H H;  4J7J A;  4B3M B;  4ED6 A;  3A0H Z;  3IAY A;  3K3V A;  3JAM N;  1OCC C;  3QO8 A;  1VF5 B;  2D3O W;  4Q4D A;  3HKC B;  1VQP V;  2ITD C;  1VMG A;  3AK2 A;  1RK5 A;  5LGU A;  5KG7 A;  2E74 B;  4B3T O;  3K58 A;  4JI3 H;  4QGP A;  1EBO A;  1FXV A;  5CB4 B;  3CSW A;  2SCU B;  1XI1 A;  3U55 A;  5KFH A;  5KFI A;  4FM2 A;  2OIE A;  2DWC A;  5KFR A;  4BBR G;  5DG8 A;  2HVS A;  4X65 H;  4YQW A;  1M6V A;  1P84 F;  2VRZ A;  1NS1 A;  4UCU A;  1FJG H;  1K5S A;  1IBL B;  3N41 B;  4J9K A;  5I5T A;  4HN2 A;  3N27 A;  4TM5 A;  4DR2 B;  1VQ7 V;  4K0K B;  3KAK A;  3LUL A;  2DPI A;  4DR4 H;  2ASJ A;  4ED0 A;  4O86 A;  3UM7 A;  1XL6 A;  4X8A A;  3PZP A;  1WCM A;  2WA3 A;  2CH7 B;  1VAR A;  3BJY A;  5KFF A;  3WB0 A;  2XND G;  3JAR A;  5GTH Z;  1FPO A;  4YR3 A;  2QKC A;  3WB2 A;  4AQY O;  4LF9 B;  1VS0 A;  4EYI B;  1X59 A;  1WJZ A;  1D5N A;  3JSN A;  3QFF A;  1THZ A;  4P30 A;  5KMG A;  3OMI B;  2H94 A;  4OX9 H;  3GTP A;  3RAX A;  5LXT F;  5LMN H;  2EJR A;  3B2E E;  4RUF A;  4PD4 F;  2XT9 A;  3ORR A;  1WP7 A;  5LXT A;  3WO1 A;  3RYF B;  1YVW A;  1BQ0 A;  1QR9 A;  2EIJ C;  5KFY A;  1X4T A;  1YHQ V;  2W70 A;  4NXM H;  2HG8 A;  1M1K W;  2AW9 A;  1M57 C;  5L3C A;  1EKP A;  2AQ4 A;  4F4Y A;  1KJJ A;  2YID A;  4I5S A;  2EX3 A;  4O7Y A;  4YJ2 B;  3GIJ A;  2EIJ B;  1KKD A;  4DV6 H;  1J95 A;  3MWE A;  4Z2W A;  4PDV A;  3CEB A;  3HBL A;  3Q1K A;  2NLJ C;  1AR5 A;  1M57 B;  2QR4 A;  2CTW A;  1N33 H;  2YIB A;  3LSU A;  4N21 A;  2HHH O;  3GIM A;  4U3J B;  3HPL C;  4R7C A;  2ZE5 A;  2YS6 A;  1ZSP A;  1BT8 A;  2V7Q G;  4QE7 A;  4LF6 O;  2WLI B;  4JI6 O;  1E79 G;  2XCA A;  3UO3 A;  1GO3 E;  3FYE B;  1ZL8 A;  3QF7 A;  2OWO A;  2GQS A;  4FZ1 A;  4JI7 H;  3PW5 A;  2DW4 A;  4IYH A;  4MTF A;  4OPH A;  4CBC A;  4WCE V;  4GC6 A;  3JAT A;  1UNN C;  1WLE A;  3V4Z A;  1RYR A;  2P0A A;  1JJO A;  5IYB O;  3UZO A;  2ZCE A;  3JAS B;  5I60 A;  4O3S A;  3B40 A;  5A2Q W;  1EYZ A;  3ZBH A;  3CCE V;  3ABK C;  3A2F A;  4UCO A;  5B5E Z;  5IJ0 A;  4EBC A;  1N32 B;  3OSP A;  2JA8 G;  4MTG A;  5JJN B;  1HNX O;  4HQ6 A;  5BWT A;  2EIK C;  4DL4 A;  1VF6 A;  2FLL A;  2E2H A;  3J7A U;  3ABU A;  2W9C B;  1XMO