4UDUC

Crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
218
Chain Sequence
KDLRKKSELQRNALSNLRQIYYYNEKAITENKESNTLLFKGFFTGHPWYNDLLVDLGSKDATNKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWIDGKQTTVPIDKVKTSKKEVTVQELDLQARHYLHGKFGLYNSDSFGGKVQRGLIVFHSSEGSTVSYDLFDAQGQYPDTLLRIYRDNKTINSENLHIDLYLYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4uduC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4uduC01
1CHQD 5TSSA 1YN4A 1JQYD 1XXGA 5ELCA 1LT4D 3EFXD 2RDHA 1FNUA 4DXGA 1PZKD 2XRSD 3MFGA 1FGBD 1TS2A 4L6TB 1BCPB 1XTCD 1KTKA 3R2TA 1LTAD 1PZJD 1SEBD 1PTOC 1JCKB 5D3IB 1PZID 3R2IA 1S5DD 4RFBA 1LTBD 2R61A 1GOZA 1ESFA 3BVMA 1DYQA 1LTRD 2CHBD 1EFID 4RGTA 1S5FD 1EWCA 1TY0A 1V1PA 1LTTD 4RH6A 1FNVA 1CHPD 2IPKD 3BVZA 1F77A 1L0YB 3DWPA 3GP7A 2O2LD 4Z9CB 3V05A 1LT5D 5ELDA 2J4XA 1EU4A 1JR0D 4O1NA 4C56C 1G8ZD 1BCPC 1TS5A 2AQ2B 3URYA 1TS4A 1EEID 3DWAA 3EA6A 1ENFA 1TY2A 3TSSA 1LT3D 1UUPA 3O13A 3BYYB 1MD2D 1S5CD 1SJED 1YN5A 1FNWA 1V1OA 2XNAC 1BXTA 1PRTB 1D5XC 2SEBD 1LTSD 4UDUC 1FD7D 1YN3A 2ICIA 2TSSA 1AN8A 1HQRD 5ELFA 3CHBD 3BYTB 2NTSA 1LLRD 1BCPF 1SE4A 1D5ZC 1LT6D 3DWQA 5ELBA 1LTID 1CQVA 1CT1D 4RHRA 5FK9C 1KLUD 1EU3A 1ET9A 1PTOF 3W2DA 1ET6A 4RGOS 1B44D 1EEFD 1LTGD 1BCPD 1RD9D 2NTTA 1PRTC 3MC0B 4RGNA 1AW7A 1D6EC 4K6LA 1RCVD 2Z8LA 1RDPD 1QILA 1T5XD 1SE2A 1JWMD 1HTLD 1PTOH 2WV6D 1PYWD 3OWEB 1STEA 1PTOD 1SBBB 2G9HD 1JWSD 4ZYSA 4NZLB 3KLSX 2AQ3B 5FKAC 4DXFA 1TS3A 4L63B 1CK1A 2QEJC 1S5BD 1SJHD 1PRTF 3BZDB 1HXYD 1I4GA 1RF2D 5ELEA 3R8BA 1S5ED 2QILA 1KLGD 1B1ZA 2AQ1B 1I4HA 1SXTA 4RCOA 3BVGA 4TSSA 1DJRD 4BWGB 1JWUD 2XN9C 1I4RA 2XRQD 2RDGA 4RHSA 5D3DA 1I4PA 1L0XB 1PTOB 1SE3A 1V1PB 4OHJA 5I4DA 1PRTD 1M4VA 2IJ0A 1I4QA 1D5MC 1HA5A 1I4XA 1LO5D 1UNSA 4RGMA 3SEBA
chains in the Genus database with same CATH superfamily
1SR3A 1SNCA 3A7AB 1NY4A 3HRZC 2PTLA 2BS4B 2UYZB 5D7GA 3TEHB 3IAM1 4NAMA 3H0GB 5C44H 3JW0X 1A62A 3KLSA 5E4WC 3GTLH 2H5XA 1MFWA 1PFMA 4JI2L 4DV0L 4OELB 5L37A 1C76A 3ZJVA 2ZVOA 1RLFA 1C78A 5M3MG 4A3BH 4DR7L 3RNAC 3TP6A 4JVZA 3M7NA 1NMGA 4LJOB 4A3CG 3CMAA 1Q81C 2JRHA 5CV8A 3ERQA 5T8IA 3AU4A 2JWZA 5CHVC 2VH2A 1O7ZA 4RGTA 2LY7A 5A35A 1OTCA 3RZDH 3GTQH 1WIAA 3H3VI 1OXSC 4JI1L 2N7JA 1GHKA 2N7DA 3GDEA 4ANXA 4Z9CB 3WDNA 1WXSA 2L0FA 4IWOA 3W5OA 4IPCA 1K73C 3TZUA 2F0JA 2LJIA 3CCLA 2H89B 2QCPX 1VQ4A 3EA6A 5C6AA 4ZRIA 1E0ZA 4A3KB 4JI4L 1TJEA 5BN3A 1VMPA 3AEVA 1P3QU 1HZAA 4V0BA 1SYEA 1B8AA 2E2HH 3MTSA 2KO3A 1SYBA 2P5ZX 2I38A 1BBXC 3TMEA 3GV6A 1MG8A 4EQNA 1W6KA 4AS1A 3HOXH 2HT1A 1YNXA 4UDUC 3N1YC 2E74C 4ZUIA 2L0CA 2WXKA 5FLXE 3I5JC 1UE1A 3JC66 3HP3A 5M3FH 2L5TA 3PO3B 4DPGA 1QE6A 2ON8A 1C3TA 3TP7A 2DZIA 4LW1A 3J80E 1WE6A 5JJZA 2WINB 1JJCB 4R4OA 2R7ZB 1V9PA 5CHFA 3SD5A 3KF6B 1WCMG 4YCWA 4R8IA 4UAIA 2V1YA 2MHVA 3VR3A 1TYGB 3DHGC 3L0OA 3PLVA 2H4OA 2H1EA 2MQHA 4N9PA 1ZP0B 4DBGA 2MO0A 1H9SA 4A3EB 1XLNA 4HSPA 2DZKA 4BA1I 4II2B 1X55A 1L0WA 3K7UC 2NCNA 1CZGA 2JE6I 2PE9A 3B9JA 4IUQA 4LWCA 4GDLA 1YHBA 1TWFH 1O78A 3NHHA 4YL8A 3GO5A 1IYFA 2L1BA 1XQQA 2B39A 1BOSA 4QIWE 3KK7A 5E3FA 1QCBD 4ZYSA 4LFBL 4HDQA 5ELOA 3VUYA 3E0JA 4IG7B 3ND8A 1C77A 1PFDA 1TS3A 2J0TD 5NUCA 4N8FA 1RYJA 4MJSA 2K28A 2OOBB 1CJEA 2JYEA 3GOEA 1CTMA 2KDBA 3ZJUA 5JAVA 2EMSA 4XT3B 5BN4A 4DU9A 5BYQA 5LL6S 1CSQA 5DM63 1VCIA 1S72A 5C4XB 1JWUD 3JAMi 5ELBA 1DGSA 1SNDA 4RHSA 3FEWX 2BWFA 4L8JA 2F4VL 2KLCA 1YNJD 2VS1A 2A1AA 1YQ3B 3P4QB 4GXBA 2EXDA 1VQPA 1M94A 5D94A 2O5IC 1GPXA 3N6RA 3Q3NC 3RUIB 3NQIA 2QC8A 1V2YA 2G1EA 2J0JA 4JI6L 1XTDA 4DV7L 4O2DA 1ZEQX 2LRUA 1FRRA 3ULPA 4NB3A 2B2WA 5EPKA 4DV5L 2KHWB 1LT4D 3B08A 4MHEA 1F9SA 4NMZA 1NE3A 4FO2A 2A6HD 2FHTA 5ELNA 1GXDC 1WX8A 3NVZA 4BBSG 1YJWA 3Q8EA 2KECA 3FHWA 2JSOA 4X65L 2CW0D 2JT4B 4EQOA 3KUZA 1JCKB 1TWCH 4DHJD 1BMLC 3Q6BA 4BKSD 1WTPA 3SHLA 1WTQA 2AEHA 3PF5A 2YLMA 4TQUS 1VQKA 4CGYB 3W3AA 1NYRA 1EQQA 4K2KA 1M90C 5CV6A 4LF6L 5IGDA 4ZCKA 3T1HQ 2KX3A 1YHAA 4NAWB 1F77A 3CCEA 1KOTA 2BDNA 4HN7A 2E2JH 2NVXH 1DGJA 4K0KL 1EIGA 2E2IH 3P4SB 2UUCQ 1TIID 3BZKA 1D8LA 1TS4A 4N6EB 4PYUA 4WJWA 3KFUA 3P75A 5KYIA 1WGDA 1PUTA 3DHHC 4YHHL 1STAA 2E2DC 3AB9A 5IT9L 4LF9L 1N62A 3DWMA 1E22A 3OW2A 1F2LA 4RMFA 3IFDA 3TP5A 4QUFA 4ME3A 4A3JG 2VUMH 1D1IA 1AWDA 3ETRA 1X6OA 4X3KA 2N8NA 4Y52H 4WAAA 1Y1WH 2F0UA 4LDTD 1QOFA 5JXVA 3RNCC 1A63A 1SMYC 1J7AA 1XNQQ 3MJWA 1VQCA 3QK0A 1EQRA 3FKIB 4PQXA 2XK5B 1SE4A 3W1YA 3VTUA 1E24A 3E5SA 1UBIA 2LGYA 1L4DB 2YEPB 4GOPC 1NNXA 1C48A 3GZNB 4DAYA 3H9DA 4DR6L 4CJ0B 3S17B 5D2MB 4A6QA 3AE4B 1BCPD 1ZPSA 3GB1A 4AIMA 3HOZB 4IWQA 1K51A 4FP5D 2FNJB 4FYDA 2A73B 5J22A 1WFQA 3E9HA 3L08A 4CDDC 3NUCA 1QZHA 3M4QA 4OO1H 2HQLA 3F2CA 3UQAA 1E2VA 2CHXA 3K0XA 1F9RA 3BG3A 3P4RB 1SAPA 4LF7Q 3V2TA 3HS0C 2JZ3B 4MTKA 1WM2A 3NPPA 1TVXA 1SN8A 4L5RC 3AE2B 1S3SG 3PUYA 1Y1WG 1N5WA 2PQAB 5LLIA 3RT3B 4IWPA 4S0RA 3AV8A 3D32A 1LM0A 1Y56A 4F7ZA 2YTXA 4KK7A 1N8RC 1BF4A 4GSWA 5MPOA 3BVGA 2PE6B 4YT0B 4JI0L 2DX5B 4DUYQ 1YNND 4W9EA 1QJOA 4BY7G 3PIP3 1HR0W 4WIPA 4DUZQ 1MIUA 3VDYA 1V1PB 4AH6A 3BINA 3F2BA 4NXML 1IBLQ 1YOVB 2MX2A 4A3PA 1HA5A 4KHPQ 2KCMA 2L1AA 1XO3A 3T53B 2RF4A 4F88A 1U4RA 3NP8A 