4UDUC

Crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
218
Chain Sequence
KDLRKKSELQRNALSNLRQIYYYNEKAITENKESNTLLFKGFFTGHPWYNDLLVDLGSKDATNKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWIDGKQTTVPIDKVKTSKKEVTVQELDLQARHYLHGKFGLYNSDSFGGKVQRGLIVFHSSEGSTVSYDLFDAQGQYPDTLLRIYRDNKTINSENLHIDLYLYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4uduC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4uduC01
1TS3A 1V1OA 3BYYB 1PTOC 3W2DA 4BWGB 1HXYD 1TS4A 2G9HD 5FK9C 4K6LA 1D5XC 1JR0D 1STEA 5ELEA 1LTBD 1DYQA 1S5BD 3BYTB 1PRTD 1G8ZD 2J4XA 1CK1A 1UNSA 4RH6A 1EFID 1PTOD 4RGNA 1XTCD 2NTTA 2RDGA 1KLUD 1V1PB 2XN9C 1FNWA 1CHPD 1SJED 1FD7D 4RGTA 2CHBD 2WV6D 4RFBA 1B1ZA 1PYWD 3DWQA 1FGBD 1LT4D 1B44D 1HA5A 1HQRD 1LTTD 3BVGA 4RCOA 2IJ0A 3TSSA 2AQ3B 1F77A 1V1PA 4OHJA 1KTKA 5TSSA 2QILA 1EU4A 1LTGD 1KLGD 1SJHD 3O13A 4L63B 1YN4A 4RGOS 1LT6D 1D6EC 1PRTB 1PTOB 3BVZA 3EFXD 1BCPC 1LT5D 2R61A 4UDUC 1ET9A 4NZLB 2RDHA 1D5ZC 1JWUD 3MC0B 3OWEB 5D3DA 1BCPD 2ICIA 3MFGA 1I4GA 1RF2D 1I4XA 1EEFD 3GP7A 1EEID 1SEBD 1XXGA 3CHBD 4RHSA 5ELCA 4RHRA 1LTSD 1PZKD 3R2TA 1PRTF 1ET6A 4TSSA 2O2LD 2AQ2B 3SEBA 1LTRD 1PTOF 1TY0A 2NTSA 2AQ1B 2TSSA 2Z8LA 4L6TB 4C56C 4DXFA 1GOZA 1RDPD 5FKAC 5ELFA 1I4RA 1EU3A 3KLSX 1MD2D 5ELDA 1LT3D 1PTOH 3EA6A 1BCPB 1I4QA 1UUPA 5ELBA 3BVMA 1FNUA 1L0YB 3V05A 1SE2A 1SE4A 1ENFA 1I4HA 1AW7A 3R2IA 1LO5D 1S5DD 1PZJD 1I4PA 2XNAC 4RGMA 1CHQD 5I4DA 3BZDB 1L0XB 1AN8A 2XRQD 1TS2A 2QEJC 3DWAA 1CT1D 1T5XD 1RCVD 1SBBB 1JCKB 1PZID 3R8BA 1EWCA 4O1NA 3URYA 1CQVA 1HTLD 1BXTA 1DJRD 4Z9CB 4DXGA 1YN5A 1YN3A 3DWPA 1RD9D 2SEBD 4ZYSA 1BCPF 1LTID 1D5MC 1LTAD 1SXTA 1JWMD 1QILA 1S5CD 1LLRD 1M4VA 1TY2A 1S5ED 1JQYD 2IPKD 1SE3A 1ESFA 1S5FD 1TS5A 1FNVA 2XRSD 5D3IB 1JWSD 1PRTC
chains in the Genus database with same CATH superfamily
1C4CA 3I4MB 2OJRA 3K5NA 3G6EA 1HR0W 4UPAA 3DVGX 5C0XJ 5KYIA 3L16A 3PZ7A 4QJFA 2A6HD 4A8XC 1L7YA 1QKZA 3MC9A 1PHJA 5NUCA 3BDCA 4JE3B 3CCQA 3NVVA 4DDGD 1BBXC 2UUAL 1V1PB 2GBMA 4YWKA 1OQYA 2N3SA 2FUG1 2F0UA 2CHBD 4LNIA 2HD5B 3GTOB 4YXDB 4X62L 4DUYQ 4RFBA 2GBKA 2JQOA 4OEMB 4BA1I 4A3MG 4LF5Q 1HA5A 1FJGL 1XLOA 2Y3AA 2F0TA 2OCEA 3NENA 3MXGA 2P5ZX 4DHZE 4HJ7A 2FNJB 2LVPA 1DOYA 1V1PA 4A3IH 4DAMA 3SK6A 1NYRA 2WKCA 3TP7A 3N9YC 4II3B 3K57A 2SOBA 2BS4B 3JC66 2N7DA 4CJ0B 3GOEA 1EU4A 1JMLA 2WHIA 1BMLC 1RLFA 2E6XA 5JEAH 5F2DA 4DV5L 2GA4B 2KQSA 3Q8FA 5A35A 3AE7B 1KAWA 5KNBA 2K04A 4GNXA 1LV9A 2I46A 2R93B 2UUBL 1RYJA 2LJ5A 4GB9A 2DJGC 4C3IB 1CI3M 4KHPQ 2BB6A 5JJLA 1X3QA 4Q5VA 3AEGB 2HIXA 3HFZB 4ZUIA 4NDXA 4MNOA 2F52A 2AYOB 4I6PA 4LNKA 3PRMB 2MJ3A 2IGHA 3LYYA 3DBHI 3MFYA 4KZ0A 2HCIA 3KOJA 3NXWA 5DEHA 4F7ZA 1SAPA 1RF2D 4IWPA 4YHHQ 3AEDB 1ZXTA 1KXLA 2Y0SE 4EGVA 1XXGA 3V3XA 1KOTA 4C2MH 2SNSA 4AS1A 2L12A 4DHZB 4ZHOA 1XNQQ 3L4PA 1GO3E 3KQ4A 5AZGA 2OQ0A 4KD4A 1VZ7A 5I6WA 2C7NB 4N59A 1DOMA 1MPEA 4L6TB 4BY7G 4C56C 1EY8A 3PGZA 3EJIA 4JVZA 3QB3A 1EYAA 5ELFA 3TREA 4A93B 2JA5B 2BT6A 4US8A 1AYFA 4MACA 1O78A 3I4NG 3P4SB 1YNXA 3GB1A 1PYSB 4YTPB 2DJFC 2F4VL 4M01A 5CC4A 4ULLA 2D9UA 1I4PA 2WWZA 4POGA 4JI2Q 1MGSA 1FGUA 3Q8DA 3ONSA 2L3ZA 2PQAB 5BO4B 1FMAD 4KLKA 2I38A 3I73A 3L10B 2F0MA 4WRDA 1SBBB 4NNJB 1V1QA 1HNWQ 4KIKB 2Y0SB 1GAQB 1J8CA 2WNMA 1N36Q 1JJGA 2GBJA 3DVNU 2PQAA 1WTPA 1M1KC 1GHKA 3A9KB 3BIID 1KH0A 1J7CA 2FIDA 4IUTA 5C1ZA 2BYTA 2FHTA 4XQJA 3CCUA 2LY7A 2J53A 3UI2A 4KIKA 3HM6X 4WWPA 4MH0E 1QE6A 3SFDB 4AUQC 2BS2B 3H1UA 4ZHPA 3A9KA 2XRSD 3IRBA 1L0VB 1B9MA 4B95A 3U2SC 3W5VB 1KFYB 2Z6KC 1ZGUB 1G2TA 4NXNL 4BWGB 2JYOA 3APDA 5BMIA 1LFDA 1K8OA 1PMRA 2JRHA 2JEBI 2M00A 1IKMA 4RKLA 2ZNVB 5IAAC 1C9FA 4FVMA 3GTMH 1VCBA 3M62B 1Y69U 1CA6A 3VTUA 2ZPYA 4RH6A 3E0JA 1BBWA 5H92C 2RDGA 3ZIMA 3QWNA 4KY6A 2F0WA 2JA9A 4A3JG 2WINB 2PE9A 1EFWA 2FCSA 4USAA 2RCNA 2NVUI 3D31A 3DWQA 4K1RB 1Q10A 5GROA 2BA1A 1EIFA 1P9DU 1NAPA 2NBWB 2O6VB 1ZKOA 1D3ZA 1XMQQ 3A5ZB 4JL9A 3WAOA 4BA2I 2G45B 2LKVA 3K58A 1EY5A 1ZUD2 2K8HA 3LXFA 2ZM6L 2KMCA 1CKNB 1PRTB 4OWWB 3KLWA 2VL6A 2O6VA 4EVOA 1LXDA 3RPFC 3IL8A 2VB2X 1BF4A 1LT5D 4KY5A 2J0JA 3Q0AA 2KC2A 1MBYA 4JI1L 5M3FH 2BYFA 3FP9A 4J15A 2D5GA 4HRSA 5E6NA 3Q23A 4PMBA 4AYBG 3RT3B 1LACA 2BH2A 2L32A 1CKNA 2CWPA 4DV1L 1X9NA 2JA7G 4P74A 4G7ZC 2MHVA 1K9MC 4HDQA 4DK5A 4PV1C 1A62A 4C1NI 1MJEA 4LNFA 5IWAL 2GBRA 2NN6G 1D1IA 4DGZA 4RF1A 1EEID 1CM9A 1ZYRD 3CC7A 5M5WH 4KK7A 3CU7A 1A0IA 4DA2A 3CCMA 4RHSA 3HG9A 4ITKA 3RNBC 1N32Q 4YWMA 4MM3B 3OW7A 3PTFC 1PDXA 4DR4Q 3MXPA 1PLFA 4KGRA 1VQJA 2UUCL 2JZ3B 4A3KG 1EM7A 2EJGC 5EBDA 1Y14B 1UELA 4ZKCB 4KY7A 5FJ8G 5C6AA 4XDXA 4BFRA 2A69D 1NI3A 3NE5B 3TDQA 1NMFA 4MM3A 1RL2A 3EA6A 3CQZH 2PVGC 4FN2A 3HOUG 3ALBA 4A3OA 4J6HA 3TJPA 3V05A 1B3QA 4LDTD 1SE4A 1B4OA 4EQPA 1VS0A 4BAXA 5HG2A 1HUMA 5IODA 4JOIC 4RGMA 1PH4A 2LRUA 3PLVA 2PZTA 4A4IA 4HJGE 3HOVG 3ZLZA 1L0WA 4AP4C 2WDTB 3VH3B 1UE5A 3DM3A 4C3HB 4HJ8A 2AWNA 1EL0A 1EWCA 2NVYB 4LNQA 5FLMH 2DWQA 2ZXPA 4G7HC 2WXQA 3RUIB 3QG1A 2H4OA 5EKLA 4DR3Q 4LUVA 3L08A 1GJXA 1RWSA 1EZ6A 1FCLA 1R4MI 2DN8A 2E2IB 5IGBA 4ZRPA 4DDID 3KLSA 3DBHB 2DZKA 4FULA 4AOFA 2F0FA 1JWMD 2UXBL 3R93A 1MHWC 1S1QB 2G1EA 1ASZA 4W9GA 