4UDUC

Crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
224
structure length
218
Chain Sequence
b'KDLRKKSELQRNALSNLRQIYYYNEKAITENKESNTLLFKGFFTGHPWYNDLLVDLGSKDATNKYKGKKVDLYGAYYGYQCAGGTPNKTACMYGGVTLHDNNRLTEEKKVPINLWIDGKQTTVPIDKVKTSKKEVTVQELDLQARHYLHGKFGLYNSDSFGGKVQRGLIVFHSSEGSTVSYDLFDAQGQYPDTLLRIYRDNKTINSENLHIDLYLYTT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN, T-CELL RECEPTOR ALPHA CHAIN C R
publication title Structure of Staphylococcal Enterotoxin E in Complex with Tcr Defines the Role of Tcr Loop Positioning in Superantigen Recognition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 57
structure length 218
sequence length 224
ec nomenclature
pdb deposition date 2014-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4uduC02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4uduC01
2G9HD 1PZID 4K6LA 1FGBD 1LLRD 1S5FD 1LO5D 2AQ2B 1LTRD 1HQRD 1D5ZC 1PTOH 1RF2D 4BWGB 1LT4D 1KTKA 1SE3A 1SE4A 4RH6A 1KLGD 1HTLD 1ENFA 1JWSD 1EEID 1TY2A 2CHBD 4RFBA 5ELFA 1SEBD 1SXTA 1PYWD 3EA6A 5FKAC 4RGNA 1STEA 1D5MC 3BVMA 3OWEB 1JR0D 1CHQD 5ELBA 1YN5A 1LTAD 1XXGA 3KLSX 1F77A 1BCPF 1XTCD 2IPKD 1CQVA 1I4GA 1LT5D 4RHRA 1LT3D 1EU3A 1UNSA 5ELCA 3URYA 4C56C 1UUPA 3R8BA 4TSSA 3V05A 1YN4A 4DXGA 3O13A 1D6EC 5ELDA 1CK1A 1PRTB 2AQ1B 1TS4A 3BYYB 2AQ3B 4RGMA 2XN9C 2XRSD 1RD9D 1PTOB 1I4HA 1I4PA 1V1OA 5FK9C 3W2DA 1CHPD 1PRTC 1ET9A 1EU4A 2IJ0A 4RGTA 1PTOC 2R61A 2QEJC 1T5XD 3SEBA 1PRTD 1S5DD 1FNUA 4L6TB 4RCOA 5D3DA 1QILA 2XNAC 1V1PB 3BZDB 1GOZA 1I4XA 1PTOD 1TS2A 1V1PA 3R2IA 1JQYD 3R2TA 1HXYD 1EFID 1L0YB 1PZKD 1LT6D 1LTTD 1PZJD 3DWQA 1SJHD 2RDGA 3EFXD 5ELEA 2J4XA 1S5BD 3BVGA 1TS3A 4ZYSA 1JCKB 1DYQA 1LTBD 1G8ZD 1LTSD 1JWMD 1JWUD 3DWPA 2ICIA 1ET6A 1YN3A 1D5XC 3MC0B 1FNWA 2SEBD 1SBBB 3MFGA 1AW7A 1BXTA 3DWAA 1BCPB 4O1NA 1I4QA 1FNVA 1AN8A 2QILA 2O2LD 1B44D 1RDPD 2WV6D 1L0XB 1M4VA 4RGOS 1EWCA 3TSSA 1BCPC 1DJRD 1SE2A 1MD2D 3BVZA 1PRTF 2NTTA 3GP7A 4OHJA 5I4DA 5TSSA 3BYTB 1FD7D 1EEFD 4Z9CB 1CT1D 1BCPD 1ESFA 1SJED 2XRQD 2Z8LA 1LTGD 1PTOF 2RDHA 4NZLB 1KLUD 1S5ED 1S5CD 4L63B 1TY0A 4RHSA 1I4RA 1RCVD 1HA5A 1TS5A 4UDUC 1B1ZA 4DXFA 2NTSA 1LTID 3CHBD 2TSSA 5D3IB
chains in the Genus database with same CATH superfamily
