4UCSA

Fragment bound to h.influenza nad dependent dna ligase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
317
structure length
317
Chain Sequence
MTNIQTQLDNLRKTLRQYEYEYHVLDNPSVPDSEYDRLFHQLKALELEHPEFLTSDSPTQRVGAKPLSGFSQIRHEIPMLSLDNAFSDAEFNAFVKRIEDRLILLPKPLTFCCEPKLDGLAVSILYVNGELTQAATRGDGTTGEDITANIRTIRNVPLQLLTDNPPARLEVRGEVFMPHAGFERLNKYALEHNEKTFANPRNAAAGSLRQLDPNITSKRPLVLNAYGIGIAEGVDLPTTHYARLQWLKSIGIPVNPEIRLCNGADEVLGFYRDIQNKRSSLGYDIDGTVLKINDIALQNELGFISKAPRWAIAYKFP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title From Fragments to Leads: Novel Bacterial Nad+-Dependent DNA Ligase Inhibitors
doi rcsb
source organism Haemophilus influenzae
molecule tags Ligase
molecule keywords DNA LIGASE
total genus 101
structure length 317
sequence length 317
ec nomenclature ec 6.5.1.2: DNA ligase (NAD(+)).
pdb deposition date 2014-12-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01653 DNA_ligase_aden NAD-dependent DNA ligase adenylation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.610 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 4ucsA01
3.30.470.30 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 DNA ligase/mRNA capping enzyme 4ucsA03
3.30.1490.70 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4ucsA02
2UUBB 2HVSA 4GKKB 4DR3B 3BA9A 2UUAB 4PZ6A 4DV4B 4AQYB 4LF4B 4EQ5A 2HVRA 4DV3B 4DV5B 4DRFA 1V9PA 5BR8B 3OTOB 1P8LA 3QWUA 4UCOA 4JYAB 2UU9B 4NXNB 4NXMB 2F4VB 4GLXA 1B04A 4UCUA 5FPRA 3W1GA 5FPOA 1XNQB 1S68A 2VQFB 1IBMB 1HNWB 4PZ7A 1J5EB 4DR5B 3RTXA 4JI0B 2UXDB 1IBLB 2ZM6B 3KYHC 4B3SB 4LF9B 4JI1B 4GKJB 3UQ8A 3VNNA 4PZ8A 4E6NA 4LH6A 4DV7B 5D1OA 4DR1B 1I94B 4LF6B 2VUGA 3BABA 3NC0B 3RR5A 2UXBB 4UFZA 1IBKB 4YY3B 4JI4B 4EEQA 1N34B 2CFMA 3L2PA 4JI5B 4LF5B 3W1BA 4UCTA 4JI3B 3TY9A 5IWAB 3TY8A 4DUYB 4DR7B 4YHHB 4X65B 4UCVA 4LF7B 4DUZB 1FJGB 1N33B 4LFAB 4JI7B 2HIVA 4K0KB 4UCSA 4CC5A 3TY5A 1FVIA 3GJXB 1HNXB 4EFBA 3JSLA 3T1HB 1HR0B 4LH7A 5DISC 3BAAA 5D1PA 1TAEA 3JSNA 4UCRA 1ZAUA 1N36B 4KHPB 3GDEA 1XK5A 4DR4B 4DR2B 2Q2UA 4LFCB 4B3TB 1A0IA 2HIXA 1XMOB 1HNZB 4JV5B 3GB8B 2UXCB 3NBYB 3S24A 4DV6B 5LMNB 2HHHB 1TA8A 4B3RB 1CKOA 4JI2B 5D1OB 1DGSA 2OWOA 4X66B 4JI8B 3PN1A 4CC6A 4X64B 1XMQB 4LFBB 1CKNB 2VQEB 3BA8A 4JI6B 1VS0A 1XDNA 1CKNA 4DV2B 4TOIA 1CKMA 2E5LB 4X62B 4LF8B 2HVQA 3NBZB 1P16A 2UUCB 1N32B 1X9NA 3T1YB 3W5OA 3SGIA 4EFEA 4DV1B 5LMUB 4B3MB 2Q2TA 4DR6B 4OX9B 4DV0B 1XNRB
chains in the Genus database with same CATH superfamily
2AXTZ 2A1HA 1JJOA 1GSOA 4J9KA 3H4DA 2BQUA 2JDIG 3AK1A 3HB3B 1MABG 3OT7A 4PHZA 2HVRA 2CK3G 1HR0H 1DF5A 5AG2A 3ABKB 1JFFA 2F1MA 3CXHF 1BL8A 1S5HC 4UCOA 2SCUB 2Q7HA 2ZXWC 4J7KA 4NXMB 5B1BC 4FLYA 5KS8A 1JX4A 5FPRA 3V6JA 1I7FA 5H9CA 4F6EA 1T36A 4ZHQB 1CEZA 3V4SA 3F8NA 2MCTA 2IA6A 1WNSA 3CCSV 2UUAO 4GKJB 3K06A 3WU2Z 1XL4A 2WTFA 4ED7A 2ITCC 2V1DA 5LOVB 1HNZH 4JXUA 5LA6F 3FFQA 1DV2A 4O3RA 2ZIOA 5IY5C 3JZFA 3UO2A 3AG1B 2DYSC 1L8DA 1VAJA 1UJWB 3RR5A 2RNBA 4FM9A 2YIDA 3GIQA 4JI4B 3DTGA 1COWG 4Q6GA 4GKJO 2UUCH 1RM1B 1SYXB 5H6QA 5LMUH 3ZRVA 4A3FG 2ZDIC 3E86A 4O2AF 5KFCA 3FKIA 3HR0A 4FPPA 3SPCA 3SPIA 4U7NA 5DQGA 2FLPA 3ETJA 3L4KA 3G4SV 1IXMA 3HOXG 3PO2G 4GKKH 3QF7A 1QCEA 1S0MA 3G6VA 4A3CG 2ZD9A 2E3CA 2ZE7A 1VBHA 4MVOA 2Y4TA 1AP5A 1CS0A 4QE7A 2EJ0A 4XZ3B 1FFXA 4JI8O 4JI2H 1Y14B 2EILB 2DQ0A 3WWJA 4MA0A 5BYBA 4FK5C 4DO2A 3J7AK 4X66H 1R9TA 3FAVA 3CP1A 3VBBA 1BT8A 4PDVA 3ABLB 1XQ8A 5D1OB 2JEXA 1NBMG 1PP9H 4NTWA 2LW7A 3ZRWB 1E4EA 3FAVB 3PFFA 2RGVA 5C93A 1Y67A 2QWRB 4QWBA 1Y76A 3K5NA 3MAQA 4BXXG 1KD1W 4U6PA 4JPRA 2Y69B 2FTKA 4YJ2A 3OMNB 1P16A 1X9NA 3SGIA 2P06A 4DV1B 4O4JB 1G4YB 4AQYH 1ZTEA 3R5XA 2DAAA 3BPZA 4GX1A 4ASUG 2YW2A 5LHIA 2UUAB 3RYIB 4UVBA 3B8NA 3I56V 3N40P 5KFKA 5EC1C 4A2BA 4NB5A 3LDDA 2Z3YA 4QNHB 1ZUQA 2XCPA 2DYRB 3UM7A 2XTAA 3AG1C 4MW3A 4ZHQF 1PD3A 1V9PA 4DK1A 1FAFA 2BR0A 1MOFA 3Q1KA 1QLEB 2ADPA 3RYHB 4GLXA 4AILC 2WWWA 4L1KA 2AGAA 2QM8A 2P0AA 2Y0IA 4DR5B 4TT3G 1M6VA 5DMXA 2QEXV 2DWCA 1KKDA 2IJHA 3EHBB 3ABLC 3U11A 2E5LO 2X6AA 1I94B 1AJQA 2IJIA 1CP9A 3H0GA 2M05A 3BABA 3CVZA 1FPOA 5H2FZ 4DL5A 2C28A 2NN4A 3WB2A 2XHBA 5EWFA 2EJ3A 2Y69C 1GN2A 5EZYB 1XI1A 4F4XA 2ODTX 3E8FA 3IC9A 3E8HA 1WLEA 2FE3A 5KT6A 3VQVA 1RSOB 4MTXA 5I5TA 4BIZA 3AW8A 3LUTB 5JWPA 4HAMA 3RV3A 5CA1A 3VA7A 3LSSA 3OMIB 5I5WA 5KG4A 1WB7A 1SRYA 2DYRC 3TY5A 3HPLC 2DLNA 1EN6A 1VQ8V 1JKJB 3JSLA 3KG2A 2B1GA 2I87A 3JZIA 1RJQA 4R8UA 4LWSA 3DAAA 5DISC 3MHHC 3JSNA 5A9GA 4FIPC 4KHPB 4FVMA 1BHAA 4EBEA 4PBCA 1J5EH 2JA7A 2Y4RA 4K8ZA 2PTMA 2Q4PA 5IP9G 2QKSA 5KFVA 1XNQH 4EG0A 4K35A 4HBNA 3DXRB 4F6RA 4O83A 4CE5A 4RAYA 2C2DA 3TXQA 2HVJC 4DR1H 4K3AA 1QVFU 1M5IA 5I5VA 4YY3O 4IYHA 1T94A 2QM7A 1E79G 1RK5A 1QU7A 1SESA 1JXLA 2IBKA 3J7AU 2YL2A 4JI4H 2Q7EA 1CKNB 1N34H 1SCUB 4HNUA 5BWWA 4U7OA 4O7YA 1VS0A 1N56A 5GTIZ 3E35A 5LYJA 5A2QN 1GM8A 4X89A 3J81W 4RAZA 4RUCA 2YWVA 3CCQV 4FBUA 1P7GA 4I55B 2YS6A 3RYFA 1KJ9A 4GC6A 4MTFA 2CNVA 5IWAH 4MTEA 4HNTA 4DUYH 3HT5A 2WE6A 2W9AA 1H2SB 1GO3E 1IOVA 4DV5O 5BR8H 4GCZA 4MVRA 2FPIB 4B7EA 5E79Z 4CKEA 4TM5A 3UZBA 3ICXA 2ZE8A 3RV4A 2Q6AA 1VBGA 4KHPH 3D3IA 2PYJA 4I4TA 4JF3A 1V51A 1SQBH 4ECYA 1XNQB 4DV3H 2VQFB 1LNQA 5BWTA 3DTFA 4DR6O 3ZHVA 1WPXA 1Y76B 1GMGA 1U96A 2ZM6B 3KYHC 3C3TA 3JAKA 3T4ZA 5DG7A 5JQGB 2Q67A 1VQ4V 3WO1A 4JI6O 2JGUA 4YB8B 1K73W 5LGNA 2N05A 2R92A 4I7HA 4O2BA 2HHHH 4QIWE 4AI8A 2OH2A 5JQGA 2UXNA 4I55F 4FE2A 5DLGA 1Y74A 5BWRA 3JARA 2HKOA 2EIKB 4PV1B 3J80N 3BQ0A 1TWGA 2YZNA 1S10A 4MSWC 1WPBA 4JI1O 4EYHB 2IH3C 3GWKC 2UXDO 4C5CA 1NR1A 4G27B 1WCMG 3S3XA 2H8PC 3JATB 4IL6Z 3M99B 4X9QA 4FFRA 1JCHA 2ZCEA 5J9PC 2QB5A 2CTWA 2HIVA 1HR0O 3CS5A 2KQXA 1Q90D 4KUMA 2YU9A 1NTKH 3GJXB 4DR2H 1K9MW 4YR0A 2R82A 4UXNA 3P3NA 3H40A 4DK0A 1B6QA 3FKIG 2XGPA 1AI4A 3HOWG 4Q8EA 1SKVA 4ZOLF 4FU0A 5CMUA 5IP7G 4NTYA 3OFNG 2QYZA 1VMGA 4ECZA 4FS2A 2ETNA 1CQJB 1Y4MA 1VQNV 4LFBH 4MVMA 1I08A 2IJKA 5KFYA 5L1IA 3E83A 2R7KA 2Z0AA 5LP6C 5IJ0B 1YJNV 3T9CA 2QR4A 1Y1VG 3IJ4A 1OCZC 4GX5A 5IT9W 1XMQB 1N32H 4WFGA 2VQEB 2EINC 1H38A 1S76D 2YYAA 1BS3A 2P5OA 1TWCA 3G6XA 4F50A 1UC9A 4CS3A 1IBKH 5H80A 1V55B 4MTGA 3W7SA 4C2MA 2IU3A 1G6UA 3B77A 1HP8A 4IYIA 3JCUZ 2Y4UA 4HYKA 2Z04A 4LF7H 4OX9B 1KJQA 1X59A 2HVSA 2FK3A 1QLEC 4CKBA 1IVSA 4KHPO 2BOBC 5ITZA 3NXSA 3HKEB 4B08A 3RBEA 3T1HH 4NXMH 1S9FA 4TV8A 3KXYT 4DV1O 4FGRA 2P67A 4TV8F 1N33O 1UC8A 4I0XB 4LF8O 3LULA 2YIBA 5CA0F 1AJPA 5B1OA 1F23A 2BTQA 2X6BA 5HFMA 1DIKA 4LF6H 1JA8A 3CXCU 1NT2B 3K5IA 1K3EA 4J9MA 1NVPD 4NZMA 2RDCA 3W7XA 1V4YA 3R9RA 4FS1A 5J2TF 3ZMTA 3JRWA 4LMYA 1MG1A 4DL2A 1JPXA 1SERA 4J9NA 1VF6C 1XMQH 5IYCG 2VQEO 1EHIA 1M9NA 2NUAB 5JH7B 2FKLA 5I5YA 4DL7A 4TQSA 1XNQO 1I6UA 4DV6O 4EGJA 3ASOC 3TQ1A 1EUCB 4BIOA 3S3WA 4X64O 5KAIZ 2I8CA 4UCTA 3GV8B 2R70A 5LXTA 3OM3B 3P30A 4PDRA 2ZDQA 2NLJC 3RYCB 4O86A 5EWGA 1ZSPA 4DR7B 5LP6A 3TQTA 4JI7B 3T9AA 3I12A 3BACA 3NUAA 4B3TO 1S0NA 3M8AA 5LP6B 1A9XA 2CDYA 4WFFA 4J10A 2QE7G 3VOTA 1HR0B 1WR2A 1BE3H 4O4LF 1AVMA 2W6JG 1TAEA 5J2TB 4YHHO 1EKVA 3GDEA 1K97A 2W9CA 2JGDB 5FD5A 2HIXA 4RUEA 4Z2WA 1KQSU 1H2NA 4FFNA 5B3SB 5CB4A 3TEKA 5JJNB 4DR5H 3NBYB 3K3VA 1MNGA 1DLBA 4EKWA 4N23A 5FLMG 2BE3A 1S0VA 5KFZA 3JD3A 1PX2A 2JA6A 5CE8A 3K9SA 4IGGA 3T54A 1YITV 3AG4B 3ABTA 2KSDA 5BMVB 4DAAA 4H13B 5EZYF 2MW2B 4J9OA 4B3MB 3CSWA 3AK2A 4LF4H 1WB8A 4YIOA 1RYSA 4R8UB 5LMNO 4O4IA 2O57A 3J81N 4RB0A 2LGWA 3AEIA 5L3BA 1VEWA 2V4QA 2UUBO 2EIJB 4H0LB 3B40A 1SQQH 3K5MA 4DV4B 3LP8A 4MTDA 2UU9H 1EBOA 4LFAH 4ECXA 4DL4A 4JASA 4JTAB 1BZKA 3NR7A 3K79A 1R3IC 3JASA 5EBLC 3HB9A 2J9GA 3RUPA 2V4DA 4JTDB 1N8RW 2EJ7A 3HKBA 2IBZH 1EKPA 1Q3EA 3FYIB 3OUUA 3RTXA 3OHAA 2M6YA 3Q8SB 3MHSC 4QIWF 5LMNH 2OIEA 2WLLB 4IRKA 2W7OA 3PJSK 4PI0A 2QTOA 4FFKA 2XAJA 2YS7A 4DR1B 4YR3A 5DGBA 5LA6B 5LYJF 2AGPA 2DE0X 2AQ4A 2YEVA 4UFZA 4LF5O 4B3RO 3SJQC 2ASDA 1Y74B 2N74A 1N34B 5JUMA 2EJ2A 5L3CA 2QA4V 4KP4A 5KT7A 3TY9A 1XNRH 3FYEB 3TY8A 3KHHA 4UUGA 3PR5B 4PDBA 3G71V 3CCUV 4TVIA 2GUZA 1Q6HA 4UB6Z 3SDLA 1EFRG 1MMMA 4UCVA 4DUZB 4QW8A 2R6FA 2J6UA 4UCSA 