5EE0A 1YZ6A 1S5ED 2LGXA 2B3GA 3A1QB 1FIQA 2F3IA 2N7JA 4WWOA 2GN5A 1EOVA 2Z4IA 1VQ4A 1Q7YC 5LMNL 2DAJA 2UU7A 4JPSA 5DPRA 2UWQA 3WANA 2LHDA 3OMGA 1IW7C 4JI5Q 1VJKA 3ZW3A 2BDNA 5JJKA 4HJKA 4JYAL 1WGGA 1Z7TA 5DLQE 3M7NA 5M3FB 3A1QA 3I3TB 1FRRA 4A3CH 3NVYA 3ZNZB 2QJLA 4ASWC 3V60A 1SMYC 2PCFB 3SFEB 1Q1EA 3OW2A 1DOIA 2AWTA 1U0LA 4RGNA 4REZA 2ZZPB 2L1BA 3NTIA 4JI7L 4PYUA 5C23A 1J9OA 2LD9A 1WM3A 4UAIA 3UIPB 1N9WA 3HOZG 2Y5CA 4HROA 2M9VA 4JIOU 1K83H 2IJ0A 5K5PA 3HIZA 1TIID 3C2PA 2R7ZG 2IHEA 2E5LL 4LF8Q 3ND9A 3AN1A 4LF4Q 4RM9A 3KVFB 1HFGA 3U7DA 5KGUA 1DZ1A 3DBRI 4BBSG 2LGIA 4YY3Q 3CQZB 1IXRA 5DM63 3MAQA 2F0VA 2EYLA 5C4ZA 4Y7NB 3KUZA 1U4LA 2NZOA 3HP3A 1A5RA 3P1MA 1D5ZC 2K05A 1EY0A 5J3BA 1SIJA 1MSHA 3S17H 3WCQA 1FXTB 2JE6I 1HZ9A 2WXHA 1GKHA 3BZKA 3OTOL 3I2ZA 4A3DG 1QQRA 3BJUA 4L1BA 3RN9C 1CUKA 2ZT9C 4JK1C 1YJNA 1WMHA 3NELA 2ID0A 2WGSA 4FYDA 5L37A 3PS6A 2MQHA 4JX1C 1EEFD 1L1OC 1S4ZA 4FF4A 4IFDG 2DYBA 2K8CA 3P2BA 1BQQT 1IBKL 2VQEL 1EQTA 2K8BA 5AEKB 1L6UA 5IIFA 4KGTA 4DN4M 1JJ2A 3IHPC 2XWBB 4HKZE 3RZDH 1E1OA 3UGBB 2D0PA 5HGQA 2N7EA 4G57A 1DOKA 4HIOA 2Q2HA 2PEAA 3M63B 1BBUA 1WXVA 1ZXIA 1NMGA 1QNKA 1YNNC 1I94L 3LWUA 2KLGA 3KLSX 3BS1A 1MD2D 3HOWH 1SSNA 1X1MA 4JI0L 1BOSA 2B2YC 2PIAA 1B9NA 1W6JA 4K8IA 3T1HQ 2VUMG 4QGUA 4ZCKA 5AUKA 5DPTA 1OO9B 4ZYNA 5K36G 1XWEA 3I4NH 3RNAC 3R2IA 2D3AA 1M8AA 4HAEA 1QLBB 3ZRCA 4QL5A 1GPXA 4AIMA 4P2CB 2K01A 4HLEA 1C77A 3QQ8B 5IN7A 2F0IA 3CCSA 2NN6I 3LWEA 3IT6B 4DR6Q 4IM0A 2JJQA 3TEWA 1HTLD 5EE3A 4Z9CB 2K4KA 4DK3C 3CWIA 2WAQG 2F0PA 1HNXQ 2BPSA 1XF5L 2LHEA 1AEXA 3R66C 2BKFA 1E7ZA 5E3FA 4W9EA 4A3GH 1LTLA 3N1ZC 5D94A 3T4AC 4K7UA 4DF7A 1C76A 1FJGQ 2XTIA 4A3MB 4C7YA 1GUWA 5LHY1 2KWUB 2LVOA 1D4BA 1TS5A 1F2MA 1TQOA 5C5MA 4DUZL 4KSKC 1T3QA 4OELB 4CDDC 5IYCH 2KCTA 2O6VD 3Q8BA 1VQ7A 2WXOA 4K5WA 4HMJA 3HK0A 2N55A 5FK9C 1PH8A 2Z4HA 4R4CA 3VA7A 2KX0A 1LTBD 3UDXA 3W1GA 3FKYA 2VQFL 3P4PB 3U7ZA 3BYTB 3S17B 3H94A 1PRTD 4JI4L 2I5LX 1B2TA 1MI0A 3RD2A 2D62A 1DCZA 5GAHC 1AP0A 3STBC 2XN9C 1FNWA 4R4OA 2F4IA 2KJ6A 3NRZA 2F0LA 4PS8A 4MH8A 2PO4A 3AE1B 2K5HA 3BY4B 3OIPA 1IBLQ 3JAMi 1XLNA 2ZEQA 4HCSA 1KRTA 3AEEB 3DHIC 3VR2A 3DBLI 4K8JA 1HA6A 3CPWA 4A3JH 3ZDTA 1KRSA 3QX1A 1Q3LA 2N78A 1XYIA 1TKGA 3RCZA 3RZDB 3C0RB 1HZAA 4DV2L 3A8KE 3KYHC 1O80A 2D2QA 1JC7A 1QUQB 3TZUA 2E8GA 5ELOA 3WALA 2CHWA 2LI5A 4ANUA 4A76A 5LLIA 1R4MB 4BY7B 2IY1B 4U673 1BCPC 2PW5A 5KNCA 1Q1OA 2M4NA 2N9XA 1HHVA 3T1YQ 1I5FA 1A3UA 1B7YB 1QUQA 3I4NB 1EYGA 4BZAA 2HTME 5D3DA 2MPMA 1H9RA 4GN3B 4W9LA 3EIVA 3PF5A 2GBNA 1GC7A 2KX3A 1F2YA 3APFA 2DZMA 4XT3B 2JA7H 5CV7A 5ELCA 4LTUA 1LTSD 4XQQA 1ET6A 1Q12A 3F2CA 5HGTA 3ML8A 1KABA 3P1HA 3SEBA 1LTRD 3S15B 4ACFA 4DXFA 2OXPA 4ODGA 2NCNA 2D2CC 4P1CC 1OTCA 4OONA 3L2PA 1P8LA 1W3SA 4B3TL 3K9PB 3ZVVA 1BKBA 3HOXH 4LF6Q 1VQNA 3Q6BA 2L7RA 3U9SA 3R3MA 2WXLA 3RULA 3TEZA 1U4MA 2EY5A 2UU9L 2CH4A 4FP5D 1LM0A 2N0SB 4M8NA 3Q2AC 2DYOA 3HOUH 3QK0A 3BZDB 1E0ZA 4MTNA 2WU2B 3DBRB 1UE6A 3TS2A 5CHFA 4IFDI 3CMEA 4B3RQ 2EDGA 4LFCL 4IZ8A 4XX5A 2BE5D 1TKEA 3B9JA 3HOVH 4BKGA 4X3KA 4OXPA 4LLGM 2BA0A 4AYBE 1G91A 1D8LA 2GVAA 4C4VB 4DAPA 1QT9A 1LTID 1B70B 3IAYA 1OQQA 4A3JB 1XNRL 2DZIA 1LLRD 3S16B 5IKCM 4RWSC 1DGJA 3ML9A 1JQYD 1X3EA 2JK8A 2NMQA 1LUZA 4DNIA 1D2BA 2RDFA 4TRDA 2KUMA 4I7AA 4C4VA 1Y8PB 5GMVA 1VR9A 3DPDA 1XTDA 2QKIC 4ZOHC 4IUQA 5IGGA 5CBEE 4FF3A 5G2NA 4K81A 2PJHA 1CSQA 4IOAA 5IGCA 4QB4A 3GTGH 3NS8A 1NVID 4K6LA 1JR0D 1STEA 1JE4A 4ZQ3A 4WJOA 1NJIC 3ZTCA 1PH9A 3H0GH 3Q6SA 5E6PA 1QF6A 5M9OA 3WAMA 1XTCD 2FMCA 2M2LA 2I07B 5T1GA 3PZ8A 4P6VF 4HEA1 4B3SL 1TTNA 3TL5A 4AYBB 1XMOQ 2V3PA 3NOBA 1E2ZA 3RUZA 5L95C 3MHSD 1U4PA 3S1NB 2V4DA 3ZNHB 4KJNA 4IPDA 5JEAJ 2FUHB 2PPHA 2JA7B 1SLJA 2LGYA 1YNJD 1SNCA 4B6WA 1EQQA 2D0OA 2X38A 5G5HA 1B9RA 3TBLD 3ECIA 4ICUA 1U4RA 2OOBB 4LMQD 5EJWA 2XEWA 1ZXHA 1KC8C 5J17A 2IO3B 1FXIA 3O13A 2KBNA 4YCUA 3I3CA 3B6YA 3MTSA 3S1QH 1GC6A 2DNFA 1AFPA 4A3KB 1J5EL 1JT8A 3EFXD 3J9CA 2KN5A 1ENAA 3RZOH 1QOAA 4LK0M 4R8NA 1R9TB 4MIUA 4PMCA 3WDNA 1ASYA 4PYZA 5LNK1 2G5DA 1MJDA 5JXVA 3E6ZX 5CYUA 1N62A 2WYQA 3HOUB 4GIVA 3S2HH 2QA4A 3FC4A 1WTQA 4OWXB 1Y8RC 1YQ4B 5HI1A 4ARCA 2J52A 3MFGA 3TP8A 1SNQA 1SMXA 3PQIA 2BF8B 1CFMA 4D2KA 1RJTA 1G6PA 1XPRA 1I4XA 1Y1VG 2J0KA 3P4QB 2NUCA 2BQQA 2V1CC 4JBMA 3HOVB 2R7DA 4GOPC 1ROEA 2KDIA 1DM0B 4IM2A 2QCPX 2DZJA 1KDCA 3DCGA 4OX9L 2R92H 2C9WB 4IFDH 2NTSA 3J7ZC 1VLBA 1H9SB 3P20A 1YJJA 3AEVA 1CZPA 3I4MH 4C00A 4OO1H 3KWLA 5COYA 1VQFA 2IO0B 1W6KA 3ABVB 2JXTA 2L8JA 1LYLA 2UXBQ 2A5UA 4WWMA 5ELBA 2NBUA 1GUTA 5KRUA 1NEKB 5A2QE 2A6ED 1H9SA 1XX8A 4QQBX 4HIKA 1E9MA 1PFDA 4F1SA 4ALPA 4GLAC 5T1IA 5A2QL 4EQNA 2KLCA 1WE6A 3MJ5A 1Q81C 4II2B 3K5LA 3NZUA 4MN3A 3ZQ4A 5K36H 1VQ6A 4ILWA 3ULPA 1PZID 1K53A 2H88B 4KV2A 2G4SA 5C0XG 3I57A 1N34L 2YYZA 5M3MG 3N3KB 4RG1A 2RGFA 1YBYA 3FHWA 1XPOA 2PTLA 3GTQH 1JICA 3KK7A 2A8VA 1N33Q 3HOZB 1TY2A 4IURA 5IT9E 2IDYA 3V6EB 1WTWA 5LXHA 2DNEA 1PUTA 4APVA 3HOYG 5D6JB 1HTOA 4NXML 2WXGA 4N58A 2WDVB 3VAWA 5D3IB 3OG5A 5IT9L 2R7ZB 3S1QB 2QC8A 2DX5B 3BYYB 3V6CB 2AWOA 1TS4A 4DU9A 1B8AA 2G9HD 2QF7A 4DV0Q 1VQMA 1F1HA 4JGHB 