2G9HD 4YHHQ 1PH2A 1R4MI 1LLRD 4N59A 2UXCQ 2ASQA 2EIFA 2IY1B 3DBRB 2R93H 4YWMA 1ILQA 3E3XA 4RH6A 3GQBA 4ZCKA 2PNRC 4TQUS 2BB6A 1GC7A 2LVPA 1HQMC 3ZNID 1RHPA 3N6RA 5M5WB 1EEID 1TY2A 3EBEA 3OWFA 2D5GA 2M0AA 1IZ6A 4S0RA 1C4PA 1SAPA 2CVRA 2JA7H 2Q8RE 1KXLA 4LNNA 4GDKB 1CHQD 4K8JA 3G7LA 4K0KQ 1XLOA 2ALYB 3HEJA 1YN5A 1KJTA 1VQ8A 2EKIA 2HUGA 3G4SA 1HTOA 1RAXA 1TKYA 5C3EB 2LXCA 4YT0B 3J7YW 2IPKD 3KBGA 4M0WA 1EQRA 2A5HA 2MBQA 1VZ7A 4CHTB 3RNEC 4CJ2C 3U58A 2L32A 1WCMH 4DR6Q 2K3UA 1VMPA 1XCQL 2KD0A 3LNNA 1TIID 1EQVA 5IYDG 4C2MB 3MFYA 2W54A 3I90A 3PHXB 1BBXC 1YJJA 4DR2L 4BY7G 2WXOA 3PUZA 3NVZA 1C48A 1FYCA 2ID0A 1VD2A 3PZ7A 3I4NB 1GAQB 1GUNA 4KGSA 2CW0C 5IGBA 1RD9D 2E74C 3MP9A 2KN5A 3KQ4A 2F0WA 2YYZA 2C35B 4QUCA 3P63A 2L0TA 4NW2A 1WXAA 3VFKA 2JWUA 1EOTA 3OLMD 1ZXTA 1KRTA 5C4XG 1PTOC 1EIFA 5E6JA 2ZM6L 1PDXA 1G2SA 1NE3A 3PIO3 2K50A 3ZGZA 2VY3A 1Q1OA 2BW2A 1GOZA 1J7BA 5AJ3Q 3IT6B 4V0BA 3W9CB 4RAUC 3SFEB 4ZKBB 1FPYA 4FXGC 2EYFA 1L0YB 2L4NA 2JK8A 1WTVA 5KIXA 2KFKA 2V3SA 3DQVA 3EJIA 1P16A 3ZRCA 3DEPA 1UD7A 2N9KA 5DM63 1O78A 2B63G 1E9MA 1Q0WB 4A3OA 3BS1A 5BMHA 2OTLA 2L5TA 1LGRA 4LDTB 2PNHA 3K8AA 4MGYE 4B9WA 3KF6B 2GBNA 3F2BA 5DLQE 3BY4B 5IP4D 3GV6A 1JWMD 3P4QB 3LYYA 1P7EA 3X23A 3A0JA 2K5WA 3I3CA 3NTHA 1T3QA 3TEWA 2A19A 1FJGL 3PSIA 1D1IA 1YOVB 1DOIA 3SR1A 1XNQL 1KM7A 2IY5B 5G2NA 2GVBA 4FF1A 2K7VA 2C60A 1ML0D 4XC2A 4LDTD 1Z47A 3T1HL 4DU9A 5BO4B 4DAPA 5GROA 3IL8A 3HP3A 4JGHB 5EBCA 1JC7A 2KCCA 2FXQA 3GTLB 3MJ5A 1FVIA 3TRZA 4BOSC 4MM3B 2KO3A 5EE1A 3QARA 1SB3C 4XQQA 5LL6X 4TMAB 2KCNA 1SJED 2Z8LA 2V3PA 1YEZA 2FIFA 1RL2A 1F9RA 4XIGS 5CBEE 4GKKQ 4LFCL 1B3AA 4XQNA 2K28A 1SYGA 3N32A 4DR7Q 3D31A 1VQPA 2J0JA 5EGTA 3DBLB 3A8IE 1EFWA 3AEVA 2D07B 2LUMA 5JXVA 4GLAC 4RM9A 1IYVA 3VXWA 3B2FA 4PMBA 2N55A 1O7IA 1ASZA 1VQCA 1XMQL 4BXXG 4RCNA 2QKIC 1X56A 1JRPA 3A5UA 3VYRA 3S15H 1WJ6A 2ZNVB 4A3EG 1V80A 1D5ZC 3NUCA 4C3IG 4YWLA 3NELA 1MI0A 1S3SG 4WAAA 3PLVA 4DV2L 1UWXA 2EMTA 3DMUA 4UAIA 3KFUA 5T1IA 4OZAA 5FLMH 4KN7C 5C4JH 1SNQA 4DV6Q 2EQSA 1D5MC 2GN5A 4ZRJA 4PG3A 4GDKA 1N34L 4IUQA 3HKZE 1S1QB 3FP9A 2DYOA 4RKBA 1WE7A 1UAPA 1YJ9A 2IX1A 4GLXA 4JI7Q 1F77A 4C3HH 2MO0A 2L15A 3SDZA 4ZK9B 2R7FA 4OO1H 1WFYA 1H9RA 3GTJH 4II3B 3URYA 3NWSA 2JXTA 3HVDA 1ZXIA 3QO2A 1E7VA 4A93B 1UE1A 2DUDA 1KQSA 3HOVB 1NVID 1KH0A 1ZOYB 2LGDA 3OW2A 3CWIA 1D6EC 3VUXA 1F2LA 2V4IB 3Q22A 1DGJA 4A3GG 