1GK9A 4MTOA 4YAKB 1NU1H 3QO5A 1VQMV 4IIJF 3FB5C 4DRXB 3ZHRA 4B3TH 1WCMA 1VKZA 4MVUA 1SA0A 4X20A 1N36B 4O3NA 1OHHG 1DF4A 1FYJA 1MZFA 2W9BB 3PR4A 3M4IA 5K2MA 2YIBD 5F2VO 3ZBHA 2UUCO 1CE8A 3S24A 2ZM6H 1TA8A 5JQGF 3N8DA 3QG5A 3SJAC 5BY1A 5LOVF 1ZQ7A 4F4WA 4O2BF 3E89A 1HNZO 3T9FA 1NH2B 2C22A 5FNVB 2EIJC 2OWOA 4JI8B 5KFAA 5KFMA 4IHJB 4X62B 1ZHSA 5KFOA 2WPDG 3CMEV 3OR6C 1P7BA 1XL6A 3IAYA 1XHXA 5FD6A 1HDJA 2WAMA 1PPJH 3UKMA 1VQPV 2PGGA 3UYYA 2UXCO 3A0BZ 4FM0A 4PZ6A 1K4CC 2X5RA 3H1LH 1N33H 4AQYB 4X20B 4IWYA 2Y48A 2NU6B 1Q6IA 3EFFK 1GN3A 1QQCA 5CN0A 4PA3A 2DOSA 1FJGO 1P8LA 5LHHA 2W0FC 5EBMC 1S68A 4PZ7A 4IIJB 3CPWU 2X0SA 2GBOA 5DLFA 3DC5A 3K04A 4K0KO 3ZIAG 1Q43A 4FM1A 4J9YB 4LF7O 4NKGB 4O2BB 3ABMB 3DGEA 5BWVA 1R6TA 2UXBO 2YZGA 1N32O 3AX6A 1VF7A 3D36C 5KT4A 5DG9A 2JEUA 1Z2OX 1AI6A 2ZINA 3OAAG 3U9TA 4J9QA 5I47A 2DIKA 2UVRA 4LNUB 4JI3B 2XD4A 1PK8A 2YCHA 2UVWA 2COIA 3KHRA 4I4TB 4K0KH 3IG0A 3BRCA 4P9PA 5EIBD 1Y1VA 3TINA 4O3PA 3WB0A 2CW8A 3N2KB 3KALA 2AHZA 1KMIZ 3H1HH 3EPGA 1M1KW 4O4HB 2V58A 3MR6A 2C35B 1DTOA 4ZBMA 3CCLV 4J0MA 4CH3A 4JZGA 5B5EZ 1NR7A 3E2EA 4TV9B 3F5WC 4RZQA 2ZJTA 2RMKB 5LXTB 2HJFC 1UFIA 2LGQA 4MV4A 2W70A 1ZL8A 3ZEDA 1K7DA 5DGAA 2Y0SE 2HFEC 1OBGA 4P30A 2DPIA 4X65O 1I3QA 5I60A 4DYLA 2CTQA 5EYPA 3FD9A 2A9HA 1DGSA 3FB8C 4U3JB 2HLDG 1E1QG 4O84A 4OX9H 2GV9A 1I1LA 4QJFB 3N6RA 4JYYA 4ED1A 3R23A 4A93G 3UFXB 3OEHG 1Y1WG 3CQZA 1SA0B 3OSNA 1KECA 4DV0B 4JYCA 3KREA 5IYZF 2JRIA 1ROPA 4NXMO 4KXRA 1EM1A 4DV1H 4CH6A 4WHXA 1T5EA 1H2MA 5BPFA 1I5YA 3RAQA 4O4IB 4R7CA 3CC2V 5CA3A 5I5SA 2QGNA 3JAMW 2ODMA 4DV0O 3N6XA 5CBGA 1K83A 3SI8A 1KT8A 1N48A 3OMAB 1H2KA 1O9HA 2QF7A 4DV7H 1XMOH 1QBZA 2VUMG 1B06A 3ZRXA 2R8HA 3GV5B 3AG2B 2ZR3A 4O81A 1LUWA 3CCEV 1Q7YW 1B6SA 4J9RA 2BQ3A 1A32A 1OCCC 3GVMA 2YDEA 4AYBA 1K33A 5K1PA 3JD0A 3CRQA 1I0HA 2ZIMA 1VQ7V 4UUJC 3Q8RB 2WLJA 3CRCA 1SQGA 5DECA 3DF7A 2W6QA 3W1BA 2F43G 3G8DA 2CZGA 2HR3A 2ADQB 4C5AA 3KCXA 2XC9A 2FPGB 3MWEA 3L74H 2COGA 5KFFA 3GLKA 2DPJA 5KT3A 2W8KA 3AG7A 4CH4A 5DQHA 1IYEA 4ECVA 1FXKB 2Y0SA 2A3QA 1J5EO 3I4NG 1TWHA 4FLVA 1D5NA 1IDSA 3JCZA 2CAZC 3BAAA 2PZSA 1S5JA 4MV6A 1YIJV 5L3GA 3MD0A 4APMA 3SPJA 3Q2OA 2BCCH 5J2UF 3T1YO 1RP3B 4C7UA 4LF4O 2E74B 3KTMA 2RDJA 4JAVA 3IGAC 1KYOF 4TUYB 2HP8A 1OCOB 3JD1A 1VQKV 2F23A 2HHHB 3CEBA 1YVWA 3ABUA 4LSAA 3K5LA 3ZMVA 3MR3A 4GX0A 3U0ZA 2QDOA 4PA6A 4LFBB 2W6IG 2YZMA 3KZIZ 3CB2A 4CH5A 1Q86W 3RB3A 3FX7A 3ABKC 5DN6G 3EVKA 5KFIA 1I2LA 2R9IA 4DV2O 5L1KA 5KFGA 1IXBA 3I4MG 3SNOA 1DK1A 2A06H 1GN4A 2XCLA 3HKZA 1MA1A 4FBTA 2IU0A 4DR6B 1XNRB 2EIYA 4XX0B 3VQWA 5KFWA 2B63G 3GTOA 1PL4A 3WG7C 4DR3B 3BA9A 1JLLB 3K5OA 1M0TA 1R3JC 5EBWC 1FJGH 4PA4A 1IYDA 4P2ZA 2VUMA 4CS4A 4BW5A 2E76B 3TIGA 4ETSA 3N2GB 4F4LA 4O4IF 5F9LA 1XUQA 2PUSA 5BR8B 3QWUA 4JI0H 4JYAO 1GH6A 2NR5A 4ZI7A 5EZYA 2XAGA 1IBMB 3GV7B 2HEPA 1OCOC 2JEJA 4WCEV 4JAAA 2P7TC 1PKXA 5KFQA 3PZPA 3RGZA 2YXHA 4PZ8A 2JEIA 1BGYH 2CE4A 4DV7B 5LL6Y 4FJCC 1RFYA 2HJWA 3TW6A 1JVMA 1VQLV 4JI4O 3Q4HA 5KFUA 1V54B 4GUNA 5LYJB 3GILA 1RYRA 4D6TH 1IBKB 2CTPA 2YUAA 4BAYA 2ZGIA 1L2ZA 4JI5B 4ZI7B 5L9XA 3VPBA 4I9QA 2W6PA 3GTJA 2NNUA 4ED6A 4CHIA 3GTGA 2ZDHA 2XNDG 3CJHB 5KHHA 5DAAA 2EINB 3ETGA 2BSKA 4DR3H 1SF9A 3SPHA 5JQWA 1IX9A 2FB9A 1KEEA 2UXXA 2O03A 2V4RA 4JGSA 3LNNA 1IURA 4LFAO 1XMOO 4ZKIA 3OTOO 4ZQIA 3RYIA 1N36H 4DR7H 1FKAH 2CNUA 1HNXB 4AYBE 2AW9A 1G8MA 5F9NA 1H8HG 2AU0A 4D7SA 2JA5A 3IFXA 4JV5H 5BWUA 4IZOA 3SYPA 2R7ZG 4DR4B 1M7JA 1R3LC 5GONA 3VPDA 2X7RB 1KBHA 3H3VH 4RNOA 4MAMA 1RSOA 5LBQA 3GB8B 5LHGA 2F66C 2V9WA 1FS0G 2ZQMA 3CYOA 1CXZB 5IE9A 1IBKO 3OEEG 2C2EA 3GWOA 3OUFA 5KUKA 2JEFA 3H1KH 2VPSA 2M7WA 2DN9A 4CC6A 4U7CA 1UPGA 1ORQC 2WA3A 1NTMH 4U3JA 1I94O 2E5LB 4HNVA 4X8AA 1O9GA 3M9OB 2Z02A 2CGNA 3E8BA 5EYPB 4ECTA 5KA5A 3ML0A 4GLWA 3L9DA 3QFFA 2WA4A 5EOYA 3JASB 4TQFA 4EFEA 4TQDA 5LMUB 1EYZA 5KKNB 4Q45A 4A3BG 3SJBC 1KJJA 4BBRG 4IRDA 1EN5A 5L1LA 1FXVA 3WFVA 2ZE5A 3H1IH 3CCMV 4G28B 3E22A 3FB7C 5L1JA 4DR2O 1ZX3A 4MW8A 5KFTA 4WFBV 2XUMA 3AG2C 2BOCC 3HKZE 3LSUA 4RQFA 2L6LA 4FZ1A 4RB2C 2PMZE 2UU9B 1KJIA 4O3SA 3RW0A 1NZ6A 2X0LA 4DQNA 5KT5A 3TK1A 1M90W 3QQMA 3W1GA 5KMGA 3T9DA 4A3KG 4A2AA 4QSHA 1GN6A 4QWEA 4HR7A 3H4BA 1EN4A 3QO7A 2NVXA 1QR9A 1TUBB 4X1IA 1M57B 4CKCA 4LF9B 3JARB 4NYEA 2RDIA 4ED3A 1ZLZA 5D1OA 4LNUA 4M7EA 4QE9A 3FMAA 1Y66A 3ZHSA 3PW7A 2ALZA 4CS2A 4JI3H 2CQYA 2YC0A 3RVZA 3F5TA 4FFBB 4OPAA 1URFA 4JI2O 4JI8H 2JJ2G 1FXKC 5J2UA 1BQ0A 4RU9A 2C2AA 2ZR2A 5C4XG 5KFEA 3SE7A 4DV3O 5BZBA 1Q8IA 2KG7B 3R5HA 1GM9A 2DZDA 4DV7O 3RBDA 2YS8A 5GTHZ 1WAZA 4TV8B 1FJGB 3AG4C 3ZRSA 1JDEA 4X88A 2W0XA 5D5PA 4O4HF 1GRJA 3RWRD 2I80A 4LBEC 3BQ2A 4YHHH 1OZ0A 5KG3A 5IYDO 3K59A 1XOUA 4JI7H 4LH7A 3TGUH 1AI5A 2WLKA 4BWSC 2R7ZA 1FKAO 4YP3A 1VQOV 1ZAUA 2WLIA 4LP8A 1Z5WA 1Y6XA 1YTFB 3LDCA 3RBZA 4NXNH 3D8CA 4LFCB 3P32A 1S03G 3B4SA 3Q8PB 3HXLA 4RCNA 2RN9A 1IOWA 4DV6B 2X6CA 4I55A 1VQ5V 5KG6A 2Q0AA 4IHJF 4RUAA 2XT9A 1OWTA 3UO3A 4ZIBA 5H5NA 2R93A 3B2EE 4WFAV 3TCUA 4X66B 1S97A 1U97A 3DXRA 4F6RB 1S3JA 3ZX6A 5IYDG 4RQEA 4DV2B 4Q43A 4WBNA 3OD4A 3RJ0A 3K9AA 1OCRB 2YI8A 3VQXA 4O82A 1AR5A 3Q8QB 5KHIA 1OBDA 3MJFA 5JJEB 3ZHTA 4NLGA 1NQTA 1YJWV 1OV9A 4GKKB 2YICA 1BQZA 2JGDA 4NYKA 1BJTA 4B3MH 4JI0O 4NZOA 3QVNA 5IT9N 2QKCA 3N43B 3W7UA 1SZXA 5T14A 5L3DA 2FPPB 3O9OA 2FB5A 2IH1C 1KC7A 4R6ZA 4DUZO 4BIUA 2J6TA 2ZDIA 3L75H 1G2WA 4NXNB 4UVCA 2F4VB 1AN7A 4EBDA 2A79B 3HKCB 1GM7A 4RB1A 2H94A 4YQWA 5KFSA 1V54C 1J5EB 1YTFD 2VWJA 2FK1A 1Q5OA 2FMLA 4C5BA 1IBLB 2GUZB 2E2HA 4ECQA 5KG1A 1WP7A 2ASLA 4U3FH 4JV2A 1AR4A 4I9WA 4EBCA 3G67A 4HNAA 4JTCB 2W6NA 4DW1A 5JCOA 2AGOA 2JK5C 4J7JA 4UV8A 4GKJH 1AILA 5KG5A 3T9BA 1SETA 5JH7A 2CFMA 3VPCA 4DRFA 5LGUA 3SPGA 2CW7A 3L71H 1B6RA 4H44B 3N44B 3CX5F 1CQIB 5CM0A 5C44G 5C8YF 3GTKA 2B9ZA 3ZHUA 4PI2A 4IR9A 4EGQA 3HOVG 4LFAB 2W9BA 2BTQB 5BYAA 1VF6A 2IJJA 4CC5A 3STZC 1S77D 1JMKC 4A3EG 2FLLA 3DSQA 1WA8B 3SYCA 1C3OA 2OLSA 5D1PA 1W93A 3GIJA 4HYOA 2RQ6A 4UCRA 2V59A 3R5FA 4YR2A 5ITZB 1OCRC 3ASNC 4BWAA 2QWNB 4CZZA 3N2KA 1SC5B 2VQFH 1GAXA 3TETA 1EZVH 4A3GG 2E2IA 2Q8VA 4FFLA 2UXDH 3ZMSA 2VQEH 3HOZG 2W7PA 1TUEB 1CKOA 2P22C 3IN5A 1W96A 2WYOA 3JAKB 1ZWIC 1N4CA 3BA8A 3PW0A 2XAFA 1KBLA 3C0FB 3OTFA 1E4GT 3ABMC 4DL3A 1KUTA 5LA6A 2HVQA 4A3IG 1XDCA 1M4UA 1YXBA 3K3PA 3T1YB 1I7LA 4JI6H 1BHBA 3PO3G 3X2QB 4E4EA 1DAAA 4QIWA 1KC8W 5JVDF 3OUZA 4H37A 5HNEA 4ECSA 3A0HZ 4LF8H 4FLWA 2PN1A 2WAQE 5CBHA 3HOYG 4J9LA 1AI7A 1KP2A 4IAJA 3C90A 3VMMA 3H1JH 4DV0H 1YDXA 3GIPA 1K34A 5DEDA 4PD4F 1JOYA 3GIMA 4YAJB 4J41A 2D2CB 3DC6A 3UT5B 5FPOA 4YJ2F 4DV5H 4WBNF 1SQXH 5B3SC 4B3SB 2EILC 3OSPA 1R1BA 2P6JA 4O4JA 2R72A 1AUVA 1WSCA 3ZHQA 1NTZH 5KHGA 4LH6A 5IJ0A 1GGOA 1WH2A 2HHFB 4A3MG 2UVUA 1E1RG 4YIPA 5LOVA 1L1FA 4IHJA 4JI5H 3ETQA 4MV7A 2OCHA 5JVLA 1I50A 3UCSC 3FKSG 3U55A 4YBZB 3RFCA 1KU9A 3CHXA 1Y1WA 3H0GG 4RB3C 5TISZ 3BJYA 1ZL8B 1ULZA 2GHYA 4LSXA 4DUYB 2GDSA 3APOA 3ASNB 4DW0A 2OCCB 2MK3A 1JFFB 3RN4A 3CCVV 3LWBA 5A2QW 4LF7B 1N33B 1US6A 4O7TA 4IIJA 5IYCO 3M9MB 4I7ZB 5HV6A 4AHCA 2R7NA 4O4HA 2YRXA 4GYCB 2GPSA 2FL4A 3R65A 4TWKA 5C1OA 4Q8FA 2W6MA 2EZOA 2F4VH 1XILA 2CGOA 2R87A 1Z2GA 1Q82W 3E8GA 2Q5ZA 1J95A 2VR1A 1O75A 4YJ2B 5EK0A 1NJIW 4DR2B 5LP6F 2F95B 1TWFA 3AK3A 4GT1A 1IBMH 4JV1A 2EIMC 5HBRB 1KP3A 4BW9A 1I1KA 4FLUA 1P84F 3WNZA 5B1BB 3BG5A 1T3NA 4B3RB 1WRVA 4R7RA 1MSWD 2RGRA 2DJVA 2FP4B 1AP6A 4O7VA 4RNNA 1I2KA 4UVAA 4XDJA 1YEWA 1DV1A 5HFLA 2YXYA 5JVDB 4Y8VB 2YEVB 1JR9A 5FNVA 1XBLA 2YRWA 2PI5A 2PMZA 2Q73A 5J2TA 1ET0A 4RWUA 2DYSB 1SEIA 3W5OA 3JZ6A 4XYMB 4DIMA 3MDSA 1GSHA 2W71A 2FK2A 5I5XA 1AUXA 3V4ZA 1JQ0A 3CSXA 3HKBB 1AROP 3T1YH 4GKKO 4HN2A 5JJJB 5E25A 4DUZH 3K57A 4DUYO 1K92A 1N0NA 2LFRA 4HZ3A 5KUMA 5CBFA 2KKWA 4FMTA 1N36O 4M9UA 4PELA 5KFDA 5BPHA 1B04A 3MWDA 1HNXO 2R8KA 4E4TA 4B3MO 1HNWB 5EIBC 4M0JA 1H8EG 2A7WA 3CEIA 4JI0B 5DQIA 2UXDB 2HGWA 4RO2A 3JD2A 3RB0A 4TV9F 2EBOA 4WFHA 4MV1A 1Q81W 3SYQA 3JAMN 4X1KB 5B1NA 4LF6B 4DV6H 4B3SO 3U9SA 3D3QA 2GTAA 4JI1H 3NC0B 4FFBA 2P4VA 5CB4F 1QHTA 4EEQA 4CMDA 2VOBA 1FFXB 1A0GA 1ENVA 