3AM9A 4XYCA 4BBSB 1PQSA 4ZRJA 3QA8A 1DYQA 3I72A 1PH6A 2LWPA 1BUVT 2GLSA 1E8YA 2K0PA 1ZPSA 2EKIA 2NTTA 1CMXB 1OXSC 1R4NI 4RGTA 5EE9A 2KO3A 3PV0A 2B39A 5JOBA 2ZPNA 2A5HA 1QOHA 3LNNA 3QJYA 4A3DB 1N60A 4ZKBB 1SSOA 3TBIB 1VDVA 2AQ3B 2IY0B 1HEZE 1VQDA 4B3ML 2L15A 3C8YA 3ZJUA 1VZ6A 1SYEA 2NVTH 4GOCA 3EQLC 1V5TA 2WAQE 4HVBA 1IHZA 2DENB 3LJ3A 1NCVA 2EVBA 2OQKA 3N1XC 1GG3A 1HH2P 2XSCA 1C7YA 1WYGA 2AL3A 2PNHA 3NP8A 5FO7B 1L4ZB 2MH7A 3NWTA 3KDFB 2ZXRA 4O0AA 4OIJA 3A7AB 4L8JA 3UQBA 4IUNA 2N4FA 4JI0Q 3J81j 5IT9c 2PE6B 2J7QB 1Q8IA 5I9PA 2VUMB 1Z2MA 3AE2B 3WAPA 2RR9A 1IP9A 3RI7C 3KDFA 1TWCH 5L83A 2MX2A 1UAPA 1JMCA 4DR7L 1RODA 1WGRA 2BKRB 1JALA 3GE8C 5GXGB 3CF5A 4BVUC 4WJWA 1VQ5A 1TT2A 2KAJA 2DNCA 4M8AA 4CGYB 2Q5WD 1DOXA 5JVH3 1A2TA 1V80A 3G48A 2JA8G 1WTHA 3ZNID 2JUOA 3C19A 3P42A 1IYJB 2E76C 4RMFA 1T0QC 3EUB2 2N49A 3GTQB 2JA6G 3HVDA 1YMHE 1GOZA 1WJ4A 2INCC 4KN7C 2WQYB 4CDEC 4EQ5A 4DKAC 2WAQB 2BVCA 3L7ZC 3L0WB 2ENBA 2EYHA 2OWOA 3RN2A 2F3VA 5IY0A 5FLXE 1ENCA 1TVXA 3P75A 4XIGS 2WIIB 5IP7G 1ILPA 1TWAB 2CHZA 3QAQA 3WIMA 2OJWA 3A33B 1FRDA 2K6QA 5CV6A 4IDIA 2DY7A 4BBRG 4RCNA 4LAAA 5FLXL 1Q5WB 2EQSA 4LNNA 1AW7A 3J80i 1PZJD 4XDDA 4WFN3 1CHQD 2LSSA 4FXDA 3ZXRA 2RPQA 3VHTC 3ERQA 2D5DA 3B08A 4KD3A 4TMAB 2QEJC 2K03A 4HCEA 4HEDA 3GDEA 4QMGA 5HFYA 2PZUA 2HT1A 1CJEA 4KKIA 3TCAA 4GKKL 1L1OB 2Q8RE 5J1ZA 1V8QA 3MXNB 1T6BX 2I1JA 4MDKE 3AXCA 1JRPA 4IALA 2HQEA 2YLMA 1DJRD 2K5NA 3DEPA 4BBNC 1AE3A 2B8GA 1EUJA 4FHJA 1GUGA 1MVKA 5EKIA 4WORA 1WJJA 2EJMA 4KX6B 3IXSA 1BR9A 2XVSA 3VR6A 1SXTA 1X32A 1L1OA 2IZVB 4DWFA 1RHPA 2F0DA 3MXNA 4IJLA 2CU1A 3OIQA 1WFYA 3NSWA 1VD2A 3AE9B 5BN3A 4URKA 2FMMA 2K3UA 2NVTB 5G3LD 3D4WA 1SGHA 1GUSA 2LMCB 3AFPA 3PHXB 3N52A 3PUXA 3CCEA 4HJ9A 4CO7A 2ES2A 4HMIA 3FDTA 4NKLA 4CDFC 1V2YA 3UI3A 5IO9A 1SYGA 1TS3A 4P75A 2UXDL 2FFKB 2EYMA 3Q3MC 1WX9A 1K8RB 1G2SA 3SK4A 1UWMA 3L17A 1SDFA 2B2YA 2L52A 1JE5A 1E7UA 3OMCA 4LFBQ 2KVRA 3A55A 1V9PA 2NYZD 1T9HA 5C0XI 2ASBA 1EO6A 1WX8A 3FPUB 4IJHA 5FLXc 2HHHL 1KRHA 1HR0L 4WJNA 4X6AH 2XGTA 1O7LA 3D3RA 2KWCA 5CX3A 1CHPD 1SJED 1TWCB 3VYSA 3OSOA 1X56A 2A1AA 3SK8A 2K75A 4DBGA 3UIOB 2K5PA 3HVZA 1J7AA 2YEPF 3BU2A 1F77A 5CMDA 1B3AA 4DV7L 2VNUD 3J7YW 4JI3L 1FFVA 4C3JG 4YCVA 5AZHA 4C80A 1PFMA 3GZNI 2B2VC 2I0QA 2FJ2A 1KLGD 1SJHD 1OEYJ 3Q3FA 1UEBA 3CAMA 4RGOS 2Q2UA 5AZFA 5C4HA 3AULA 1AH9A 4IM3A 1EY9A 3TRZA 2KT7A 1QOFA 3W5UB 4B0EA 3CSTA 4BY1G 1YIWA 1VQCA 4C3HH 5KIXA 5E6JA 2NVYH 1WE7A 3CSFA 4NPNA 3A8IE 4KMUC 4B3TQ 3FKIG 2D10A 2MGSA 3Q3OC 5MPOA 3AH7A 5E6OA 1KNEA 3ZDMC 2ZJPA 4IOIE 5I9OA 4WJQA 2E2IH 3ZJVA 3GTLB 2ICIA 3U50C 1PA6A 1PH1A 1PH7A 1A8VA 2K5DA 1JOOA 3T16A 4DV6L 2A68C 3M3YB 4KDLB 2NB0A 3ZYYX 3UQAA 2DGYA 1MG4A 2D3GA 4RF0A 3S2AA 1HUNA 1YI2A 1Y1VH 1PTOF 4XZ4A 2AQ1B 4POFA 5I6YA 3TS0A 1L2FA 3SHLA 1GB4A 4RKBA 3PIPA 1PH3A 1YJ1A 3Q8AA 1G51A 4JI8Q 4EEWA 5LL6S 1R4NB 2MUYA 2KMAA 3PO0A 4QIWE 2QDFA 2ZTCA 5C3XA 2Q2TA 3OAWA 3OHXC 2F0HA 2K33A 1BCPB 2EXZA 4H13C 1XNRQ 1MHHE 1WXMA 2H89B 5HKHA 2KJRA 1UE1A 4N9PA 2ZCBA 2M0XA 2EYOA 2OEDA 4X65Q 2DHZA 2Z0SA 1GUOA 1RKNA 3M7GA 1F2RC 1KJTA 1VMCA 1V49A 1FVIA 3NBHB 1YJWA 1Z47A 4DFAA 3J81L 4LFAL 2INPE 1HNZL 4FJYA 1CQVA 3H8HA 1I3QB 2L76A 4MSQB 2WB1G 2RSUA 1IYUA 4GN1A 1QG7A 2F0OA 1H95A 3HGBA 4MSMB 3I91A 1NTGA 3GTPB 4JV5Q 4IQZA 4MGYE 1E7PB 5C0XH 1C8CA 3NBHA 4B3SQ 2G9DA 3JVZX 4IUVA 3KYCD 3OJ4B 5M3MH 3LDZE 1EIHA 4DV3L 2YU9H 1S5CD 2K1BA 5LMUQ 4DR2Q 1ZDVA 2K9XA 3N32A 1H8CA 4Y7NH 1VMPA 4QIWB 1IYFA 5GAEC 4X66Q 1F9SA 5BN5A 2IPKD 4K0KL 1NY4A 2Z0DB 3H91A 1JWSD 5BYSA 4WJ4A 2AMCB 2NWGA 4QF4A 4XYOA 3QIAA 2JWZA 4DV4Q 4CJ1B 4AQYL 2IL8A 2PKOA 3ONAB 4FJZA 5JHAA 3UDFA 3H3VC 1D5XC 3FEWX 5ELEA 4GLXA 2JVCA 5C3EG 1F2LA 4M0WB 5J39A 4BOSC 2AUKA 2KJHB 3NVWA 3SHQA 1OQRA 4I6NB 1WXQA 3RR5A 1K3BC 1IW7D 3I56A 2L83A 3NUHB 3TMPB 3EROA 4KHVA 1SE8A 1FFUA 1WOCA 2INNE 3DBSA 1T0SC 4HWIB 4M0WA 3MP9A 1E10A 5D65A 1VQGA 1ML0D 1FYCA 1UGJA 1SMYD 3J81c 2WXIA 1EQRA 1Y1VB 4LCDE 1S72A 4NAMA 3CCVA 1WGDA 4JI6L 2VH1A 3EFCA 4PS7A 3ZUNA 4KHZA 2LFNA 1NR4A 1VQKA 2J0MA 4XE0A 3W3AA 4L63B 1NDDA 4DR5Q 1ZE3D 1K8MA 3VUYA 3MEFA 1A70A 4CHTB 4TQ0A 4W9KA 4HIDA 2KEDA 2AX5A 3CC2A 2UXCQ 2R61A 1NBWA 3I7FA 4IN3A 1N6ZA 4K6DA 1YITA 3NTKA 2F0EA 1JWBD 4GSWA 1A15A 4OL7A 3TZDA 1FM0D 4GGQA 2EMSA 2L0CA 1QCBD 3CMAA 1ZDXA 1QVCA 2I5MX 2E74C 3AU4A 3I63C 3DOWA 3J7AV 2INDC 4KDIC 2JQRB 4R1JA 2AEHA 4JPBW 2WXPA 2RD0A 1AE2A 3PRPB 1VCIA 3TEHB 4A3MH 3PO3G 4BOZB 2OTLA 4CJ2C 3J7AF 1JWAD 1PDQA 3T53B 1L4DB 3FAHA 5M3MB 2JA8H 3VYUA 2YU9B 1VF5C 1DGSA 3M4YA 4GKJL 3DVGY 2KHSA 1IBML 1ACCA 4GNXC 5CBAE 4BBNF 3KFUA 2K6DB 3ZRFA 1PV4A 1QJOA 4E3CA 2MP2B 1EZ8A 2GRIA 3QJZA 3VR8B 5FO9B 2WP9B 3IFWB 2BWES 3RFZB 3HOYB 4L5SA 1YNND 2C60A 2YEPB 5JAVA 3WOEA 2QHOA 4RNAA 3GZNB 4FF1A 2NS5A 3DWAA 3ZGZA 2OTJA 2MP2A 4UP7A 4W9IA 1TGZB 4LF9L 3WA0A 4QY7A 3NY5A 4HPMB 5JHBA 1ZKHA 3KH0A 5LL6X 4GOPB 5M5XB 1WI0A 5C4XG 1ZW7A 4FADA 1JOQA 2WDQB 1QNUA 2X6GA 1ZEQX 5H1SE 2BOSA 1MI2A 3H7PB 3EHVA 4BY7H 1QILA 2C5LC 3OOCA 2CHXA 5BN4A 3GD7A 3U4ZA 4X64L 4GOPA 3K7AB 2GI9A 3CD6A 3CW2C 3RLFA 4LF7Q 4MJSB 3RMHA 3K0YA 2ASQA 4BXXG 1A2UA 1Q90A 