3GOEA 3V6CB 1VDZA 1Q1EA 2BYTA 4HJ5A 3P4SB 2EY5A 1SNDA 2H88B 1I4HA 3EECA 1TU2B 3OPOA 4OEMB 4P1CC 4WWPA 2KZRA 2AEHA 4G3XB 1ET9A 1C76A 1VQ6A 1IW7C 5G3LF 4IUTA 5AFWA 5IP9H 1ZYRD 2PQAB 1S5DD 4FVMA 3CCVA 2WS3B 1UE5A 2XNAC 3SE0A 4A3IG 3U9SA 1S72A 2IGGA 2KK8A 2WB1B 1I4XA 1TS2A 2PMZE 3HOXG 2KKCA 3K7UC 2IO1B 4LJZC 2F0FA 2N9XA 5C0XJ 2DY8A 2PJHA 4P7IA 1JICA 2UUBQ 3PO3H 4AYBG 4GN4B 1LM0A 4P6VF 3ZTCA 4RM8A 5FO9B 1OEYJ 5LMUQ 2NVUI 2DNEA 4ZYSA 3M4OB 1WJJA 2RHQB 4BA2I 3GTMH 4GOPC 4YSXB 1UE6A 3MXUA 3QWZB 1PQSA 4FHKA 2KQ3A 3KF6A 5CX3A 3PS6A 1HPCA 3NTIA 4IUPA 3H7PB 5C44B 1DOLA 2K5PA 1WD0A 1TTNA 3FKIB 2NYZD 2Y5CA 1V6EA 1IBLL 1IGCA 4R8IA 1FCCC 1Q12A 4N6EB 1FNVA 2LEKA 4US9A 1L1OB 1WJUA 4HPMB 2IWHA 1F9QA 4YTPB 1YX5B 2JU6X 2ICEC 3PUWA 3I2ZA 1WRIA 2D3CA 1TR5A 3EFUA 2Y5BB 3S2HB 4MM3A 3BYTB 1FD7D 2L05A 5DNFA 4KMUC 3SXHA 1Y8RC 4MDKE 1JJGA 3AE4B 3WAPA 1IGDA 1K8GA 3I56A 4M00A 4NZLB 1DOKA 4JL9A 3HFZB 4DR4Q 1NR2A 3MEFA 5HFYA 1MG4A 2FE8A 4XZ4A 4LFBL 1WXVA 3SU8X 3A9JB 1JALA 2HTME 1TS5A 4DK0A 1VQLA 2AMCB 4KKUA 2F0LA 5CV4A 1Q82C 1Y1WH 4NXNQ 4WAFA 3SK4A 1FGBD 4KY5A 2AQ2B 2EKEC 3H9DA 3ZUNA 2E3TA 1MKHA 1CSPA 1TWFB 4EZKA 4QY7A 4LNQA 4KHPQ 2WXRA 4YWKA 1HTLD 1GUGA 2KDMA 2LHEA 5AZHA 2SAKA 2RPVA 3BVMA 2FMMA 3J81E 3QC8B 4IOIE 1CZGA 3AU5A 2F3WA 2Z6KA 3CMAA 1XMOQ 2CHXA 1WMHB 3K0XA 3Q24A 4W9LA 1U4AA 1PH7A 1XPUA 1PVOA 4JBJA 5C3XA 3ETRA 2BT6A 2B3GA 2LGIA 3NZUA 4AP4C 1G2TA 4W9EA 2F0QA 5C5MA 4M01A 3NHEB 2BDOA 4M8NA 1FL0A 3VR3A 4JI2Q 1F2MA 5IP7H 2ZCBA 3AE6B 5IA7A 2KN4A 3Q6SA 3J7AF 5JPNC 1PA6A 2E2DC 2AL6A 1HRJA 3BK2A 5KRUA 4H02A 2K04A 2LXKA 3J80E 3EROA 5M5YH 2K32A 1TVXA 1HZ5A 1C4CA 1RRBA 1VS0A 2RGFA 3OSOA 2NB0A 2JA5G 4MSMB 2D62A 1TWHB 4WWOA 2N3SA 1C3TA 3AEDB 2WAQB 3CC2A 1WJNA 2QEJC 4I7AA 1FNUA 1STYA 1B2TA 2PQAA 3ZDMC 1CM9A 2KQ7A 3AQQA 2UUAL 4A3JG 4ZDVA 3UDIA 1QJOA 1JWAD 2KWUB 3ZJYC 1L2FA 4BBSB 3TEZA 3R2TA 1QOBA 1I94L 3SK6A 3U30A 1LT6D 5GAEC 1LXDA 2L0CA 2E5LQ 1MVKA 2LASA 1PFSA 3UDXA 4K6DA 1F1HA 1TS3A 2A69C 2E75C 1AWDA 4BY1B 4AIMA 1G6ZA 5H1SE 3A1QB 3CCSA 2RSNA 3MJWA 3WALA 4K5VA 4F88A 1F9PA 2R93B 1SNCA 1L4DB 3A4SC 3H7PA 3TJPA 1SYBA 3SFDB 4R1JA 2L83A 1EWHA 1K83B 5JHBA 3MTNB 2JZPA 3TS2A 2ZW1A 3NJTA 4A90A 5DAUA 5M5WH 2FUG1 3V96A 3HOWG 3H8HA 4DR5Q 2PW5A 1OXVA 4G57A 1L1OA 1JMCA 1CKOA 2K14A 4L5SA 3FMCA 1SFOB 