O;  4MTO A;  3ABK B;  4JZ2 A;  2BOB C;  3ETH A;  2XAJ A;  2CQY A;  4MTD A;  4RAZ A;  3L4K A;  3VQV A;  1JFF A;  3E8H A;  5LMU O;  2EIK B;  4LNU B;  2X0L A;  1B6Q A;  4B3S B;  5HFL A;  4UV9 A;  1IX9 A;  4LMY A;  3BA8 A;  2R8K A;  3W7S A;  5IJ9 A;  4HYK A;  4JI0 B;  2W6I G;  4GLW A;  4O4I B;  4DO2 A;  2ODM A;  4ZBM A;  5EBL C;  5LGT A;  1NH2 B;  4DV5 H;  1L2Z A;  2JGU A;  1VBH A;  1US6 A;  4E4T A;  5J2T B;  2VR1 A;  5LBQ A;  1KEE A;  2ATK C;  2NR5 A;  4RB0 A;  2W7O A;  4QWD A;  1AI4 A;  1MMM A;  1Y74 A;  2JVD A;  4I55 B;  3SYP A;  5KFD A;  3ZHU A;  1K34 A;  2N74 A;  1NJI W;  2EJ3 A;  3I12 A;  3TY9 A;  2RJZ A;  3ZHS A;  3V6J A;  2DZD A;  2NU6 B;  3JD2 A;  1F4M A;  2GPS A;  3FFQ A;  4QSH A;  2GPW A;  4O4L F;  2R9I A;  4FFP A;  3RBE A;  3QWU A;  3CP1 A;  1K33 A;  3A0R A;  4O4L A;  4FU0 A;  3J80 W;  4CS2 A;  4CS3 A;  4KFM A;  4QPJ A;  2HDK A;  5DLG A;  1I0H A;  3T9E A;  4J9O A;  5KHI A;  1K4C C;  3JAW A;  1I94 B;  3MR6 A;  1NQT A;  1HNZ B;  4NTW A;  2ZDI A;  1IUR A;  2R7Z A;  3E22 B;  3N2G A;  2UXB B;  4PZ7 A;  4GKK H;  3HKZ A;  2CAZ C;  1P7G A;  3ZMT A;  4YP3 A;  4XZ3 B;  2HJF C;  4RNO A;  2I87 A;  5JCO C;  1OCO C;  3N8D A;  2KB1 A;  2J6S A;  5C4X G;  2O03 A;  1QLE C;  1Z5W A;  4QW9 A;  5IWA O;  1B06 A;  4PA7 A;  2ZM6 B;  4Q0Y A;  1JR9 A;  4YHH H;  1BZK A;  4RQE A;  2P22 C;  2UUC H;  4GX1 A;  2JEG A;  5BYB A;  1OCO B;  1FKA O;  4J9P A;  1XNR B;  5KHJ A;  3E2E A;  4ZOL B;  3GV5 B;  4O2A F;  2YUA A;  1QLE B;  1YXB A;  1K8A W;  1CQJ B;  5KFS A;  1I6U A;  2OLS A;  3SPH A;  4O2A A;  4UFZ A;  5LA6 A;  1RSO A;  2RNB A;  3TCU A;  1XDC A;  3J7A K;  3JZI A;  5LYJ F;  3DSQ A;  4DK0 A;  3J81 N;  4JI8 O;  4MV9 A;  5J2U F;  2KSW A;  2UUB H;  2ZIN A;  1RK6 A;  4DV7 B;  3NBZ B;  2YXY A;  3Q8Q B;  1Z5V A;  3Q4H A;  2CK3 G;  5J2U A;  3CCR V;  4YJ3 F;  1OJH A;  1L0L H;  1VQ8 V;  3W7W A;  4LH7 A;  2UVW A;  1W2B U;  4RWU A;  4YJ3 A;  2PI4 A;  5EBM C;  2PN1 A;  5BWX A;  1SER A;  4NYK A;  3V6K A;  4IR1 A;  1KYO F;  2JGD B;  4QJF B;  5B66 Z;  1JQ0 A;  1N34 O;  1OWT A;  4A3B G;  2EIM C;  4JTA B;  1CKO A;  1RPR A;  5BMV F;  4WBN B;  3AG1 B;  1Q7Y W;  4X64 H;  3DTU B;  4F6E