4HTHA 2KWVB 2LJIA 2VZKB 3H7PA 3D0FA 1NE3A 2JXMB 3W2DA 4WH4A 1HXYD 1SYFA 2N9LA 2I1KA 3SR6A 3RMKC 4JW0A 2KXJA 5E4WC 1LQBA 2Q2IA 4QUFA 3W1SC 1KNAA 1X3GA 2BWFA 2W3SA 4PZ8A 2A74C 3SR1A 1L2NA 2KHIA 3GO5A 3APCA 2UUAQ 1DOLA 1IUEA 5CGKA 3S15H 2AL6A 2KTRB 1H9JA 3QO2A 3E9IA 3K5OA 1S40A 4FXKC 2WV6D 4DUYL 4X62Q 3I4LA 1B1ZA 3CCRA 3UDGA 4LF5L 4LNOA 1FGBD 1LTTD 4RCOA 4MGKE 2MBOA 3EC8A 3UF8A 3AEFB 1FPYA 3STBD 2HD3A 3N6RA 4WIPA 1YNTE 4JBWA 3CXCA 1ICFB 4P71A 3T56B 2GOWA 2JA8B 2Q8TA 4DV5Q 5CR3A 1HCZA 1WH3A 1EQVA 2M8SA 5C5LA 2JA6B 2UUBQ 4C3JH 3TP5A 4FBJB 1TIFA 4KHPL 4MEMA 1ZOYB 1ET9A 1XO3A 4I7ZC 1WTXA 3PUVA 2WX1A 1JWUD 1UE7A 1TWFH 4B9XA 2KJXA 2VS1A 3A54A 5ELNA 2RPVA 3L0OA 1UH6A 4NQLB 3RNCC 4BY1H 2Q8IB 2BBCA 4HN7A 1BCPD 4F87A 4BBRB 1TWGH 3NUCA 1YIJA 4YHHL 3FKIH 3GP7A 1RRBA 3N30A 4H2AA 1V8CA 3S16H 2WACA 2WXKA 2LXAA 2IGGA 2QMTA 3HKZG 1XNQL 4HPPA 4NQKE 1RIPA 2KCNA 4R4QA 2HTHA 1TYGB 1E90A 2MJDA 3Q3NC 2KEEA 3AU7A 3WWVA 2KHWB 1F2RI 2G4DB 4DNTB 1I50H 2JX5A 1II3A 4LUZA 3Q8EA 2V1YA 1EY6A 4L5QA 4K2LA 4A3FG 3AMUA 5D7GA 3VUXA 3DLLA 1GM5A 2KA7A 3D6WA 2HDMA 1JORA 1N63A 4MGIE 2TMPA 2PMVA 2F4VQ 4NP5A 1WGKA 1STHA 2KANA 4W9DA 3X23A 4A55A 1I4HA 1EF5A 1QZEA 4E6IA 1S5DD 5IGDA 3IAM1 4GXBA 3W1BA 4BKTA 4JI2L 5AJ3L 2JF5A 5EBCA 4FNFA 1AZQA 1PGXA 4OW0A 3S1NH 4O42A 2HE7A 5EQ0A 2JEAI 2MCNB 1TZOA 2PW7A 4EX5A 1K73C 3V61A 2V3SA 1E24A 3R8BA 5G55A 3EN2A 4S3SA 1HNWL 3A4SC 4A3BG 1STGA 2AUJD 2NN6H 3URYA 2OF1A 1YJ9A 2M19A 2NVXB 3X3NA 1N36L 4DHJB 2CW0C 5KNDA 4N8X1 3TEXA 4GN4B 1EIYB 1MFWA 4LJZC 3JW0X 3ICEA 3CPFA 4A3IG 1LTAD 4A3KH 3DWGC 1UZXB 1M4VA 3MC8A 1R4PB 4GMVA 3ZNGC 4C7ZA 5FJ8H 2OEOA 1R9TH 1A3TA 1ICWA 5JEAG 5M5YH 2MLBA 2L4NA 3OPOA 4EE2A 1JOKA 3NS1A 4E74A 4N6EB 2F0JA 2K5VA 1C4AA 4HJ5A 2PYKA 4C3JB 4NXNQ 2N1WA 5IYBG 3P63A 1C0AA 3F1ZA 3K59A 4RM8A 3T3NA 1HPCA 1TWFB 1X6OA 3K6OA 1STNA 1FL0A 1LGRA 3VR5A 2NZ1D 4BY1B 3PUYA 2EYFA 1A3VA 3H9DA 4P16A 1B53A 1TWGB 2L05A 3FKIB 2E2HH 3DUZA 1YHBA 1PYWD 4MT5A 1LT4D 1O7ZA 3K80C 4JQWC 4UP9A 1KLVA 4MZ9A 3DXJC 1G6ZA 5BMHA 4XGAB 2RF4A 1EWYC 3QIJA 4WJ3M 4OIKA 1YVCA 1EY4A 3UE1A 2EZVA 1WRDB 1SF0A 1I50B 2WB1E 4UHVA 4RMAA 3QHTA 2ZM6Q 1SYCA 1I7HA 3ITPA 3MHBA 1Y1WG 4B08A 4IUUA 2QIEB 4H7BA 2YVCA 2KWDA 1YQ3B 3QCAA 3VR9B 3PZDA 2M1MA 4GLVB 3A8JE 4UDUC 4QCLA 1HE8A 4JI1Q 3MJWA 5CTRC 4NAWB 1KD1C 4OVVA 3Q8CA 1KF6B 2AKWB 3RLNA 5KYLA 1TR5A 2PI2E 1VQ8A 1I6HB 4DV1Q 3AB5A 4YWGG 1HJPA 3HRDD 3EVQA 4DK1A 2QSDA 2RMMA 1I4GA 2HQLA 3V96A 1JRUA 2IGDA 5CHWA 2B2WC 4NAWA 5IWAQ 2BDOA 4C1NK 1IYVA 2HJ1A 1SYDA 3WOFA 1SEBD 1P16A 3HOZH 1QOGA 2K22A 4IC7B 3F2BA 1N32L 3NZSA 1QVFA 4I6LB 3HEJA 1PZKD 2PLPA 4DR4L 1K0RA 4HSPA 3RNUA 1MHXA 2K1FA 4WQOB 4EKUA 1JROA 2UUCQ 2R7ZH 2Z8LA 3NG0A 4PNYA 3VTWA 2WB1B 4IWQA 1EU3A 3VRBB 3Q14C 2I5HA 4Q0FA 4BBSH 1DONA 5IA7A 1FXAA 2IWHA 3PMFA 1YEZA 5M5YB 4MGZE 1I4QA 2KQ7A 4K3CA 3LB8C 1KIXA 4X57B 1SNPA 1WI5A 3KJOA 3GTKB 1OFFA 2Z6KA 2QW7A 3A5UA 4PS3A 1U4AA 3CRKC 4NB3A 3DQVA 3CRLC 2K50A 2C7HA 2CKZB 4H02A 2V4LA 5J2RA 1TS2A 1PH5A 4A3DH 3J7A5 4A75A 5FOBB 1T5XD 2VZKD 2RHQB 5J22A 4PT5A 3VUWA 2ZVNA 4E71A 1WZ3A 1MKHA 2PI2A 3KF8B 1BXTA 5C3EB 3Q24A 3VTVA 2E2HB 3EFUA 3H7SA 2JWUA 4YSYB 4M00A 1OGWA 2V4IB 2K6AA 4ZYSA 4HR7B 4R8IA 2W55A 4NY0A 3FILB 5C4XH 3G71A 2O5IC 2DAFA 2J42A 2FXQA 4HIMA 4M02A 2KN4A 1K8GA 2KQ4X 3KF8A 5HY6A 4XYQA 1Q1BA 1J6QA 4KV6A 1MG8A 2VRRB 4F88A 3KBGA 1SE3A 4L5TA 2QDBA 2ON8A 1J0GA 5LMNQ 3AQQA 3M95A 1N5WA 3T51B 1NYQA 2VUMH 3DMUA 3FILA 3B0AA 3I4OA 2CJOA 1PTOC 4PZ7A 5DPSA 4JI5L 4NJ6A 2JZPA 4JYAQ 2VXWA 2B63G 4BXXH 4YL8A 1NNXA 3M4QA 2KMMA 2C5CA 2O2VB 2ZJDA 1WYDA 1H4RA 3TMEA 1KLUD 4MHEA 5BR8L 4JI7Q 4N9F4 1HZ5A 4HPLB 3PIO3 3PIOA 1FD7D 2ZW1A 4A20A 2VB3X 2WS3B 2ZCCA 1BDOA 2B3AA 1W2BA 3JSVB 2MBHA 1F2ZA 3BK2A 1HQRD 1EY7A 1O7YA 4DQOC 1BUIC 3JAME 2RBMA 4LF8L 4K7SA 1TWAH 2E5LQ 1KTKA 4LF4L 1FEHA 1YX5B 1YOVB 3QWZB 4WQMA 4QAYA 4NMZA 4US9A 2FCQA 4ZK9B 1EUVB 3JAML 3JSVA 5GADC 1QB5D 3PO3B 4GLSC 1D6EC 4YY3L 1WJ6A 4CKEA 3ZTDA 3V2TA 3SK5A 4F8MA 4YTNB 4KKJA 1WD1A 4GKJQ 1F9RA 2KFJA 2MW5A 5EE1A 2D11A 1T5EA 3ULJA 5HURA 1Z9FA 4KVGB 2J0TD 4A3PA 1HTPA 4JOIA 2LFIA 3S2DH 1IGDA 2MQJA 3OTOQ 4ABNA 4ZRKA 3T8MA 2K14A 5IGFA 2RKSA 5FLMG 3U4EG 4B0MA 1FCCC 1D7QA 1RFKA 2RHSB 1H9MA 2FCNA 1IBKQ 3RZWC 2VQEQ 3NQIA 2BGFA 4RHRA 4B9KA 3F2DA 1PRTF 2K52A 3KF6B 5D2MB 1VQHA 1XJVA 4FXGC 1TY0A 5DM73 5HHDG 4ZAIA 2MHJA 2G3QB 1JB7A 2UYZB 5C4XB 1Y56A 2N9EB 2Z59B 1I94Q 1STAA 3AYHB 4DHJD 4KGSA 1X54A 4TKOB 3KF6A 2KCCA 1WM2A 2N9PC 1WX7A 3MXUA 1X3PA 1L0YB 1STBA 5DNFA 2YTYA 3JAMc 2L55A 2XBBC 1ENFA 1AZPA 4IWOA 3RNFC 2IHFA 1NBFC 2V3NA 1LO5D 2HUGA 4M8MA 3A0JA 1UEAB 3U4VA 4IW0A 4WJPA 4EZKA 4A3CG 3BZCA 2K7VA 4DK0A 1UD7A 2MRPA 2WLBA 3PPAA 4WWNA 4ME3A 3PSIA 1N5XA 4CKCA 2PPBC 4DR6L 1UGMA 2ZVOA 1OXXK 4I65A 3ULLA 4DNRB 4J3OD 3NHEB 2DUDA 5IP4D 1YJIA 1HNXL 3VFKA 4A3BH 1JQ4A 3BDOA 3I55A 2F03A 3B1LX 4G50A 3BINA 2DBYA 3U52E 4H0LC 1RAXA 3HKSA 3VYRA 1KL9A 2BTEA 2IO2B 5C44G 3KLRA 3QOJA 4GNXB 3HKZE 2WXFA 2A6HC 2EJFC 1LABA 1FNVA 3G6JB 1A63A 1TJEA 2D3BA 4DUZQ 4W9JA 4ARIA 1V1OA 4A3EG 1SRUA 4DAVA 1U5KA 2MO0A 3G4SA 3GTLH 4ZDVA 1V86A 2JSOA 4NPSA 