3X23A 4AYBG 3Q24A 3S16H 1HA6A 2MQJA 2BH8A 2GOWA 1HNWQ 2Y0SE 3M7GA 4J15A 1NEKB 4DR5L 4PS7A 5GROA 4D2KA 4EGVA 4QL5A 1I5FA 5C5MA 3GTKB 3P1HA 4A3DG 2QMTA 4IURA 4LNKA 1PZJD 3OG5A 3CC2A 4IUTA 2FIFA 1SFOH 4LLGM 2BS2B 2JZPA 1CKMA 2IZVB 2RHQB 5D14A 4JBKA 3VDZA 2KENA 3K5LA 1PHJA 3VTWA 2BQQA 3KYCD 5IE8A 3GS2A 1N32L 4M0WA 5LNK1 1OQQA 2WXFA 1U0LA 1MHWC 2CJNA 2O6VD 4KVGB 3FILB 2XWBB 2NR2A 4KZ0A 2KCCA 2LVPA 2L05A 1YJIA 2UUBL 3BDCA 1Y14B 1W2BA 5I9OA 4V190 5T1IA 1LGRA 4POGA 3N3KB 4MGIE 4ZLTF 4RM9A 5HGTA 1A6XA 1CZPA 3OTOQ 2MCNB 4YCUA 5H92C 2K6DB 3RZOH 3ZVVA 1KH0A 3V6CB 2D9UA 1MD2D 2C35B 4XTCS 1HZCA 1BXTA 2K14A 2KANA 2PW5A 1YJNA 2RMMA 2A69D 2QKIC 2SEBD 1UGMA 3MC8A 4XQQA 4IM2A 3NBHB 5IA7A 4LF4L 1FPYA 1D7QA 1CKNB 1WGYA 1TXYA 3IRBA 2D3AA 4C3JH 5FLMH 2K33A 1FYCA 5E1FA 3HVZA 4BOSC 2BGFA 3PO2B 3TIXA 2UXDQ 2UXBL 2B8FA 2F0TA 5EKIA 1WTWA 4RHRA 1G91A 2D2QA 1RFKA 2KDIA 2D3CA 4FHJA 1E7UA 5FLXc 4MM3B 3U7DA 3A8IE 1V81A 1B44D 4IZ8A 4B6WA 2JQOA 4PZ7A 1C0AA 3DPDA 3J80c 4JBWA 4EUTA 1L2NA 2ZVNA 4GOPA 1XMOL 2K1BA 3MHBA 1RCVD 2K6AA 2NVYH 3T1YL 4P1BC 2EYJA 1QILA 3H6NA 4LDTB 4DR2Q 4I7AA 4HDOA 2WV6D 3BDOA 1SBBB 2VY3A 2W54A 3HUIA 4POFA 2PNHA 1NBWA 1UE7A 4W9HA 2MUYA 5FKAC 3H7PB 2D3BA 4M8MA 1JB7A 4TQ1A 4ACFA 5CV7A 3ZNGC 2ZNVB 3ZDTA 3D8GA 1LTLA 5IWAQ 1ASZA 1NI2A 5JJIA 2DJFC 4W9GA 4JQWC 1I4GA 1MI2A 5J3BA 4F7XA 1UE6A 2HHHL 3NZSA 3SFEB 5J18A 1EY6A 4FF2A 2QILA 2JA8G 2A4ZA 2KDEB 3EECA 4B3RQ 3M95A 3ABVB 4ZRZA 5AEKB 2J53A 1E8XA 1VD2A 2J7ZA 1ZUD2 1YVCA 4HJAA 3L0WB 2F0QA 3TRZA 1SIFA 5E6OA 3SK4A 2OQ0A 5AJ3L 3K57A 4A3MH 2M4NA 1WYDA 1H4RA 4K5WA 1S1QB 4OZCA 3ZKJC 4DF7A 3S2AA 2B8GA 3MJ5A 2D3GA 5LMUL 2O5JC 2B63H 2NVTH 1IPGA 3ULLA 2RKSA 3C1EA 1WGKA 4PS8A 3A1QA 2JEAI 4PMWA 3Q22A 5EE3A 5TSSA 3GTOB 3APFA 2QIEB 4BOZB 1B53A 3KDFB 2IY0B 3ZNID 3RMHA 3NWSA 4A55A 4N8X1 1K0RA 3ZLZA 2N88A 2HCCA 1K8AC 1EO6A 1XF5L 2F0MA 1Q46A 3OIPA 1MGSA 1GNUA 1G291 4ABNA 1WOCA 2R92G 3OJ3A 3PRMB 2UU9Q 2EZVA 1J7CA 3CP0A 5M5WH 1S5DD 2DYOA 2AWNA 1JB3A 2GA4B 3K7AH 4A3IB 3HOUG 1OQRA 1UBQA 2KK8A 1V5OA 2VQFQ 4HCPB 4L2YA 2AMCB 1SB3C 3AE5B 1V5TA 3QR8A 4XIGS 1LACA 3MXUA 1SF0A 1WXQA 1LTTD 4KHZA 3GTPH 3DWPA 3KBGA 4KMUC 4A3MG 2KAJA 1MKHA 2I5LX 2DZMA 5JH5C 5IODA 4KIKB 1O80A 2N9LA 5H1SE 2MA9B 2JRIB 1Z9FA 1JJ2A 3PV1A 2LHEA 2YU9H 2WXPA 2AQ2B 4KGTA 5M5YH 2E5LL 4IOAA 3C0RB 3JSVA 1KABA 3AYHB 1T0YA 1E10A 1PRTB 1D5XC 1F2ZA 3E9SA 4A3GG 3ZNZB 1YX5B 4YXDB 3M4YA 5J39A 4L5TA 3ZYYX 4P16A 3BU2A 4FXGC 2R93G 4GLSC 2O6VB 1YN3A 4DNTB 2D10A 2B2YC 1Z5SB 2HCIA 4TQ0A 2F0EA 3F8TA 4DR4L 1JW9D 5JEAJ 4GIVA 3AI5A 4MGZE 2KEEA 1IHZA 1QVGA 5AUIA 3A9JA 3NQTA 4A93B 2N1WA 3VUWA 5FJ8H 3UINB 5L95C 4YY3Q 1YHQA 2MSED 1JE4A 4K6DA 2RD0A 3I4LA 2KN5A 2B2TA 1G6JA 2NVQH 1V8QA 2IT1A 2JA7G 1WMHA 3WIMA 1GM5A 4KD4A 1WYWB 2PJHA 3ZDMC 1KAAA 1WX7A 3NOBA 3Q8AA 2EY6A 1WWTA 4CJ2C 2KVRA 2WX0A 2BDOA 4AQYL 3NZ3A 3HOVB 1JWMD 1STHA 5CYUA 2GMIC 4LFCL 2CS4A 1ENAA 5C0XJ 2DGYA 2F3WA 1G6PA 1MJCA 1F2RC 2GBKA 1WTHA 1PH5A 3KUPA 4KHVA 4DV1Q 2D62A 2JX5A 2GBJA 1WJNA 4X64Q 1VZ8A 2I46A 3QA8A 1HRJA 1WZ0A 3AQQA 3I4NB 1SDFA 2K5QA 3U2SC 3K58A 1K0SA 4QUCA 1X54A 3BZDB 4M8NA 1HXYD 5AZGA 3VVWB 1PH2A 2JA5H 2ACZB 4NJ6A 4BBNF 1EUVB 1Z2MA 3HKSA 1W3SA 3NG0A 1KRTA 1EIYB 2WX1A 4C3HG 3PUWA 2W3RA 2INNE 1JOQA 1YQBA 1U5KA 1S3OA 2BKRB 2EYFA 1GO3E 3A8JE 4ANVA 2MP2A 4JCVE 1AEXA 2WXJA 5JEAH 5EAYA 3NWTA 1QOBA 3K59A 4B9WA 1RTNA 3KLRA 2KMCA 1VZ7A 1UH6A 2TMPA 3PRPB 2WDQB 1Y8RC 3QC8B 3WOEA 2ZZPB 4MTNA 3R7RA 5CBEE 4XQJA 1R9TB 2DNEA 2IL8A 3ZJYC 1VDVA 3UGBB 1GC7A 3H15A 3NTHA 2KHIA 3RLOA 1NSNS 4ZRQA 4KKUA 2J7QB 4OZAA 5BMIA 2LMCA 3HRDD 3EFCA 1L6UA 5C0XH 3RNUA 4B3MQ 2FFKB 1J6QA 1YEZA 4B95A 3KBXA 3KWVA 3VH4B 4Q5VA 3SGIA 1I3QB 3AN1A 2B2VA 4KKSA 2K7VA 3T13A 1KD1C 3V60A 3PREA 2RSNA 3CCVA 5EPJA 2O2LD 1WZ3A 1HZBA 1JR0D 1YIWA 5JEAG 1WRDB 1J8CA 3I4MG 2OHFA 2GBRA 2LSSA 3EUB2 3F2DA 1EEID 1K53A 2HDMA 1XPRA 1WYGA 3K0YA 1TY2A 2VRRB 1JMCA 4MSMB 3ZIMA 4S17A 1BT0A 3J81j 1SSNA 3DBHI 2IY1B 2KX0A 2NBUA 1FJGL 2CHWA 1UEAB 1OGWA 2BCOA 4WJNA 4C3IB 4R9WA 4PG3A 2MO1A 3U4ZA 1DZ1A 2ICIA 3H1UA 1AN8A 1ACCA 3EGRA 5ELFA 5DNFA 4KZCA 4NY0A 5C2TB 1N5XA 3N52A 1BCPF 1K83H 1I50H 5C0XG 1EWYC 2HTME 3M9BA 3Q3MC 1AP0A 2GBMA 4BY1B 4E71A 1QWYA 2Y0SG 2B2YA 4A3FB 3CAMA 2FXQA 2G5DA 2EELA 1OEYJ 4ZOHC 2ZEQA 3SK6A 2KDMA 2ZM6L 1DOLA 1EIHA 3FC4A 2NTTA 3S2HB 3A9KB 4GN5A 4ZHOA 4JI2Q 3RR5A 1PA6A 2PVOD 2B2UA 1PXUA 3EHVA 4IKGA 4M8AA 4DV0Q 3CQZB 3N1ZC 2PVGC 1KFYB 1E8ZA 3MA2B 4ITKA 3E9IA 1TKGA 4DR7Q 1D1KA 2JEBI 2KCTA 1TWHH 2J0KA 1C9OA 3IFTA 2A68D 2NZHA 2HTHA 4A20A 1O7IA 1SMYD 2IBIB 2Z6BA 4KV2A 4JPSA 3H0GH 1IXRA 4GB9A 5LXHA 3W9CB 1ZXTA 1TZOA 1PYSB 2A6ED 4JI1Q 5EE0A 1B1ZA 1ENCA 3UE1A 3X3MA 1FFUA 4ME5A 2WAQB 3VYUA 1V49A 2AX5A 2DYMA 1L4ZB 4C4VB 4BBRB 3C19A 2IWHA 1M1KC 3WAPA 1KRSA 4I65A 1N33L 1VMCA 2F0GA 2LGIA 1M4VA 2V1CC 5E6JA 5I6YA 4YWKA 1WR1A 2KTRA 3MXNB 2K8BA 2ZT9C 4LCDE 1GB1A 4LFAL 3AE9B 1AZQA 2FUG1 4HJKA 1IYJB 2IYDB 5IYDH 2Z6KA 3W5UB 2Z1CA 4H0LC 2PEAA 2B3AA 3U4EG 3NTIA 3H7SA 2FINB 1Q8KA 3D31A 5BYRA 1FNUA 3M85A 1SRUA 4XDCA 2NZOA 4L6TB 4DKAC 1G2SA 1WF9A 4HJ8A 1F2RI 2BYEA 3FMCA 