2K5HA 3G48A 1GC6A 3NS1A 1IYUA 2FCNA 3VR6A 4X3TA 1G51A 3V05A 5D14A 4ZRZA 3ITPA 1PUTA 1WCMB 1DGSA 2CJNA 2WXNA 1W2BA 1S5ED 3E5SA 2BOSA 3W3AA 4L63B 3VDYA 5JAVA 2MHJA 4OZBA 3U7DA 5CV7A 4B3ML 2FINB 1B50A 4C2MH 4AQYL 4CDDC 2EY1A 1K9MC 3BZCA 3A9JA 3W5VB 4JE3B 1SYEA 2G1EA 2R7ZG 2N7EA 3IAS1 1HHVA 1KOTA 3I4NH 1MHHE 2K33A 1I6HB 1TWGB 3S1QB 4K6LA 4ZRIA 1CZWA 1D3ZA 2NVYB 1DONA 1ZKOA 3VHTC 1BVSA 4NJCA 1EL0A 1KTKA 1Y56A 2N9LA 1HTQA 1JWSD 5G3LD 2WB1E 3K58A 1PH6A 4LF5L 2F0OA 3BJUA 3N1ZC 3W1SA 2ZTEA 3Q3MC 3PCOB 4JI5L 1RKNA 1HNXL 1UEBA 1A8VA 1YQBA 2D9UA 3NY5A 1EY6A 5IYCH 4A3LH 1UELA 1WH3A 4CJ0B 3KYDD 3W1YA 1NSNS 4DV4Q 1WMHA 1ZDVA 4LF8Q 3QIJA 1NBWA 3NVVA 5CYUA 5KNDA 1I42A 3KJPA 1EY9A 2NZ1D 4BFRA 1UEAB 2LJ5A 1L6VA 1PMRA 4A3FG 4MTNA 3GTGB 2IL8A 1SNPA 2PO4A 5EAYA 2MP2B 4LNFA 3UQBA 2KQ4X 1LTLA 1QQRA 1YN4A 2QEXA 5ELDA 1ONLA 5J17A 1P0RA 1VQ7A 3AE7B 5C3JB 1XNRQ 3BYYB 3D6WA 4MHEA 3U4ZA 3ERSX 4LF9L 1VQMA 1WZ0A 2KACA 2JYTA 1CHPD 3ZNZB 4LUOA 5AZFA 2DZIA 5BN3A 3NBHB 1EUVB 1A2TA 2PCFB 4CKEA 4P1BC 3GTLH 2GVAA 1X1MA 1PH9A 4DR1Q 2BS2B 2EOTA 3RMKC 1PH4A 4EKUA 4NPNA 2I0QA 2WXLA 2C9WB 2MFIA 5FO7B 3NWTA 3JAME 2FUHB 2CWAA 4F87A 3JSVB 5E4XA 3TZUA 1WVLA 2YEPF 4ZYNA 4MTKA 3AEAB 3DVGY 1HA6A 4DR3Q 2M1MA 3WA0A 5IGEA 3BVGA 1QNUA 2NBWB 4LFAL 2DY7A 3Q8EA 1W6KA 3BDLA 3E9HA 3GTQH 2JSOA 3S15B 1E2WA 1XX8A 1YIJA 2KT7A 2WP9B 3A1QA 1VJKA 1F0ZA 2NUCA 1JMLA 3MC0B 2LUEA 2BDNA 1FNWA 3ENEA 4TVAB 2KLGA 1KAWA 1BUVT 3E9SA 4ANXA 1BOSA 2B2VA 2GBKA 1JOQA 4OWTB 2WDRB 3I73A 4J8QA 3AE2B 1B44D 4XXEA 2LS01 4IPGA 3DHQA 2O6VA 4MZ9A 1BCPC 4IFDH 1A3VA 4JQWC 1TYGB 1V5TA 2WHIA 4KV6A 4FA6A 2KBNA 1JRUA 5IGDA 1CJEA 1N36Q 5I4DA 1HTPA 2A6HC 4Z9CB 3G6EA 3DM1A 1R4NB 2BS3B 2V1CC 4DFAA 3H6MA 2XIWA 3SHLA 1Q10A 1C8CA 1KAAA 2QF7A 4BBRG 2ZTDA 4HVBA 3JYUA 3ZJTA 5COYA 3HOYH 1K0RA 2IHFA 3CF5A 3OIPA 4P73A 4RHSA 5IGCA 4JI6L 4H7BA 4A93H 1MFWA 3B6YA 3G71A 3CF6E 2MGSA 3J7A5 2Z59B 4USAA 3J81L 1J5EQ 4LNOA 3C19A 4MIUA 1OQQA 1PZID 2DZJA 2ONQA 3MHZA 1LO5D 4JX1C 2ZTCA 5JHAA 2WAQE 3F2CA 2MX2A 5GADC 4BKSA 4FDBA 1Q46A 3P20A 1UF0A 2DYMA 3TBIB 1TGZB 4JWUC 2KX3A 2I5LX 1YJ1A 3RLOA 5C4XB 1YMHE 2DLBA 2MBHA 1Q3LA 4WJWA 4OVZA 4JCVE 3UF8A 1FM0D 1BR9A 1EY0A 1QOFA 5E4WC 2R2QA 1WI0A 1DOYA 4UY8C 2R92G 4HTHA 1UWMA 5LNK1 1RM6C 5GMVA 3QWNA 1ZE3D 5JEAH 1KRSA 4P75A 4GN5A 2KMMA 