A;  1I7F A;  3FAV B;  2YXL A;  5BMV A;  3W1G A;  1DAA A;  2IW5 A;  3M4I A;  3JAL A;  1NH2 D;  3RGX A;  5L1J A;  2Q0A A;  1H2N A;  3D3I A;  2IA6 A;  4HNA B;  2EIM B;  3IJ4 A;  2P06 A;  4MVM A;  1SQP H;  4DV2 B;  1XHX A;  4ED7 A;  2EIL C;  2COJ A;  1SF9 A;  4LFA B;  2WPD G;  2BQU A;  5GON F;  1KD1 W;  5GON A;  3ZMV A;  2DWD C;  3PW0 A;  4IHJ B;  3E8G A;  3FDS A;  3K5I A;  3HB3 B;  1SS3 A;  5KT2 A;  1LUW A;  2EIL B;  4JI5 O;  2P67 A;  2EBO A;  5KA6 A;  2LJ2 A;  3DGE A;  4ECR A;  2F4V H;  4TQF A;  3T1H B;  3U11 A;  3G6B A;  5KAF Z;  3CC7 V;  3GQC A;  1RP3 B;  2E3C A;  5IYC G;  2Q0O C;  3UYY A;  4ECW A;  3C3T A;  2AZ2 A;  2JEF A;  3PW7 A;  2O57 A;  3ZIA G;  3ETG A;  1IOV A;  3N44 B;  4B3T H;  1WSC A;  4MTX A;  4QNH B;  1V54 C;  1TUE B;  4B3R H;  5DED A;  3U54 A;  1OHH G;  5DGB A;  3SI8 A;  3K5H A;  3OMN B;  2AHZ A;  1PNL A;  3B4S A;  3SPI A;  1NT2 B;  4PBC A;  3RVZ A;  4DR3 B;  2UUA O;  3CQZ A;  4NXN B;  5L1I A;  3OUZ A;  4X66 H;  4GC7 A;  1V54 B;  4C5A A;  3GIK A;  1XNQ B;  4WHX A;  5KFM A;  2JS5 A;  4DL5 A;  3EYY A;  4A3D G;  5BYA A;  2R8I A;  1NKD A;  3FKI A;  4A3J G;  4ASU G;  2QTO A;  2NU8 B;  1N36 B;  4FE2 A;  1UFI A;  4Q6G A;  4A3G G;  2L6L A;  5DEC A;  4TQR A;  2WLL A;  4JV5 O;  2BCC H;  3MR3 A;  2KKW A;  3BCC H;  2CNU A;  5EOY A;  1C30 A;  2QTS A;  1JDB B;  4F4Z A;  4LF7 O;  3AX6 A;  3ZRW A;  3OTO B;  5B1A C;  4A3M G;  1Y6X A;  2GV9 A;  3OW2 U;  2DLN A;  3H1L H;  1EZ1 A;  2P4K A;  4Y8V B;  2H3O A;  3DC6 A;  2VQE B;  3RW0 A;  3KRE A;  1VEW A;  4PHZ A;  1H2S B;  4J0M A;  2IJI A;  4QWE A;  5KT3 A;  4GKJ B;  5B1A B;  3H4B A;  4O2B B;  4MAM A;  2A7W A;  5FLX N;  4EEQ A;  3OD4 A;  2QWQ B;  3WU2 Z;  4BY7 G;  2M7W A;  1FVI A;  1CS0 A;  1QQC A;  4DRX B;  4FZ0 A;  2ZDQ A;  5T14 A;  5C44 G;  2IP4 A;  4FM1 A;  2QB5 A;  2YZM A;  4BBS G;  4XYL B;  3GTJ A;  1Y1W A;  1NR1 A;  5KT7 A;  3RV4 A;  5CA0 B;  4B3M O;  2LFS A;  2RGV A;  1Z2G A;  4F4L A;  4K8Z A;  1AUV A;  4ED8 A;  4O4J F;  4I4T B;  5LOV B;  3Q2O A;  4DRF A;  2HHF A;  4O4J A;  5L9X A;  4FFR A;  4FPP A;  1T36 A;  5EC1 C;  2CTR A;  3VQX A;  2WTF A;  1O9H A;  2P6J A;  3UT5 A;  3GID A;  1GSH A;  3LUT