2ZNIA 1S0OA 2R7MA 1RJRA 4LF5B 2WB1A 2NU7B 4X66O 4J42A 1E4FT 1PM9A 1X4TA 1K4DC 3T7AA 4X62H 3UT5A 4MV9A 4QPJA 3BEHA 3O65A 3THOA 2HG5C 4F4ZA 3RVYA 4YHHB 1QNMA 2EIMB 3N42B 3JAWA 2CTRA 2W57A 2CKZB 3SYAA 2V5AA 2N04A 2W8LA 3OR7C 3HKEA 4K6NA 5FLXN 1FVIA 3T1HO 3G80A 3JAWB 3RB6A 3LQSA 1F4NA 3G6BA 3JYCA 3ZJZA 2JA7G 2PVPA 1KJ8A 3T99A 2HG8A 4UV9A 5LXTF 4QJFA 1SZTA 2Q2UA 2JA8G 3CMAV 1YCIA 4ED8A 4ZOLB 1H2GA 3MFHA 4JV5B 5BWXA 3C3SA 4QW9A 1K1SA 3AYHB 1XNRO 3MFIA 3TXSA 1RM1C 2E5LH 4F4YA 4X1YA 3OGCC 2Q7DA 1M56C 3X2QC 2WLLA 1A3GA 2E75B 1L0LH 1XDNA 1YSCA 4LF5H 1CKNA 2Q69A 2XAHA 5B66Z 1JIHA 5EDWA 4ECRA 1SS3A 3NBZB 2H3OA 1FFTB 2ITDC 1N32B 2F93B 2HJDA 2IW5A 4MVZA 4FLXA 5CA0A 4DXWA 1YJ9V 3CE2A 4DV4H 1PV0A 2Q9LA 3GIIA 2HGXA 2GTSA 4I50A 2ZXWB 1BGWA 1YI2V 2CUGA 2VPQA 3KHGA 3OTOH 2COJA 4XDLA 1VF5B 4PA7A 5LL6b 4LF4B 2Q7GA 4WD3A 1SFOA 2GSMB 1ZHQA 1GSAA 2DMXA 3G6EV 4YJ3F 1W59A 4DRXA 3ETHA 4PJ0Z 3JATA 3L73H 1XHZA 1S72V 1Z5VA 2K1EA 3G8CA 2RCVA 4X62O 3KAJA 3ORQA 3WWIA 1WJZA 2EX3A 3WWHA 5FR9A 3RB4A 5B1AC 5IYZA 4YXWG 5KFPA 5FNVF 5JVDA 4ICGA 4JZ2A 4J9SA 5D5QA 2VWKA 2WB1E 3CWBH 1E4EB 4A3LG 4LR3A 3SR2C 2DABA 3N41B 4EEYA 3RF2A 5KFNA 3GIKA 4J7ZA 3A0RA 2OTJV 4MV8A 1I7NA 2A0LA 1GKFA 1OCZB 4KFMA 3OE7G 2RF4A 1N0JA 5KFBA 5L3EA 4MA5A 4NXNO 3L2PA 4OGQB 2W9CB 4OPHA 2QWQB 3HKCA 4DR6H 3ZCCA 4RUFA 1W2BU 2ABJA 3ZS8C 3ZN1A 1EZ1A 3APQA 3M7MX 2IM9A 4XBFA 3CCJV 3BFRA 1YHQV 5I5UA 2YXLA 4I0XA 5DM6V 2YI9A 1K1QA 2P90A 3K0GA 4E2LA 1P4RA 5BXZA 2VA3A 4TQRA 1L0NH 4O4LB 1HNWH 3K3WA 4HQ6A 1JJ2U 4KL1A 1R6NA 2ZNJA 1AJNA 5KFXA 1OJHA 5CA1B 4GZRB 4WBNB 5IWAO 4Q0YA 5LMUO 5C8YA 1A0IA 3TJTA 1XMOB 1Q6UA 2R7LA 4O3OA 2GQSA 3K08A 3TIIA 2B1IA 2WSSG 4DL6A 5KG2A 4OX9O 1CPYA 3GTLA 5J2UB 5BMVF 1F4MA 1SQPH 3T2MA 4RZRA 1TWAA 1MZEA 4O4JF 1IBMO 4JI6B 3STLC 1C30A 2LFSA 3L72H 4YY3H 5IYZB 2R9RB 5IYBG 2C00A 5KFJA 4W4KA 4CBCA 3QZ7A 2R86A 2VQFO 5B1AB 3OW2U 4I4TF 4TUYA 2UUBB 4L87A 2IP4A 3ORRA 2WLNA 1KB9F 3KHLA 1F7YA 2AGQA 3PVXA 1AB3A 4JYAH 1BCCH 1NH2D 4Q4DA 4FLTA 4FFPA 5IDJA 1HNXH 3RYHA 4EQ5A 2W6OA 4A3DG 2YZLA 2EZPA 5LGTA 1S5LZ 4P9OA 3E5NA 4DV3B 4DV5B 4JI7O 4YJ3B 1SQVH 2AZ2A 4BY1G 3OTOB 2W6ZA 5CA0B 1LR1A 4JYAB 1QR8A 3QNEA 3HKDA 3L70H 2R85A 4J9ZB 4FFMA 3OGIB 1NKDA 5KHJA 2PBZA 1I94H 2GLTA 4W4LA 2R8GA 4B7KA 2LW1A 3L4JA 2KB1A 2ZE6A 1H2LA 1GYFA 5KX5A 4JI5O 3RYFB 3UQ8A 4X1YB 3VNNA 4ECUA 4DLKA 4LF9O 2XAQA 3JALA 4LCUC 2AHYA 4O7WA 4NR1A 1RJPA 4D7TA 3KCYA 5FJ8G 2R9AA 4YY3B 2RJZA 1K8AW 1TUBA 2VS0A 2NU9B 5KLVH 1XEQA 3V6KA 3B8MA 2R84A 2R8IA 4O7RA 4JAUA 4JV5O 4LFBO 3GTQA 1KTAA 5KFLA 2ILMA 1KUQA 2AZ0A 2Y0PA 5KFHA 3T5LA 4LFCO 2UUAH 3VQYA 3WG7B 1D5AA 5C1PA 3BQ1A 2HDKA 4O7LA 3MR2A 3I55V 4K0KB 4JV0A 5BR8O 3SJCC 2FLNA 4I5SA 5CA1F 3ZN0A 3T1HB 4IT5A 4O3QA 3W7WA 2JIZG 5CR5A 5KAFZ 4GC7A 3W7TA 2XASA 1THZA 3ZMZA 2CNQA 2UXCH 2IMWP 2XIGA 1M56B 4AQYO 1IZ3A 3RFRA 4B3TB 5JH7F 3U54A 1HNZB 3CC4V 1R6KA 2UXCB 3FB6C 4O2AA 4B3SH 2JVDA 4J11A 4JI2B 1RK6A 1KKCA 2WLMA 1SQFA 2L35A 2K9PA 3B09A 1WN7A 1JDBB 4O2AB 4Z1VA 3PN1A 5CB4B 4X64B 5KX5F 2C2RA 5K3WA 4R8CA 4LF6O 5DG8A 4TOIA 4EB6A 1MZBA 4ME6A 4LF8B 3BY6A 3MR5A 5DGIA 5C5JA 1W0JG 1MSDA 3VOUA 3PW4A 2QTSA 3BHPA 1M0WA 4A5UB 1TVKA 2Q2TA 2ASJA 1HNWO 1VIBA 5EWEA 3G6YA 4QGPA 4ZHQA 2BQRA 5C8YB 3QZ8A 2R92G 3CRRA 2QWPB 3JRXA 1K5SA 2OTLV 2DQ3A 2R8JA 3ETEA 3RGBA 1PNMA 1BMFG 2Q0OC 4Q20A 3ZMUA 4I50B 2JS5A 5KHKA 2XOKG 3AG3C 4YJ3A 1PNKA 3CJHA 4TUYF 1PL0A 3GTPA 2ARHA 2EULA 2J6SA 1TGOA 2PF4E 4UCUA 2PYLA 1VARA 2ATLA 3RGXA 1BSMA 3BCCH 3H9VA 2EIKC 3OHBA 4JI1B 2QJ1A 3NGDA 4RAIA 2FMAA 3OUSA 3P3PA 2B63A 1FXHA 1GO3F 1WP8A 2CH7A 5BMVA 3HBLA 2VUGA 1RPRA 4X64H 4EB6B 3KKYA 3T5HA 1GTOA 3TW7A 1AR1B 5FL7G 2LP7A 1PNLA 1N34O 1ZETA 4A3JG 5GONB 5GW7A 4QWAA 4XYLB 2NU8B 3LNMB 2CH7B 1XMQO 4X65H 2WLIB 3HKDB 1IBLO 4Q44A 2UVVA 3LSQA 2JEGA 1B3QA 4RNMA 4JUZA 4DR1O 4BR6A 4DR4O 1YZBA 2V7QG 2Z5UA 3K0DA 4X65B 2F4VO 4L8JA 4ABMA 3ETDA 5KMGB 4PDLA 3J80W 5C3EG 2JA5G 4EYIB 1BXRA 4O4LA 3FDSA 1Z2NX 3GB7C 4G2KA 4Z1MG 2Q68A 4MT8A 2ZKOA 4EFBA 4QPKA 3T9EA 2DW4A 2BSKB 4CMFA 2FJZA 1FXKA 4FFOA 3WB1A 1XK5A 1IBLH 4PDMA 4DV4O 4ECWA 2WAQA 3K03A 3T4DA 3RYCA 1B33N 4ED2A 5LMNB 2XGQA 1VQ9V 2HHHO 3KAKA 1V55C 3U0GA 3Q4HB 2WDTA 4O7SA 5KG7A 4J9PA 5JCOC 1FD9A 4K8XA 2ZDGA 3CC7V 3U10A 2ZM6O 2QSAA 5KA6A 3IC7A 5EC2C 4QWDA 3CRAA 3F7YC 2OIGA 2HVKC 5KG0A 1CKMA 4PWQA 5CAEB 2PY5A 1D2DA 2BTOA 3ZRWA 3UZOA 3HO8A 4HNAB 4LC1A 2FYUH 1EKFA 5L3FA 3T5JA 2P4KA 3RT3C 1HWYA 3GIDA 3CRMA 4TV9A 3HOUG 1I1MA 2KSWA 3N2GA 1M57C 2QK4A 3RIZA 4ZI7F 3QO8A 2VA2A 1LUVA 3CCRV 4NTXA 3QTCA 4DR7O 3A8TA 2QKAA 3H20A 3EPIA 3D36A 4LWSB 4I50F 4MVQA 2DWDC 1TVKB 4UB8Z 2EJRA 2WLHA 4DR3O 3K5HA 2OT5A 2B5UA 4IR1A 3H01A 3EXAA 2FKXA 2JS3A 4IRCA 2HGSA 3SYOA 1BNCA 5KT2A 2DWEC 4JI3O 1EUDB 2QM4A 5H6RA 4FZ0A 3ASOB 5D8DA 4E6NA 4DR4H 4Q4CA 1NS1A 2OYQA 5KFRA 3EYYA 4MV3A 3A2FA 1UNNC 5FLXW 1HW7A 2UXBB 4GX2A 1Z2PX 4X1IB 2PI4A 3V6HA 2ZT9B 5E1AC 2NVYA 3JALB 5GONF 2HHFA 1GLVA 3T5KA 1K5QA 3DTUB 4O7ZA 1W0KG 5IWAB 3CD6V 3GQCA 2XCAA 1JX9A 4G3IA 4XDKA 4TSFG 4FLZA 2ATKC 2R93G 1F51A 4N21A 4ZOLA 4FM2A 1R3KC 1OCCB 1P49A 1YF2A 3PW5A 2UU9O 2YIAA 2UUBH 3E22B 4BBSG 4IWXA 4H33A 5DGHA 4ED0A 2JA6G 1EZJA 4R50A 3T1CA 1RPOA 1WA8A 2GPWA 4PA9A 4LFCH 1R73A 2QWOB 2LJ2A 2YSUB 2GQRA 3M9NB 4O7NA 3LDEA 3RAXA 3GTMA 4JYBA 1XREA 3PW2A 4BY7G 1A48A 3LMLA 1M93A 2KG7A 2LO1A 4OXSA 4LF9H 1NI8A 4MS2A 4DV2H 5IJ9B 1VP7A 1QVGU 2UXBH 3F7VC 4NZNA 5KX5B 4NVPA 5IY5B 3JD4A 4DR5O 4QWCA 4J80A 2OCCC 4WFEA 4MVSA 4B3RH 3BVOA 3WO0A 1I5XA 2G38A 2VQDA 5K1XA 3I5DA 1NVPB 3K58A 4WF9V 3N27A 5IJ9A 2LQTA 3MWMA 2UUCB 1VQ6V 4X1KA 1QLNA 2VRZA 5IYBO 2D3OW 1G1XB 3AG3B 3R66A 2JJ1G
chains in the Genus database with same CATH topology
4I50A 4O4IA 4RB0A 3SJBC 1JJOA 1BGWA 3OTOH 2UU9H 3E22A 5LL6b 3K5MA 4DV4B 4LF4B 2Q7GA 4MTDA 4LFAH 4PHZA 2HVRA 1HR0H 1ZHQA 4DRXA 1JFFA 2F1MA 3JATA 1XHZA 1Z5VA 4UCOA 4RB2C 2UU9B 2Q7HA 3JASA 3KAJA 4NXMB 4FLYA 4DR4H 2V4DA 5FPRA 3W1GA 1I7FA 2EX3A 5KMGA 4A2AA 3HKBA 5IYZA 1Q3EA 3RTXA 5JVDA 4ZHQB 3F8NA 1TUBB 4X1IA 1WNSA 2MCTA 5LMNH 4LF9B 5D5QA 2VWKA 3JARB 4GKJB 4PI0A 5LOVB 4LR3A 3SR2C 3N41B 1HNZH 5D1OA 3RF2A 4DR1B 3FFQA 4LNUA 5LA6B 2ZIOA 4M7EA 3FMAA 1L8DA 4CS2A 4JI3H 3RR5A 4UFZA 4FM9A 4JI4B 4FFBB 4Q6GA 4JI8H 1N34B 2UUCH 3L2PA 1SYXB 5J2UA 5LMUH 3HKCA 4DR6H 3TY9A 1XNRH 3TY8A 1Q8IA 4PDBA 3ZS8C 4UCVA 4TV8B 4DUZB 1FJGB 3L4KA 3M7MX 2IM9A 5D5PA 4GKKH 3RWRD 3QF7A 4UCSA 4YHHH 2YXLA 2YI9A 3K59A 4DRXB 4JI7H 4LH7A 4B3TH 4BWSC 2E3CA 4O4LB 1HNWH 1SA0A 4X20A 1ZAUA 1N36B 4KL1A 1Z5WA 2ZNJA 4NXNH 5CA1B 4WBNB 4LFCB 3M4IA 1FFXA 4Q0YA 4JI2H 5C8YA 1A0IA 1S03G 2YIBD 3HXLA 1XMOB 3J7AK 4X66H 3S24A 4DV6B 2ZM6H 4I55A 1TA8A 2Q0AA 3QG5A 3SJAC 1XQ8A 5J2UB 5D1OB 4ZIBA 5FNVB 2RGVA 2OWOA 3B2EE 4X66B 4JI8B 4F6RB 4JI6B 3K5NA 3MAQA 4DV2B 4IHJB 4WBNA 5IYZB 4X62B 1ZHSA 3RJ0A 4YY3H 3VQXA 2YI8A 4YJ2A 1P16A 1X9NA 3IAYA 3SGIA 5KHIA 4DV1B 4O4JB 1XHXA 5FD6A 5JJEB 4AQYH 4TUYA 2UUBB 3BPZA 2PGGA 4GKKB 1BJTA 2UUAB 3RYIB 4FM0A 4PZ6A 3N40P 4B3MH 4JYAH 1N33H 4A2BA 4FLTA 1HNXH 3RYHA 4X20B 4AQYB 4EQ5A 3N43B 4DV3B 4DV5B 1QQCA 4YJ3B 1V9PA 4DK1A 3OTOB 5CA0B 1P8LA 4JYAB 4NXNB 3HKDA 3RYHB 4GLXA 2F4VB 1AN7A 3HKCB 4AILC 1S68A 4RB1A 4PZ7A 5KHJA 1J5EB 2VWJA 4IIJB 1Q5OA 4DR5B 1I94H 3L4JA 1IBLB 1GYFA 1Q43A 4FM1A 5KX5A 3RYFB 3UQ8A 4X1YB 3VNNA 3U11A 4O2BB 1I94B 4HNAA 3JALA 5JCOA 3BABA 3CVZA 4D7TA 4GKJH 1VF7A 3WB2A 2XHBA 2R9AA 4YY3B 2RJZA 1TUBA 1Z2OX 2ZINA 5JH7A 2CFMA 5EZYB 2CW7A 1XI1A 4LNUB 4JI3B 2YCHA 3N44B 4I4TB 2FE3A 3IG0A 4K0KH 3BRCA 3VQVA 5EIBD 2UUAH 3VQYA 1D5AA 3WB0A 2CW8A 3N2KB 4PI2A 3KALA 1KMIZ 4LFAB 5CA1A 4O4HB 2BTQB 4K0KB 4LF4H 3SJCC 4CC5A 3TY5A 4J0MA 4CH3A 3T1HB 3JSLA 1JMKC 4TV9B 3DSQA 5DISC 4RZQA 5D1PA 3JSNA 1J5EH 2ZJTA 4UCRA 2RQ6A 4FVMA 5LXTB 4KHPB 2UXCH 4K8ZA 2PTMA 2XIGA 3ZEDA 5ITZB 4BWAA 3N2KA 3RFRA 4B3TB 1XNQH 2VQFH 4HBNA 4F6RA 4RAYA 1HNZB 4DR1H 2UXCB 2UXDH 1M5IA 4O2AA 2VQEH 4B3SH 2JVDA 1CKOA 4JI2B 2P22C 1SQFA 5EYPA 1WN7A 2WYOA 1DGSA 4O2AB 4JI4H 2Q7EA 4U3JB 3JAKB 3PN1A 5CB4B 4X64B 1CKNB 1N34H 3BA8A 1VS0A 4TOIA 4OX9H 2GV9A 