2SNMA 3H0GG 5JOBA 4ZUIA 4X66L 1EIYB 2KXJA 3QCAA 3JC66 4GNXB 5HGQA 2B63B 2MJ3A 2N7JA 2KC1A 4RMFA 4TSSA 3OJ4B 1BNZA 1GM5A 3WWVA 2MP2A 4HJGE 1PGAA 1E1TA 1WXQA 1AE3A 4A4IA 2KOXA 3K81C 2W3SA 1N8RC 1SYFA 3FKIH 2UUCL 1JE4A 3U7ZA 4HDQA 1QB5D 2ZXPA 5K36G 1V2YA 2BGFA 3NS8A 3CW2C 2FBWB 4KKJA 2J52A 5G5GA 3HRZC 4O0AA 1XLNA 2HQEA 1KRHA 1E8YA 5HI1A 4B3TQ 1R4NI 4HJ9A 2A4ZA 3BIID 1NY4A 3JAMi 1OEYA 2E2HH 1BBUA 3MXNB 1W3SA 2GI9A 2PIAA 2F0DA 3APFA 4FXDA 1YHAA 2E2IB 3M7GA 3S2HH 1QKZA 2MQJA 2OQ0A 2IX3A 2X69A 2DBYA 3TP8A 3R93A 1WGDA 2N1WA 5BYRA 2IZVB 2WYQA 2F0VA 3LWEA 2W82A 4HDOA 2YVCA 2I5MX 3VYSA 2VQFL 2C7HA 4LUVA 3JSVA 1HUMA 4KY6A 2D11A 4KSKC 3MXPA 5EKIA 4LF6L 1WGKA 4NJ6A 1L4ZB 5M3MB 3PRPB 2XVSA 4G7ZC 3QJZA 4PMCA 1P9DU 4DV1Q 4IOAA 2ON8A 1E90A 1OXXK 4A3EB 1TWFH 1GUWA 2JZ3B 3DHHC 1N9WA 1EWYC 1KLVA 2LY7A 3ULLA 4FYDA 2VQEQ 3ICEA 4CHKA 1B53A 3MAQA 1SGHA 4IDIA 2BH8A 2AWNA 2F0EA 4FO2A 3NZ3A 3CCQA 3TN2A 2KENA 1PV4A 4DAYA 2AX5A 1S40A 3UINB 4OHJA 4DBGA 2NBUA 2INDC 1IXRA 3OTOQ 3ZXVA 4DV0L 5LMNW 1IKMA 1WE6A 1AZPA 2WWZA 5DPTA 1YBYA 1HNWL 1EYAA 3NOBA 2V4DA 3LWUA 5FR6A 1QOAA 5LMNL 4FJVB 3CCUA 3N30A 2K5NA 2HHHQ 5IYBH 5AUKA 4YIJA 3RMHA 2GA4B 1YNTE 1PH8A 4JPSA 5C0XG 3L4PA 2W55A 5IN7A 1Q8IA 4ZKCB 4JBWA 1ZP0B 2DAJA 3I4MG 4A3GB 1MJCA 1NJIC 3M4QA 2QA4A 2WU5B 3KUDB 2M4NA 1Z5SB 5IGGA 4NXML 1ROEA 3E6ZX 4ZQ3A 5K5PA 2J0MA 2PKOA 4DNRB 4LF4L 3R3MA 4JYAQ 1TWHH 4ANVA 2BKFA 1K73C 3NENA 1K28A 3S1MB 1SEBD 4WIPA 3EA6A 4M02A 4US8A 1N33L 4R8NA 4LCDE 3HRDD 3ZDTA 2F4VL 1KHIA 4N58A 1FGUA 3VYUA 1SNMA 2V1YA 1H9KA 4DUYQ 4A3IB 3R7QA 1E1OA 3L08A 2DWQA 3HOXB 2UXDL 1TKEA 1A2UA 3DHGC 1XXGA 1TWCH 2OOBB 5AUIA 2GRIA 1IBML 1I4GA 1WR1A 1H9MA 2KHIA 4GS3A 4AYBB 3EQLC 3SVMA 2BWFA 4K81A 4GNXA 1X32A 1JOKA 2EPBA 4R4CA 1S4ZA 2E6XA 4KIKB 1SMXA 3T53B 1A6XA 1FRRA 1Z2MA 3ECIA 2KAJA 3Q0AA 4I6LB 3RUIB 3TEHB 1CK1A 1M94A 4HIMA 1K83H 1Y1VH 2AQ3B 3RZWC 3CQZB 3G6JB 4NMZA 3JAML 4LF7L 4QCLA 1YQ3B 4RG1A 3DCGA 3PMFA 3Q3NC 4A3DG 3UE1A 1QZEA 2F0GA 2JEBI 1SFOH 2LSSA 3BZKA 2WXHA 3EUB2 3M62B 1WTRA 4GSWA 2OEOA 4KY7A 3MXNA 3ZYYX 1B70B 4HCNB 3WAOA 1EZ6A 1D4BA 1GG3A 4W9CA 4B9XA 1TIFA 1E10A 3VYTA 4AH6A 1XCTL 4NNJB 4HROA 4GOCA 2NN6G 1PZKD 2YV5A 4WJ3M 3APCA 5EE3A 2WDQB 2K6QA 1SIFA 2BA1A 5FLXc 4AJYB 4J1MA 1B9RA 4A75A 4R9WA 2XK5B 5GQOA 2INCC 3DVGX 1HNZL 3HIZA 