4OONA 1QKZA 3DHQA 3R2TA 2DAFA 4A3KH 1HTPA 5C23A 3HOYG 2EYMA 5EGTA 1ESRA 1NR4A 4QGUA 3AEDB 4W9CA 4RFBA 1LTBD 3MVVA 3D3RA 4K7UA 3CC7A 5LMNL 4DNRB 3VRAB 4P71A 3RYTA 2BOSA 4YWGG 2CKHB 2NUCA 4JIOU 1N63A 2KJHB 4B9KA 4MN3A 1S40A 1C4CA 2IGDA 3PO3H 1B3QA 1L0YB 1I7HA 2DLBA 5CTRC 4PV1C 4LFBQ 1FR3A 2WXIA 2R7ZH 2WB1B 3N1XC 3JVZX 1WI0A 3E6ZX 2VW9A 4Y7NB 2PKOA 2IHFA 1AH9A 3BJUA 4JK1C 5C1ZA 2QSDA 1U9RA 3I8ZA 3WAMA 3EBEA 4TUUA 3I3CA 1EWIA 2DNCA 4KY7A 4A3EH 2FAZA 2L0TA 2LWPA 4FULA 3J81c 2KFKB 1P9DU 2IGHA 3APDA 3U8ZA 2EJFC 1LM8B 1L2FA 2JYOA 3J80i 4W9IA 1PFSA 1PDXA 1F2MA 4A3KG 1YITA 1KJTA 2AL6A 5M9OA 3BYTB 2I1JA 1XMQL 2F4VQ 2QDFA 1E7ZA 1PFBA 1Z47A 2W55A 3NELA 3OYYA 1CQVA 1UEBA 1KRHA 1V80A 1WRIA 2ONQA 3AE7B 4JE3B 3TEXA 4ARCA 2LXAA 3NY5A 3OOCA 1IBXB 1ZXHA 4LNOA 5JPMC 5EQ0A 3TS0A 1K9MC 4ARIA 4JI6Q 4IPHA 4DV7Q 4C1NI 2FE8A 1JOKA 4DV5Q 2ALYB 1YZ6A 3KF8A 5CR3A 3LB8C 2Z4HA 1IBML 2JU6X 3NE5B 2Q8IB 5C44G 3W1BA 4FADA 5C4XH 3K80C 3PIOA 4HR7B 1BUIC 4GU2A 2VB2X 1HTLD 2JK8A 1DXMA 2A8VA 1V1QA 4X65Q 3DVGX 5BMGA 1EUJA 2LHDA 1MSGA 4MGKE 5D65A 1B7YB 1WJUA 4W9LA 2WDTB 4A3BG 1FRDA 3IVFA 1HJPA 2HJ1A 1Q0WB 3IFWB 4KY6A 4URKA 4P74A 1XYIA 1CK1A 1A8VA 3MXPA 4LF6Q 2Y5CA 5G3LD 3HM3A 4MIUA 2F0KA 4A76A 1IGCA 2AQ1B 3ECIA 2PMZB 2VQEL 4K0KQ 4ZKCB 2BT6A 4TSSA 3R93A 1VQNA 3MP9A 3TMPB 3V6EB 5J1ZA 4RMAA 3S9WA 1Q82C 1XJVA 1NUCA 1OXXK 1F0ZA 1E6EB 4PZ6A 1KLVA 3B2GA 1HUMA 2IJ0A 5C4JB 4YHHQ 4ANUA 5JHBA 1KDAA 2G9DA 2SAKA 3RNEC 4EX5A 3WALA 5KHOA 2KOLA 2IX0A 4NXNL 3X3NA 5C4XG 2D2CC 1IYUA 2ASBA 1YN4A 3KWLA 1PMRA 3HEJA 1Q86C 3CD6A 1Y1VB 1U4AA 3HOXG 3QG1A 2KC1A 3B0AA 3KJPA 1C4PA 5EPLA 4DA2A 3CKIB 4M00A 5G55A 4AJWA 4K5VA 2N9KA 1F9QA 1PZKD 3CMEA 5M3FG 2N7EA 4HRSA 2K8HA 4HK2A 4JOIC 2N3SA 2RQXA 3K8AA 3CCJA 5IT9E 2KQ7A 1UWVA 4XZ4A 1DOMA 2QDLA 3WOFA 2QJLA 1LTAD 2KDFB 4C7ZA 2WXLA 1SEBD 4H7BA 3CCUA 1EFWA 4DR6Q 3A56A 1WCMB 2M19A 1STYA 2FCMA 2E3TA 2C9OA 1TWGB 1FCCC 3AEBB 1DYQA 3Q23A 4LMQD 1CM9A 2RSOA 4QF4A 4RG1A 3M3JA 1II3A 3SR1A 2EYLA 4L5SA 4MACA 3UI3A 5JHAA 3GQBA 2PPBC 4UP9A 4J8QA 1CHPD 1H8CA 2VZKB 4GMVA 3FKIH 2MEKA 1KXLA 2K8CA 4HWIB 2KQ3A 3TDQA 3M63B 1WI5A 2QHOA 4K7SA 3T9LA 2CH4W 5HURA 1HUNA 1XD3B 1L1OA 3TSSA 1WE7A 3L10B 3O13A 3B1LX 3S17H 3OJ4B 4BXXH 2WXOA 4KDLB 3RD4A 4CHTB 3HOZH 4NJCA 4PMBA 4B9XA 3KYHC 4OEMB 4FF3A 4U673 3J7AF 2KJRA 4QJFA 2F3IA 2W3SA 4JI0Q 4F1SA 4HCSA 3PGEA 2CVRA 2RDBC 5H8YE 4DR1L 2NTSA 2O2VA 4RM8A 4ZRPA 4NXMQ 1N60A 4C7YA 3CCMA 4WJ4A 2JQRB 1B9MA 1T0RC 1P0RA 1FMAD 1A3TA 3GE3C 4HIMA 3P63A 3L17A 3TBLD 4DHZE 1Z7TA 4TMAB 2LKVA 4GKKL 3ML9A 1Q7YC 1MVKA 3WANA 1SLJA 5LXIB 4DR5Q 1PH1A 1BUVT 3DM3A 3EQLC 4W9DA 4B3SL 4G7OC 2NS5A 3R3OA 4ZHPA 3CCRA 3OWEB 1C7YA 1PTOD 1N61A 1TWAB 4OVZA 1UGJA 1XNRL 4BBSB 4AWJA 1TGZB 1T9HA 2E6XA 2M1MA 4HIOA 2BYFA 4DV3L 2DNFA 1FEHA 3L16A 4WJOA 2PO4A 3GTGB 4NP5A 1EF1A 1N32Q 1S5BD 1YBYA 1DONA 2SNMA 4C1NK 3PRZA 5FO9B 3GTMB 1T0SC 1PH4A 4ICVA 5KIXA 4ALPA 5BYSA 5AUKA 3SXHA 2UUBQ 2CH4A 3S1MB 3GTKH 2A19A 1DJRD 2EVBA 2CJOA 2F0WA 4KX6B 2XRQD 3C2PA 5J2RA 5D3DA 1BNZA 1A70A 3UDFA 3VFKA 2KYWA 1GUSA 1E2WA 2C9WB 4JI7L 2V0GA 1A5RA 4DK1A 3U7ZA 5C0XI 1UWMA 2FJ2A 2EKIA 3EIVA 4LF4Q 4RF0A 4A3JB 2VUMG 4KV6A 3S1RB 2F0FA 1XXGA 4X66L 3F2UA 3L7ZC 2QA4A 2K52A 4OXPA 3IBEA 2F52A 5BR8L 5GQOA 1JWAD 4GDKA 3MWYW 3SVMA 5C3EB 1HFNA 2UXBQ 5C3WA 2DY7A 2L76A 5DPTA 2XVSA 4IC7B 4DK3C 1ZDVA 2MJ8A 1WXAA 4F8MA 2KWUB 2NBFA 1J0GA 3L9AX 1QNKA 3MHZA 2INDC 4JOIA 1VQGA 3M3YB 4IOIE 3I73A 3D6WA 2I0QA 1RWSA 1Q8IA 3TEZA 1XMOQ 2IO2B 4FJZA 4LF8L 3BS1A 3T1YQ 1ZYRC 3JAML 3HKZB 4A4IA 2CQAA 1XLOA 2C60A 5ELDA 1KQSA 1YIJA 4OO1G 1RODA 4HCNB 1EU4A 3PO2H 4KN4C 1R7SA 2EE1A 4JWUC 1SGHA 1FD6A 5JJKA 3ZTCA 4WQMA 2Z0EB 4US8A 2EQSA 3VA5A 1E5WA 4N9TA 1QUQB 3ZNHB 2Q8RE 3ZO5B 5IY0A 4I6NB 2RCNA 2K03A 2JA9A 2GRIA 2HHHQ 2KJ6A 2BF8B 4HKQA 2QEXA 5BN5A 4GNXB 3AU7A 2WGSA 3A4SC 1LUZA 2F0IA 4W9JA 1OXTA 1IUEA 4GOCA 2MFIA 4HKZE 1ILQA 1RJTA 5AJ3Q 2WAQE 2F1MA 2LXKA 1YJJA 1SNPA 3DBHB 4BY7B 5LMUQ 1LTID 1F2YA 1R4PB 5F2DA 1HTQA 3Q6SA 3T51B 5FK9C 1EU3A 1VQ5A 4NNJB 2RBMA 1OEYA 1VZ6A 3RULA 1DOXA 3IXSA 4RWSC 1SNOA 4KSLC 4JWSC 2ZPNA 4DHJB 3MC0B 1X3FA 3IAYA 1FGUA 4CYEA 3MEFA 1WSPA 1PDQA 2Z8LA 4HCEA 4IUVA 5JJLA 4A3OA 1MJDA 1FO4A 3C46A 4ZYNA 3ICEA 2MLBA 2RCFA 2ZJPA 2XTIA 4NDXA 2CU3A 1QT9A 2EJGC 2LZ6A 3QWNA 1DCZA 2WNMA 3PQIA 2AQ3B 4A3DB 4HXDA 5K36H 3BDLA 2IO0B 2N78A 2DBYA 4KN7C 2GVBA 5E7NA 4TKNA 4H44C 5IGBA 2B2TC 1PFNA 2QW7A 4CDEC 2KKCA 3PLUA 4FXCA 4EEWA 3GTOH 3UQBA 3DQVA 4LK1C 2K6QA 2K75A 2X69A 5ELEA 1EF5A 1C9FA 1ZOYB 1S5ED 3RN9C 1T0QC 3T3OA 1RAXA 3KF6A 1XX8A 1KHIA 3MC9A 3C8YA 1N36L 2Z9HA 3QWZB 1LYLA 3VA7A 3EC8A 2WLBA 1PTOB 1SE3A 4FJVB 4YWLA 5DPRA 3A5UA 4HLEA 2E5LQ 4DV6L 4A3IH 3AXCA 4DN4M 1E3PA 1HEZE 2ZTDA 3U52E 1K52A 2I1KA 4UP7A 4IALA 4R1JA 2IY5B 3TJPA 4DWFA 4IJHA 5JVH3 1WTXA 4EOYA 5IGFA 1KAWA 4KJNA 5LHY1 4IFDJ 2ZW0A 2OQKA 3GTJB 3S14B 2NPTB 1EZ8A 5KNBA 1UE5A 5K36G 1EYGA 4DR4Q 1BCPB 4UP8A 4C3JG 5FLMG 5I2YA 2M9VA 3N32A 2HJ8A 1KTKA 4A8XC 2GLSA 2WWZA 4JV5L 2PIAA 3C3LA 4BKTA 4HAEA 2BW2A 3H3VH 3R2IA 3DBLI 4ULLA 1QQRA 4E74A 2IW3A 2BH2A 3CPFA 1C4AA 4XC2A 2CHBD 3UI2A 