5LYJA 3C0FB 3OTFA 4EB6A 1E4GT 1MZBA 3J81W 4LF8B 4RAZA 5LA6A 2HVQA 1M4UA 1SA0B 4I55B 3T1YB 3RYFA 4JI6H 3BHPA 1M0WA 1TVKA 2Q2TA 4DV0B 5IWAH 4MTEA 4DUYH 4ZHQA 4LF8H 4FLWA 5C8YB 2WE6A 1H2SB 5BR8H 4IAJA 4DV1H 4CH6A 1T5EA 4DV0H 3RGBA 4I50B 2JS5A 4O4IB 3ICXA 5KHKA 4YJ3A 4KHPH 2PYJA 4I4TA 3JAMW 3UT5B 1TGOA 4UCUA 3N6XA 5FPOA 1XNQB 2PYLA 4DV3H 2VQFB 3RGXA 4DV5H 1O9HA 4DV7H 1XMOH 2ZM6B 3KYHC 4B3SB 3JAKA 2QJ1A 4O4JA 2R72A 4JI1B 5JQGB 5KHGA 4LH6A 2JGUA 5IJ0A 1WH2A 5BMVA 2VUGA 4O2BA 4I7HA 4X64H 4EB6B 5LOVA 2HHHH 4JI5H 4IHJA 3ETQA 5JQGA 4MV7A 5K1PA 3JARA 2ZIMA 1WPBA 1KU9A 3CHXA 4RB3C 5GONB 1SQGA 3DF7A 4X65H 3W1BA 3HKDB 4LSXA 4DUYB 3JATB 1JFFB 5A2QW 4X65B 4LF7B 1N33B 4IIJA 2ZCEA 4L8JA 4CH4A 5KMGB 2HIVA 4AHCA 3J80W 4O4HA 4GYCB 4O4LA 1Z2NX 3GJXB 4EFBA 4DR2H 4FLVA 2F4VH 2CAZC 4DK0A 3BAAA 2PZSA 1S5JA 1O75A 4YJ2B 4APMA 3WB1A 1XK5A 1IBLH 1SKVA 4DR2B 2F95B 1IBMH 4TUYB 4BW9A 3RYCA 4LFBH 4FLUA 5LMNB 2HHHB 3KAKA 4B3RB 2WDTA 4LSAA 4R7RA 5JCOC 3K5LA 4K8XA 5LP6C 5IJ0B 3U10A 2RGRA 3U0ZA 4LFBB 5IT9W 1XMQB 1YEWA 3CB2A 1N32H 4CH5A 2VQEB 5JVDB 2P5OA 1CKMA 2PY5A 2BTOA 5FNVA 4CS3A 1IBKH 4HNAB 1G6UA 5J2TA 1SEIA 3W5OA 4TV9A 4LF7H 4DR6B 4OX9B 2KSWA 1XNRB 3N2GA 3VQWA 2HVSA 4DR3B 3BA9A 3RIZA 3CSXA 3HKBB 5ITZA 3K5OA 3HKEB 4B08A 3T1YH 5JJJB 1M0TA 4DUZH 1FJGH 3QTCA 3K57A 3T1HH 4NXMH 3H20A 4CS4A 4TV8A 3KXYT 4ETSA 4DRFA 3N2GB 2KKWA 2PUSA 5BR8B 1TVKB 3QWUA 4JI0H 2YIBA 1B04A 2BTQA 4ZI7A 5EZYA 1IBMB 1HNWB 5EIBC 4LF6H 1NT2B 4JI0B 2HGSA 2HEPA 2UXDB 2QM4A 3RGZA 4X1KB 4E6NA 4PZ8A 4LMYA 4DV7B 2OYQA 4LF6B 4DV6H 3EYYA 1XMQH 3A2FA 5LYJB 5JH7B 4JI1H 3NC0B 5FLXW 4FFBA 1HW7A 2UXBB 1IBKB 1Z2PX 1QHTA 4X1IB 4EEQA 1I6UA 2VOBA 1FFXB 1L2ZA 2ZNIA 4JI5B 3JALB 4ZI7B 4LF5B 4I9QA 4UCTA 1E4FT 1X4TA 2R70A 5LXTA 4X62H 3UT5A 5IWAB 4MV9A 3THOA 5KHHA 3RYCB 4DR3H 4DR7B 4YHHB 4FLZA 2O03A 3N42B 4ZOLA 4FM2A 3JAWA 5LP6A 1P49A 3LNNA 2W57A 2UUBH 2YIAA 4JI7B 3E22B 3HKEA 3RYIA 1FVIA 1N36H 1FKAH 4DR7H 3JAWB 5LP6B 1HNXB 4LFCH 1HR0B 1TAEA 5J2TB 4D7SA 4JV5H 3GDEA 4DR4B 2Q2UA 5GONA 4ZOLB 5FD5A 2HIXA 1RSOA 3LMLA 4DR5H 4JV5B 5CB4A 1M93A 5JJNB 3GB8B 2F66C 3NBYB 3K3VA 4LF9H 4DV2H 5IJ9B 2E5LH 2UXBH 4X1YA 2VPSA 5KX5B 4NVPA 4CC6A 1XDNA 4B3RH 4LF5H 4U3JA 1CKNA 2E5LB 1O9GA 5K1XA 3K58A 5EYPB 5BMVB 5IJ9A 3NBZB 3MWMA 2UUCB 1N32B 5EOYA 2F93B 3JASB 4X1KA 4TQFA 4EFEA 4B3MB 4TQDA 5LMUB 5CA0A 4FLXA 4DV4H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB B;  2HVS A;  4GKK B;  4DR3 B;  3BA9 A;  2UUA B;  4PZ6 A;  4DV4 B;  4AQY B;  4LF4 B;  4EQ5 A;  2HVR A;  4DV3 B;  4DV5 B;  4DRF A;  1V9P A;  5BR8 B;  3OTO B;  1P8L A;  3QWU A;  4UCO A;  4JYA B;  2UU9 B;  4NXN B;  4NXM B;  2F4V B;  4GLX A;  1B04 A;  4UCU A;  5FPR A;  3W1G A;  5FPO A;  1XNQ B;  1S68 A;  2VQF B;  1IBM B;  1HNW B;  4PZ7 A;  1J5E B;  4DR5 B;  3RTX A;  4JI0 B;  2UXD B;  1IBL B;  2ZM6 B;  3KYH C;  4B3S B;  4LF9 B;  4JI1 B;  4GKJ B;  3UQ8 A;  3VNN A;  4PZ8 A;  4E6N A;  4LH6 A;  4DV7 B;  5D1O A;  4DR1 B;  1I94 B;  4LF6 B;  2VUG A;  3BAB A;  3NC0 B;  3RR5 A;  2UXB B;  4UFZ A;  1IBK B;  4YY3 B;  4JI4 B;  4EEQ A;  1N34 B;  2CFM A;  3L2P A;  4JI5 B;  4LF5 B;  3W1B A;  4UCT A;  4JI3 B;  3TY9 A;  5IWA B;  3TY8 A;  4DUY B;  4DR7 B;  4YHH B;  4X65 B;  4UCV A;  4LF7 B;  4DUZ B;  1FJG B;  1N33 B;  4LFA B;  4JI7 B;  2HIV A;  4K0K B;  4UCS A;  4CC5 A;  3TY5 A;  1FVI A;  3GJX B;  1HNX B;  4EFB A;  3JSL A;  3T1H B;  1HR0 B;  4LH7 A;  5DIS C;  3BAA A;  5D1P A;  1TAE A;  3JSN A;  4UCR A;  1ZAU A;  1N36 B;  4KHP B;  3GDE A;  1XK5 A;  4DR4 B;  4DR2 B;  2Q2U A;  4LFC B;  4B3T B;  1A0I A;  2HIX A;  1XMO B;  1HNZ B;  4JV5 B;  3GB8 B;  2UXC B;  3NBY B;  3S24 A;  4DV6 B;  5LMN B;  2HHH B;  1TA8 A;  4B3R B;  1CKO A;  4JI2 B;  5D1O B;  1DGS A;  2OWO A;  4X66 B;  4JI8 B;  3PN1 A;  4CC6 A;  4X64 B;  1XMQ B;  4LFB B;  1CKN B;  2VQE B;  3BA8 A;  4JI6 B;  1VS0 A;  1XDN A;  1CKN A;  4DV2 B;  4TOI A;  1CKM A;  2E5L B;  4X62 B;  4LF8 B;  2HVQ A;  3NBZ B;  1P16 A;  2UUC B;  1N32 B;  1X9N A;  3T1Y B;  3W5O A;  3SGI A;  4EFE A;  4DV1 B;  5LMU B;  4B3M B;  2Q2T A;  4DR6 B;  4OX9 B;  4DV0 B;  1XNR B; 
#chains in the Genus database with same CATH topology
 2AXT Z;  2A1H A;  1JJO A;  1GSO A;  4J9K A;  3H4D A;  2BQU A;  2JDI G;  3AK1 A;  3HB3 B;  1MAB G;  3OT7 A;  4PHZ A;  2HVR A;  2CK3 G;  1HR0 H;  1DF5 A;  5AG2 A;  3ABK B;  1JFF A;  2F1M A;  3CXH F;  1BL8 A;  1S5H C;  4UCO A;  2SCU B;  2Q7H A;  2ZXW C;  4J7K A;  4NXM B;  5B1B C;  4FLY A;  5KS8 A;  1JX4 A;  5FPR A;  3V6J A;  1I7F A;  5H9C A;  4F6E A;  1T36 A;  4ZHQ B;  1CEZ A;  3V4S A;  3F8N A;  2MCT A;  2IA6 A;  1WNS A;  3CCS V;  2UUA O;  4GKJ B;  3K06 A;  3WU2 Z;  1XL4 A;  2WTF A;  4ED7 A;  2ITC C;  2V1D A;  5LOV B;  1HNZ H;  4JXU A;  5LA6 F;  3FFQ A;  1DV2 A;  4O3R A;  2ZIO A;  5IY5 C;  3JZF A;  3UO2 A;  3AG1 B;  2DYS C;  1L8D A;  1VAJ A;  1UJW B;  3RR5 A;  2RNB A;  4FM9 A;  2YID A;  3GIQ A;  4JI4 B;  3DTG A;  1COW G;  4Q6G A;  4GKJ O;  2UUC H;  1RM1 B;  1SYX B;  5H6Q A;  5LMU H;  3ZRV A;  4A3F G;  2ZDI C;  3E86 A;  4O2A F;  5KFC A;  3FKI A;  3HR0 A;  4FPP A;  3SPC A;  3SPI A;  4U7N A;  5DQG A;  2FLP A;  3ETJ A;  3L4K A;  3G4S V;  1IXM A;  3HOX G;  3PO2 G;  4GKK H;  3QF7 A;  1QCE A;  1S0M A;  3G6V A;  4A3C G;  2ZD9 A;  2E3C A;  2ZE7 A;  1VBH A;  4MVO A;  2Y4T A;  1AP5 A;  1CS0 A;  4QE7 A;  2EJ0 A;  4XZ3 B;  1FFX A;  4JI8 O;  4JI2 H;  1Y14 B;  2EIL B;  2DQ0 A;  3WWJ A;  4MA0 A;  5BYB A;  4FK5 C;  4DO2 A;  3J7A K;  4X66 H;  1R9T A;  3FAV A;  3CP1 A;  3VBB A;  1BT8 A;  4PDV A;  3ABL B;  1XQ8 A;  5D1O B;  2JEX A;  1NBM G;  1PP9 H;  4NTW A;  2LW7 A;  3ZRW B;  1E4E A;  3FAV B;  3PFF A;  2RGV A;  5C93 A;  1Y67 A;  2QWR B;  4QWB A;  1Y76 A;  3K5N A;  3MAQ A;  4BXX G;  1KD1 W;  4U6P A;  4JPR A;  2Y69 B;  2FTK A;  4YJ2 A;  3OMN B;  1P16 A;  1X9N A;  3SGI A;  2P06 A;  4DV1 B;  4O4J B;  1G4Y B;  4AQY H;  1ZTE A;  3R5X A;  2DAA A;  3BPZ A;  4GX1 A;  4ASU G;  2YW2 A;  5LHI A;  2UUA B;  3RYI B;  4UVB A;  3B8N A;  3I56 V;  3N40 P;  5KFK A;  5EC1 C;  4A2B A;  4NB5 A;  3LDD A;  2Z3Y A;  4QNH B;  1ZUQ A;  2XCP A;  2DYR B;  3UM7 A;  2XTA A;  3AG1 C;  4MW3 A;  4ZHQ F;  1PD3 A;  1V9P A;  4DK1 A;  1FAF A;  2BR0 A;  1MOF A;  3Q1K A;  1QLE B;  2ADP A;  3RYH B;  4GLX A;  4AIL C;  2WWW A;  4L1K A;  2AGA A;  2QM8 A;  2P0A A;  2Y0I A;  4DR5 B;  4TT3 G;  1M6V A;  5DMX A;  2QEX V;  2DWC A;  1KKD A;  2IJH A;  3EHB B;  3ABL C;  3U11 A;  2E5L O;  2X6A A;  1I94 B;  1AJQ A;  2IJI A;  1CP9 A;  3H0G A;  2M05 A;  3BAB A;  3CVZ A;  1FPO A;  5H2F Z;  4DL5 A;  2C28 A;  2NN4 A;  3WB2 A;  2XHB A;  5EWF A;  2EJ3 A;  2Y69 C;  1GN2 A;  5EZY B;  1XI1 A;  4F4X A;  2ODT X;  3E8F A;  3IC9 A;  3E8H A;  1WLE A;  2FE3 A;  5KT6 A;  3VQV A;  1RSO B;  4MTX A;  5I5T A;  4BIZ A;  3AW8 A;  3LUT B;  5JWP A;  4HAM A;  3RV3 A;  5CA1 A;  3VA7 A;  3LSS A;  3OMI B;  5I5W A;  5KG4 A;  1WB7 A;  1SRY A;  2DYR C;  3TY5 A;  3HPL C;  2DLN A;  1EN6 A;  1VQ8 V;  1JKJ B;  3JSL A;  3KG2 A;  2B1G A;  2I87 A;  3JZI A;  1RJQ A;  4R8U A;  4LWS A;  3DAA A;  5DIS C;  3MHH C;  3JSN A;  5A9G A;  4FIP C;  4KHP B;  4FVM A;  1BHA A;  4EBE A;  4PBC A;  1J5E H;  2JA7 A;  2Y4R A;  4K8Z A;  2PTM A;  2Q4P A;  5IP9 G;  2QKS A;  5KFV A;  1XNQ H;  4EG0 A;  4K35 A;  4HBN A;  3DXR B;  4F6R A;  4O83 A;  4CE5 A;  4RAY A;  2C2D A;  3TXQ A;  2HVJ C;  4DR1 H;  4K3A A;  1QVF U;  1M5I A;  5I5V A;  4YY3 O;  4IYH A;  1T94 A;  2QM7 A;  1E79 G;  1RK5 A;  1QU7 A;  1SES A;  1JXL A;  2IBK A;  3J7A U;  2YL2 A;  4JI4 H;  2Q7E A;  1CKN B;  1N34 H;  1SCU B;  4HNU A;  5BWW A;  4U7O A;  4O7Y A;  1VS0 A;  1N56 A;  5GTI Z;  3E35 A;  5LYJ A;  5A2Q N;  1GM8 A;  4X89 A;  3J81 W;  4RAZ A;  4RUC A;  2YWV A;  3CCQ V;  4FBU A;  1P7G A;  4I55 B;  2YS6 A;  3RYF A;  1KJ9 A;  4GC6 A;  4MTF A;  2CNV A;  5IWA H;  4MTE A;  4HNT A;  4DUY H;  3HT5 A;  2WE6 A;  2W9A A;  1H2S B;  1GO3 E;  1IOV A;  4DV5 O;  5BR8 H;  4GCZ A;  4MVR A;  2FPI B;  4B7E A;  5E79 Z;  4CKE