3H6MA 2K5QA 3K0XA 3M3YH 2NBFA 2JPHA 4TUUA 2X8XX 3U9OA 2VQFQ 3C1FA 1T0RC 2ZW0A 5IYBH 4JI4Q 3S2DB 3GE3C 4AJWA 2HJ8A 1MIUA 3SVMA 1ONLA 2XIWA 2SNMA 1QZGA 1M90C 3NWSA 4DAYB 1XQQA 2IW3A 3IVFA 4S17A 1A6XA 5TR5A 1EF1A 4YSZB 4U68A 3T13A 3S1RB 2PVOD 1IBLL 1UWVA 5JJZA 1B44D 1SIFA 5GAGC 4OHJA 4DAYA 2ZTDA 4LUOA 4DV2Q 2D3CA 2V0GA 3HKZB 1GUNA 3H6NA 2R2QA 2PMZE 1CQFA 3HOWG 3F8TA 1G6JA 4J6IA 2LMCA 3AE5B 3T1YL 4IUPA 3U58A 2R7FA 2WXNA 4CQNA 4DR1L 4A3FB 1TXYA 1SE9A 2KCMA 4A3LG 1E22A 1Y1WH 3IAS1 4JCVE 3KUDB 2RDBC 1I3QH 2W82A 1WYWB 1C78A 5DAUA 2L5TA 3E56A 3GTPH 2L0TA 3C1EA 3RZFA 3MZ5A 2B29A 4HXDA 4JG2A 4K2KA 3KBXA 5EGTA 5AJ3Q 3M4OH 2KECA 1E2VA 1F9PA 4GZYC 1G291 3W1SA 5IOIA 2E2DC 2X6LA 3EBEA 2GB1A 3A4RA 3OYYA 1Q46A 4TQ1A 3SDLC 3EECA 3GQBA 2AQ2B 4A3GG 1QVGA 4A3BB 2WX0A 1X3FA 2A68D 2F0QA 2FBWB 3KUPA 2KOLA 2PMZB 1RTNA 4X3TA 2KC1A 5DPWA 2LEKA 5EPJA 3TQYA 4A3IB 4G3XB 4OZAA 5IYCG 4LF6L 2W9NA 3SE0A 1VQIA 3ENEA 1EWIA 4BS9A 3NJTA 5D14A 4CYEA 2ZXOA 2UU9Q 4G7OC 2L1AA 1I42A 5I4DA 1UF0A 2I2YA 1L0XB 4UY8C 2MNAA 2XRQD 3CIRB 2DY8A 1CT1D 1OXUA 3K81C 4B9WA 1X65A 4B3RL 1LM8B 2R2OA 1HRJA 3M9BA 4LFCQ 4IKGA 1KDAA 1MJCA 3K8AA 4DPGA 2WDRB 2EIFA 4P73A 4XTCS 4IPHA 3H15A 1V97A 2FAZA 4DXAB 3PIP3 2EY2A 2VZAA 5LMNW 5JZEB 1RD9D 2E75C 5IP9G 3AI5A 3TEYA 1D5MC 1C48A 1STYA 5FO8B 3SU8X 1AARA 2QGQA 1V9JA 2ZTEA 3FRPB 4C2MB 2RSOA 2N88A 2W54A 1ESFA 4KSLC 2B2UC 4KTAA 4P7IA 2X69A 3PHWB 3J81E 4JC0A 4JWUC 1YD8U 1CZGA 2QCZA 1I6VC 4XXEA 3PO2G 3U30A 1HZBA 2M56B 2FIFA 2M17A 3OWFA 3E0EA 1Y1WB 1VQOA 1CK1A 1VZ8A 4LJPB 4AWJA 4Y52H 4G0NB 4HSVA 2B63H 2MJEA 1WR6E 1GHJA 5FR3A 1XMOL 3AFQA 1PFNA 1VDZA 3M4OB 1IKLA 3KJPA 3IKJA 2LGSA 2NBVB 4XC2A 3BVGA 1TKWB 3UE0A 1E5WA 2MBQA 4IUMB 1Q86C 1C1YB 2D07B 5G5GA 1S3OA 3U8ZA 5TSSA 3AE4B 4X3SA 2WKDA 3VR3A 1WCMG 2K39A 5BMGA 4LK1C 1CA5A 3HOYH 2WXJA 2CJNA 3V62A 3IFDA 3M85A 2DLBA 1CTMA 4WURA 3BVZA 1J5EQ 1E8XA 3HOXG 3R7RA 1O7IA 1U9RA 1IBXB 3PLUA 3RD4A 5DCNA 2IY5B 2HIVA 2CS4A 5CV4A 4LJOB 2GVBA 1ZYRC 4CKBA 3Q69A 4A9AA 5M5XH 5KHOA 2CKHB 1DXMA 1RTOA 4CDCC 5T8IA 1IBXA 2N1VA 2QDLA 4HCPB 1GXDC 3PUZA 3PCOB 2DYMA 5FR6A 4FLHA 3S9WA 3GTMB 2FCMA 5CV5A 3P4RB 3K7UC 4HK2A 4MELA 3K7AH 2B2TC 2A69C 3NQTA 4KN4C 3C3LA 2NZHA 5E4XA 1E1TA 4XWWA 4OX9Q 1L6VA 3DM1A 1K51A 2TSSA 5FKAC 4EZJA 1C3TA 4UP8A 4FA6A 2N9KA 2A19A 1PTOH 2EYPA 2LXKA 2OT2A 3DDCB 3BVMA 1SFOH 2JP1A 1K8AC 4XQNA 2E3TA 3A74A 4YSXB 3ETRA 2PZWA 2JY6A 2H1EA 1SR3A 1AN8A 1JB3A 3J80E 2WFWA 1SB3C 2LZ6A 4KKTA 2LXJA 3H0GG 2EELA 2JYEA 3D6CA 2WU5B 2VW9A 3DHQA 2B63B 1CZWA 1TU2B 3J80L 2KDFB 3PRZA 1N34Q 3VRAB 4WAAA 2ZJRA 1DD2A 4DK6C 5EKKA 3DHHC 1R4QB 2MFIA 3TN2A 4IO9A 4L2YA 1PGBA 5BR8Q 3DWPA 2F0SA 2B2WA 2MA9B 1Q0WB 3HS0C 3A7LA 5CORA 1N33L 2JA6H 1TZ1A 4MTKA 2BYEA 1KAAA 5M5WB 2MSED 3RYTA 4ICVA 4V190 2ALYB 4OVZA 4FO2A 2YTVA 4F7XA 1F0ZA 4IPGA 3B2FA 4NXMQ 2EY6A 4AJYB 4J1MA 4ME5A 1ILQA 5IP7H 1TWHH 1WTOA 1XLPA 1HFNA 3PREA 3N1YC 3HRZC 5C44H 1C79A 4BBRH 4DV0L 2JZZA 2BYVE 1P0RA 2JRIB 1P3QU 2JN4A 4PMWA 4A3EH 1WMHB 4LW1A 2A4ZA 4OZCA 2N8NA 2K32A 1V6EA 2L0FA 1ESRA 3CCJA 2J7ZA 5C4JH 4Q2JA 3G7LA 3GV3A 2EKEC 2PNRC 1WVLA 5IE8A 2EXDA 1P1AA 4S0RA 3JYUA 1QWYA 4K5VA 3CF6E 1K52A 1E2WA 1V5OA 3X0WA 3J80c 5ISRA 2R92G 3L13A 3ND8A 1RM6C 4XDCA 2CH4W 4B3MQ 3PVLA 3AMZA 3I4MG 5CV8A 4OO1G 1VRAB 1XD3B 4XWTA 1OXVA 2JU6X 4JWSC 3AE6B 3KYDD 2F0GA 1F9QA 1UBQA 4FXCA 3L3OC 4MJSA 1PTOB 1WZ0A 3ZO5B 3Q22A 2JSVX 3GTJH 3I5JC 2KQ3A 4TQUS 1VQPA 4HJAA 1D1KA 1SFOB 1K50A 1XCTL 3IBEA 3PUWA 3KUCB 1BO0A 2KENA 1AWDA 3FVQA 5G3LF 2LUMA 3PGEA 2NVXH 1T0YA 3HZXA 4IPCA 2MBBB 2WXMA 4NJCA 1P7EA 3I70A 4ZRQA 4TVAB 4GS3A 4A3LH 1IL2A 1WJUA 3HHMA 2IBIB 1V43A 1FD6A 2WXRA 2K25A 4DR7Q 3OJ3A 1JJCB 1EWHA 2RVLA 2CR5A 3L9AX 4ZUJA 4JBJA 2BW2A 1Q82C 2KTRA 3AEAB 2KTFA 3IT4B 2XWJB 3NK9A 2R93G 4L23A 1VQBA 2GMIC 3NTHA 2QEXA 4C3IG 4IOCA 2IX1A 1M94A 3T3OA 2HCCA 1K83B 1WIAA 2CCZA 3CCLA 3QOLA 5ELDA 3NHHA 3S24A 3PSEB 1LT3D 3CMMB 2F3WA 1UUPA 3TUOA 2Y5PA 1XCQL 5JPNC 4CHKA 5BYRA 1TWHB 2O5JC 3IG3A 3W9CB 2H5XA 2KACA 3F2UA 4CBVA 1ISNA 1PXUA 5C44B 2LUEA 3QARA 1HZCA 2NVQH 2XNAC 4IFDJ 2K28A 2SAKA 4OGQC 1SN8A 2F0KA 2ZNVC 2FINB 3E5SA 2ONQA 1HZ6A 4A3EB 5IYDG 3K9OB 2L9HA 4BKSA 1P98A 4GKKQ 1GJZA 1SNOA 5C4JB 4DXGA 2JA5G 3SD5A 4A93G 3CC4A 1J7BA 1YN3A 1BNZA 2VH2A 1MSGA 4OZBA 5JJIA 1IPGA 3P7JA 4EUTA 4HKQA 1OEYA 4PQXA 5IP9H 2CW0D 4WAFA 2LVQA 4P72A 1S5FD 2CQOA 3GV6A 3LX0A 3VH4B 1GB1A 1I6HH 1PRTC 2BCOA 2R6GA 4K7WA 4AQ7A 1Y8NB 2UXDQ 3GTJB 5JVG3 3K5MA 2L11A 3VR4A 4JLCA 5JH5C 3HOWB 2Y0SG 5EDSA 4G11A 1HQMC 2OHFA 4LFBL 4F8CB 4ID6A 1FR3A 2CU3A 1NR2A 1UNSA 1EFID 4K5XA 4DR1Q 2HHHQ 3B2GA 1HR0Q 3PO2H 4KI0A 1OTRB 1BT0A 5GQOA 5I2YA 2KD0A 3L54A 3H3VI 2KFKB 1GNUA 3FPPA 1VQEA 3ZJTA 2C35B 4YT0B 3TIXA 3AB9A 1V81A 2JT4B 3M4PA 4ANXA 3H09A 3TSSA 1TBEA 2KNBA 2IYDB 4DV7Q 2KVZA 2EOTA 3GTKH 4JI3Q 3UDIA 2KFKA 2QILA 1E3PA 1LTGD 2B76B 1J8IA 1K28A 1QZHA 3ZXVA 3SDZA 2F0NA 2RA4A 4HDOA 3RNGC 4A3GB 3ZJYC 4W9FA 4XT1B 4GDLB 1NSNS 1WCMH 5JPMC 3DHGC 1WRIA 3AE8B 5C3WA 5J18A 2JXXA 4NZLB 2RDHA 1WXAA 1WY8A 4KKSA 1H9KA 4P1BC 3MC0B 2IO1B 3Q3JA 2NVQB 4R9WA 5C3EH 3QR8A 2EY1A 1BVSA 3ER0A 