B;  1KP3 A;  3CX5 F;  2BTQ B;  3BQ1 A;  1P4R A;  3MAQ A;  4AHC A;  1IBL O;  5LP6 C;  1IYE A;  5D5Q A;  4DR2 O;  4K0K O;  4EKW A;  3K04 A;  2ADQ B;  4X1I B;  4QWB A;  4O4H F;  2Q73 A;  4FFK A;  3CRQ A;  4RUC A;  3OHB A;  4O4H A;  1KT8 A;  2QKA A;  1ARO P;  5JQG F;  1GRJ A;  3I4M G;  2N05 A;  5JQG A;  2UXC H;  3KAL A;  4ZHQ F;  4DK1 A;  4ECV A;  4X1Y B;  4JI2 B;  4LF9 O;  4UB8 Z;  1BS3 A;  3AG2 C;  4ZHQ A;  4ZIB A;  2A1H A;  5KFN A;  3MHS C;  3KG2 A;  4CKB A;  1I3Q A;  4YR2 A;  1GSO A;  2JA7 G;  1ROP A;  2JEX A;  3JCU Z;  3D8C A;  1OCZ C;  4AIL C;  4TV9 B;  2Q67 A;  2CNV A;  4ME6 A;  1SFO A;  3H1J H;  3K3W A;  2UXN A;  4PV1 B;  1V9P A;  1G2W A;  2QE7 G;  2F23 A;  2FLP A;  3RYC B;  1HR0 H;  1C3O A;  1I5X A;  5IP7 G;  4MTE A;  1K92 A;  1PNK A;  2WE6 A;  5A2Q N;  4DV0 B;  1OV9 A;  3N2K A;  1I7L A;  3BQ2 A;  4LC1 A;  1VQ4 V;  4KHP B;  3H0G A;  2PVP A;  3WO0 A;  5EK0 A;  3T7A A;  4BXX G;  3G6E V;  1ZET A;  3QG5 A;  5EIB D;  1WRV A;  2JIZ G;  5CB4 F;  4J9M A;  5KAI Z;  4HR7 A;  1JXL A;  5KFT A;  4DR1 B;  4J42 A;  5CB4 A;  3T5H A;  4MSW C;  2F43 G;  4TVI A;  1F4N A;  3VQY A;  3CC2 V;  5BWU A;  3AG4 B;  2UU9 O;  3NR7 A;  4JYA B;  1N0J A;  3K0G A;  3DAA A;  1XHZ A;  3EXA A;  4LF4 O;  2FK3 A;  5J9P C;  1HNW B;  2HVR A;  2YCH A;  4FFB A;  4NTX A;  2ZE8 A;  4YY3 H;  1KEC A;  1Y66 A;  4DAA A;  4O3N A;  3SYC A;  3K9S A;  3T4D A;  2HLD G;  1E4E A;  3TW7 A;  4P9O A;  1IXM A;  3TIG A;  3BEH A;  4K8X A;  4AYB A;  3KTM A;  3OUF A;  2QSA A;  1EN6 A;  1Y76 A;  3WWJ A;  3BY6 A;  2XHB A;  4DV1 O;  3ABL B;  4M0J A;  2KG7 B;  2CH7 A;  5LHI A;  3RGB A; 
#chains in the Genus database with same CATH homology
 4HBN A;  1ZAU A;  3W5O A;  1Z2N X;  3RGZ A;  3RYF B;  2HEP A;  1B04 A;  1N32 H;  4PZ8 A;  3CVZ A;  1X4T A;  3PN1 A;  4B3T B;  4PI0 A;  3NC0 B;  2F95 B;  4JI3 B;  3RWR D;  4NXM H;  5LA6 B;  4RB1 A;  1TAE A;  2CW8 A;  4FLY A;  1HR0 B;  3LNN A;  2EX3 A;  4YJ2 B;  3VQW A;  1FKA H;  3RYF A;  4DV6 H;  1TUB B;  4CC5 A;  5J2U B;  1FJG B;  4LF5 B;  4UCR A;  4PZ6 A;  5FD5 A;  4B3S H;  4RB3 C;  2IM9 A;  2Q2T A;  2Q7E A;  2F66 C;  2HHH H;  3HKD A;  3T1Y B;  1N33 H;  3JAT B;  2YIB