A;  4TM5 A;  3UZB A;  3ICX A;  2ZE8 A;  3RV4 A;  2Q6A A;  1VBG A;  4KHP H;  3D3I A;  2PYJ A;  4I4T A;  4JF3 A;  1V51 A;  1SQB H;  4ECY A;  1XNQ B;  4DV3 H;  2VQF B;  1LNQ A;  5BWT A;  3DTF A;  4DR6 O;  3ZHV A;  1WPX A;  1Y76 B;  1GMG A;  1U96 A;  2ZM6 B;  3KYH C;  3C3T A;  3JAK A;  3T4Z A;  5DG7 A;  5JQG B;  2Q67 A;  1VQ4 V;  3WO1 A;  4JI6 O;  2JGU A;  4YB8 B;  1K73 W;  5LGN A;  2N05 A;  2R92 A;  4I7H A;  4O2B A;  2HHH H;  4QIW E;  4AI8 A;  2OH2 A;  5JQG A;  2UXN A;  4I55 F;  4FE2 A;  5DLG A;  1Y74 A;  5BWR A;  3JAR A;  2HKO A;  2EIK B;  4PV1 B;  3J80 N;  3BQ0 A;  1TWG A;  2YZN A;  1S10 A;  4MSW C;  1WPB A;  4JI1 O;  4EYH B;  2IH3 C;  3GWK C;  2UXD O;  4C5C A;  1NR1 A;  4G27 B;  1WCM G;  3S3X A;  2H8P C;  3JAT B;  4IL6 Z;  3M99 B;  4X9Q A;  4FFR A;  1JCH A;  2ZCE A;  5J9P C;  2QB5 A;  2CTW A;  2HIV A;  1HR0 O;  3CS5 A;  2KQX A;  1Q90 D;  4KUM A;  2YU9 A;  1NTK H;  3GJX B;  4DR2 H;  1K9M W;  4YR0 A;  2R82 A;  4UXN A;  3P3N A;  3H40 A;  4DK0 A;  1B6Q A;  3FKI G;  2XGP A;  1AI4 A;  3HOW G;  4Q8E A;  1SKV A;  4ZOL F;  4FU0 A;  5CMU A;  5IP7 G;  4NTY A;  3OFN G;  2QYZ A;  1VMG A;  4ECZ A;  4FS2 A;  2ETN A;  1CQJ B;  1Y4M A;  1VQN V;  4LFB H;  4MVM A;  1I08 A;  2IJK A;  5KFY A;  5L1I A;  3E83 A;  2R7K A;  2Z0A A;  5LP6 C;  5IJ0 B;  1YJN V;  3T9C A;  2QR4 A;  1Y1V G;  3IJ4 A;  1OCZ C;  4GX5 A;  5IT9 W;  1XMQ B;  1N32 H;  4WFG A;  2VQE B;  2EIN C;  1H38 A;  1S76 D;  2YYA A;  1BS3 A;  2P5O A;  1TWC A;  3G6X A;  4F50 A;  1UC9 A;  4CS3 A;  1IBK H;  5H80 A;  1V55 B;  4MTG A;  3W7S A;  4C2M A;  2IU3 A;  1G6U A;  3B77 A;  1HP8 A;  4IYI A;  3JCU Z;  2Y4U A;  4HYK A;  2Z04 A;  4LF7 H;  4OX9 B;  1KJQ A;  1X59 A;  2HVS A;  2FK3 A;  1QLE C;  4CKB A;  1IVS A;  4KHP O;  2BOB C;  5ITZ A;  3NXS A;  3HKE B;  4B08 A;  3RBE A;  3T1H H;  4NXM H;  1S9F A;  4TV8 A;  3KXY T;  4DV1 O;  4FGR A;  2P67 A;  4TV8 F;  1N33 O;  1UC8 A;  4I0X B;  4LF8 O;  3LUL A;  2YIB A;  5CA0 F;  1AJP A;  5B1O A;  1F23 A;  2BTQ A;  2X6B A;  5HFM A;  1DIK A;  4LF6 H;  1JA8 A;  3CXC U;  1NT2 B;  3K5I A;  1K3E A;  4J9M A;  1NVP D;  4NZM A;  2RDC A;  3W7X A;  1V4Y A;  3R9R A;  4FS1 A;  5J2T F;  3ZMT A;  3JRW A;  4LMY A;  1MG1 A;  4DL2 A;  1JPX A;  1SER A;  4J9N A;  1VF6 C;  1XMQ H;  5IYC G;  2VQE O;  1EHI A;  1M9N A;  2NUA B;  5JH7 B;  2FKL A;  5I5Y A;  4DL7 A;  4TQS A;  1XNQ O;  1I6U A;  4DV6 O;  4EGJ A;  3ASO C;  3TQ1 A;  1EUC B;  4BIO A;  3S3W A;  4X64 O;  5KAI Z;  2I8C A;  4UCT A;  3GV8 B;  2R70 A;  5LXT A;  3OM3 B;  3P30 A;  4PDR A;  2ZDQ A;  2NLJ C;  3RYC B;  4O86 A;  5EWG A;  1ZSP A;  4DR7 B;  5LP6 A;  3TQT A;  4JI7 B;  3T9A A;  3I12 A;  3BAC A;  3NUA A;  4B3T O;  1S0N A;  3M8A A;  5LP6 B;  1A9X A;  2CDY A;  4WFF A;  4J10 A;  2QE7 G;  3VOT A;  1HR0 B;  1WR2 A;  1BE3 H;  4O4L F;  1AVM A;  2W6J G;  1TAE A;  5J2T B;  4YHH O;  1EKV A;  3GDE A;  1K97 A;  2W9C A;  2JGD B;  5FD5 A;  2HIX A;  4RUE A;  4Z2W A;  1KQS U;  1H2N A;  4FFN A;  5B3S B;  5CB4 A;  3TEK A;  5JJN B;  4DR5 H;  3NBY B;  3K3V A;  1MNG A;  1DLB A;  4EKW A;  4N23 A;  5FLM G;  2BE3 A;  1S0V A;  5KFZ A;  3JD3 A;  1PX2 A;  2JA6 A;  5CE8 A;  3K9S A;  4IGG A;  3T54 A;  1YIT V;  3AG4 B;  3ABT A;  2KSD A;  5BMV B;  4DAA A;  4H13 B;  5EZY F;  2MW2 B;  4J9O A;  4B3M B;  3CSW A;  3AK2 A;  4LF4 H;  1WB8 A;  4YIO A;  1RYS A;  4R8U B;  5LMN O;  4O4I A;  2O57 A;  3J81 N;  4RB0 A;  2LGW A;  3AEI A;  5L3B A;  1VEW A;  2V4Q A;  2UUB O;  2EIJ B;  4H0L B;  3B40 A;  1SQQ H;  3K5M A;  4DV4 B;  3LP8 A;  4MTD A;  2UU9 H;  1EBO A;  4LFA H;  4ECX A;  4DL4 A;  4JAS A;  4JTA B;  1BZK A;  3NR7 A;  3K79 A;  1R3I C;  3JAS A;  5EBL C;  3HB9 A;  2J9G A;  3RUP A;  2V4D A;  4JTD B;  1N8R W;  2EJ7 A;  3HKB A;  2IBZ H;  1EKP A;  1Q3E A;  3FYI B;  3OUU A;  3RTX A;  3OHA A;  2M6Y A;  3Q8S B;  3MHS C;  4QIW F;  5LMN H;  2OIE A;  2WLL B;  4IRK A;  2W7O A;  3PJS K;  4PI0 A;  2QTO A;  4FFK A;  2XAJ A;  2YS7 A;  4DR1 B;  4YR3 A;  5DGB A;  5LA6 B;  5LYJ F;  2AGP A;  2DE0 X;  2AQ4 A;  2YEV A;  4UFZ A;  4LF5 O;  4B3R O;  3SJQ C;  2ASD A;  1Y74 B;  2N74 A;  1N34 B;  5JUM A;  2EJ2 A;  5L3C A;  2QA4 V;  4KP4 A;  5KT7 A;  3TY9 A;  1XNR H;  3FYE B;  3TY8 A;  3KHH A;  4UUG A;  3PR5 B;  4PDB A;  3G71 V;  3CCU V;  4TVI A;  2GUZ A;  1Q6H A;  4UB6 Z;  3SDL A;  1EFR G;  1MMM A;  4UCV A;  4DUZ B;  4QW8 A;  2R6F A;  2J6U A;  4UCS A;  1GK9 A;  4MTO A;  4YAK B;  1NU1 H;  3QO5 A;  1VQM V;  4IIJ F;  3FB5 C;  4DRX B;  3ZHR A;  4B3T H;  1WCM A;  1VKZ A;  4MVU A;  1SA0 A;  4X20 A;  1N36 B;  4O3N A;  1OHH G;  1DF4 A;  1FYJ A;  1MZF A;  2W9B B;  3PR4 A;  3M4I A;  5K2M A;  2YIB D;  5F2V O;  3ZBH A;  2UUC O;  1CE8 A;  3S24 A;  2ZM6 H;  1TA8 A;  5JQG F;  3N8D A;  3QG5 A;  3SJA C;  5BY1 A;  5LOV F;  1ZQ7 A;  4F4W A;  4O2B F;  3E89 A;  1HNZ O;  3T9F A;  1NH2 B;  2C22 A;  5FNV B;  2EIJ C;  2OWO A;  4JI8 B;  5KFA A;  5KFM A;  4IHJ B;  4X62 B;  1ZHS A;  5KFO A;  2WPD G;  3CME V;  3OR6 C;  1P7B A;  1XL6 A;  3IAY A;  1XHX A;  5FD6 A;  1HDJ A;  2WAM A;  1PPJ H;  3UKM A;  1VQP V;  2PGG A;  3UYY A;  2UXC O;  3A0B Z;  4FM0 A;  4PZ6 A;  1K4C C;  2X5R A;  3H1L H;  1N33 H;  4AQY B;  4X20 B;  4IWY A;  2Y48 A;  2NU6 B;  1Q6I A;  3EFF K;  1GN3 A;  1QQC A;  5CN0 A;  4PA3 A;  2DOS A;  1FJG O;  1P8L A;  5LHH A;  2W0F C;  5EBM C;  1S68 A;  4PZ7 A;  4IIJ B;  3CPW U;  2X0S A;  2GBO A;  5DLF A;  3DC5 A;  3K04 A;  4K0K O;  3ZIA G;  1Q43 A;  4FM1 A;  4J9Y B;  4LF7 O;  4NKG B;  4O2B B;  3ABM B;  3DGE A;  5BWV A;  1R6T A;  2UXB O;  2YZG A;  1N32 O;  3AX6 A;  1VF7 A;  3D36 C;  5KT4 A;  5DG9 A;  2JEU A;  1Z2O X;  1AI6 A;  2ZIN A;  3OAA G;  3U9T A;  4J9Q A;  5I47 A;  2DIK A;  2UVR A;  4LNU B;  4JI3 B;  2XD4 A;  1PK8 A;  2YCH A;  2UVW A;  2COI A;  3KHR A;  4I4T B;  4K0K H;  3IG0 A;  3BRC A;  4P9P A;  5EIB D;  1Y1V A;  3TIN A;  4O3P A;  3WB0 A;  2CW8 A;  3N2K B;  3KAL A;  2AHZ A;  1KMI Z;  3H1H H;  3EPG A;  1M1K W;  4O4H B;  2V58 A;  3MR6 A;  2C35 B;  1DTO A;  4ZBM A;  3CCL V;  4J0M A;  4CH3 A;  4JZG A;  5B5E Z;  1NR7 A;  3E2E A;  4TV9 B;  3F5W C;  4RZQ A;  2ZJT A;  2RMK B;  5LXT B;  2HJF C;  1UFI A;  2LGQ A;  4MV4 A;  2W70 A;  1ZL8 A;  3ZED A;  1K7D A;  5DGA A;  2Y0S E;  2HFE C;  1OBG A;  4P30 A;  2DPI A;  4X65 O;  1I3Q A;  5I60 A;  4DYL A;  2CTQ A;  5EYP A;  3FD9 A;  2A9H A;  1DGS A;  3FB8 C;  4U3J B;  2HLD G;  1E1Q G;  4O84 A;  4OX9 H;  2GV9 A;  1I1L A;  4QJF B;  3N6R A;  4JYY A;  4ED1 A;  3R23 A;  4A93 G;  3UFX B;  3OEH G;  1Y1W G;  3CQZ A;  1SA0 B;  3OSN A;  1KEC A;  4DV0 B;  4JYC A;  3KRE A;  5IYZ F;  2JRI A;  1ROP A;  4NXM O;  4KXR A;  1EM1 A;  4DV1 H;  4CH6 A;  4WHX A;  1T5E A;  1H2M A;  5BPF A;  1I5Y A;  3RAQ A;  4O4I B;  4R7C A;  3CC2 V;  5CA3 A;  5I5S A;  2QGN A;  3JAM W;  2ODM A;  4DV0 O;  3N6X A;  5CBG A;  1K83 A;  3SI8 A;  1KT8 A;  1N48 A;  3OMA B;  1H2K A;  1O9H A;  2QF7 A;  4DV7 H;  1XMO H;  1QBZ A;  2VUM G;  1B06 A;  3ZRX A;  2R8H A;  3GV5 B;  3AG2 B;  2ZR3 A;  4O81 A;  1LUW A;  3CCE V;  1Q7Y W;  1B6S A;  4J9R A;  2BQ3 A;  1A32 A;  1OCC C;  3GVM A;  2YDE A;  4AYB A;  1K33 A;  5K1P A;  3JD0 A;  3CRQ A;  1I0H A;  2ZIM A;  1VQ7 V;  4UUJ C;  3Q8R B;  2WLJ A;  3CRC A;  1SQG A;  5DEC A;  3DF7 A;  2W6Q A;  3W1B A;  2F43 G;  3G8D A;  2CZG A;  2HR3 A;  2ADQ B;  4C5A A;  3KCX A;  2XC9 A;  2FPG B;  3MWE A;  3L74 H;  2COG A;  5KFF A;  3GLK A;  2DPJ A;  5KT3 A;  2W8K A;  3AG7 A;  4CH4 A;  5DQH A;  1IYE A;  4ECV A;  1FXK B;  2Y0S A;  2A3Q A;  1J5E O;  3I4N G;  1TWH A;  4FLV A;  1D5N A;  1IDS A;  3JCZ A;  2CAZ C;  3BAA A;  2PZS A;  1S5J A;  4MV6 A;  1YIJ V;  5L3G A;  3MD0 A;  4APM A;  3SPJ A;  3Q2O A;  2BCC H;  5J2U F;  3T1Y O;  1RP3 B;  4C7U A;  4LF4 O;  2E74 B;  3KTM A;  2RDJ A;  4JAV A;  3IGA C;  1KYO F;  4TUY B;  2HP8 A;  1OCO B;  3JD1 A;  1VQK V;  2F23 A;  2HHH B;  3CEB A;  1YVW A;  3ABU A;  4LSA A;  3K5L A;  3ZMV A;  3MR3 A;  4GX0 A;  3U0Z A;  2QDO A;  4PA6 A;  4LFB B;  2W6I G;  2YZM A;  