1LTSD 5IIFA 3ND9A 5E7NA 1TWGH 3S1QH 1I6HH 1WI5A 3QOJA 4Y52H 3T8MA 3V62A 4PV1C 2NVYH 4NPSA 4PS7A 5M3FB 1GHJA 2L76A 5KYIA 4NAMA 4OONA 2L8JA 2JRIB 2MJ8A 3B0AA 4G7OC 3R7RA 5EKKA 1E8WA 1MI2A 5IKCM 3H91A 4F1SA 1E8XA 1LV9A 2WV6D 3PF4A 1SE8A 4IG7B 1NI3A 3L9AX 1KIXA 2AWTA 2MUYA 2UU9L 2BF8B 4KZCA 2XRQD 1TWAB 2VZKB 2KDBA 3MZ5A 2ACZB 1ASYA 3TQYA 1C79A 3DBRI 2RDHA 4BZAA 1U4MA 2B3AA 3GTGH 4H44C 4B0EA 2Z0EB 3CIRB 2W3RA 2E2JB 4K2KA 5BYQA 1TKWB 2F0MA 2M17A 4A3BG 1QOHA 3S17B 4UP8A 1EQTA 4LLGM 2KTFA 2VZKD 3AH7A 5FJ8H 3HOUG 4AUQC 4QB4A 1U4LA 3T56B 5I6WA 4EEWA 4JI3L 1BMLC 1V8QA 1NAPA 3L3OC 5IT9c 1LT4D 2K9XA 3VA7A 3P1HA 4GLVB 2DNCA 5EPLA 3M85A 2IHEA 1YZ6A 2JT4B 3HHMA 3UIPB 1ENFA 3DPDA 1G6JA 2JA8G 4OWWB 2ZNVC 3RD4A 3VAWA 2VB2X 2Z6BA 5HY6A 4P16A 2KVMA 5CBAE 4REZA 1VR9A 2DAFA 1EWIA 1HFGA 1RJTA 2L11A 1IBKQ 4KJOA 2I38A 3F8TA 2DENB 1VQEA 5E1FA 3T51B 4A55A 1CTMA 4B0MA 1GO3E 4JI0L 2UXBQ 1VQDA 1XTCD 2Z6KC 1CQVA 3CMMB 2GBMA 3F2DA 4RHRA 1LT3D 2RDFA 5EJWA 2A6ED 2AHOB 5ELCA 3U52E 3GTQB 1EM7A 1V8CA 2B2YA 4IZ8A 3RN5A 1STAA 3L0WB 3TIXA 4WWMA 1DZ1A 4KIKA 2KCTA 3RD2A 2WQYB 2M9VA 2Z0SA 1EYGA 1OQYA 3A4RA 4NDXA 2AQ1B 4QQBX 4JWSC 3STBD 1R4PB 2Y0SE 4D2KA 1QE6A 1YHBA 2N49A 1KL9A 1ZYRC 3QA8A 3HOWB 1UBIA 1C9FA 3PO2G 3C1EA 1IPGA 4BBNF 1BQQT 2BYVE 1DOXA 5GXGB 2HCIA 3QR8A 3M4YA 1T5XD 2ATWA 5D3DA 3GB1A 1H9SB 3CPWA 3AE1B 3HOYB 1V43A 2K1FA 4IWOA 1F2RC 4GKJQ 2EZVA 3D8GA 3VR4A 1SJHD 4JV5L 3HM6X 3K80C 5J2RA 4PNYA 4X65L 5IYDH 2XK5A 4BY7H 1UZXB 4L5RC 2O2VB 2BWES 1DYQA 1I50B 2R7ZB 3HG9A 3EC8A 2VS1A 4FXKC 5D94A 2Z4IA 5EPJA 5J3BA 4B3SQ 3KUZA 4FN2A 2K8CA 4EQPA 2I07B 1YJWA 2K22A 3NSWA 1AW7A 2F4IA 3RNUA 2WXFA 4YWGG 4K7SA 2V9HA 1CZPA 2G9DA 5LHY1 2X6LA 5C4XH 4A3MG 1RDPD 3KW5B 4RGOS 2MBEA 1EWCA 2HQLA 3RN2A 2KA7A 2N4FA 3A9KB 3ZW3A 5I9OA 4UHVA 4OVVA 3HKSA 3F1ZA 2MLBA 4LMQD 4X64L 4AYBE 4DV3Q 3V2TA 4QGUA 1L1OC 1C0AA 4OX9L 4KDLB 1K0SA 1DCZA 1ESFA 2JYEA 2AUKA 3BWUD 2C7NB 4MT5A 2K6AA 2MQHA 2Q2UA 1NI2A 2B63H 4RF1A 1YI2A 4JI4Q 3ONAB 3RNAC 1EOVA 3ZJUA 5EDSA 4YCUA 4ARIA 2HJ1A 2Q8TA 4KGTA 4A3CG 1C77A 2LZ6A 1RODA 1CQFA 4HCEA 2MWSB 3L54A 3ZIMA 4IFDI 1E2VA 4DV5L 3C2PA 2TSSA 4KHVA 4GU2A 2B76B 4DDID 5BR8Q 1PHJA 1WTQA 2J0KA 1JROA 1YIWA 4RMAA 4ZLTF 2E2HB 1KLGD 2DJGC 1PH3A 1SMYD 4R4TA 2JXMB 2IW3A 5IWAL 3L13A 4HCPB 4DDGD 2PW7A 1WFQA 1GB1A 