4G0NB 2FMMA 1QVCA 2MBQA 5L83A 4LF5L 5IGCA 5IAAC 2ZCBA 3J81i 3M4OB 2UU7A 1VQHA 2L4NA 4JW0A 1EY7A 2ZXOA 2IPKD 4AQYQ 1YJ9A 4I7ZC 2Q2TA 4JYAL 2N1VA 2HDLA 1I94L 4LFCQ 3PHXB 2WXQA 2JN4A 2F0NA 4A3IG 3PZ8A 3OSOA 4G50A 4J6IA 5HI1A 1G51A 1P16A 3T4AC 1PGBA 1N6ZA 2MW5A 3AE6B 4GKJL 3N20C 4DK5A 4USAA 2N55A 4XYQA 4ID6A 4A93H 1RFAA 5IP7H 2DAJA 2X8XX 4X57B 1HZ6A 3VYRA 2ES2A 2Z0DB 2B2VC 1HFGA 2DN8A 1E8WA 4PS3A 2XNAC 2BA1A 4CJ1B 3FRPB 1SMXA 3DVNV 1IW7C 4MELA 1T3QA 1ZDXA 2NZ1D 2NB0A 2IX1A 3HOWB 3DEOA 2EPBA 3HOVH 3T3NA 2CQOA 2JA8B 2JSVX 4IUNA 3J7A5 1TIFA 3KUDB 2WU2B 3EROA 2L00B 1CFMA 2LXJA 2PMZE 2L12A 4JG2A 3UDGA 1J5EQ 4IFDH 1EY8A 5IP9H 2JYTA 3SFDB 4NKLA 2JA6B 2KHJA 3TZDA 1PH6A 2KACA 1EQTA 3U50C 3I4NH 5J17A 2BE5D 3VR5A 1EL0A 2B63G 1ET9A 1JWBD 2AL3A 1Y8NB 4NAWA 2JWUA 1WXMA 2L52A 1GKHA 3PCOB 1ET6A 2F0VA 2KEDA 4DR3L 2WXMA 1GUOA 2IGGA 2KQSA 5DPSA 5IYBH 1K3BC 2K22A 4K3CA 1CUKA 1ONLA 1RDPD 1X65A 1TU2B 4A93G 1UWXA 1SE2A 2MRPA 2MGSA 5HGQA 3R7QA 2R3ZA 1VQJA 5G3LF 2MJDA 2G3QB 4OZBA 4CBVA 2DZJA 1E0BA 3SK5A 2EY1A 2R92B 1E1OA 4EZJA 2F0PA 2GI9A 4WRDA 3H09A 3HOUB 1K8RB 5I9PA 1R4MI 1STBA 1PH7A 2ZXPA 3QO2A 1PH3A 2GB1A 1AE2A 2BYTA 5IGEA 4QIWB 1ZKOA 2B2UC 4YWMA 2XK5A 3W5VB 1NCVA 4IFDG 2M17A 4X3UA 1R9TH 4WWOA 4RCNA 2L55A 1RM6C 3NS1A 5EE1A 3VHTC 3MHSD 3I4NG 1ASYA 1I6HB 3VYSA 3L54A 1ILPA 1PGXA 1GD7A 4KJOA 4FHKA 3B2FA 1JALA 4KGSA 1TBEA 2M0AA 1I3QH 1LO5D 2I07B 3P7JA 5IYBG 2KMAA 4DV2L 2LUEA 2V3NA 1FJGQ 4OWXB 3DUZA 1R4QB 2L9HA 1U4PA 1WTVA 2ZNVC 3R3MA 4Q2JA 1CQFA 2PLPA 1CA6A 4A3GB 2M56B 1HR0L 3I70A 1H9RA 1N34L 2PW9A 2KCNA 2R93B 5GAHC 4CKBA 1ICFB 5HHDG 1FGBD 1YJ1A 1DOYA 4K8JA 4H2AA 1YMHE 3I56A 3DBRI 2PQAA 3ERSX 1ZGUB 1GJXA 1VQFA 5AFWA 5FO8B 1GHJA 4E6IA 4IUUA 4XT1B 5FJ8G 2ZM6Q 2Z6KC 4H02A 2SOBA 3WWVA 4GLXA 2EXZA 1NMFA 1VQEA 4C3IH 1EWCA 2JA7B 4X3TA 3BY4B 1V1PA 2NBVB 1OXVA 4LUOA 2OCEA 4NPSA 1F1HA 2K9XA 3PTFC 1FXAA 3V05A 3CCQA 1H9SB 2UU9L 5CHWA 4BY1H 2ATWA 1GG3A 3J81L 3PVLA 4GDLB 4A3FH 4XE0A 1GUNA 4OWTB 2OJWA 4HROA 3NBIA 2WKCA 1S5CD 1YN5A 1V1OA 3NEMA 3SHQA 5EKLA 3S2HH 3G7LA 1VQMA 3I72A 4RF1A 2MBEA 2MPMA 4XXEA 2JA5G 3CQZH 4OVVA 2BVCA 1FD7D 3QIJA 2OEOA 3VUXA 2D07B 5IO9A 3E3XA 3ULJA 1HTOA 3FP9A 2BKFA 4HPPA 4MJSB 3MZ5A 1NVID 3EJIA 1LLRD 2K5WA 2K04A 4O0AA 4C3HB 3L2PA 1N33Q 2KOXA 4JL9A 4YSYB 1QG7A 5FR3A 3ENEA 2CKZB 4FXDA 5EBCA 1TT5B 1EIFA 1WJ6A 4LFAQ 4C3IG 2KD0A 2YV5A 1X3GA 4GS3A 2B3GA 5M5XB 1YD8U 2LXCA 1PTOF 2HIVA 2QGQA 1YI2A 3BZCA 4TV3A 1WJ4A 3H3VC 4BAXA 2ZJRA 2HQEA 4OIJA 4TKOB 3FILA 1PRTC 3K5NA 2R7DA 4BY1G 2ICEC 2Z0SA 2NVUI 2ZXRA 4BBRH 2PQEA 3QIAA 4A3FG 4LK0M 4REZA 3B6YA 2X6GA 4BKSA 1B9NA 1G6ZA 1JWSD 1WXVA 1Q12A 4OX9Q 3A4RA 3PPAA 3Q14C 5GAGC 1IBKL 3TN2A 3V62A 3NBHA 5IOIA 4KD3A 5LMNQ 2K5PA 4X62L 2RR9A 5JVG3 2C7MB 2K01A 1CKNA 1JJGA 4OO1I 3QOLA 1L6VA 2IO3B 4X3SA 3TL5A 1BO0A 1I4HA 4A3LH 2RA4A 1XPUA 2AUJD 2N49A 4A75A 2LJ5A 3HKZE 4MM3A 5DCNA 5KHQA 3DMUA 5CBAE 1L0XB 4IUPA 5I4DA 1D3ZA 4EQPA 2UUAL 3I4MB 1GUWA 3DHIC 1I4QA 3S2DB 2Z59B 4DGZA 1D5MC 2L11A 1OTRB 1I35A 1JE5A 3I90A 2EY5A 3AB5A 2PZWA 2WAQG 5KEEA 2X6LA 3RNGC 5G5GA 4BBRG 4DV4L 2K1FA 2UWQA 5CORA 3GE8C 2OJRA 3VAWA 3VYTA 3H7PA 1XMQQ 3PSEB 3W1GA 3ML8A 1X3PA 3UDIA 5CC4A 5K5PA 4MT5A 1LV9A 2V9HA 3H94A 4Y7NH 2JF5A 3WCQA 1BDOA 1RHPA 1HZ5A 2UXCL 2KA7A 3AH7A 1SNMA 1GAQB 1HNZL 1HE8A 3UF8A 2R61A 4FXKC 2RGFA 2VB3X 3P1MA 1EY0A 4JI4Q 1IZ6A 1LTRD 4K81A 1IBMQ 4LUZA 4A3LG 2HE7A 1STGA 1VQBA 3D0FA 1U4MA 4IPDA 4JI5L 2I2YA 2K5DA 2RSUA 1XCTL 3I9V1 2OXPA 3MEHA 4DAYB 1C1YB 4RKBA 1HH2P 2MWSB 3GP7A 4E3CA 4DAVA 4EKUA 2J0MA 3KH0A 4IDIA 3U4VA 1AZPA 3TCAA 2J4XA 3U9SA 1Q1OA 3ZRFA 1JT8A 4B3TL 1UELA 1BBUA 1VRAB 1B2TA 4ANWA 1UD7A 4WJQA 4AP4C 2NN6H 3KDFA 1JORA 2EIFA 3KUCB 2YTVA 4ZKBB 5JPNC 1MHHE 4QMGA 1SJED 1TKWB 4P6VF 2PYKA 3H0GG 3W1SA 2M2LA 1SYDA 3QARA 1ZW7A 5IKCM 2VQEQ 2VH1A 1HNXL 4HJ9A 5EJWA 5FOBB 3S1NH 2JPHA 4NQLB 3CHBD 3H6MA 2KMMA 3PMFA 1X1MA 4GGQA 4AQ7A 4K14A 2PI2E 2EY2A 1L1OC 1LT6D 3DWQA 4UPAA 3V61A 3ZW3A 2KXJA 4NPNA 2L15A 4DFAA 4A3CH 4HIKA 2JXTA 3I3TB 4QB4A 3S15B 2K3UA 3PUVA 2ZW1A 4UY8C 4KIKA 1A0IA 1VQOA 1LXDA 4ZQ3A 1WTOA 3RZFA 4KSKC 5IYDG 1RD9D 4A90A 3TEWA 1E8YA 5CX3A 5CV9A 1V6EA 4I6PA 2DUDA 2LFNA 2KC2A 1SROA 3V96A 3L13A 3D4RA 2MHJA 2NN6G 2V4DA 1STEA 5DEHA 1P8LA 2X38A 3OWFA 4NZLB 5C4JH 3S1QB 5KNDA 1FXIA 5GADC 1NENB 3HOYB 2I5HA 4C2MB 3SE0A 5C3XA 3N30A 2O6VA 1SSOA 2F0DA 4HMJA 4BZAA 5CV4A 2FCQA 2BTEA 3J7AV 3STBC 4EQ5A 4B0MA 3ITPA 1Y1VH 1PH8A 3R8BA 1K8OA 1IKLA 1KLGD 5C5LA 3QOJA 4WH4A 3RN2A 4WQOB 2PZTA 1SXTA 4WAFA 3PO3G 4JI3L 3TREA 4IOCA 2BWES 4EZLA 4BWGB 3PHWB 2XN9C 4M0WB 2R7ZG 1I4PA 1TQOA 3LWUA 3MTNB 4LNNA 1L0VB 2M8SA 1WCMH 5BO4B 3OW7A 2LVQA 4IW0A 3U58A 3S1NB 1TWGH 1V9JA 3ZQ4A 1VQ8A 2ZJDA 5TR5A 4DXAB 1C4QA 2PCFB 1VR9A 2A5UA 1PV4A 5M3MB 4GZYC 4A3EG 2N9PC 4BA2I 1CHQD 3H91A 2FIDA 3N9YC 3Q3JA 1H9MA 1VQ7A 2W82A 1VQAA 4DDID 3S24A 3PUXA 5ELCA 3K5OA 3EFXD 5DLQE 4HMIA 4DR1Q 2CHZA 3MFGA 2IHEA 2JUOA 3A7LA 2ZTEA 3KQ4A 1NAPA 1RL2A 4J6HA 2F0OA 3VR2A 3A8KE 1I42A 1HQMC 1PZID 1Y1VG 2NWGA 1EY9A 3UE0A 4HPMB 5KRUA 1HPCA 4P73A 3OIQA 1Y8PB 4HIDA 4GKKQ 4XWTA 1EFID 1CA5A 1KL9A 