3KZI Z;  3CB2 A;  4CH5 A;  1Q86 W;  3RB3 A;  3FX7 A;  3ABK C;  5DN6 G;  3EVK A;  5KFI A;  1I2L A;  2R9I A;  4DV2 O;  5L1K A;  5KFG A;  1IXB A;  3I4M G;  3SNO A;  1DK1 A;  2A06 H;  1GN4 A;  2XCL A;  3HKZ A;  1MA1 A;  4FBT A;  2IU0 A;  4DR6 B;  1XNR B;  2EIY A;  4XX0 B;  3VQW A;  5KFW A;  2B63 G;  3GTO A;  1PL4 A;  3WG7 C;  4DR3 B;  3BA9 A;  1JLL B;  3K5O A;  1M0T A;  1R3J C;  5EBW C;  1FJG H;  4PA4 A;  1IYD A;  4P2Z A;  2VUM A;  4CS4 A;  4BW5 A;  2E76 B;  3TIG A;  4ETS A;  3N2G B;  4F4L A;  4O4I F;  5F9L A;  1XUQ A;  2PUS A;  5BR8 B;  3QWU A;  4JI0 H;  4JYA O;  1GH6 A;  2NR5 A;  4ZI7 A;  5EZY A;  2XAG A;  1IBM B;  3GV7 B;  2HEP A;  1OCO C;  2JEJ A;  4WCE V;  4JAA A;  2P7T C;  1PKX A;  5KFQ A;  3PZP A;  3RGZ A;  2YXH A;  4PZ8 A;  2JEI A;  1BGY H;  2CE4 A;  4DV7 B;  5LL6 Y;  4FJC C;  1RFY A;  2HJW A;  3TW6 A;  1JVM A;  1VQL V;  4JI4 O;  3Q4H A;  5KFU A;  1V54 B;  4GUN A;  5LYJ B;  3GIL A;  1RYR A;  4D6T H;  1IBK B;  2CTP A;  2YUA A;  4BAY A;  2ZGI A;  1L2Z A;  4JI5 B;  4ZI7 B;  5L9X A;  3VPB A;  4I9Q A;  2W6P A;  3GTJ A;  2NNU A;  4ED6 A;  4CHI A;  3GTG A;  2ZDH A;  2XND G;  3CJH B;  5KHH A;  5DAA A;  2EIN B;  3ETG A;  2BSK A;  4DR3 H;  1SF9 A;  3SPH A;  5JQW A;  1IX9 A;  2FB9 A;  1KEE A;  2UXX A;  2O03 A;  2V4R A;  4JGS A;  3LNN A;  1IUR A;  4LFA O;  1XMO O;  4ZKI A;  3OTO O;  4ZQI A;  3RYI A;  1N36 H;  4DR7 H;  1FKA H;  2CNU A;  1HNX B;  4AYB E;  2AW9 A;  1G8M A;  5F9N A;  1H8H G;  2AU0 A;  4D7S A;  2JA5 A;  3IFX A;  4JV5 H;  5BWU A;  4IZO A;  3SYP A;  2R7Z G;  4DR4 B;  1M7J A;  1R3L C;  5GON A;  3VPD A;  2X7R B;  1KBH A;  3H3V H;  4RNO A;  4MAM A;  1RSO A;  5LBQ A;  3GB8 B;  5LHG A;  2F66 C;  2V9W A;  1FS0 G;  2ZQM A;  3CYO A;  1CXZ B;  5IE9 A;  1IBK O;  3OEE G;  2C2E A;  3GWO A;  3OUF A;  5KUK A;  2JEF A;  3H1K H;  2VPS A;  2M7W A;  2DN9 A;  4CC6 A;  4U7C A;  1UPG A;  1ORQ C;  2WA3 A;  1NTM H;  4U3J A;  1I94 O;  2E5L B;  4HNV A;  4X8A A;  1O9G A;  3M9O B;  2Z02 A;  2CGN A;  3E8B A;  5EYP B;  4ECT A;  5KA5 A;  3ML0 A;  4GLW A;  3L9D A;  3QFF A;  2WA4 A;  5EOY A;  3JAS B;  4TQF A;  4EFE A;  4TQD A;  5LMU B;  1EYZ A;  5KKN B;  4Q45 A;  4A3B G;  3SJB C;  1KJJ A;  4BBR G;  4IRD A;  1EN5 A;  5L1L A;  1FXV A;  3WFV A;  2ZE5 A;  3H1I H;  3CCM V;  4G28 B;  3E22 A;  3FB7 C;  5L1J A;  4DR2 O;  1ZX3 A;  4MW8 A;  5KFT A;  4WFB V;  2XUM A;  3AG2 C;  2BOC C;  3HKZ E;  3LSU A;  4RQF A;  2L6L A;  4FZ1 A;  4RB2 C;  2PMZ E;  2UU9 B;  1KJI A;  4O3S A;  3RW0 A;  1NZ6 A;  2X0L A;  4DQN A;  5KT5 A;  3TK1 A;  1M90 W;  3QQM A;  3W1G A;  5KMG A;  3T9D A;  4A3K G;  4A2A A;  4QSH A;  1GN6 A;  4QWE A;  4HR7 A;  3H4B A;  1EN4 A;  3QO7 A;  2NVX A;  1QR9 A;  1TUB B;  4X1I A;  1M57 B;  4CKC A;  4LF9 B;  3JAR B;  4NYE A;  2RDI A;  4ED3 A;  1ZLZ A;  5D1O A;  4LNU A;  4M7E A;  4QE9 A;  3FMA A;  1Y66 A;  3ZHS A;  3PW7 A;  2ALZ A;  4CS2 A;  4JI3 H;  2CQY A;  2YC0 A;  3RVZ A;  3F5T A;  4FFB B;  4OPA A;  1URF A;  4JI2 O;  4JI8 H;  2JJ2 G;  1FXK C;  5J2U A;  1BQ0 A;  4RU9 A;  2C2A A;  2ZR2 A;  5C4X G;  5KFE A;  3SE7 A;  4DV3 O;  5BZB A;  1Q8I A;  2KG7 B;  3R5H A;  1GM9 A;  2DZD A;  4DV7 O;  3RBD A;  2YS8 A;  5GTH Z;  1WAZ A;  4TV8 B;  1FJG B;  3AG4 C;  3ZRS A;  1JDE A;  4X88 A;  2W0X A;  5D5P A;  4O4H F;  1GRJ A;  3RWR D;  2I80 A;  4LBE C;  3BQ2 A;  4YHH H;  1OZ0 A;  5KG3 A;  5IYD O;  3K59 A;  1XOU A;  4JI7 H;  4LH7 A;  3TGU H;  1AI5 A;  2WLK A;  4BWS C;  2R7Z A;  1FKA O;  4YP3 A;  1VQO V;  1ZAU A;  2WLI A;  4LP8 A;  1Z5W A;  1Y6X A;  1YTF B;  3LDC A;  3RBZ A;  4NXN H;  3D8C A;  4LFC B;  3P32 A;  1S03 G;  3B4S A;  3Q8P B;  3HXL A;  4RCN A;  2RN9 A;  1IOW A;  4DV6 B;  2X6C A;  4I55 A;  1VQ5 V;  5KG6 A;  2Q0A A;  4IHJ F;  4RUA A;  2XT9 A;  1OWT A;  3UO3 A;  4ZIB A;  5H5N A;  2R93 A;  3B2E E;  4WFA V;  3TCU A;  4X66 B;  1S97 A;  1U97 A;  3DXR A;  4F6R B;  1S3J A;  3ZX6 A;  5IYD G;  4RQE A;  4DV2 B;  4Q43 A;  4WBN A;  3OD4 A;  3RJ0 A;  3K9A A;  1OCR B;  2YI8 A;  3VQX A;  4O82 A;  1AR5 A;  3Q8Q B;  5KHI A;  1OBD A;  3MJF A;  5JJE B;  3ZHT A;  4NLG A;  1NQT A;  1YJW V;  1OV9 A;  4GKK B;  2YIC A;  1BQZ A;  2JGD A;  4NYK A;  1BJT A;  4B3M H;  4JI0 O;  4NZO A;  3QVN A;  5IT9 N;  2QKC A;  3N43 B;  3W7U A;  1SZX A;  5T14 A;  5L3D A;  2FPP B;  3O9O A;  2FB5 A;  2IH1 C;  1KC7 A;  4R6Z A;  4DUZ O;  4BIU A;  2J6T A;  2ZDI A;  3L75 H;  1G2W A;  4NXN B;  4UVC A;  2F4V B;  1AN7 A;  4EBD A;  2A79 B;  3HKC B;  1GM7 A;  4RB1 A;  2H94 A;  4YQW A;  5KFS A;  1V54 C;  1J5E B;  1YTF D;  2VWJ A;  2FK1 A;  1Q5O A;  2FML A;  4C5B A;  1IBL B;  2GUZ B;  2E2H A;  4ECQ A;  5KG1 A;  1WP7 A;  2ASL A;  4U3F H;  4JV2 A;  1AR4 A;  4I9W A;  4EBC A;  3G67 A;  4HNA A;  4JTC B;  2W6N A;  4DW1 A;  5JCO A;  2AGO A;  2JK5 C;  4J7J A;  4UV8 A;  4GKJ H;  1AIL A;  5KG5 A;  3T9B A;  1SET A;  5JH7 A;  2CFM A;  3VPC A;  4DRF A;  5LGU A;  3SPG A;  2CW7 A;  3L71 H;  1B6R A;  4H44 B;  3N44 B;  3CX5 F;  1CQI B;  5CM0 A;  5C44 G;  5C8Y F;  3GTK A;  2B9Z A;  3ZHU A;  4PI2 A;  4IR9 A;  4EGQ A;  3HOV G;  4LFA B;  2W9B A;  2BTQ B;  5BYA A;  1VF6 A;  2IJJ A;  4CC5 A;  3STZ C;  1S77 D;  1JMK C;  4A3E G;  2FLL A;  3DSQ A;  1WA8 B;  3SYC A;  1C3O A;  2OLS A;  5D1P A;  1W93 A;  3GIJ A;  4HYO A;  2RQ6 A;  4UCR A;  2V59 A;  3R5F A;  4YR2 A;  5ITZ B;  1OCR C;  3ASN C;  4BWA A;  2QWN B;  4CZZ A;  3N2K A;  1SC5 B;  2VQF H;  1GAX A;  3TET A;  1EZV H;  4A3G G;  2E2I A;  2Q8V A;  4FFL A;  2UXD H;  3ZMS A;  2VQE H;  3HOZ G;  2W7P A;  1TUE B;  1CKO A;  2P22 C;  3IN5 A;  1W96 A;  2WYO A;  3JAK B;  1ZWI C;  1N4C A;  3BA8 A;  3PW0 A;  2XAF A;  1KBL A;  3C0F B;  3OTF A;  1E4G T;  3ABM C;  4DL3 A;  1KUT A;  5LA6 A;  2HVQ A;  4A3I G;  1XDC A;  1M4U A;  1YXB A;  3K3P A;  3T1Y B;  1I7L A;  4JI6 H;  1BHB A;  3PO3 G;  3X2Q B;  4E4E A;  1DAA A;  4QIW A;  1KC8 W;  5JVD F;  3OUZ A;  4H37 A;  5HNE A;  4ECS A;  3A0H Z;  4LF8 H;  4FLW A;  2PN1 A;  2WAQ E;  5CBH A;  3HOY G;  4J9L A;  1AI7 A;  1KP2 A;  4IAJ A;  3C90 A;  3VMM A;  3H1J H;  4DV0 H;  1YDX A;  3GIP A;  1K34 A;  5DED A;  4PD4 F;  1JOY A;  3GIM A;  4YAJ B;  4J41 A;  2D2C B;  3DC6 A;  3UT5 B;  5FPO A;  4YJ2 F;  4DV5 H;  4WBN F;  1SQX H;  5B3S C;  4B3S B;  2EIL C;  3OSP A;  1R1B A;  2P6J A;  4O4J A;  2R72 A;  1AUV A;  1WSC A;  3ZHQ A;  1NTZ H;  5KHG A;  4LH6 A;  5IJ0 A;  1GGO A;  1WH2 A;  2HHF B;  4A3M G;  2UVU A;  1E1R G;  4YIP A;  5LOV A;  1L1F A;  4IHJ A;  4JI5 H;  3ETQ A;  4MV7 A;  2OCH A;  5JVL A;  1I50 A;  3UCS C;  3FKS G;  3U55 A;  4YBZ B;  3RFC A;  1KU9 A;  3CHX A;  1Y1W A;  3H0G G;  4RB3 C;  5TIS Z;  3BJY A;  1ZL8 B;  1ULZ A;  2GHY A;  4LSX A;  4DUY B;  2GDS A;  3APO A;  3ASN B;  4DW0 A;  2OCC B;  2MK3 A;  1JFF B;  3RN4 A;  3CCV V;  3LWB A;  5A2Q W;  4LF7 B;  1N33 B;  1US6 A;  4O7T A;  4IIJ A;  5IYC O;  3M9M B;  4I7Z B;  5HV6 A;  4AHC A;  2R7N A;  4O4H A;  2YRX A;  4GYC B;  2GPS A;  2FL4 A;  3R65 A;  4TWK A;  5C1O A;  4Q8F A;  2W6M A;  2EZO A;  2F4V H;  1XIL A;  2CGO A;  2R87 A;  1Z2G A;  1Q82 W;  3E8G A;  2Q5Z A;  1J95 A;  2VR1 A;  1O75 A;  4YJ2 B;  5EK0 A;  1NJI W;  4DR2 B;  5LP6 F;  2F95 B;  1TWF A;  3AK3 A;  4GT1 A;  1IBM H;  4JV1 A;  2EIM C;  5HBR B;  1KP3 A;  4BW9 A;  1I1K A;  4FLU A;  1P84 F;  3WNZ A;  5B1B B;  3BG5 A;  1T3N A;  4B3R B;  1WRV A;  4R7R A;  1MSW D;  2RGR A;  2DJV A;  2FP4 B;  1AP6 A;  4O7V A;  4RNN A;  1I2K A;  4UVA A;  4XDJ A;  1YEW A;  1DV1 A;  5HFL A;  2YXY A;  5JVD B;  4Y8V B;  2YEV B;  1JR9 A;  5FNV A;  1XBL A;  2YRW A;  2PI5 A;  2PMZ A;  2Q73 A;  5J2T A;  1ET0 A;  4RWU A;  2DYS B;  1SEI A;  3W5O A;  3JZ6 A;  4XYM B;  4DIM A;  3MDS A;  1GSH A;  2W71 A;  2FK2 A;  5I5X A;  1AUX A;  3V4Z A;  1JQ0 A;  3CSX A;  3HKB B;  1ARO P;  3T1Y H;  4GKK O;  4HN2 A;  5JJJ B;  5E25 A;  4DUZ H;  3K57 A;  4DUY O;  1K92 A;  1N0N A;  2LFR A;  4HZ3 A;  5KUM A;  5CBF A;  2KKW A;  4FMT A;  1N36 O;  4M9U A;  4PEL A;  5KFD A;  5BPH A;  1B04 A;  3MWD A;  1HNX O;  2R8K