A;  3C0F B;  4FM9 A;  4U3J B;  5KHH A;  1WN7 A;  3SJA C;  4YJ2 A;  4I4T A;  1ZHQ A;  4LF6 H;  5LOV A;  4JI6 H;  3BA9 A;  3BRC A;  4YY3 B;  3QF7 A;  2OWO A;  5IJ0 B;  4JI7 H;  4AQY B;  4FLV A;  3BAB A;  3RJ0 A;  3WB1 A;  3JAT A;  4E6N A;  4OX9 B;  1JJO A;  1N34 H;  2ZCE A;  3JAS B;  5LMN B;  2BTQ A;  5A2Q W;  2WDT A;  4EFE A;  3A2F A;  4UCO A;  5IJ0 A;  4D7S A;  5FD6 A;  1JFF B;  1XNQ H;  1D5A A;  1N32 B;  4LF8 B;  4X1I A;  1I94 H;  1HNX H;  4APM A;  1HNZ H;  5JJJ B;  5JJN B;  4DUZ B;  4A2A A;  3SR2 C;  1XDN A;  4NXM B;  1XMO H;  3JAS A;  1P49 A;  3N43 B;  4IAJ A;  4ETS A;  4TQD A;  1L8D A;  3GB8 B;  4MTD A;  3RF2 A;  4RAZ A;  4ZI7 B;  3OTO H;  3L4K A;  5JH7 B;  4X1Y A;  3VQV A;  1CKN B;  5LMU H;  1JFF A;  4D7T A;  4DV6 B;  1S5J A;  4CC6 A;  2CW7 A;  4LNU B;  4LSA A;  3HKE B;  3RFR A;  4B3S B;  2CFM A;  4DR5 B;  4LMY A;  3BA8 A;  2HHH B;  1Z2P X;  2ZM6 H;  5IJ9 A;  1N33 B;  3RR5 A;  4GKJ H;  3ICX A;  4JI0 B;  1XK5 A;  1WPB A;  4O4I B;  3KYH C;  4DV3 H;  1SEI A;  4TV9 A;  4DV4 B;  4ZI7 A;  4DV5 H;  5JH7 A;  1CKN A;  3HKC A;  2PUS A;  4JI6 B;  4LF6 B;  1L2Z A;  2JGU A;  3GDE A;  5J2T B;  4LNU A;  1IBK H;  2YI9 A;  4RB0 A;  5KX5 B;  4JI4 B;  3JSL A;  4DUY H;  4I55 B;  1FFX B;  2JVD A;  1J5E H;  1JMK C;  4GLX A;  3SJB C;  3U0Z A;  1G6U A;  3TY9 A;  2RJZ A;  4O4I A;  1BJT A;  5D5P A;  1XMQ H;  1N34 B;  4DV7 H;  3N2G B;  3FFQ A;  2YIB D;  5K1P A;  4EB6 B;  5J2T A;  2R70 A;  3QWU A;  2WYO A;  1TVK B;  1TA8 A;  4O4L A;  3J80 W;  3SJC C;  4CS2 A;  4CS3 A;  4JI1 B;  4I55 A;  5KHI A;  1O9G A;  1Z2O X;  3JAW A;  1I94 B;  1HNX B;  5C8Y B;  1HNZ B;  1M0T A;  1S03 G;  1XMO B;  1A0I A;  1SYX B;  3E22 B;  3N2G A;  2UXB B;  4PZ7 A;  4GKK H;  2CAZ C;  3J81 W;  5IT9 W;  4EQ5 A;  3ETQ A;  1TVK A;  1DGS A;  2UXD B;  2F1M A;  2R72 A;  5LMU B;  3BAA A;  3N6X A;  5JCO C;  3RTX A;  3RIZ A;  5C8Y A;  4O2A B;  5IWA H;  2O03 A;  1Z5W A;  4FLU A;  4TOI A;  4DV2 H;  2VQF H;  4Q0Y A;  2ZM6 B;  1CKM A;  4YHH H;  4LFA H;  4X65 B;  3FMA A;  4DV3 B;  2P22 C;  2UUC H;  4BW9 A;  5LYJ B;  3GJX B;  1XNR B;  5KHJ A;  1AN7 A;  4ZOL B;  1Q43 A;  1E4F T;  1I6U A;  1IBK B;  4YJ3 B;  4DR4 