1SYCA 4S3SA 4LF9Q 1A15A 4B3SQ 4HJGE 4ZUJA 3K81C 5C3JB 3A54A 3I4OA 5C44B 2PNRC 4G7ZC 3DBLB 3GTLB 4GLAC 1XNRQ 1V97A 2CWAA 4XWWA 4C56C 4RNAA 4GOPB 1BVSA 4DV3Q 2BYVE 2VZAA 1EYDA 4YCVA 3AMUA 4IFDI 4A3BB 2RDFA 4PNYA 4HJ7A 1ENFA 4JI8L 5CMDA 4KI0A 1W6JA 1NI3A 1X3QA 1KDCA 2MJEA 3DLLA 1QF6A 1P1AA 1FNWA 3RZWC 3RN5A 1C8CA 1PGAA 1R4NI 1XT9B 3BIID 2L7RA 4ICUA 5I2XA 2C5LC 2AUKA 2ENBA 3IAS1 1VQIA 2ZTCA 4I6LB 2INPE 2TSSA 1HQRD 3RZDB 1HCZA 3GTQB 4FF4A 1VCBA 2BB5A 1KF6B 2C7HA 1TWAH 2GVAA 4FF1A 1I6VC 4BBSH 5KYLA 1JOOA 2AHOB 1STNA 2CCZA 4JI7Q 3GV3A 3Q8FA 1GJZA 2AYOB 4R4CA 3A0JA 1SYFA 3GTGH 3IT4B 5BMHA 5IN7A 1K8MA 1JC7A 2IO1B 2E2HB 2LD9A 3GTMH 3I2ZA 1LTGD 4X66Q 3PS6A 1PQSA 2KJXA 1CI3M 5BR8Q 2F03A 2KWVB 3S1MH 3DDCB 3HOXB 2JZZA 3KJOA 3CXCA 1KNAA 3G6JB 4LAAA 3A1QB 3AE8B 1V43A 1EOTA 3FKYA 1EM7A 3VR6A 4MDKE 1J9OA 2CWPA 4IO9A 5M3FB 4KGRA 1E7VA 2AKWB 1Q10A 1IW7D 4ZAIA 4R3DA 3RMKC 3KLSX 2KN4A 5FLXL 1B50A 3P42A 3JYUA 2WXNA 4L63B 3NUHB 5I6WA 4XQNA 3CC4A 3AEEB 3HHMA 3VQIA 1HZ9A 3CRLC 5D6JB 2EDGA 2KZRA 4DAMA 3QJYA 3J80L 4A3JH 3S1RH 1E1TA 4LF8Q 2G45B 2H88B 1RF2D 1Y8OB 2K25A 3Q8BA 3SDLC 4LJPB 1BBWA 4FA6A 1C79A 3E0EA 4IN3A 1FIQA 1Q90A 1FVIA 1VQDA 3OMGA 4HSVA 4KKTA 2WDVB 2WP9B 3CIRB 2N0SB 5EBDA 3LGJA 5C3EH 1TWFB 3FKIG 2XIWA 4KKIA 4QQBX 4NJ7A 1R4MB 4ILWA 2WACA 3DXJC 3LJ3A 3NHEB 3RUZA 3KLWA 3JAME 2WDRB 3A9KA 2NBWB 3LDZE 2JVCA 3M3YH 1JICA 2MBBB 4DAPA 4BXXG 4B0EA 3ONAB 3HOZG 2WKDA 2V4IB 4FNFA 2HDEA 1MJEA 2DJGC 3JSVB 1NYQA 3D4WA 3IL8A 1TS2A 2LVOA 2K05A 4APVA 4GN3B 1XTCD 4IUMB 4JLCA 1KNEA 4HTHA 1OQYA 2LUMA 3PZDA 3RFZB 2EJMA 1TTNA 1UAPA 2R2OA 3OHXC 5IGGA 3BVMA 3NVWA 2A68C 4MGYE 4C4VA 4QAYA 5LL6X 3A9JB 5C3EG 3ZUNA 2NYZD 3DBRB 1XPOA 3J9CA 2KNBA 1QOAA 1WFYA 1FNVA 4DQOC 2J52A 4II3B 2A6EC 3MXNA 3H8HA 5JZEB 3T56B 4BY7H 3LNNA 1WMHB 2Q5WD 3HM6X 1F9JA 4FN2A 1TS5A 5T1GA 3URYA 3DWAA 3D6CA 4NQKE 1DOKA 4JBJA 3G6EA 3VR9B 1UUPA 1TWCB 1VF7A 3HKZG 3D4DA 5IYCH 4L23A 4K2LA 2HIXA 4M01A 3EFUA 3NS8A 4RKLA 3AMZA 2K4KA 1VQLA 4NW2A 3DWGC 1PYBA 3E56A 4WJPA 4BFRA 2KT7A 1N36Q 1TKYA 3OPOA 4XX5A 2EMTA 2E2JB 2NVXB 4CKCA 3AEAB 4A3DH 4MZ9A 4DV6Q 3QQ8B 2E76C 2CU1A 2E2IB 4P1CC 4J1MA 1JRPA 1MBYA 3P2BA 1A3UA 2R7FA 4G57A 1JROA 1P7EA 1D4BA 4H13C 4WFN3 4P2CB 2DYBA 1T6BX 1XLPA 1BQQT 3QAQA 4KDIC 3FVQA 2HD3A 4RGNA 2MP2B 2ID0A 2VUMB 3HGBA 4K6LA 2PPHA 2D11A 1F52A 1MPEA 1Y1WB 3HK0A 3Q2AC 3LX0A 4MNOA 3FPPA 3RLFA 3T1HL 4QCLA 1PTOH 1L5PA 2CR5A 5E6NA 3SU8X 4UHVA 3ZXRA 4JV5Q 1A3VA 4HEA1 1GB4A 4ASWC 3TBIB 5HY6A 2WXGA 5IYCG 2KFKA 4DXFA 2UUCL 2REXA 2WYQA 2FCSA 1FM0D 5HG2A 3TP8A 3NVYA 3J7ZC 1P7FA 4LF5Q 3NZUA 1SJHD 4IQZA 4K1RB 2RPVA 2ASQA 4N58A 2LMCB 3WAOA 2FCNA 4JYAQ 2KHSA 3GTJH 3S14H 1I94Q 3APCA 3A33B 4KLKA 1AFPA 1P98A 2MBOA 3NJTA 1DD2A 4C00A 1IBXA 4GKJQ 4AYBB 1ROEA 1I4RA 2JXXA 3PO2G 1IL8A 3I7FA 1XNQL 3KVFB 1PRTD 2JP1A 3ZJTA 4WORA 5A2QE 2L8JA 1UZXB 4OGQC 3Q3FA 3BK2A 4OL7A 4JGHB 2BS3B 1KIXA 2SNSA 3SEBA 1F9PA 3L3OC 2KWCA 4YTMB 1JQYD 3M4OH 4FBJB 4HVBA 2R6GA 1SE8A 3Q8DA 1SNQA 4YTNB 3CWIA 3PIPA 1ICWA 4N9F4 1X3EA 2K5HA 3IKJA 3CW2C 4R4QA 5FO7B 4X6AH 2IDYA 1WVLA 1IL2A 4CHKA 1SIJA 2XGTA 4HEDA 1V8CA 2D0PA 2EYHA 3P20A 3BK1A 1CZWA 2OWOA 2L3ZA 4P75A 5KNCA 4G7HC 4M1UB 2GN5A 4LF7L 1Y69U 3T16A 3L4PA 4DR3Q 3O65B 3CF5A 3VRBB 2WB1E 2NN6I 1H9KA 4O42A 2RPQA 4L5QA 1O7LA 3HOWH 1TR5A 3NTKA 1TY0A 2JA8H 4ODGA 3S16B 2Q2UA 4RH6A 1EZ6A 1QLBB 1WY8A 4G4KA 2K32A 4U68A 3AEFB 2KVMA 4CKEA 3ND9A 3DVNU 4DDGD 5HKHA 5C4ZA 3AFPA 2JA6H 2D5GA 4DK0A 1MHXA 1WR6E 1G8ZD 5IIFA 4DUYL 3MXGA 4DUZL 1MG4A 3I55A 1XCQL 2MBHA 2I5MX 2LEKA 2WS3B 2Y3AA 4CQNA 3A55A 1E2ZA 1IBLL 1J7BA 4FVMA 1ZXIA 3PGZA 1SFOB 4KHPL 3VTVA 5HFYA 1RKNA 3ONSA 2N9XA 2QF7A 4KY5A 5IOCA 3RNFC 1OFFA 3IHPC 1TT2A 4RAUC 1HNWL 1Z6HA 5IT9c 2K39A 5A2QL 2R2QA 4FLHA 4JX1C 3M4PA 2C7NB 1D5ZC 4OIKA 3HFZB 1T5EA 2R92H 5C4HA 1YX6B 1YQ4B 3UIOB 1GVPA 2WU5B 1KLUD 2Q2IA 4DV2Q 3HOUH 3HOWG 1KM7A 3OMCA 2PZUA 2MNAA 1JRUA 4EFOA 1OXUA 2MH7A 3RZOB 4GLVB 2JY6A 1SE9A 4GN1A 3K6OA 5COYA 1HR0Q 2OTJA 2EYOA 3A74A 1N34Q 2KTRB 3CU7A 1VS0A 2YTYA 1YNJC 1AW7A 2JA6G 1FL0A 1YNTE 3K9PB 3RI7C 4AUQC 4BBNC 5GAEC 2RHSB 4GNXC 2ZJQA 1I6HH 3FAHA 1DM0B 2E8GA 4OVUA 1U4LA 2F0HA 4C3JB 4DNIA 1L7YA 3ZRCA 4FDBA 2XEWA 1RIPA 1EOVA 2VL6A 1WGRA 2L83A 1QOGA 2QCZA 3PV0A 1VQ6A 1VDZA 2BA0A 3A5ZB 2F4IA 3F1ZA 3OTOL 4EE2A 2A6HC 3R66C 3ER0A 4A3GH 2LI5A 2F0SA 2VNUD 2CW0C 5AZHA 3WA0A 5CGKA 2V3SA 4LTUA 4CDCC 3CRKC 2R93H 2W9NA 4G11A 2JXMB 3K5MA 4US9A 5FR6A 3SR6A 3TS2A 1JMLA 1TKEA 2NVYB 1VLBA 4R4TA 1B4OA 1J19A 1VF5C 1EWHA 1QZGA 4HPLB 5IP7G 3CCSA 2YEPF 2UXDL 1I4XA 2Z4IA 2OEDA 4M02A 2ZPYA 4RGMA 2JA7H 1X9NA 1LQBA 3TQYA 1WD1A 4EZKA 1K8GA 3J81E 2KWDA 2PW7A 3HG9A 3VR8B 1A2UA 1N9WA 5LMNW 3HOVG 1K28A 2WIIB 1KDBA 4OWWB 1NDDA 5DM73 2XRSD 3JAMc 3AU5A 1XEEA 2Q2HA 3HVDA 4XGAB 1LABA 3STBD 4DR2L 1Q1EA 5IP9G 1EY5A 3G71A 4F8CB 3KOJA 2B76B 4G3XB 1PTOC 3OLMD 4A3MB 4WWNA 1FFVA 1ESFA 1J8IA 2B63B 3CPWA 4JC0A 2NVTB 2L32A 2WFWA 3UDXA 2MP1A 4LNIA 5IWAL 1S5FD 3HIZA 3PT2B 3EVQA 3ZTDA 2HUGA 4C3HH 4B3RL 1LT5D 2WP8J 3KF8B 5GXGB 1X32A 1IBKQ 2LS01 4O1NA 2HD5B 1BCPC 3DBSA 2K0PA 3PO0A 4W9KA 1JQ4A 2WQYB 