2VY3A 4GDLA 2E2JH 2Y5BB 2CQAA 3NBIA 5E7NA 4GDKB 4A90A 2Z9HA 2IX3A 2BH8A 4LWCA 1C4PA 4DV6Q 2KVMA 3AE3B 1XMQL 3ERSX 2Z0EB 3CHBD 3I90A 1IGCA 1E6EB 4K14A 3NPPA 2MEKA 4GU2A 1WSPA 3HM3A 4TSSA 4OO1I 2O2LD 3R3OA 2WP8J 3A9JB 3DVNV 2AHOB 2F1MA 4GDKA 4AH6A 5IOCA 3RNEC 3BG3A 4N8FA 1SROA 3E9HA 1UBIA 2IT1A 4JI8L 2EYJA 2HDEA 2KZRA 1YHAA 1XT9B 1PFSA 3LGJA 2B8FA 3A9JA 3MHZA 3CP0A 1K3RA 4ZLTF 2RCFA 5AFWA 5KHQA 3SXHA 5I2XA 2BE5C 4X65L 1WF9A 3PT2B 2IX0A 1Z6HA 4J8QA 2PW9A 1GVPA 4NW2A 3I9V1 1CSPA 5C2TB 1WGHA 3GS2A 3D32A 1CKOA 2C7MB 3A56A 1Q8KA 1RCVD 2ACZB 3PO2B 1YX6B 4LFAQ 1QOBA 1HNZQ 5AUIA 3DWMA 1WTVA 4EFOA 2MWSB 2CVRA 5BYQA 4G4KA 3CKIB 4M1UB 3PO3H 4JV5L 4OVUA 2SEBD 1Z5SB 4RAUC 4R4TA 1HTQA 1IZ6A 1R7SA 1E8ZA 5LMUL 4DV3Q 1Y8OB 4DR2L 2REXA 4ZRIA 3AV8A 1E8WA 3X3MA 3H3VH 3R7QA 2JYTA 4X66L 4H44C 4K0KQ 2B2VA 2NPTB 1VQAA 2LS01 4KZCA 1F9JA 2ICEC 3S14H 2SDFA 1KM7A 1XLQA 2FE8A 3VQIA 3VDZA 3OLMD 1I35A 4DV4L 4ZRZA 1WCMB 3NVZA 4C3HG 4AQYQ 4EZLA 4RA8A 1NENB 3SGIA 4FJVB 3AECB 1E0BA 2L00B 2NPTA 1S5BD 4FF2A 3HOXB 1B50A 2J4XA 1G8ZD 4DR3L 1YNJC 3MTNB 2KDEB 4ANWA 5IGEA 1PTOD 1K0SA 4O2DA 2E2JB 3BDLA 1YHQA 3N20C 1EIGA 3D8GA 3MEHA 1KHIA 1WJNA 1WGYA 3EGRA 1EOTA 3D4DA 2KYWA 1X55A 2MBEA 4YCWA 2MJ8A 1PH2A 5EAYA 2C9OA 4YIJA 3C46A 3S1MH 3T9LA 1SNMA 3MA2B 4L5RC 4X3UA 1WWTA 3MWYW 2LRWA 1WR1A 2CWAA 2BB5A 4IG7B 4JI6Q 2Z6BA 4TV3A 2K5WA 4EOYA 3VYTA 2Z1CA 5M3FG 1YN4A 3KW5B 2YTXA 2KDBA 4DR5L 1LT6D 4N9TA 3IFTA 5KEEA 2ATWA 2LASA 2BS3B 3DEOA 2KOXA 4R3DA 2UXCL 1CKMA 1NI2A 3VDYA 2EE1A 1PVOA 2KK8A 2KKCA 2ZJQA 3D4RA 4A6QA 1FO4A 1VF7A 2B2UA 4R4IA 5E1FA 3DBLB 3OWEB 3PV1A 5EPKA 1TKYA 2KDMA 3M3JA 4W9HA 2PQEA 1J19A 5H8YE 1N61A 3GTGB 2O2VA 4JBKA 1WD0A 1P7FA 2RQXA 2EMTA 4BKSD 3GTOH 5EPLA 1UWXA 2KHJA 3ZKJC 1XEEA 3H0GB 1PGAA 3R2TA 1SYBA 1PYBA 3AEBB 2HDLA 3W5OA 2O4XA 3AU5A 1VQ9A 5LXIB 2A6EC 1RDPD 2V9HA 4K3BA 3BK1A 1I4RA 4OWTB 1VQLA 3VA5A 2LGDA 1TT5B 4PZ6A 2NR2A 4FHKA 2R93H 1IBMQ 4GN5A 1C4QA 1C9OA 2MO1A 2RSNA 2YV5A 1KDBA 3BWUD 2R3ZA 4YWLA 1FNUA 1GD7A 2CFMA 3TP6A 4C3IH 3PF4A 3S14B 1YQBA 2W3RA 5CHVC 3W1YA 4PK1A 4YTMB 1SE2A 1ZP0B 1KQSA 3J81i 3KWVA 4PG3A 1XPUA 4FDBA 4EQOA 3S1RH 3E9SA 1GUAB 3HUIA 3NEMA 4ANVA 1L5PA 4V0BA 3RN5A 3RZOB 1JW9D 1S3SG 3VVWB 2XK5B 1JCKB 1WXSA 2A73B 1N8RC 2M0AA 2MP1A 4LF9Q 4O1NA 5CV9A 3MVVA 3I8ZA 1WFQA 1EYDA 1SNDA 3RLOA 3NZ3A 5IYDH 1YN5A 3S2HB 1F52A 3QC8B 1OXTA 4HCNB 4NJ7A 5C3JB 4KJOA 1PFBA 3VXWA 1BCPF 2XK5A 4KKUA 3S1MB 2JA5H 4LDTB 3FMCA 3T1HL 4A93H 1WTRA 1IL8A 4X64Q 1RFAA 2B2TA 4QUCA 2LXCA 4LF7L 4A3FH 4TKNA 3UINB 3O65B 2R92B 1NUCA 2EPBA 3E3XA 1E7VA 1EYCA 4W9CA
chains in the Genus database with same CATH topology
1C4CA 3I4MB 3K5NA 5C0XJ 5KYIA 3PZ7A 2A6HD 4A8XC 1QKZA 5NUCA 3BDCA 4JE3B 3NVVA 1BBXC 1V1PB 2FUG1 2F0UA 2CHBD 3GTOB 4YXDB 4RFBA 1XLOA 4BA1I 2Y3AA 1HA5A 2F0TA 3MXGA 1DOYA 1V1PA 3SK6A 1NYRA 2WKCA 3TP7A 3N9YC 3K57A 2SOBA 2BS4B 4CJ0B 1EU4A 1JMLA 1BMLC 2E6XA 5JEAH 5F2DA 2GA4B 3Q8FA 5A35A 3AE7B 5KNBA 2K04A 2R93B 1LV9A 2I46A 1RYJA 4C3IB 1CI3M 2BB6A 1X3QA 4Q5VA 3AEGB 4ZUIA 4NDXA 2MJ3A 2IGHA 3LYYA 3MFYA 2HCIA 3NXWA 5DEHA 1SAPA 1RF2D 3AEDB 1ZXTA 4EGVA 1XXGA 3V3XA 2SNSA 4AS1A 2L12A 4ZHOA 3L4PA 3KQ4A 4KD4A 1VZ7A 5I6WA 4N59A 1DOMA 1MPEA 4L6TB 4C56C 1EY8A 2JA5B 3EJIA 4US8A 3QB3A 1EYAA 5ELFA 4A93B 2BT6A 1AYFA 4MACA 1O78A 3P4SB 3GB1A 4YTPB 5CC4A 4ULLA 2D9UA 1I4PA 1MGSA 1FMAD 2I38A 3I73A 2F0MA 4WRDA 1SBBB 2Y0SB 1GAQB 2WNMA 1WTPA 1GHKA 3BIID 1KH0A 1J7CA 2BYTA 4IUTA 2FHTA 4XQJA 2LY7A 2J53A 3UI2A 1QE6A 3SFDB 2BS2B 4ZHPA 2XRSD 1L0VB 1B9MA 3U2SC 3W5VB 1KFYB 1G2TA 4BWGB 2JYOA 5BMIA 1K8OA 1PMRA 2JEBI 2M00A 1IKMA 4RKLA 1C9FA 4FVMA 1Y69U 1CA6A 4RH6A 3E0JA 5H92C 2RDGA 3QWNA 4KY6A 2F0WA 2WINB 4USAA 3D31A 3DWQA 1Q10A 2BA1A 1NAPA 1ZKOA 4BA2I 2LKVA 3K58A 1EY5A 1ZUD2 3LXFA 1PRTB 4EVOA 3RPFC 3IL8A 2VB2X 1BF4A 1LT5D 4KY5A 3Q0AA 1MBYA 2D5GA 4HRSA 3Q23A 4PMBA 1LACA 2L32A 4G7ZC 2MHVA 4PV1C 4C1NI 2NN6G 1D1IA 4DGZA 4RF1A 1EEID 1CM9A 1ZYRD 4KK7A 3CU7A 4DA2A 4ITKA 4RHSA 3HG9A 4MM3B 3OW7A 1PDXA 4KGRA 3MXPA 1PLFA 1EM7A 2EJGC 5EBDA 4ZKCB 4KY7A 5C6AA 4XDXA 2A69D 1NI3A 3NE5B 3TDQA 3EA6A 2PVGC 4J6HA 3V05A 1SE4A 1B4OA 4EQPA 5HG2A 1HUMA 5IODA 4RGMA 4HJGE 2PZTA 4C3HB 2AWNA 1EL0A 1EWCA 2NVYB 2DWQA 2WXQA 2ZXPA 4G7HC 3QG1A 2H4OA 5EKLA 1GJXA 1RWSA 1EZ6A 1FCLA 2DN8A 2E2IB 5IGBA 4ZRPA 3KLSA 2F0FA 1JWMD 2G1EA 3R93A 5EE0A 1S5ED 1FIQA 2N7JA 2Z4IA 4JPSA 2LHDA 3OMGA 1IW7C 1VJKA 2BDNA 1Z7TA 3M7NA 5M3FB 1FRRA 3NVYA 2QJLA 1SMYC 2PCFB 3SFEB 1Q1EA 1DOIA 4RGNA 4REZA 2L1BA 3NTIA 1J9OA 4UAIA 2Y5CA 4HROA 2M9VA 2IJ0A 5K5PA 1TIID 3C2PA 3ND9A 3AN1A 1HFGA 5KGUA 1DZ1A 2LGIA 3CQZB 5DM63 3MAQA 2F0VA 2EYLA 5C4ZA 4Y7NB 1U4LA 3HP3A 3P1MA 1D5ZC 2K05A 1EY0A 1SIJA 1MSHA 3WCQA 2JE6I 2WXHA 1QQRA 4L1BA 2ZT9C 4JK1C 2ID0A 4FYDA 4JX1C 1EEFD 1S4ZA 4FF4A 4IFDG 1BQQT 1EQTA 1L6UA 5IIFA 4KGTA 4DN4M 2XWBB 4HKZE 4G57A 1DOKA 1ZXIA 1QNKA 1YNNC 3LWUA 3KLSX 3BS1A 1MD2D 1SSNA 2PIAA 1BOSA 2B2YC 1B9NA 1W6JA 4K8IA 5AUKA 1OO9B 5K36G 1XWEA 3R2IA 1M8AA 4HAEA 1QLBB 1GPXA 4P2CB 2K01A 1C77A 2F0IA 2NN6I 3LWEA 3IT6B 3TEWA 1HTLD 5EE3A 4Z9CB 3CWIA 2F0PA 1XF5L 2LHEA 1AEXA 5E3FA 