2OQKA 3B08A 4L8JA 4KHZA 2E2IH 4MELA 2WXIA 3E9IA 4RA8A 4K5XA 2G4SA 2IX0A 1WX7A 4J6IA 5BN4A 4PZ6A 5E6PA 1LM8B 1KD1C 1JORA 3PZ8A 2OJRA 3RULA 3NTKA 1CSQA 1ICFB 1EU3A 3R66C 5J22A 2VW9A 1N6ZA 2A68D 4DPGA 5JJKA 4ALPA 5C3EG 2LHDA 3DDCB 4BXXH 1B9MA 5M3MH 3C8YA 3NZSA 3O13A 1F2RI 3P75A 4W9GA 2IGHA 4MH8A 4QF4A 4A3EH 2KFJA 4GMVA 5CHWA 3HGBA 3I4LA 4PQXA 4RGMA 1AARA 3PTFC 1WTHA 2BYEA 3VDZA 2BVCA 1N32L 3ERQA 4JLCA 4ULLA 3VA5A 1PDQA 1AE2A 4S3SA 3CU7A 4MJSB 4KX6B 4O2DA 2K8BA 4B08A 1VF7A 1Q81C 1A0IA 2D2QA 1O7ZA 5LXHA 3CC4A 1H9SA 2D5DA 3MWYW 4BBRB 1HJPA 2PQEA 1JWBD 4K3BA 3GZNB 3RZDB 4N9F4 1LTTD 1J9OA 4DV7L 4E3CA 2BCOA 3AI5A 4N8FA 2JX5A 2N7DA 3C1FA 1STBA 5C1ZA 5FR3A 4ZRKA 2VB3X 4FNFA 4IN3A 4YY3Q 4CKCA 1YNJD 2O2VA 2Y3AA 2ZCCA 4A3GH 4DUYL 2BYFA 1N62A 5I2XA 1XEEA 3FKYA 4EFOA 4QL5A 3BU2A 2AUJD 3ZNGC 4MN3A 4CQNA 3NXWA 4PMWA 1NBFC 2PPHA 3K9OB 2BA0A 1ZEQX 2I1KA 5GAGC 3S1MH 2K52A 2QILA 3RN9C 1VQHA 1T0RC 2DGYA 1M4VA 3AE3B 3SK5A 4YHHL 1XPOA 2WACA 2DNFA 5J1ZA 3A9KA 2B2VC 2N0SB 1LUZA 2UXCL 4K14A 4A3IH 2BTEA 4EVOA 2LGXA 1TWCB 3HOXH 4PS3A 3KLWA 1YNND 4W9FA 3DWMA 3KVFB 3AXCA 3TP6A 4XQJA 1L0VB 4HK2A 3H0GB 5HGTA 1FXAA 1S5CD 4AWJA 1EY7A 3GV3A 2KECA 3QX1A 2CFMA 1N5WA 3CCRA 1QCBD 1TT5B 4K0KL 1W6JA 4A3KG 3EGRA 2WINB 2WX0A 3V3XA 4X62Q 1AH9A 3T9LA 1NNXA 4R4IA 3U2SC 1FD6A 1AYFA 4V190 2ENBA 2N9EB 1Y1VB 2MW5A 4GN1A 2HIVA 2X38A 5D2MB 4H2AA 1JJCB 2EJGC 3CQZH 3K57A 1E7PB 1FRDA 2L7RA 1LTRD 2A74C 2LXJA 2KEDA 1HR0Q 4DR6L 2O6VB 2XGTA 1P7FA 4WJNA 1SE3A 4DHJB 3GS2A 4P2CB 2P5ZX 2RMMA 1B4OA 1QG7A 3I70A 3T1YQ 3AECB 3VR9B 3I9V1 3B9JA 2CHBD 3IAM1 1PYSB 1M1KC 1E7UA 3KWVA 3GZNI 1JR0D 4JVZA 3PVLA 4C1NI 3UE0A 2HE7A 4B3RQ 1MHXA 1T0QC 1Q1BA 3S16H 2KANA 2O6VD 3TEYA 3IBEA 3M7NA 2KDEB 4DHJD 2QCPX 1T5EA 1PXUA 4GZYC 1XJVA 4JIOU 3VRAB 4KKIA 3RZOB 4XDCA 4HJKA 3KLSA 3AB9A 4ID6A 5EKLA 1MJEA 1STGA 1UUPA 2B39A 3NK9A 3R8BA 3HOZG 4M8AA 3M3YB 2KJ6A 3ABVB 1U0LA 2K25A 5AJ3L 3OMCA 1WYDA 5KEEA 1I3QB 2OF1A 1A63A 1RYJA 1ESRA 4POGA 2KMCA 4K7UA 4NKLA 2K0PA 5IODA 5M3FH 2CWPA 2QCZA 1WM2A 2O4XA 4J15A 2XN9C 4JI8Q 2NVXH 2XRSD 3HOVG 1T9HA 5I9PA 1YX6B 2KC2A 2ZJRA 1PGXA 5TR5A 4EUTA 3K5NA 3W2DA 3AYHB 3CCMA 1ISNA 2SNSA 1G291 4CGYB 1SDFA 4BKSD 3KYHC 5IY0A 1GJZA 3GTOB 4ODGA 4TQ1A 2ES2A 2HDMA 4IALA 1GUTA 1TJEA 3AEGB 3ALBA 2QDLA 4MJSA 4L6TB 1QILA 2HTHA 