4X62Q 3IG3A 5M5XH 2A74C 1WD0A 1VJKA 1BKBA 1WGGA 2BB6A 2INCC 2NMQA 2V3PA 1NR2A 4HJ5A 5M5WB 3LYYA 1EY4A 3K7AB 3RCZA 3QX1A 2FMCA 1B3AA 3GD7A 4K8IA 1KC8C 1FXTB 3MAQA 1LTSD 3GZNI 1IP9A 1Q1BA 4Q0FA 4LNQA 1CMXB 1H95A 3GTPB 1GUTA 1GC6A 1AYFA 2UUAQ 1WGHA 3FPUB 1R4NB 3I57A 4KTAA 2YU9B 1NTGA 1XWEA 5M5YB 3W2DA 1NJIC 1YNNC 4WURA 3HZXA 3RLNA 1EEFD 2VQFL 4DV4Q 1RRBA 3W1SC 4ZDVA 5G2NA 3QHTA 1QB5D 3LWEA 1J5EL 3KYDD 4KKJA 4MH8A 2G4DB 2N4FA 2KBNA 2K50A 3T8MA 1T5XD 2EOTA 2KUMA 2VXWA 1QUQA 4EVOA 3OAWA 5DPWA 4XDXA 2GBNA 3AM9A 3I4MH 2UXCQ 4DHZB 4FJYA 3S2DH 1X56A 4XDDA 1IKMA 1HNZQ 4RA8A 2F0LA 5KGUA 4J3OD 4GNXA 2YYZA 3QJZA 3DCGA 3PUZA 4WJ3M 2K5NA 4JI5Q 4ZRJA 1QZEA 1TZ1A 2V4LA 2NVQB 3I63C 2FUHB 1WH3A 3QCAA 1K3RA 4RCOA 4IM3A 2WXRA 2DY8A 4LNFA 4B3TQ 1MSHA 3U9OA 1SYGA 2M00A 2Y5BB 2G4SA 2RDGA 1M8AA 3J7YW 1E9MA 3K9OB 1D2BA 4WWMA 3DEPA 3DM1A 3G4SA 3P4PB 4LUVA 3AECB 3AFQA 1QNUA 1WJJA 3ZGZA 2YVCA 1UNSA 2DHZA 2LGSA 4YY3L 4P7IA 2A5HA 1GUGA 3C1FA 2B29A 2KVZA 2D5DA 4IPGA 1PLFA 1HNXQ 1L1OB 4W9FA 3RD2A 3RNBC 3EN2A 2EYPA 2IX3A 2AWTA 2JA5B 2WHIA 1ISNA 2RDHA 1A2TA 4AOFA 4CDFC 1WX9A 4DXGA 4PK1A 4BS9A 1WTRA 2MJ3A 2KFJA 3CSFA 2XWJB 4R4IA 3AEGB 2F3VA 3ZXVA 2O4XA 1G2TA 2N9EB 2A69C 3NSWA 1PH9A 3DOWA 4MEMA 4PT5A 2XBBC 1IGDA 1Q3LA 4TRDA 5D3IB 2FBWB 3CF6E 4DV1L 4IM0A 1K50A 1OO9B 1GOZA 4GN4B 2Q8TA 4X64L 2OT2A 2LGDA 2O2VB 5GMVA 4BVUC 2PI2A 1MI0A 1CKOA 3ALBA 3U30A 1CSPA 1AARA 1HHVA 1XLQA 2XSCA 2K5VA 2KLGA 3BVZA 3NK9A 4N59A 4B08A 2CFMA 1O7YA 4K7WA 3QB3A 1S4ZA 3NRZA 3VH3B 1NBFC 1FCLA 3IT6B 3VR4A 3S15H 1AE3A 1E90A 3PZ7A 4IJLA 1LT3D 3PF4A 2C5CA 3BYYB 2OF1A 2NPTA 1EQVA 1LFDA 3AE3B 1UF0A 5E4XA 2KQ4X 2Y0SB 3NXWA 3DVGY 3RPFC 4PMCA 1Q5WB 4JI3Q 3SDZA 3KW5B 5ISRA 2KTFA 4YIJA 3VXWA 1DOIA 3S1QH 4AYBE 2OTLA 1ZKHA 4XYOA 1BR9A 3HOYH 3NVVA 2LRWA 4C2MH 1IYVA 1CT1D 1E7PB 1V86A 2LFIA 2LGXA 1GUAB 2JJQA 1RTOA 4B3ML 1ZE3D 4C80A 4RGOS 2BBCA 3MFYA 5E6PA 1QOHA 4F87A 2J42A 2Y5PA 4JBMA 2PMVA 4A9AA 3PSIA 1D6EC 3AE1B 4PZ8A 5IP4D 5EE9A 2WB1G 5EKKA 1WM3A 2BPSA 1PYWD 2RVLA 4JPBW 3CMMB 4L1BA 2G9HD 3Q69A 4LJZC 4R8NA 4DK6C 3AULA 4ZRKA 3V3XA 5CV5A 1K83B 1I50B 4K5XA 3BWUD 4YSZB 3I91A 4ZK9B 1VQ9A 2WXHA 4XYCA 4GDKB 2EKEC 2QEJC 5M3MH 3PIO3 2DENB 5DAUA 2SDFA 2VZKD 4AJYB 3LXFA 1PRTF 1ZYRD 1ML0D 3G48A 4MH0E 4P72A 4NXNQ 2D0OA 5EDSA 4WWPA 2M0XA 2DWQA 3CSTA 3X0WA 4OX9L 1B70B 3UIPB 3FDTA 2E75C 4QY7A 3SK8A 2ZCCA 4YTPB 4OHJA 4TVAB 4BKGA 2QDBA 3TEYA 1B9RA 4JI8Q 2LASA 3Q8CA 2AWOA 2B2WC 3NENA 5JOBA 1QVFA 4PYZA 4YSXB 1EYCA 1H9JA 1TWHB 4K3BA 4OW0A 1EYAA 5AZFA 3TUOA 1PVOA 3Q0AA 3Q3OC 4MSQB 4CO7A 5G5HA 3M62B 2BE5C
chains in the Genus database with same CATH topology
1SNCA 3A7AB 3HRZC 2PTLA 2BS4B 5D7GA 3IAM1 4NAMA 3H0GB 3KLSA 5E4WC 1PFMA 1C76A 3ZJVA 1C78A 3TP6A 3M7NA 5CV8A 3ERQA 5T8IA 1O7ZA 4RGTA 2LY7A 5A35A 1OXSC 2N7JA 1GHKA 4Z9CB 3WDNA 3TZUA 2F0JA 2LJIA 2H89B 2QCPX 3EA6A 5C6AA 1E0ZA 4A3KB 1TJEA 5BN3A 1VMPA 4V0BA 1SYEA 3MTSA 1SYBA 2I38A 1BBXC 3TMEA 3GV6A 4EQNA 1W6KA 4AS1A 4UDUC 2E74C 4ZUIA 2L0CA 2WXKA 5FLXE 3HP3A 2L5TA 3PO3B 1QE6A 2ON8A 3TP7A 3J80E 5JJZA 2WINB 2R7ZB 4R8IA 4UAIA 2MHVA 3VR3A 1TYGB 2H4OA 2H1EA 4N9PA 1ZP0B 1H9SA 4A3EB 1XLNA 4HSPA 4BA1I 3B9JA 1CZGA 2JE6I 4IUQA 1O78A 3NHHA 3GO5A 2L1BA 2B39A 1BOSA 5E3FA 3KK7A 4ZYSA 1QCBD 3E0JA 3ND8A 1C77A 1PFDA 1TS3A 2J0TD 5NUCA 1RYJA 2K28A 1CJEA 2JYEA 1CTMA 5JAVA 4XT3B 5BN4A 4DU9A 5BYQA 5LL6S 5DM63 5C4XB 1VCIA 1JWUD 5ELBA 1SNDA 4RHSA 3FEWX 4L8JA 1YNJD 1YQ3B 3P4QB 2O5IC 1GPXA 3N6RA 3NQIA 2G1EA 1ZEQX 1FRRA 5EPKA 2B2WA 1LT4D 4MHEA 1F9SA 4NMZA 4FO2A 2A6HD 2FHTA 1GXDC 3NVZA 3Q8EA 2KECA 2JSOA 2CW0D 4EQOA 1JCKB 1BMLC 1WTPA 3SHLA 1WTQA 4TQUS 4CGYB 3W3AA 1NYRA 4K2KA 5CV6A 5IGDA 4NAWB 1F77A 2BDNA 4HN7A 1DGJA 1EIGA 3P4SB 1TIID 1TS4A 4N6EB 4WJWA 3P75A 5KYIA 1PUTA 1STAA 2E2DC 3AB9A 5IT9L 1N62A 3DWMA 1NYQA 1F2LA 3TP5A 3IFDA 1AWDA 4QUFA 3ETRA 1D1IA 4X3KA 2F0UA 5JXVA 1QOFA 1SMYC 1J7AA 3FKIB 4PQXA 1SE4A 3E5SA 1L4DB 2YEPB 1C48A 4DAYA 4CJ0B 3S17B 4A6QA 3AE4B 1BCPD 1ZPSA 3GB1A 3HOZB 1K51A 4FP5D 4FYDA 2A73B 5J22A 3NUCA 4OO1H 1E2VA 3P4RB 1F9RA 3BG3A 1SAPA 3V2TA 3HS0C 3NPPA 1TVXA 3AE2B 3PUYA 1N5WA 3AV8A 1Y56A 4KK7A 1BF4A 5MPOA 3BVGA 4YT0B 1YNND 1QJOA 3PIP3 4WIPA 1V1PB 1HA5A 2L1AA 1XO3A 3T53B 4F88A 1U4RA 3NP8A 3Q24A 1HA6A 3M7GA 1NEKB 4D2KA 4EGVA 3GTKB 5C5MA 3P1HA 2QMTA 4IURA 1PZJD 4IUTA 4LLGM 2BS2B 2JZPA 5D14A 3K5LA 3GS2A 4M0WA 5LNK1 1OQQA 2WXFA 2CJNA 3FILB 2XWBB 2KCCA 1YJIA 3BDCA 5I9OA 4V190 5T1IA 4ZLTF 5HGTA 1A6XA 1CZPA 5H92C 1KH0A 2D9UA 1MD2D 4XTCS 1BXTA 2PW5A 2RMMA 2A69D 2QKIC 2SEBD 4XQQA 2K33A 1FYCA 5E1FA 3HVZA 3PO2B 2B8FA 2F0TA 5EKIA 1WTWA 4RHRA 1G91A 1RFKA 4MM3B 3A8IE 1B44D 4IZ8A 4JBWA 2K1BA 3MHBA 1RCVD 2K6AA 2EYJA 1QILA 2WV6D 3BDOA 1SBBB 3HUIA 2W54A 2MUYA 5FKAC 4TQ1A 5CV7A 3D8GA 3SFEB 1I4GA 1MI2A 4F7XA 1EY6A 4FF2A 2QILA 3ABVB 4ZRZA 2J53A 2J7ZA 1ZUD2 2F0QA 3SK4A 3K57A 4OZCA 4K5WA 4DF7A 2B8GA 3MJ5A 2O5JC 2RKSA 3C1EA 1WGKA 2JEAI 4PMWA 3Q22A 5EE3A 5TSSA 3GTOB 2QIEB 1B53A 3RMHA 3NWSA 4A55A 2N88A 2HCCA 1XF5L 2F0MA 3OIPA 1MGSA 1G291 4ABNA 2EZVA 1J7CA 1S5DD 2DYOA 2AWNA 1JB3A 2GA4B 4A3IB 1OQRA 4L2YA 1SB3C 