A;  4E4T A;  4B3M O;  1HNW B;  5EIB C;  4M0J A;  1H8E G;  2A7W A;  3CEI A;  4JI0 B;  5DQI A;  2UXD B;  2HGW A;  4RO2 A;  3JD2 A;  3RB0 A;  4TV9 F;  2EBO A;  4WFH A;  4MV1 A;  1Q81 W;  3SYQ A;  3JAM N;  4X1K B;  5B1N A;  4LF6 B;  4DV6 H;  4B3S O;  3U9S A;  3D3Q A;  2GTA A;  4JI1 H;  3NC0 B;  4FFB A;  2P4V A;  5CB4 F;  1QHT A;  4EEQ A;  4CMD A;  2VOB A;  1FFX B;  1A0G A;  1ENV A;  2ZNI A;  1S0O A;  2R7M A;  1RJR A;  4LF5 B;  2WB1 A;  2NU7 B;  4X66 O;  4J42 A;  1E4F T;  1PM9 A;  1X4T A;  1K4D C;  3T7A A;  4X62 H;  3UT5 A;  4MV9 A;  4QPJ A;  3BEH A;  3O65 A;  3THO A;  2HG5 C;  4F4Z A;  3RVY A;  4YHH B;  1QNM A;  2EIM B;  3N42 B;  3JAW A;  2CTR A;  2W57 A;  2CKZ B;  3SYA A;  2V5A A;  2N04 A;  2W8L A;  3OR7 C;  3HKE A;  4K6N A;  5FLX N;  1FVI A;  3T1H O;  3G80 A;  3JAW B;  3RB6 A;  3LQS A;  1F4N A;  3G6B A;  3JYC A;  3ZJZ A;  2JA7 G;  2PVP A;  1KJ8 A;  3T99 A;  2HG8 A;  4UV9 A;  5LXT F;  4QJF A;  1SZT A;  2Q2U A;  2JA8 G;  3CMA V;  1YCI A;  4ED8 A;  4ZOL B;  1H2G A;  3MFH A;  4JV5 B;  5BWX A;  3C3S A;  4QW9 A;  1K1S A;  3AYH B;  1XNR O;  3MFI A;  3TXS A;  1RM1 C;  2E5L H;  4F4Y A;  4X1Y A;  3OGC C;  2Q7D A;  1M56 C;  3X2Q C;  2WLL A;  1A3G A;  2E75 B;  1L0L H;  1XDN A;  1YSC A;  4LF5 H;  1CKN A;  2Q69 A;  2XAH A;  5B66 Z;  1JIH A;  5EDW A;  4ECR A;  1SS3 A;  3NBZ B;  2H3O A;  1FFT B;  2ITD C;  1N32 B;  2F93 B;  2HJD A;  2IW5 A;  4MVZ A;  4FLX A;  5CA0 A;  4DXW A;  1YJ9 V;  3CE2 A;  4DV4 H;  1PV0 A;  2Q9L A;  3GII A;  2HGX A;  2GTS A;  4I50 A;  2ZXW B;  1BGW A;  1YI2 V;  2CUG A;  2VPQ A;  3KHG A;  3OTO H;  2COJ A;  4XDL A;  1VF5 B;  4PA7 A;  5LL6 b;  4LF4 B;  2Q7G A;  4WD3 A;  1SFO A;  2GSM B;  1ZHQ A;  1GSA A;  2DMX A;  3G6E V;  4YJ3 F;  1W59 A;  4DRX A;  3ETH A;  4PJ0 Z;  3JAT A;  3L73 H;  1XHZ A;  1S72 V;  1Z5V A;  2K1E A;  3G8C A;  2RCV A;  4X62 O;  3KAJ A;  3ORQ A;  3WWI A;  1WJZ A;  2EX3 A;  3WWH A;  5FR9 A;  3RB4 A;  5B1A C;  5IYZ A;  4YXW G;  5KFP A;  5FNV F;  5JVD A;  4ICG A;  4JZ2 A;  4J9S A;  5D5Q A;  2VWK A;  2WB1 E;  3CWB H;  1E4E B;  4A3L G;  4LR3 A;  3SR2 C;  2DAB A;  3N41 B;  4EEY A;  3RF2 A;  5KFN A;  3GIK A;  4J7Z A;  3A0R A;  2OTJ V;  4MV8 A;  1I7N A;  2A0L A;  1GKF A;  1OCZ B;  4KFM A;  3OE7 G;  2RF4 A;  1N0J A;  5KFB A;  5L3E A;  4MA5 A;  4NXN O;  3L2P A;  4OGQ B;  2W9C B;  4OPH A;  2QWQ B;  3HKC A;  4DR6 H;  3ZCC A;  4RUF A;  1W2B U;  2ABJ A;  3ZS8 C;  3ZN1 A;  1EZ1 A;  3APQ A;  3M7M X;  2IM9 A;  4XBF A;  3CCJ V;  3BFR A;  1YHQ V;  5I5U A;  2YXL A;  4I0X A;  5DM6 V;  2YI9 A;  1K1Q A;  2P90 A;  3K0G A;  4E2L A;  1P4R A;  5BXZ A;  2VA3 A;  4TQR A;  1L0N H;  4O4L B;  1HNW H;  3K3W A;  4HQ6 A;  1JJ2 U;  4KL1 A;  1R6N A;  2ZNJ A;  1AJN A;  5KFX A;  1OJH A;  5CA1 B;  4GZR B;  4WBN B;  5IWA O;  4Q0Y A;  5LMU O;  5C8Y A;  1A0I A;  3TJT A;  1XMO B;  1Q6U A;  2R7L A;  4O3O A;  2GQS A;  3K08 A;  3TII A;  2B1I A;  2WSS G;  4DL6 A;  5KG2 A;  4OX9 O;  1CPY A;  3GTL A;  5J2U B;  5BMV F;  1F4M A;  1SQP H;  3T2M A;  4RZR A;  1TWA A;  1MZE A;  4O4J F;  1IBM O;  4JI6 B;  3STL C;  1C30 A;  2LFS A;  3L72 H;  4YY3 H;  5IYZ B;  2R9R B;  5IYB G;  2C00 A;  5KFJ A;  4W4K A;  4CBC A;  3QZ7 A;  2R86 A;  2VQF O;  5B1A B;  3OW2 U;  4I4T F;  4TUY A;  2UUB B;  4L87 A;  2IP4 A;  3ORR A;  2WLN A;  1KB9 F;  3KHL A;  1F7Y A;  2AGQ A;  3PVX A;  1AB3 A;  4JYA H;  1BCC H;  1NH2 D;  4Q4D A;  4FLT A;  4FFP A;  5IDJ A;  1HNX H;  3RYH A;  4EQ5 A;  2W6O A;  4A3D G;  2YZL A;  2EZP A;  5LGT A;  1S5L Z;  4P9O A;  3E5N A;  4DV3 B;  4DV5 B;  4JI7 O;  4YJ3 B;  1SQV H;  2AZ2 A;  4BY1 G;  3OTO B;  2W6Z A;  5CA0 B;  1LR1 A;  4JYA B;  1QR8 A;  3QNE A;  3HKD A;  3L70 H;  2R85 A;  4J9Z B;  4FFM A;  3OGI B;  1NKD A;  5KHJ A;  2PBZ A;  1I94 H;  2GLT A;  4W4L A;  2R8G A;  4B7K A;  2LW1 A;  3L4J A;  2KB1 A;  2ZE6 A;  1H2L A;  1GYF A;  5KX5 A;  4JI5 O;  3RYF B;  3UQ8 A;  4X1Y B;  3VNN A;  4ECU A;  4DLK A;  4LF9 O;  2XAQ A;  3JAL A;  4LCU C;  2AHY A;  4O7W A;  4NR1 A;  1RJP A;  4D7T A;  3KCY A;  5FJ8 G;  2R9A A;  4YY3 B;  2RJZ A;  1K8A W;  1TUB A;  2VS0 A;  2NU9 B;  5KLV H;  1XEQ A;  3V6K A;  3B8M A;  2R84 A;  2R8I A;  4O7R A;  4JAU A;  4JV5 O;  4LFB O;  3GTQ A;  1KTA A;  5KFL A;  2ILM A;  1KUQ A;  2AZ0 A;  2Y0P A;  5KFH A;  3T5L A;  4LFC O;  2UUA H;  3VQY A;  3WG7 B;  1D5A A;  5C1P A;  3BQ1 A;  2HDK A;  4O7L A;  3MR2 A;  3I55 V;  4K0K B;  4JV0 A;  5BR8 O;  3SJC C;  2FLN A;  4I5S A;  5CA1 F;  3ZN0 A;  3T1H B;  4IT5 A;  4O3Q A;  3W7W A;  2JIZ G;  5CR5 A;  5KAF Z;  4GC7 A;  3W7T A;  2XAS A;  1THZ A;  3ZMZ A;  2CNQ A;  2UXC H;  2IMW P;  2XIG A;  1M56 B;  4AQY O;  1IZ3 A;  3RFR A;  4B3T B;  5JH7 F;  3U54 A;  1HNZ B;  3CC4 V;  1R6K A;  2UXC B;  3FB6 C;  4O2A A;  4B3S H;  2JVD A;  4J11 A;  4JI2 B;  1RK6 A;  1KKC A;  2WLM A;  1SQF A;  2L35 A;  2K9P A;  3B09 A;  1WN7 A;  1JDB B;  4O2A B;  4Z1V A;  3PN1 A;  5CB4 B;  4X64 B;  5KX5 F;  2C2R A;  5K3W A;  4R8C A;  4LF6 O;  5DG8 A;  4TOI A;  4EB6 A;  1MZB A;  4ME6 A;  4LF8 B;  3BY6 A;  3MR5 A;  5DGI A;  5C5J A;  1W0J G;  1MSD A;  3VOU A;  3PW4 A;  2QTS A;  3BHP A;  1M0W A;  4A5U B;  1TVK A;  2Q2T A;  2ASJ A;  1HNW O;  1VIB A;  5EWE A;  3G6Y A;  4QGP A;  4ZHQ A;  2BQR A;  5C8Y B;  3QZ8 A;  2R92 G;  3CRR A;  2QWP B;  3JRX A;  1K5S A;  2OTL V;  2DQ3 A;  2R8J A;  3ETE A;  3RGB A;  1PNM A;  1BMF G;  2Q0O C;  4Q20 A;  3ZMU A;  4I50 B;  2JS5 A;  5KHK A;  2XOK G;  3AG3 C;  4YJ3 A;  1PNK A;  3CJH A;  4TUY F;  1PL0 A;  3GTP A;  2ARH A;  2EUL A;  2J6S A;  1TGO A;  2PF4 E;  4UCU A;  2PYL A;  1VAR A;  2ATL A;  3RGX A;  1BSM A;  3BCC H;  3H9V A;  2EIK C;  3OHB A;  4JI1 B;  2QJ1 A;  3NGD A;  4RAI A;  2FMA A;  3OUS A;  3P3P A;  2B63 A;  1FXH A;  1GO3 F;  1WP8 A;  2CH7 A;  5BMV A;  3HBL A;  2VUG A;  1RPR A;  4X64 H;  4EB6 B;  3KKY A;  3T5H A;  1GTO A;  3TW7 A;  1AR1 B;  5FL7 G;  2LP7 A;  1PNL A;  1N34 O;  1ZET A;  4A3J G;  5GON B;  5GW7 A;  4QWA A;  4XYL B;  2NU8 B;  3LNM B;  2CH7 B;  1XMQ O;  4X65 H;  2WLI B;  3HKD B;  1IBL O;  4Q44 A;  2UVV A;  3LSQ A;  2JEG A;  1B3Q A;  4RNM A;  4JUZ A;  4DR1 O;  4BR6 A;  4DR4 O;  1YZB A;  2V7Q G;  2Z5U A;  3K0D A;  4X65 B;  2F4V O;  4L8J A;  4ABM A;  3ETD A;  5KMG B;  4PDL A;  3J80 W;  5C3E G;  2JA5 G;  4EYI B;  1BXR A;  4O4L A;  3FDS A;  1Z2N X;  3GB7 C;  4G2K A;  4Z1M G;  2Q68 A;  4MT8 A;  2ZKO A;  4EFB A;  4QPK A;  3T9E A;  2DW4 A;  2BSK B;  4CMF A;  2FJZ A;  1FXK A;  4FFO A;  3WB1 A;  1XK5 A;  1IBL H;  4PDM A;  4DV4 O;  4ECW A;  2WAQ A;  3K03 A;  3T4D A;  3RYC A;  1B33 N;  4ED2 A;  5LMN B;  2XGQ A;  1VQ9 V;  2HHH O;  3KAK A;  1V55 C;  3U0G A;  3Q4H B;  2WDT A;  4O7S A;  5KG7 A;  4J9P A;  5JCO C;  1FD9 A;  4K8X A;  2ZDG A;  3CC7 V;  3U10 A;  2ZM6 O;  2QSA A;  5KA6 A;  3IC7 A;  5EC2 C;  4QWD A;  3CRA A;  3F7Y C;  2OIG A;  2HVK C;  5KG0 A;  1CKM A;  4PWQ A;  5CAE B;  2PY5 A;  1D2D A;  2BTO A;  3ZRW A;  3UZO A;  3HO8 A;  4HNA B;  4LC1 A;  2FYU H;  1EKF A;  5L3F A;  3T5J A;  2P4K A;  3RT3 C;  1HWY A;  3GID A;  3CRM A;  4TV9 A;  3HOU G;  1I1M A;  2KSW A;  3N2G A;  1M57 C;  2QK4 A;  3RIZ A;  4ZI7 F;  3QO8 A;  2VA2 A;  1LUV A;  3CCR V;  4NTX A;  3QTC A;  4DR7 O;  3A8T A;  2QKA A;  3H20 A;  3EPI A;  3D36 A;  4LWS B;  4I50 F;  4MVQ A;  2DWD C;  1TVK B;  4UB8 Z;  2EJR A;  2WLH A;  4DR3 O;  3K5H A;  2OT5 A;  2B5U A;  4IR1 A;  3H01 A;  3EXA A;  2FKX A;  2JS3 A;  4IRC A;  2HGS A;  3SYO A;  1BNC A;  5KT2 A;  2DWE C;  4JI3 O;  1EUD B;  2QM4 A;  5H6R A;  4FZ0 A;  3ASO B;  5D8D A;  4E6N A;  4DR4 H;  4Q4C A;  1NS1 A;  2OYQ A;  5KFR A;  3EYY A;  4MV3 A;  3A2F A;  1UNN C;  5FLX W;  1HW7 A;  2UXB B;  4GX2 A;  1Z2P X;  4X1I B;  2PI4 A;  3V6H A;  2ZT9 B;  5E1A C;  2NVY A;  3JAL B;  5GON F;  2HHF A;  1GLV A;  3T5K A;  1K5Q A;  3DTU B;  4O7Z A;  1W0K G;  5IWA B;  3CD6 V;  3GQC A;  2XCA A;  1JX9 A;  4G3I A;  4XDK A;  4TSF G;  4FLZ A;  2ATK C;  2R93 G;  1F51 A;  4N21 A;  4ZOL A;  4FM2 A;  1R3K C;  1OCC B;  1P49 A;  1YF2 A;  3PW5 A;  2UU9 O;  2YIA A;  2UUB H;  3E22 B;  4BBS G;  4IWX A;  4H33 A;  5DGH A;  4ED0 A;  2JA6 G;  1EZJ A;  4R50 A;  3T1C A;  1RPO A;  1WA8 A;  2GPW A;  4PA9 A;  4LFC H;  1R73 A;  2QWO B;  2LJ2 A;  2YSU B;  2GQR A;  3M9N B;  4O7N A;  3LDE A;  3RAX A;  3GTM A;  4JYB A;  1XRE A;  3PW2 A;  4BY7 G;  1A48 A;  3LML A;  1M93 A;  2KG7 A;  2LO1 A;  4OXS A;  4LF9 H;  1NI8 A;  4MS2 A;  4DV2 H;  5IJ9 B;  1VP7 A;  1QVG U;  2UXB H;  3F7V C;  4NZN A;  5KX5 B;  4NVP A;  5IY5 B;  3JD4 A;  4DR5 O;  4QWC A;  4J80 A;  2OCC C;  4WFE A;  4MVS A;  4B3R H;  3BVO A;  3WO0 A;  1I5X A;  2G38 A;  2VQD A;  5K1X A;  3I5D A;  1NVP B;  3K58 A;  4WF9 V;  3N27 A;  5IJ9 A;  2LQT A;  3MWM A;  2UUC B;  1VQ6 V;  4X1K A;  1QLN A;  2VRZ A;  5IYB O;  2D3O W;  1G1X B;  3AG3 B;  3R66 A;  2JJ1 G; 