3T4AC 4DF7A 1C76A 4A3MB 4C7YA 1GUWA 5LHY1 1D4BA 1TS5A 1F2MA 1TQOA 5C5MA 1T3QA 3Q8BA 2WXOA 4K5WA 4HMJA 2N55A 5FK9C 2Z4HA 3VA7A 1LTBD 3U7ZA 3P4PB 3BYTB 3S17B 3H94A 1PRTD 1MI0A 1B2TA 2D62A 1DCZA 1AP0A 2XN9C 1FNWA 3NRZA 2F4IA 2F0LA 4MH8A 2PO4A 3AE1B 3OIPA 1XLNA 3AEEB 4HCSA 3VR2A 4K8JA 1HA6A 1Q3LA 1XYIA 1TKGA 3RZDB 3A8KE 1O80A 1JC7A 3TZUA 4BY7B 4U673 1BCPC 2PW5A 5KNCA 1HHVA 1A3UA 3I4NB 2HTME 5D3DA 2MPMA 1H9RA 1F2YA 4XT3B 5CV7A 5ELCA 4LTUA 1LTSD 4XQQA 1ET6A 1Q12A 5HGTA 1KABA 3P1HA 3SEBA 1LTRD 3S15B 4DXFA 2OXPA 4ODGA 2D2CC 3U9SA 2WXLA 3TEZA 1U4MA 2EY5A 4FP5D 2N0SB 2DYOA 3BZDB 1E0ZA 2WU2B 4IFDI 2EDGA 4IZ8A 2BE5D 1TKEA 3B9JA 4X3KA 4LLGM 2BA0A 1G91A 4DAPA 1QT9A 1LTID 3IAYA 1OQQA 4A3JB 1LLRD 3S16B 4RWSC 1DGJA 1JQYD 2NMQA 1D2BA 2RDFA 4TRDA 2KUMA 1Y8PB 1VR9A 2QKIC 4ZOHC 4IUQA 5IGGA 5CBEE 4FF3A 5IGCA 4QB4A 1NVID 4K6LA 1JR0D 1STEA 1JE4A 4ZQ3A 3Q6SA 1QF6A 5M9OA 1XTCD 2FMCA 2M2LA 2I07B 5T1GA 3PZ8A 4P6VF 4HEA1 4AYBB 2V3PA 1E2ZA 3RUZA 1U4PA 3S1NB 2V4DA 4KJNA 5JEAJ 2JA7B 1YNJD 1SNCA 2X38A 5G5HA 1B9RA 1U4RA 4LMQD 5EJWA 1ZXHA 1FXIA 3O13A 3I3CA 3MTSA 1AFPA 4A3KB 3EFXD 3J9CA 1ENAA 1QOAA 4LK0M 4R8NA 1R9TB 4MIUA 4PMCA 3WDNA 5LNK1 5JXVA 3E6ZX 5CYUA 1N62A 3HOUB 3FC4A 1WTQA 1YQ4B 5HI1A 4ARCA 2J52A 3MFGA 3TP8A 1SNQA 4D2KA 1CFMA 1RJTA 1I4XA 3P4QB 2NUCA 3HOVB 1ROEA 1DM0B 2QCPX 1KDCA 4IFDH 2NTSA 1VLBA 1H9SB 3P20A 1YJJA 1CZPA 4OO1H 3KWLA 5COYA 1W6KA 3ABVB 2JXTA 4WWMA 5ELBA 1GUTA 5KRUA 1NEKB 5A2QE 2A6ED 1H9SA 1XX8A 1E9MA 1PFDA 5T1IA 5A2QL 4EQNA 3MJ5A 3K5LA 3ZQ4A 4MN3A 5K36H 4ILWA 1PZID 1K53A 2H88B 5C0XG 3I57A 2YYZA 2PTLA 1JICA 3KK7A 3HOZB 1TY2A 4IURA 5IT9E 2IDYA 1WTWA 2DNEA 1PUTA 2WXGA 4N58A 2WDVB 5D3IB 5IT9L 2R7ZB 3S1QB 3BYYB 2AWOA 1TS4A 4DU9A 2G9HD 2QF7A 3AM9A 4BBSB 1DYQA 3I72A 1BUVT 2K0PA 1ZPSA 2EKIA 2NTTA 1OXSC 4RGTA 5EE9A 3PV0A 2B39A 5JOBA 2A5HA 1QOHA 3LNNA 3QJYA 4A3DB 1N60A 4ZKBB 1SSOA 3TBIB 1VDVA 2AQ3B 1HEZE 3C8YA 3ZJUA 1VZ6A 1SYEA 3EQLC 1IHZA 1NCVA 2EVBA 2XSCA 1WYGA 3NP8A 5FO7B 1L4ZB 2MH7A 3NWTA 2ZXRA 4OIJA 3A7AB 4L8JA 4IUNA 1Q8IA 5I9PA 2VUMB 3AE2B 3ZJVA 1UAPA 5GXGB 1RODA 1JALA 4WJWA 1TT2A 2KAJA 2DNCA 4M8AA 4CGYB 2Q5WD 1DOXA 5JVH3 1A2TA 3P42A 2E76C 3EUB2 3GTQB 3HVDA 1YMHE 1GOZA 4KN7C 2WQYB 2WAQB 3L7ZC 2ENBA 2EYHA 2JSVX 2F3VA 5FLXE 1ENCA 1TVXA 3P75A 4XIGS 2WIIB 1ILPA 1TWAB 1FRDA 5CV6A 4IDIA 2DY7A 4RCNA 4LAAA 5FLXL 1AW7A 1PZJD 4XDDA 4WFN3 1CHQD 4FXDA 3ERQA 2D5DA 4KD3A 4TMAB 2QEJC 2K03A 4HCEA 4HEDA 4QMGA 5HFYA 2PZUA 1CJEA 4KKIA 1T6BX 2Q8RE 5J1ZA 1V8QA 1JRPA 4IALA 2HQEA 1DJRD 3DEPA 2B8GA 1GUGA 1MVKA 5EKIA 4WORA 2EJMA 4KX6B 3IXSA 1BR9A 3VR6A 2XVSA 1SXTA 1X32A 1RHPA 2F0DA 3MXNA 3OIQA 3NSWA 3AE9B 5BN3A 2FMMA 2K3UA 2NVTB 5G3LD 3D4WA 1GUSA 2LMCB 3N52A 3PUXA 3UI3A 4HMIA 3FDTA 4NKLA 1SYGA 1TS3A 2FFKB 2EYMA 1G2SA 3SK4A 1UWMA 1SDFA 2B2YA 2L52A 3OMCA 3A55A 2NYZD 5C0XI 3FPUB 1KRHA 1O7LA 3D3RA 1CHPD 1SJED 1TWCB 3VYSA 3OSOA 3SK8A 2K5PA 3HVZA 1J7AA 2YEPF 1F77A 5CMDA 1B3AA 2VNUD 3J7YW 1FFVA 4C3JG 4C80A 1PFMA 2B2VC 2FJ2A 1KLGD 1SJHD 4RGOS 5C4HA 1EY9A 1QOFA 3W5UB 4B0EA 5KIXA 5E6JA 3A8IE 4KMUC 2MGSA 5MPOA 3AH7A 1KNEA 4IOIE 5I9OA 3GTLB 2ICIA 2K5DA 3T16A 1JOOA 2A68C 3M3YB 2NB0A 3ZYYX 4RF0A 1HUNA 1PTOF 2AQ1B 5I6YA 3SHLA 1GB4A 4RKBA 3Q8AA 5LL6S 2MUYA 3PO0A 5C3XA 3OHXC 2F0HA 2K33A 1BCPB 2EXZA 4H13C 1MHHE 2H89B 4N9PA 2EYOA 2OEDA 1GUOA 1RKNA 3M7GA 1F2RC 1VMCA 1Z47A 4DFAA 3J81L 2INPE 1CQVA 3H8HA 1I3QB 1IYUA 1QG7A 2F0OA 3HGBA 3VQIA 3I91A 3GTPB 4IQZA 1E7PB 5C0XH 1C8CA 3NBHA 2G9DA 4IUVA 1EIHA 1ZDVA 1S5CD 2K1BA 2K9XA 1VMPA 4QIWB 1F9SA 5BN5A 2IPKD 3H91A 1JWSD 5BYSA 2NWGA 4QF4A 4XYOA 3QIAA 4CJ1B 2IL8A 2PKOA 3ONAB 3H3VC 1D5XC 3FEWX 5ELEA 1F2LA 5J39A 2AUKA 3NVWA 1OQRA 1WXQA 1IW7D 2L83A 3NUHB 3EROA 4KHVA 1FFUA 2INNE 1E10A 4M0WA 3MP9A 5D65A 1ML0D 1FYCA 1UGJA 1SMYD 2WXIA 1Y1VB 4NAMA 4KHZA 2LFNA 1NR4A 4XE0A 3W3AA 4L63B 1ZE3D 1K8MA 1A70A 4CHTB 4TQ0A 2KEDA 2AX5A 2R61A 4IN3A 4K6DA 3NTKA 2F0EA 1JWBD 1A15A 4OL7A 3TZDA 1FM0D 2L0CA 1QCBD 1ZDXA 2E74C 3J7AV 2JQRB 2WXPA 1VCIA 3J7AF 4CJ2C 1JWAD 1PDQA 3T53B 1L4DB 3FAHA 5M3MB 3VYUA 2YU9B 1VF5C 3M4YA 2KHSA 1ACCA 5CBAE 1QJOA 1EZ8A 2GRIA 3VR8B 5FO9B 2WP9B 3RFZB 3HOYB 1YNND 2YEPB 5JAVA 3WOEA 4RNAA 4FF1A 3DWAA 3ZGZA 5LL6X 5M5XB 1JOQA 2WDQB 1QNUA 2X6GA 1ZEQX 2BOSA 1MI2A 1QILA 3OOCA 5BN4A 3GD7A 3K7AB 2GI9A 3RLFA 3RMHA 3K0YA 1A2UA 4HTHA 1Q90A 2LJIA 2VZKB 2JXMB 3W2DA 4WH4A 1HXYD 1SYFA 2N9LA 3SR6A 5E4WC 4QUFA 1KNAA 2W3SA 3SR1A 2A74C 3GO5A 1IUEA 1DOLA 5CGKA 1H9JA 3QO2A 3K5OA 4FXKC 2WV6D 3I4LA 1B1ZA 1FGBD 1LTTD 4RCOA 3AEFB 3N6RA 4WIPA 1YNTE 4JBWA 3T56B 2JA8B 2Q8TA 5CR3A 1HCZA 1EQVA 5C5LA 2JA6B 3TP5A 1ZOYB 1ET9A 1XO3A 4I7ZC 1WTXA 3PUVA 1JWUD 4B9XA 2KJXA 3A54A 2RPVA 2Q8IB 2BBCA 4HN7A 1BCPD 4F87A 4BBRB 3NUCA 3GP7A 4H2AA 1V8CA 2WACA 2WXKA 2QMTA 2IGGA 2KCNA 1TYGB 2MJDA 2KEEA 3AU7A 1F2RI 4DNTB 2JX5A 1II3A 3Q8EA 1EY6A 4K2LA 3AMUA 5D7GA 2KA7A 3D6WA 2HDMA 1JORA 1N63A 2TMPA 2PMVA 4NP5A 1WGKA 1STHA 4A55A 1I4HA 4E6IA 1S5DD 5IGDA 3IAM1 5EBCA 4FNFA 1AZQA 1PGXA 4OW0A 4O42A 5EQ0A 2JEAI 1TZOA 2PW7A 3R8BA 4S3SA 1STGA 2AUJD 2NN6H 3URYA 2OF1A 2M19A 2NVXB 3X3NA 2CW0C 5KNDA 3TEXA 