3AE5B 4XIGS 1LACA 3MXUA 1SF0A 1WXQA 1LTTD 4KHZA 2KAJA 3DWPA 3KBGA 4KMUC 5IODA 1O80A 2N9LA 2LHEA 2WXPA 2AQ2B 4KGTA 1KABA 1E10A 1PRTB 1D5XC 1F2ZA 3E9SA 4YXDB 3M4YA 5J39A 3ZYYX 4P16A 4FXGC 4GLSC 1YN3A 4DNTB 2B2YC 2HCIA 4TQ0A 2F0EA 1JW9D 5JEAJ 2KEEA 1IHZA 5AUIA 3NQTA 4A93B 1JE4A 4K6DA 3I4LA 2B2TA 1V8QA 2IT1A 4KD4A 1KAAA 3Q8AA 2EY6A 1WWTA 4CJ2C 2BDOA 3NZ3A 3HOVB 1JWMD 1STHA 5CYUA 1ENAA 5C0XJ 2F3WA 1F2RC 3KUPA 4KHVA 2D62A 2JX5A 1VZ8A 2I46A 1HRJA 3I4NB 1SDFA 2K5QA 3U2SC 3K58A 4QUCA 3BZDB 1HXYD 2ACZB 4C3HG 3PUWA 2W3RA 2INNE 1JOQA 2EYFA 3A8JE 1AEXA 2WXJA 5JEAH 3NWTA 1QOBA 3K59A 4B9WA 1RTNA 3KLRA 1VZ7A 2TMPA 2WDQB 3WOEA 5CBEE 4XQJA 1R9TB 2DNEA 2IL8A 1VDVA 3NTHA 1NSNS 4ZRQA 4KKUA 4OZAA 5BMIA 2LMCA 3HRDD 1L6UA 5C0XH 2FFKB 3KBXA 3KWVA 4Q5VA 1I3QB 3AN1A 2B2VA 4KKSA 2K7VA 3T13A 2RSNA 5EPJA 2O2LD 1JR0D 5JEAG 2OHFA 3EUB2 1EEID 1K53A 2HDMA 1WYGA 3K0YA 1TY2A 1SSNA 1UEAB 2BCOA 4C3IB 4R9WA 1DZ1A 2ICIA 1AN8A 1ACCA 3EGRA 5ELFA 5DNFA 5C2TB 1N5XA 3N52A 1BCPF 5C0XG 2HTME 1EWYC 1AP0A 4BY1B 1QWYA 2B2YA 4A3FB 2EELA 4ZOHC 3SK6A 2KDMA 1DOLA 1EIHA 3FC4A 2NTTA 3S2HB 4ZHOA 2PVOD 4IKGA 2B2UA 1PXUA 4M8AA 3CQZB 2PVGC 1KFYB 3MA2B 4ITKA 1TKGA 1D1KA 2JEBI 3IFTA 2A68D 1SMYD 4JPSA 3W9CB 1ZXTA 1TZOA 2A6ED 5EE0A 1B1ZA 1ENCA 3X3MA 1FFUA 4ME5A 2WAQB 3VYUA 2AX5A 2DYMA 1L4ZB 4BBRB 2IWHA 4I65A 1VMCA 2F0GA 2LGIA 1M4VA 5E6JA 5I6YA 2ZT9C 1GB1A 3AE9B 1AZQA 2FUG1 3W5UB 2Z1CA 4H0LC 3U4EG 3NTIA 2FINB 3D31A 5BYRA 1FNUA 3M85A 4XDCA 4L6TB 1G2SA 1F2RI 3FMCA 1QKZA 3DHQA 3R2TA 1HTPA 2EYMA 5EGTA 1ESRA 1NR4A 3AEDB 4RFBA 1LTBD 3MVVA 3D3RA 4DNRB 3VRAB 2BOSA 4YWGG 2NUCA 1N63A 4MN3A 1C4CA 2IGDA 1L0YB 1I7HA 2DLBA 4PV1C 1FR3A 2WXIA 2WB1B 3E6ZX 2PKOA 4Y7NB 4JK1C 2QSDA 1U9RA 3I8ZA 3I3CA 4KY7A 2DNCA 2IGHA 2EJFC 2JYOA 1PDXA 1F2MA 5M9OA 3BYTB 1PFBA 1Z47A 2W55A 1CQVA 1WRIA 1KRHA 3AE7B 4JE3B 2ONQA 4ARCA 3TEXA 1IBXB 3OOCA 1ZXHA 5JPMC 5EQ0A 4ARIA 4C1NI 2FE8A 1JOKA 3KF8A 5CR3A 3LB8C 2Z4HA 2JU6X 3NE5B 2Q8IB 1BUIC 4HR7B 2VB2X 1HTLD 1DXMA 5BMGA 2LHDA 1MSGA 5D65A 1FRDA 4KY6A 1XYIA 1CK1A 3MXPA 2Y5CA 5G3LD 4MIUA 2F0KA 1IGCA 2AQ1B 2PMZB 4ZKCB 2BT6A 4TSSA 3R93A 3MP9A 5J1ZA 3S9WA 1NUCA 1OXXK 1F0ZA 1E6EB 3B2GA 1HUMA 2IJ0A 5C4JB 1KDAA 2G9DA 2SAKA 2KOLA 2IX0A 3X3NA 1YN4A 2D2CC 1IYUA 3KWLA 1PMRA 3HEJA 3ZJUA 1Y1VB 3QG1A 1C4PA 5EPLA 4DA2A 3CKIB 4K5VA 2N9KA 1F9QA 1PZKD 4HRSA 5IT9E 2RQXA 1DOMA 3WOFA 2QJLA 1LTAD 4C7ZA 2WXLA 1SEBD 4H7BA 3A56A 1WCMB 2M19A 1STYA 3AEBB 2E3TA 2C9OA 1TWGB 1FCCC 1DYQA 3Q23A 4LMQD 1CM9A 2RSOA 4QF4A 1II3A 3SR1A 2EYLA 4MACA 3UI3A 3GQBA 2PPBC 4J8QA 1CHPD 2VZKB 2MEKA 2KQ3A 3TDQA 5HURA 1HUNA 3TSSA 3O13A 2WXOA 3RD4A 4CHTB 4NJCA 4PMBA 4B9XA 4FF3A 4U673 3J7AF 2W3SA 4HCSA 2CVRA 5H8YE 2NTSA 4ZRPA 1N60A 4C7YA 2JQRB 1B9MA 1FMAD 1A3TA 3P63A 1Z7TA 4TMAB 2LKVA 1MVKA 1BUVT 3EQLC 4G7OC 3R3OA 4ZHPA 3OWEB 1PTOD 1N61A 1TWAB 4OVZA 1UGJA 4BBSB 2E6XA 1FEHA 2PO4A 3GTGB 4NP5A 1S5BD 1DONA 2SNMA 4C1NK 5FO9B 3GTMB 5KIXA 5BYSA 5AUKA 3SXHA 3S1MB 1DJRD 2EVBA 2CJOA 2F0WA 4KX6B 2XRQD 3C2PA 5D3DA 1BNZA 1A70A 1GUSA 1E2WA 2V0GA 4DK1A 3U7ZA 5C0XI 1UWMA 2FJ2A 2EKIA 4RF0A 4A3JB 4KV6A 3S1RB 2F0FA 1XXGA 3F2UA 3L7ZC 1JWAD 3MWYW 3SVMA 5C3EB 1HFNA 5C3WA 2DY7A 2XVSA 1ZDVA 2MJ8A 4F8MA 2NBFA 3L9AX 1QNKA 3MHZA 4IOIE 3M3YB 3I73A 3D6WA 3TEZA 1RWSA 1Q8IA 3BS1A 1ZYRC 3JAML 3HKZB 2CQAA 1XLOA 5ELDA 4OO1G 1RODA 1EU4A 1R7SA 4KN4C 2EE1A 4JWUC 1FD6A 4WQMA 4US8A 3VA5A 4N9TA 2Q8RE 2K03A 2GRIA 4HKQA 5BN5A 3AU7A 2F0IA 1OXTA 1IUEA 4HKZE 1ILQA 1RJTA 2F1MA 1YJJA 1SNPA 4BY7B 1LTID 1F2YA 1R4PB 5F2DA 3Q6SA 3T51B 5FK9C 1EU3A 2RBMA 1VZ6A 1DOXA 3IXSA 4RWSC 1SNOA 4JWSC 3MC0B 3IAYA 1WSPA 1PDQA 2Z8LA 4HCEA 4IUVA 1FO4A 3C46A 4NDXA 2CU3A 1QT9A 2EJGC 3QWNA 1DCZA 2WNMA 2AQ3B 4A3DB 5K36H 3BDLA 2DBYA 4KN7C 4H44C 5IGBA 2B2TC 1PFNA 4FXCA 4LK1C 2X69A 5ELEA 1C9FA 1ZOYB 1S5ED 3T3OA 1XX8A 3C8YA 3VA7A 2WLBA 1PTOB 1SE3A 4DN4M 1HEZE 3U52E 1K52A 4IALA 5JVH3 1WTXA 5IGFA 4KJNA 5LHY1 4IFDJ 2ZW0A 3GTJB 3S14B 1EZ8A 5KNBA 5K36G 1BCPB 4C3JG 5I2YA 2M9VA 1KTKA 4A8XC 2PIAA 3C3LA 4HAEA 2BW2A 3R2IA 4ULLA 1QQRA 2IW3A 1C4AA 2CHBD 3UI2A 2FMMA 5IGCA 3M4OB 2L4NA 1EY7A 2ZXOA 2IPKD 4I7ZC 2HDLA 3PZ8A 2WXQA 2F0NA 3OSOA 5HI1A 3AE6B 3T4AC 1PGBA 4USAA 2N55A 4XYQA 4ID6A 1HZ6A 3VYRA 2B2VC 1HFGA 2DN8A 2XNAC 2BA1A 4CJ1B 3FRPB 1IW7C 1T3QA 1ZDXA 2NZ1D 2NB0A 2IX1A 3HOWB 3DEOA 2EPBA 3T3NA 2JA8B 2JSVX 4IUNA 2WU2B 3EROA 1CFMA 2L12A 4IFDH 2JYTA 3SFDB 1EY8A 4NKLA 2JA6B 3TZDA 2KACA 1EQTA 2BE5D 3VR5A 1EL0A 1JWBD 1ET9A 1Y8NB 2JWUA 2L52A 1ET6A 2F0VA 2KEDA 2WXMA 1GUOA 2IGGA 2K22A 1ONLA 1RDPD 1UWXA 1TU2B 1SE2A 2MGSA 2R3ZA 5G3LF 2MJDA 4OZBA 4CBVA 1E0BA 3SK5A 2EY1A 2R92B 2F0PA 2GI9A 4WRDA 3H09A 3HOUB 5I9PA 1STBA 2ZXPA 3QO2A 2GB1A 2BYTA 5IGEA 4QIWB 1ZKOA 2B2UC 3W5VB 1NCVA 4IFDG 4X3UA 4RCNA 2L55A 1RM6C 3NS1A 5EE1A 1I6HB 3VYSA 1ILPA 1PGXA 4KJOA 3B2FA 1JALA 4KGSA 2M0AA 3P7JA 1LO5D 2I07B 2V3NA 3DUZA 1R4QB 2L9HA 1U4PA 1WTVA 4Q2JA 1CQFA 2PLPA 1CA6A 4A3GB 2M56B 3I70A 1H9RA 2PW9A 2KCNA 2R93B 5HHDG 4CKBA 1FGBD 1DOYA 4K8JA 4H2AA 1YMHE 1GJXA 5AFWA 5FO8B 1GHJA 4E6IA 4IUUA 4XT1B 2SOBA 2EXZA 1EWCA 2JA7B 4X3TA 1V1PA 1OXVA 2K9XA 1FXAA 