#chains in the Genus database with same CATH homology
 4I50 A;  4O4I A;  4RB0 A;  3SJB C;  1JJO A;  1BGW A;  3OTO H;  2UU9 H;  3E22 A;  5LL6 b;  3K5M A;  4DV4 B;  4LF4 B;  2Q7G A;  4MTD A;  4LFA H;  4PHZ A;  2HVR A;  1HR0 H;  1ZHQ A;  4DRX A;  1JFF A;  2F1M A;  3JAT A;  1XHZ A;  1Z5V A;  4UCO A;  4RB2 C;  2UU9 B;  2Q7H A;  3JAS A;  3KAJ A;  4NXM B;  4FLY A;  4DR4 H;  2V4D A;  5FPR A;  3W1G A;  1I7F A;  2EX3 A;  5KMG A;  4A2A A;  3HKB A;  5IYZ A;  1Q3E A;  3RTX A;  5JVD A;  4ZHQ B;  3F8N A;  1TUB B;  4X1I A;  1WNS A;  2MCT A;  5LMN H;  4LF9 B;  5D5Q A;  2VWK A;  3JAR B;  4GKJ B;  4PI0 A;  5LOV B;  4LR3 A;  3SR2 C;  3N41 B;  1HNZ H;  5D1O A;  3RF2 A;  4DR1 B;  3FFQ A;  4LNU A;  5LA6 B;  2ZIO A;  4M7E A;  3FMA A;  1L8D A;  4CS2 A;  4JI3 H;  3RR5 A;  4UFZ A;  4FM9 A;  4JI4 B;  4FFB B;  4Q6G A;  4JI8 H;  1N34 B;  2UUC H;  3L2P A;  1SYX B;  5J2U A;  5LMU H;  3HKC A;  4DR6 H;  3TY9 A;  1XNR H;  3TY8 A;  1Q8I A;  4PDB A;  3ZS8 C;  4UCV A;  4TV8 B;  4DUZ B;  1FJG B;  3L4K A;  3M7M X;  2IM9 A;  5D5P A;  4GKK H;  3RWR D;  3QF7 A;  4UCS A;  4YHH H;  2YXL A;  2YI9 A;  3K59 A;  4DRX B;  4JI7 H;  4LH7 A;  4B3T H;  4BWS C;  2E3C A;  4O4L B;  1HNW H;  1SA0 A;  4X20 A;  1ZAU A;  1N36 B;  4KL1 A;  1Z5W A;  2ZNJ A;  4NXN H;  5CA1 B;  4WBN B;  4LFC B;  3M4I A;  1FFX A;  4Q0Y A;  4JI2 H;  5C8Y A;  1A0I A;  1S03 G;  2YIB D;  3HXL A;  1XMO B;  3J7A K;  4X66 H;  3S24 A;  4DV6 B;  2ZM6 H;  4I55 A;  1TA8 A;  2Q0A A;  3QG5 A;  3SJA C;  1XQ8 A;  5J2U B;  5D1O B;  4ZIB A;  5FNV B;  2RGV A;  2OWO A;  3B2E E;  4X66 B;  4JI8 B;  4F6R B;  4JI6 B;  3K5N A;  3MAQ A;  4DV2 B;  4IHJ B;  4WBN A;  5IYZ B;  4X62 B;  1ZHS A;  3RJ0 A;  4YY3 H;  3VQX A;  2YI8 A;  4YJ2 A;  1P16 A;  1X9N A;  3IAY A;  3SGI A;  5KHI A;  4DV1 B;  4O4J B;  1XHX A;  5FD6 A;  5JJE B;  4AQY H;  4TUY A;  2UUB B;  3BPZ A;  2PGG A;  4GKK B;  1BJT A;  2UUA B;  3RYI B;  4FM0 A;  4PZ6 A;  3N40 P;  4B3M H;  4JYA H;  1N33 H;  4A2B A;  4FLT A;  1HNX H;  3RYH A;  4X20 B;  4AQY B;  4EQ5 A;  3N43 B;  4DV3 B;  4DV5 B;  1QQC A;  4YJ3 B;  1V9P A;  4DK1 A;  3OTO B;  5CA0 B;  1P8L A;  4JYA B;  4NXN B;  3HKD A;  3RYH B;  4GLX A;  2F4V B;  1AN7 A;  3HKC B;  4AIL C;  1S68 A;  4RB1 A;  4PZ7 A;  5KHJ A;  1J5E B;  2VWJ A;  4IIJ B;  1Q5O A;  4DR5 B;  1I94 H;  3L4J A;  1IBL B;  1GYF A;  1Q43 A;  4FM1 A;  5KX5 A;  3RYF B;  3UQ8 A;  4X1Y B;  3VNN A;  3U11 A;  4O2B B;  1I94 B;  4HNA A;  3JAL A;  5JCO A;  3BAB A;  3CVZ A;  4D7T A;  4GKJ H;  1VF7 A;  3WB2 A;  2XHB A;  2R9A A;  4YY3 B;  2RJZ A;  1TUB A;  1Z2O X;  2ZIN A;  5JH7 A;  2CFM A;  5EZY B;  2CW7 A;  1XI1 A;  4LNU B;  4JI3 B;  2YCH A;  3N44 B;  4I4T B;  2FE3 A;  3IG0 A;  4K0K H;  3BRC A;  3VQV A;  5EIB D;  2UUA H;  3VQY A;  1D5A A;  3WB0 A;  2CW8 A;  3N2K B;  4PI2 A;  3KAL A;  1KMI Z;  4LFA B;  5CA1 A;  4O4H B;  2BTQ B;  4K0K B;  4LF4 H;  3SJC C;  4CC5 A;  3TY5 A;  4J0M A;  4CH3 A;  3T1H B;  3JSL A;  1JMK C;  4TV9 B;  3DSQ A;  5DIS C;  4RZQ A;  5D1P A;  3JSN A;  1J5E H;  2ZJT A;  4UCR A;  2RQ6 A;  4FVM A;  5LXT B;  4KHP B;  2UXC H;  4K8Z A;  2PTM A;  2XIG A;  3ZED A;  5ITZ B;  4BWA A;  3N2K A;  3RFR A;  4B3T B;  1XNQ H;  2VQF H;  4HBN A;  4F6R A;  4RAY A;  1HNZ B;  4DR1 H;  2UXC B;  2UXD H;  1M5I A;  4O2A A;  2VQE H;  4B3S H;  2JVD A;  1CKO A;  4JI2 B;  2P22 C;  1SQF A;  5EYP A;  1WN7 A;  2WYO A;  1DGS A;  4O2A B;  4JI4 H;  2Q7E A;  4U3J B;  3JAK B;  3PN1 A;  5CB4 B;  4X64 B;  1CKN B;  1N34 H;  3BA8 A;  1VS0 A;  4TOI A;  4OX9 H;  2GV9 A;  5LYJ A;  3C0F B;  3OTF A;  4EB6 A;  1E4G T;  1MZB A;  3J81 W;  4LF8 B;  4RAZ A;  5LA6 A;  2HVQ A;  1M4U A;  1SA0 B;  4I55 B;  3T1Y B;  3RYF A;  4JI6 H;  3BHP A;  1M0W A;  1TVK A;  2Q2T A;  4DV0 B;  5IWA H;  4MTE A;  4DUY H;  4ZHQ A;  4LF8 H;  4FLW A;  5C8Y B;  2WE6 A;  1H2S B;  5BR8 H;  4IAJ A;  4DV1 H;  4CH6 A;  1T5E A;  4DV0 H;  3RGB A;  4I50 B;  2JS5 A;  4O4I B;  3ICX A;  5KHK A;  4YJ3 A;  4KHP H;  2PYJ A;  4I4T A;  3JAM W;  3UT5 B;  1TGO A;  4UCU A;  3N6X A;  5FPO A;  1XNQ B;  2PYL A;  4DV3 H;  2VQF B;  3RGX A;  4DV5 H;  1O9H A;  4DV7 H;  1XMO H;  2ZM6 B;  3KYH C;  4B3S B;  3JAK A;  2QJ1 A;  4O4J A;  2R72 A;  4JI1 B;  5JQG B;  5KHG A;  4LH6 A;  2JGU A;  5IJ0 A;  1WH2 A;  5BMV A;  2VUG A;  4O2B A;  4I7H A;  4X64 H;  4EB6 B;  5LOV A;  2HHH H;  4JI5 H;  4IHJ A;  3ETQ A;  5JQG A;  4MV7 A;  5K1P A;  3JAR A;  2ZIM A;  1WPB A;  1KU9 A;  3CHX A;  4RB3 C;  5GON B;  1SQG A;  3DF7 A;  4X65 H;  3W1B A;  3HKD B;  4LSX A;  4DUY B;  3JAT B;  1JFF B;  5A2Q W;  4X65 B;  4LF7 B;  1N33 B;  4IIJ A;  2ZCE A;  4L8J A;  4CH4 A;  5KMG B;  2HIV A;  4AHC A;  3J80 W;  4O4H A;  4GYC B;  4O4L A;  1Z2N X;  3GJX B;  4EFB A;  4DR2 H;  4FLV A;  2F4V H;  2CAZ C;  4DK0 A;  3BAA A;  2PZS A;  1S5J A;  1O75 A;  4YJ2 B;  4APM A;  3WB1 A;  1XK5 A;  1IBL H;  1SKV A;  4DR2 B;  2F95 B;  1IBM H;  4TUY B;  4BW9 A;  3RYC A;  4LFB H;  4FLU A;  5LMN B;  2HHH B;  3KAK A;  4B3R B;  2WDT A;  4LSA A;  4R7R A;  5JCO C;  3K5L A;  4K8X A;  5LP6 C;  5IJ0 B;  3U10 A;  2RGR A;  3U0Z A;  4LFB B;  5IT9 W;  1XMQ B;  1YEW A;  3CB2 A;  1N32 H;  4CH5 A;  2VQE B;  5JVD B;  2P5O A;  1CKM A;  2PY5 A;  2BTO A;  5FNV A;  4CS3 A;  1IBK H;  4HNA B;  1G6U A;  5J2T A;  1SEI A;  3W5O A;  4TV9 A;  4LF7 H;  4DR6 B;  4OX9 B;  2KSW A;  1XNR B;  3N2G A;  3VQW A;  2HVS A;  4DR3 B;  3BA9 A;  3RIZ A;  3CSX A;  3HKB B;  5ITZ A;  3K5O A;  3HKE B;  4B08 A;  3T1Y H;  5JJJ B;  1M0T A;  4DUZ H;  1FJG H;  3QTC A;  3K57 A;  3T1H H;  4NXM H;  3H20 A;  4CS4 A;  4TV8 A;  3KXY T;  4ETS A;  4DRF A;  3N2G B;  2KKW A;  2PUS A;  5BR8 B;  1TVK B;  3QWU A;  4JI0 H;  2YIB A;  1B04 A;  2BTQ A;  4ZI7 A;  5EZY A;  1IBM B;  1HNW B;  5EIB C;  4LF6 H;  1NT2 B;  4JI0 B;  2HGS A;  2HEP A;  2UXD B;  2QM4 A;  3RGZ A;  4X1K B;  4E6N A;  4PZ8 A;  4LMY A;  4DV7 B;  2OYQ A;  4LF6 B;  4DV6 H;  3EYY A;  1XMQ H;  3A2F A;  5LYJ B;  5JH7 B;  4JI1 H;  3NC0 B;  5FLX W;  4FFB A;  1HW7 A;  2UXB B;  1IBK B;  1Z2P X;  1QHT A;  4X1I B;  4EEQ A;  1I6U A;  2VOB A;  1FFX B;  1L2Z A;  2ZNI A;  4JI5 B;  3JAL B;  4ZI7 B;  4LF5 B;  4I9Q A;  4UCT A;  1E4F T;  1X4T A;  2R70 A;  5LXT A;  4X62 H;  3UT5 A;  5IWA B;  4MV9 A;  3THO A;  5KHH A;  3RYC B;  4DR3 H;  4DR7 B;  4YHH B;  4FLZ A;  2O03 A;  3N42 B;  4ZOL A;  4FM2 A;  3JAW A;  5LP6 A;  1P49 A;  3LNN A;  2W57 A;  2UUB H;  2YIA A;  4JI7 B;  3E22 B;  3HKE A;  3RYI A;  1FVI A;  1N36 H;  1FKA H;  4DR7 H;  3JAW B;  5LP6 B;  1HNX B;  4LFC H;  1HR0 B;  1TAE A;  5J2T B;  4D7S A;  4JV5 H;  3GDE A;  4DR4 B;  2Q2U A;  5GON A;  4ZOL B;  5FD5 A;  2HIX A;  1RSO A;  3LML A;  4DR5 H;  4JV5 B;  5CB4 A;  1M93 A;  5JJN B;  3GB8 B;  2F66 C;  3NBY B;  3K3V A;  4LF9 H;  4DV2 H;  5IJ9 B;  2E5L H;  2UXB H;  4X1Y A;  2VPS A;  5KX5 B;  4NVP A;  4CC6 A;  1XDN A;  4B3R H;  4LF5 H;  4U3J A;  1CKN A;  2E5L B;  1O9G A;  5K1X A;  3K58 A;  5EYP B;  5BMV B;  5IJ9 A;  3NBZ B;  3MWM A;  2UUC B;  1N32 B;  5EOY A;  2F93 B;  3JAS B;  4X1K A;  4TQF A;  4EFE A;  4B3M B;  4TQD A;  5LMU B;  5CA0 A;  4FLX A;  4DV4 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...