B;  4O2A A;  1SQG A;  4UFZ A;  5LA6 A;  1RSO A;  3J7A K;  1J5E B;  4JI8 H;  3T1H H;  3DSQ A;  4X20 B;  4DK0 A;  4UCT A;  4MV9 A;  3TY8 A;  1XMQ B;  2ZIN A;  2KSW A;  4DV7 B;  3NBZ B;  2UUB H;  5JCO A;  1Z5V A;  3RYH B;  1TUB A;  5J2U A;  4LFC H;  5BMV B;  4LH7 A;  4YJ3 A;  3JAL B;  1E4G T;  2XIG A;  3N42 B;  1BGW A;  4UCV A;  4U3J A;  4X20 A;  3HKB B;  4IIJ B;  4MV7 A;  1GYF A;  3ZED A;  2HVQ A;  1CKO A;  3KAJ A;  3RYH A;  4GKK B;  4WBN B;  4O4H B;  4DR3 H;  1IBM H;  4X64 H;  4PDB A;  2QM4 A;  1I7F A;  4NXN H;  2YXL A;  5BMV A;  3W1G A;  3UQ8 A;  5D1P A;  3M4I A;  5GON B;  5JQG B;  4UCS A;  3JAL A;  3RGX A;  1SQF A;  2Q0A A;  3BPZ A;  1N36 H;  2ZNI A;  4HNA B;  1S68 A;  2ZNJ A;  5IWA B;  4IIJ A;  4JYA H;  4DV2 B;  2VQF B;  1XHX A;  2V4D A;  3BHP A;  4YHH B;  4LFA B;  4LSX A;  5LP6 B;  1HNW H;  2HGS A;  4I50 B;  3HXL A;  5BR8 H;  2UUC B;  5GON A;  3W1B A;  4L8J A;  2R9A A;  4IHJ B;  3H20 A;  2ZIO A;  1WH2 A;  2Q7G A;  1WNS A;  2VQE H;  4JI5 H;  4TV8 B;  5K1X A;  2PGG A;  4CH6 A;  3K5N A;  4TQF A;  4JI8 B;  3T1H B;  3U11 A;  2F4V H;  1KU9 A;  1KMI Z;  2E3C A;  3N2K B;  4LFC B;  3ZS8 C;  5KHK A;  3HKE A;  4JI7 B;  5DIS C;  3N44 B;  4B3T H;  4F6R B;  3VNN A;  2RGR A;  4B3R H;  4TV8 A;  2YI8 A;  4DR6 H;  3MWM A;  1NT2 B;  2UUA H;  4FLT A;  3DF7 A;  4DR3 B;  1IBM B;  4X1K B;  4NXN B;  2MCT A;  4X66 H;  5KX5 A;  5FLX W;  4FFB B;  1XNQ B;  1FFX A;  2JS5 A;  3JAR B;  2HIV A;  4F6R A;  3EYY A;  3N40 P;  3T1Y H;  1N36 B;  4Q6G A;  3CHX A;  4CH3 A;  2PYJ A;  2UU9 H;  5KMG B;  4JV5 H;  4R7R A;  4FLZ A;  1ZHS A;  4LF4 H;  2KKW A;  4LF7 H;  5EOY A;  4EB6 A;  4X1K A;  1SKV A;  3OTO B;  2VWJ A;  3TY5 A;  2GV9 A;  1T5E A;  2PYL A;  2VQE B;  4JI5 B;  3K5M A;  4PHZ A;  2YIA A;  3E22 A;  1H2S B;  3KXY T;  4J0M A;  4DV1 H;  4GKJ B;  3CB2 A;  3RYI B;  2F4V B;  2F93 B;  4B08 A;  3SGI A;  4TUY B;  4O2B B;  1XQ8 A;  4DV5 B;  4CH4 A;  4EEQ A;  3CSX A;  4JI2 H;  2ZIM A;  3K57 A;  1FVI A;  4O4J B;  4LF8 H;  1QQC A;  4DRX B;  1P8L A;  5EYP B;  4M7E A;  4DUY B;  1Q5O A;  1Q3E A;  5IYZ B;  4FM1 A;  4DUZ H;  4LR3 A;  3UT5 B;  4FLW A;  4B3R B;  4DR7 H;  4BWA A;  4RB2 C;  3HKD