3V05A 1H9SB 3J81L 4GDLB 4XE0A 1GUNA 4HROA 3NBIA 2WKCA 1S5CD 1YN5A 1V1OA 5EKLA 3G7LA 3I72A 4RF1A 2MPMA 4XXEA 1FD7D 2OEOA 1GB4A 3MZ5A 1NVID 3EJIA 1LLRD 2K5WA 2K04A 4C3HB 4YSYB 1QG7A 5FR3A 4FXDA 5EBCA 4C3IG 3FILA 5M5XB 1PTOF 3H3VC 2HQEA 4OIJA 4TKOB 1PRTC 3K5NA 2ICEC 2ZXRA 2PQEA 3QIAA 4LK0M 4REZA 2X6GA 1B9NA 1G6ZA 1JWSD 1Q12A 3TN2A 3NBHA 4KD3A 2K5PA 5JVG3 2K01A 4OO1I 3QOLA 1L6VA 4X3SA 1BO0A 1I4HA 2RA4A 2AUJD 3DMUA 5CBAE 1L0XB 4IUPA 5I4DA 4EQPA 3I4MB 1GUWA 1I4QA 3S2DB 4DGZA 1D5MC 2L11A 3I90A 2EY5A 3AB5A 2PZWA 5KEEA 2X6LA 5G5GA 5CORA 3VYTA 1X3PA 5CC4A 4MT5A 5K5PA 1LV9A 3H94A 3WCQA 1BDOA 1RHPA 1HZ5A 2KA7A 3AH7A 1SNMA 1GAQB 2R61A 4FXKC 2VB3X 3P1MA 1EY0A 1LTRD 1STGA 1U4MA 2I2YA 2K5DA 1XCTL 3I9V1 2OXPA 3MEHA 4RKBA 3GP7A 4DAVA 4IDIA 1AZPA 2J4XA 3U9SA 1VRAB 1B2TA 2NN6H 1JORA 4ZKBB 1MHHE 5JPNC 4QMGA 1SJED 1TKWB 4P6VF 2PYKA 3W1SA 2M2LA 1SYDA 5EJWA 5FOBB 3CHBD 3H6MA 2KMMA 3PMFA 4AQ7A 4K14A 2EY2A 1LT6D 3DWQA 4DFAA 2JXTA 4QB4A 3S15B 2K3UA 3PUVA 2ZW1A 4ZQ3A 1WTOA 4A90A 1RD9D 3TEWA 5CV9A 2LFNA 3V96A 3D4RA 2NN6G 2V4DA 1STEA 5DEHA 2X38A 3OWFA 4NZLB 3S1QB 5KNDA 1FXIA 1NENB 3HOYB 4C2MB 3SE0A 5C3XA 1SSOA 2F0DA 4HMJA 5CV4A 2BTEA 3J7AV 4B0MA 3ITPA 3R8BA 1K8OA 1IKLA 1KLGD 5C5LA 3QOJA 4WH4A 2PZTA 1SXTA 4WAFA 4BWGB 2XN9C 1I4PA 1TQOA 3LWUA 1L0VB 3OW7A 3S1NB 3ZQ4A 1C4QA 2PCFB 1VR9A 5M3MB 4GZYC 3N9YC 4BA2I 1CHQD 3H91A 1H9MA 2W82A 3PUXA 5ELCA 3K5OA 3EFXD 4HMIA 3MFGA 3A7LA 3KQ4A 1NAPA 4J6HA 2F0OA 3VR2A 3A8KE 1HQMC 1PZID 2NWGA 1EY9A 5KRUA 1HPCA 3OIQA 1Y8PB 4XWTA 1EFID 1CA5A 1SYCA 4S3SA 1A15A 4HJGE 4ZUJA 5C3JB 3A54A 5C44B 2PNRC 4G7ZC 3GTLB 1V97A 4XWWA 4C56C 4RNAA 1EYDA 3AMUA 4IFDI 4A3BB 2RDFA 4PNYA 1ENFA 5CMDA 4KI0A 1W6JA 1NI3A 1X3QA 1KDCA 2MJEA 1QF6A 1FNWA 1C8CA 1PGAA 3BIID 5I2XA 2AUKA 2ENBA 3IAS1 2INPE 2TSSA 1HQRD 3RZDB 1HCZA 3GTQB 4FF4A 2BB5A 4KKJA 1KF6B 4FF1A 1I6VC 5KYLA 1JOOA 1STNA 3Q8FA 3GV3A 1SYFA 5BMHA 3IT4B 1K8MA 1JC7A 2E2HB 1LTGD 2KJXA 1CI3M 2F03A 3HOXB 1KNAA 3G6JB 4LAAA 3AE8B 1V43A 1EOTA 1EM7A 3VR6A 1J9OA 5M3FB 4KGRA 4R3DA 1Q10A 1IW7D 4ZAIA 3KLSX 2KN4A 5FLXL 1B50A 3P42A 2WXNA 4L63B 3NUHB 5I6WA 4XQNA 3AEEB 3VQIA 3CRLC 2EDGA 3J80L 3QJYA 2H88B 3Q8BA 1RF2D 1Y8OB 1C79A 4IN3A 1FIQA 1Q90A 3OMGA 4HSVA 4KKTA 2WDVB 2WP9B 3CIRB 2N0SB 5EBDA 1TWFB 2XIWA 4KKIA 4ILWA 2WACA 3DXJC 3RUZA 2WDRB 3JAME 1JICA 4DAPA 4B0EA 3ONAB 2WKDA 2V4IB 4FNFA 2HDEA 3D4WA 3IL8A 1TS2A 2K05A 1XTCD 1KNEA 4HTHA 2LUMA 3RFZB 2EJMA 1UAPA 3OHXC 5IGGA 3BVMA 3NVWA 2A68C 5LL6X 2NYZD 3J9CA 1QOAA 1FNVA 4DQOC 2J52A 2A6EC 3MXNA 3H8HA 3T56B 3LNNA 2Q5WD 1TS5A 5T1GA 3URYA 3DWAA 3D6CA 1DOKA 3VR9B 1UUPA 1TWCB 1VF7A 3D4DA 4L23A 4K2LA 4RKLA 3AMZA 3E56A 4NW2A 3DWGC 1TKYA 3OPOA 2E2JB 2NVXB 4CKCA 3AEAB 2E76C 2E2IB 4J1MA 1JRPA 1MBYA 1A3UA 4G57A 1JROA 1P7EA 1D4BA 4H13C 4WFN3 4P2CB 1T6BX 1XLPA 1BQQT 3FVQA 4RGNA 2ID0A 2VUMB 3HGBA 4K6LA 1MPEA 1Y1WB 3LX0A 3RLFA 3FPPA 4QCLA 1L5PA 1PTOH 1A3VA 4HEA1 3TBIB 2WXGA 4DXFA 1FM0D 5HG2A 3TP8A 3NVYA 1P7FA 1SJHD 4IQZA 4N58A 2RPVA 2LMCB 2KHSA 1AFPA 1DD2A 1IBXA 4AYBB 1ROEA 1I4RA 1IL8A 1PRTD 2JP1A 3ZJTA 4WORA 5A2QE 4OGQC 3BK2A 4OL7A 2BS3B 2SNSA 3SEBA 1F9PA 3L3OC 4YTMB 1JQYD 2R6GA 1SNQA 4YTNB 3CWIA 1ICWA 3IKJA 5FO7B 2IDYA 1WVLA 1SIJA 4HEDA 1V8CA 2EYHA 3P20A 3BK1A 1CZWA 5KNCA 4G7HC 4M1UB 1Y69U 3T16A 3L4PA 3VRBB 2NN6I 1H9KA 4O42A 1O7LA 1TR5A 3NTKA 1TY0A 4ODGA 3S16B 4RH6A 1EZ6A 1QLBB 4G4KA 2K32A 4U68A 3AEFB 2KVMA 4CKEA 3ND9A 5C4ZA 2D5GA 4DK0A 1MHXA 1G8ZD 5IIFA 3MXGA 1XCQL 2LEKA 2WS3B 2Y3AA 4CQNA 3A55A 1E2ZA 1J7BA 4FVMA 1ZXIA 1SFOB 5HFYA 1RKNA 2QF7A 4KY5A 5IOCA 1OFFA 1TT2A 4RAUC 1Z6HA 5A2QL 4JX1C 1D5ZC 4OIKA 1T5EA 5C4HA 1YQ4B 2WU5B 1KLUD 3OMCA 2PZUA 1OXUA 2MH7A 3RZOB 3K6OA 5COYA 2EYOA 3CU7A 1YNJC 1AW7A 1YNTE 3FAHA 1DM0B 1U4LA 2F0HA 4C3JB 2L83A 1QOGA 3PV0A 1VDZA 2BA0A 4EE2A 2F4IA 2A6HC 2F0SA 2VNUD 2CW0C 5CGKA 4LTUA 3CRKC 3SR6A 2JXMB 3K5MA 4US9A 1JMLA 1TKEA 2NVYB 1VLBA 1B4OA 1VF5C 1EWHA 2YEPF 1I4XA 2Z4IA 2OEDA 4RGMA 1WD1A 3J81E 2KWDA 2PW7A 3HG9A 3VR8B 1A2UA 2WIIB 1KDBA 5DM73 2XRSD 1XEEA 3HVDA 1LABA 1Q1EA 1EY5A 2B76B 1PTOC 4A3MB 1FFVA 1ESFA 1J8IA 2B63B 2NVTB 2L32A 2MP1A 1S5FD 3EVQA 2HUGA 1LT5D 2WP8J 5GXGB 1X32A 1JQ4A 2LS01 4O1NA 3PO0A 1BCPC 2K0PA 2WQYB 2A74C 1WD0A 1VJKA 2BB6A 2NMQA 2V3PA 1NR2A 5M5WB 3LYYA 1EY4A 3K7AB 2FMCA 1B3AA 3GD7A 4K8IA 3MAQA 1LTSD 1Q1BA 4Q0FA 3GTPB 1GUTA 1AYFA 3FPUB 3I57A 4KTAA 2YU9B 1XWEA 5M5YB 3W2DA 1YNNC 4WURA 3HZXA 1EEFD 1QB5D 3LWEA 4MH8A 1T5XD 2EOTA 2KUMA 2VXWA 4EVOA 4XDXA 3AM9A 4XDDA 1IKMA 4RA8A 2F0LA 5KGUA 4J3OD 2YYZA 3PUZA 2NVQB 4RCOA 2WXRA 2DY8A 1MSHA 3U9OA 1SYGA 2M00A 2RDGA 1M8AA 3J7YW 1E9MA 4WWMA 1D2BA 3DEPA 3DM1A 3P4PB 3AECB 1QNUA 3ZGZA 1UNSA 2A5HA 1GUGA 3C1FA 2D5DA 1PLFA 2EYPA 2IX3A 2JA5B 2RDHA 1A2TA 4DXGA 4BS9A 1WTRA 2MJ3A 2XWJB 3AEGB 2F3VA 2O4XA 1G2TA 2A69C 3NSWA 4PT5A 1IGDA 1Q3LA 4TRDA 5D3IB 2FBWB 1K50A 1OO9B 1GOZA 2Q8TA 2OT2A 1MI0A 1HHVA 1XLQA 2XSCA 3BVZA 3NK9A 4N59A 4B08A 1O7YA 3QB3A 1S4ZA 3NRZA 1FCLA 3IT6B 3VR4A 3PZ7A 1LT3D 2C5CA 3BYYB 2OF1A 1EQVA 3AE3B 5E4XA 2KQ4X 2Y0SB 3NXWA 3RPFC 4PMCA 3SDZA 5ISRA 4YIJA 1DOIA 4XYOA 1BR9A 3NVVA 1IYVA 1CT1D