4LJZC 1LTAD 3DWGC 4C7ZA 1M4VA 1R4PB 2OEOA 1A3TA 1ICWA 5JEAG 2L4NA 3OPOA 4EE2A 1JOKA 3NS1A 4N6EB 2F0JA 1C4AA 2PYKA 4C3JB 3P63A 3K59A 3T3NA 1HPCA 1TWFB 3K6OA 1STNA 3VR5A 2NZ1D 4BY1B 3PUYA 2EYFA 1A3VA 4P16A 1B53A 1TWGB 3FKIB 3DUZA 1PYWD 4MT5A 1LT4D 1O7ZA 3DXJC 1G6ZA 5BMHA 1EWYC 4OIKA 1EY4A 2EZVA 1SF0A 1I50B 1I7HA 1SYCA 3ITPA 3MHBA 4B08A 4IUUA 2QIEB 4H7BA 2KWDA 1YQ3B 3VR9B 4QCLA 3A8JE 4UDUC 4NAWB 3Q8CA 1KF6B 5KYLA 1TR5A 1I6HB 3AB5A 4YWGG 3HRDD 3EVQA 4DK1A 2QSDA 2RMMA 1I4GA 3V96A 2IGDA 2B2WC 2BDOA 4C1NK 1IYVA 1SYDA 3WOFA 1SEBD 1QOGA 2K22A 3HEJA 1PZKD 2PLPA 4HSPA 1MHXA 1JROA 2Z8LA 4PNYA 2WB1B 1EU3A 3VRBB 4Q0FA 1DONA 1FXAA 2IWHA 3PMFA 5M5YB 1I4QA 3LB8C 1SNPA 3GTKB 1OFFA 3CRKC 3CRLC 1TS2A 5FOBB 1T5XD 2VZKD 4PT5A 5J22A 1BXTA 5C3EB 3Q24A 2E2HB 2JWUA 4YSYB 2V4IB 2K6AA 4ZYSA 4HR7B 4R8IA 2W55A 3FILB 2O5IC 2J42A 2KN4A 2KQ4X 3KF8A 4XYQA 1Q1BA 4KV6A 4F88A 3KBGA 1SE3A 2QDBA 2ON8A 1N5WA 3T51B 1NYQA 3DMUA 3FILA 2CJOA 1PTOC 2JZPA 2VXWA 2KMMA 2C5CA 3TMEA 1KLUD 4MHEA 1HZ5A 3PIO3 1FD7D 2ZW1A 2VB3X 2WS3B 1BDOA 1F2ZA 3BK2A 1HQRD 1EY7A 1O7YA 4DQOC 1BUIC 3JAME 2RBMA 4AQ7A 1KTKA 1FEHA 4WQMA 4NMZA 4US9A 4ZK9B 3JAML 3PO3B 1QB5D 4GLSC 1D6EC 4CKEA 3V2TA 3SK5A 4F8MA 4YTNB 4KKJA 1WD1A 1F9RA 5EE1A 1T5EA 5HURA 2J0TD 1HTPA 2LFIA 1IGDA 4ABNA 5IGFA 2RKSA 3U4EG 4B0MA 1FCCC 1RFKA 1H9MA 3NQIA 4RHRA 1PRTF 4FXGC 1TY0A 5DM73 5HHDG 4ZAIA 5C4XB 1Y56A 1STAA 4KGSA 4TKOB 2KCCA 3MXUA 1X3PA 1L0YB 1STBA 5DNFA 2L55A 1ENFA 1AZPA 2V3NA 1LO5D 2HUGA 1UEAB 2K7VA 4DK0A 2WLBA 1N5XA 4CKCA 2PPBC 1OXXK 4I65A 4DNRB 4J3OD 1YJIA 1JQ4A 3BDOA 2F03A 2DBYA 3U52E 4H0LC 3VYRA 2BTEA 3KLRA 3QOJA 2WXFA 2A6HC 2EJFC 1LABA 1FNVA 3G6JB 1TJEA 4ARIA 1V1OA 4DAVA 2JSOA 3H6MA 2K5QA 2NBFA 3U9OA 3C1FA 2ZW0A 3S2DB 3SVMA 1ONLA 2XIWA 2SNMA 3NWSA 2IW3A 1A6XA 4YSZB 4U68A 3T13A 3S1RB 2PVOD 5JJZA 1B44D 4OHJA 4DAYA 2V0GA 3HKZB 1GUNA 1CQFA 2LMCA 3AE5B 4IUPA 2WXNA 4CQNA 4A3FB 3IAS1 2W82A 1C78A 5DAUA 2L5TA 3E56A 3C1EA 3MZ5A 4K2KA 3KBXA 5EGTA 2KECA 1E2VA 1F9PA 4GZYC 1G291 3W1SA 2E2DC 2X6LA 2GB1A 4TQ1A 3GQBA 2AQ2B 4A3BB 2A68D 2F0QA 2FBWB 3KUPA 2KOLA 2PMZB 1RTNA 4X3TA 2LEKA 5EPJA 4A3IB 4OZAA 3SE0A 4BS9A 5D14A 2ZXOA 4G7OC 2L1AA 5I4DA 2I2YA 1L0XB 2XRQD 3CIRB 2DY8A 1CT1D 1OXUA 4B9WA 1HRJA 4IKGA 1KDAA 2WDRB 4XTCS 1V97A 3PIP3 2EY2A 1RD9D 2E75C 3TEYA 1D5MC 1C48A 1STYA 5FO8B 3FRPB 4C2MB 2RSOA 2N88A 2W54A 1ESFA 2B2UC 4KTAA 2X69A 3J81E 4JWUC 1CZGA 1I6VC 4XXEA 2M56B 3OWFA 1Y1WB 1CK1A 1VZ8A 4HSVA 2MJEA 1GHJA 5FR3A 1PFNA 1VDZA 3M4OB 1IKLA 3IKJA 3BVGA 1TKWB 5G5GA 5TSSA 3AE4B 4X3SA 2WKDA 3VR3A 5BMGA 4LK1C 1CA5A 2WXJA 2CJNA 3IFDA 3M85A 2DLBA 1CTMA 4WURA 3BVZA 1U9RA 1IBXB 3RD4A 5CV4A 1ZYRC 4CKBA 3Q69A 4A9AA 1DXMA 1RTOA 5T8IA 1IBXA 1GXDC 3PUZA 2DYMA 3S9WA 3GTMB 5CV5A 3P4RB 2B2TC 2A69C 3NQTA 4KN4C 3C3LA 5E4XA 4XWWA 1L6VA 3DM1A 1K51A 2TSSA 5FKAC 2N9KA 1PTOH 2EYPA 2OT2A 3BVMA 2JP1A 4XQNA 2E3TA 4YSXB 3ETRA 2PZWA 2H1EA 1JB3A 1AN8A 3J80E 1SB3C 4KKTA 2JYEA 2EELA 3D6CA 2WU5B 3DHQA 2B63B 1CZWA 1TU2B 3J80L 3VRAB 1DD2A 5EKKA 1R4QB 3TN2A 4L2YA 1PGBA 3DWPA 2F0SA 2B2WA 3HS0C 3A7LA 5CORA 1KAAA 5M5WB 4V190 4OVZA 4FO2A 4F7XA 1F0ZA 3B2FA 2EY6A 4J1MA 4ME5A 1ILQA 1WTOA 1XLPA 1HFNA 3HRZC 1C79A 4PMWA 4OZCA 2K32A 1ESRA 2J7ZA 4Q2JA 3G7LA 3GV3A 2PNRC 1WVLA 1QWYA 4K5VA 1K52A 1E2WA 5ISRA 3ND8A 1RM6C 4XDCA 3AMZA 5CV8A 4OO1G 1VRAB 4XWTA 1OXVA 2JU6X 4JWSC 3AE6B 2F0GA 1F9QA 4FXCA 3L3OC 1PTOB 3Q22A 2KQ3A 4TQUS 1SFOB 1D1KA 1K50A 1XCTL 3PUWA 1BO0A 1AWDA 3FVQA 5G3LF 2LUMA 3HZXA 2WXMA 4NJCA 1P7EA 3I70A 4ZRQA 1FD6A 1V43A 2WXRA 1EWHA 2RVLA 3L9AX 4ZUJA 2BW2A 3AEAB 3IT4B 2XWJB 3NK9A 4L23A 3NTHA 4C3IG 2IX1A 3T3OA 2HCCA 1K83B 3QOLA 5ELDA 3NHHA 1LT3D 2F3WA 1UUPA 3TUOA 2Y5PA 1XCQL 5JPNC 5BYRA 1TWHB 2O5JC 3W9CB 2KACA 3F2UA 4CBVA 1PXUA 5C44B 4IFDJ 2XNAC 2K28A 2SAKA 4OGQC 2F0KA 2FINB 3E5SA 2ONQA 1HZ6A 4A3EB 2L9HA 1SNOA 5C4JB 4DXGA 1J7BA 1YN3A 1BNZA 1MSGA 4OZBA 3P7JA 4HKQA 4PQXA 2CW0D 4WAFA 1S5FD 3GV6A 3LX0A 1GB1A 1PRTC 2BCOA 2R6GA 1Y8NB 3GTJB 5JVG3 3K5MA 2L11A 3VR4A 3HOWB 1HQMC 2OHFA 4ID6A 1FR3A 2CU3A 1NR2A 1UNSA 1EFID 4K5XA 3B2GA 4KI0A 5I2YA 3FPPA 3ZJTA 4YT0B 3AB9A 3H09A 3TSSA 2EOTA 2QILA 2B76B 1LTGD 1J8IA 3SDZA 2F0NA 2RA4A 4A3GB 4XT1B 4GDLB 1NSNS 5JPMC 1WRIA 3AE8B 5C3WA 4NZLB 2RDHA 4KKSA 1H9KA 3MC0B 2NVQB 4R9WA 2EY1A 2CQAA 3NBIA 4GDKB 4A90A 2IX3A 1C4PA 2KVMA 3AE3B 3CHBD 3I90A 1IGCA 1E6EB 4K14A 3NPPA 2MEKA 1WSPA 4TSSA 4OO1I 2O2LD 2WP8J 3R3OA 2F1MA 5IOCA 3BG3A 2IT1A 2EYJA 2HDEA 2B8FA 3MHZA 4ZLTF 5AFWA 3SXHA 5I2XA 2BE5C 2IX0A 1Z6HA 4J8QA 2PW9A 4NW2A 3I9V1 5C2TB 3GS2A 3A56A 1RCVD 2ACZB 3PO2B 1QOBA 5AUIA 3DWMA 1WTVA 2CVRA 5BYQA 4G4KA 3CKIB 4M1UB 2SEBD 4RAUC 1R7SA 1Y8OB 3AV8A 3X3MA 2JYTA 4H44C 2B2VA 2LS01 2ICEC 2SDFA 1XLQA 2FE8A 4ZRZA 1WCMB 3NVZA 4C3HG 4RA8A 1NENB 3AECB 1E0BA 1S5BD 4FF2A 3HOXB 1B50A 2J4XA 1G8ZD 1YNJC 5IGEA 1PTOD 2E2JB 3BDLA 1EIGA 3D8GA 3MEHA 3EGRA 1EOTA 3D4DA 2MJ8A 3C46A 2C9OA 4YIJA 1SNMA 3MA2B 4X3UA 1WWTA 3MWYW 2BB5A 2K5WA 3VYTA 2Z1CA 1YN4A 1LT6D 4N9TA 3IFTA 5KEEA 2BS3B 3DEOA 4R3DA 2EE1A 3D4RA 4A6QA 1FO4A 1VF7A 2B2UA 5E1FA 3OWEB 5EPKA 1TKYA 2KDMA 2PQEA 5H8YE 1N61A