B;  3RYI A;  4B3M H;  4DR6 B;  4TUY A;  5CA0 B;  5LYJ A;  2RGV A;  4O2B A;  2PZS A;  4K8Z A;  1SA0 B;  4RAY A;  1TGO A;  2UUA B;  4ZOL A;  4I4T B;  5LOV B;  1P16 A;  3QTC A;  4DRF A;  2RQ6 A;  4O4J A;  4X66 B;  4DRX A;  5EYP A;  2E5L H;  5IYZ A;  3VQX A;  2OYQ A;  4DR5 H;  4PI2 A;  4LH6 A;  1O9H A;  3UT5 A;  5ITZ B;  2W57 A;  4RZQ A;  5CA0 A;  2UU9 B;  2PTM A;  3F8N A;  4JI0 H;  4DV0 H;  4JV5 B;  1Q8I A;  4DV4 H;  1SA0 A;  4KHP H;  4LF4 B;  2VOB A;  4LF7 B;  2BTQ B;  1IBL H;  4EFB A;  3MAQ A;  5D1O B;  1HW7 A;  5JVD B;  2BTO A;  3M7M X;  4AHC A;  3JAM W;  5LP6 C;  4DR2 H;  4K0K H;  5D5Q A;  4DR1 H;  4JI4 H;  5FPO A;  3K59 A;  4ZHQ B;  5ITZ A;  4BWS C;  4X1I B;  3HKB A;  3NBY B;  1MZB A;  4A2B A;  4WBN A;  4O4H A;  4DV1 B;  2P5O A;  5LL6 b;  3L2P A;  4FVM A;  5D1O A;  2Q7H A;  5JQG A;  5JVD A;  4FLX A;  2UXC H;  2PY5 A;  3KAL A;  4DK1 A;  2FE3 A;  4LF9 H;  4X1Y B;  4JI2 B;  4JI1 H;  4HNA A;  4GYC B;  4ZHQ A;  4ZIB A;  3K5L A;  4LFB H;  4CS4 A;  3L4J A;  4X62 H;  3THO A;  4DR7 B;  1M0W A;  2UXB H;  5LP6 A;  5IJ9 B;  4B3M B;  1VF7 A;  4I50 A;  3S24 A;  5FPR A;  2UUB B;  4AIL C;  3IAY A;  4NVP A;  4TV9 B;  3K3V A;  4IHJ A;  5CA1 B;  4CH5 A;  1O75 A;  3HKC B;  4FM0 A;  5FNV B;  5EZY B;  2E5L B;  3K58 A;  1V9P A;  4JI3 H;  4I7H A;  5CB4 B;  2VWK A;  3RYC B;  1XI1 A;  1HR0 H;  4FM2 A;  2VUG A;  4MTE A;  1M4U A;  2HVS A;  2WE6 A;  4KL1 A;  4X65 H;  4DV0 B;  3N2K A;  4I9Q A;  4KHP B;  4X64 B;  5CA1 A;  2HIX A;  4UCU A;  1XNR H;  1FJG H;  1IBL B;  3N41 B;  4LF5 H;  3QG5 A;  5EIB D;  4DR2 B;  5FNV A;  4K0K B;  3KAK A;  1YEW A;  5EZY A;  4O4L B;  4DR4 H;  4DR1 B;  5CB4 A;  2ZJT A;  5KHG A;  2UXD H;  3RYC A;  3VQY A;  3U10 A;  3JAW B;  1M93 A;  3IG0 A;  4JYA B;  3LML A;  3JAK B;  1XHZ A;  1QHT A;  1HNW B;  5BR8 B;  5LXT B;  2HVR A;  2YCH A;  3WB0 A;  4FFB A;  4YY3 H;  2UXC B;  3JAR A;  5EIB C;  5JJE B;  2Q2U A;  4AQY H;  3WB2 A;  4LF9 B;  1VS0 A;  1M5I A;  3JSN A;  2VPS A;  3K5O A;  4K8X A;  5KMG A;  1X9N A;  4OX9 H;  4LFB B;  3JAK A;  2QJ1 A;  4X62 B;  2XHB A;  5LMN H;  3B2E E;  3OTF A;  5LXT A;  3RGB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...