1TWAH 2L0FA 3FDTA 5LLIA 4LJPB 4WJ4A 4F8MA 1D2BA 3VR5A 3FHWA 4DR2Q 4DAVA 3M63B 4ANWA 5IE8A 5E6NA 4IM2A 2RDGA 1Y8NB 3EFXD 5CV9A 4K1RB 2WB1G 1WF9A 2E2JH 3HS0C 4MEMA 1VQ9A 4OZCA 2G5DA 3AMUA 3S17H 1R7SA 2MO1A 4DXAB 3TMPB 2CR5A 2N1VA 4LTUA 3VTVA 2CCZA 4GKKL 1M90C 3AN1A 3I4MB 1ZKHA 1MGSA 1Y8OB 4DR7L 2ZXOA 1MJDA 3MFGA 2JA5H 3C0RB 1K3BC 3K7AB 2UXBL 2ZM6Q 5BMIA 4GN3B 1WYWB 1XD3B 1WSPA 2WDTB 4YCWA 5C44G 1AN8A 1Y14B 1IL2A 2GOWA 3AE8B 4NQLB 3VUYA 5E3FA 3ULJA 4PZ8A 3APDA 4A3JH 3HM3A 3H6NA 1STNA 1NYRA 1M8AA 4ABNA 3BVZA 1PRTF 2JQOA 4IQZA 4JOIA 2D0OA 3GTPB 4FJZA 4R3DA 4I6NB 3O65B 4IM3A 5E6OA 4CO7A 4BVUC 3EHVA 1X6OA 4OIKA 4DV6L 1PFBA 2B2WA 3DXJC 5BN5A 1FJGQ 3PIP3 1O7YA 1V9PA 1CA5A 3J9CA 1XNQQ 1ENAA 4KGRA 4XYQA 1I4RA 1I35A 3N9YC 2HDEA 4JI7L 3NEMA 1ZW7A 2DJFC 1PH5A 1Q5WB 2JUOA 3K9PB 3T1HQ 4ICVA 3S2DB 3AFQA 3KLRA 3TZDA 1YJIA 2VUMG 2FNJB 2L55A 3CRKC 2CKHB 2PYKA 3HOWH 1L6UA 4KZ0A 2AL3A 2MSED 4DAYB 4A3DB 3NHHA 2IY0B 4NY0A 4DGZA 4QJFA 1C9OA 5ELFA 3VTWA 1SXTA 2RA4A 1FIQA 4LFCQ 4FHJA 1HEZE 2K75A 1RIPA 1E22A 2R6GA 4G7HC 3VVWB 1OXUA 3ZXRA 1VQKA 3GDEA 3Q3JA 3WANA 3IFTA 4FF4A 2F3IA 2K4KA 3KLSX 2WXKA 5DPRA 2LGSA 1XMQQ 5BMGA 5C0XI 3VH4B 2BH2A 3T3OA 4BY7B 2F52A 4TRDA 4WQOB 2BE5D 4HKZE 3VR2A 5L83A 4XT3B 3P2BA 1I50H 2R7ZH 4LW1A 4DV2Q 2HDLA 4GNXC 1PFMA 2UUBL 4C3JG 4OL7A 3RYTA 3KYCD 3LXFA 4X3UA 1QWYA 3P42A 4YCVA 2VRRB 1LQBA 5LMUL 2R3ZA 1Q8KA 1T6BX 2KEEA 1N34Q 1V1OA 2PLPA 2I46A 5LXIB 4PT5A 3JVZX 1EUJA 2TMPA 1AZQA 1VQ5A 4CYEA 4Y7NB 4RGTA 4ZHPA 4NB3A 5CGKA 4G50A 2EYHA 1MHWC 2GBRA 3DM3A 2XEWA 3S1NB 4PS8A 3DBLI 3WAMA 3A7AB 5C2TB 2KJHB 4WRDA 1X3EA 5D7GA 1O80A 1F52A 1V5OA 1YQ4B 1Z6HA 4A3FH 2M56B 3UGBB 2RCFA 2JE6I 5JVG3 4HJ7A 3RNFC 4OWXB 2JA6G 1QNKA 4BBSG 1PGBA 3MXGA 4WJQA 3D4DA 2YTYA 4HSVA 4A3BB 3OMGA 3SGIA 3QIAA 2OT2A 2HCCA 3RR5A 3HOUB 4HPLB 4MH0E 4MGZE 2G45B 4IPHA 4HJ8A 1UWVA 4DR4L 3QHTA 4F8CB 5G55A 4BY1G 4CKBA 3WOEA 3PRZA 3L17A 1K8RB 1C7YA 2NMQA 1VCIA 2B2UA 2R93G 3TDQA 1WX8A 2WNMA 1HZBA 2JA8B 3CPFA 5FOBB 1A3UA 2HD5B 2JPHA 4NXNL 1NEKB 1RFKA 4WJPA 4APVA 4HIOA 4HEA1 3HUIA 1SE2A 4HSPA 3UDFA 1SROA 3KDFB 4CDEC 2JA7G 1PFDA 2LI5A 4KHPL 3K5MA 2Z0DB 2EELA 3Q8BA 4W9HA 2D0PA 3NQTA 1LTGD 1PTOF 5T1GA 2QW7A 3UI2A 3X3NA 2ZJPA 2INNE 2J42A 2PZWA 1J7AA 1XMOL 2K1BA 1IBLQ 4KD4A 2B2TA 2FCQA 1WCMG 3OIQA 5DPSA 4C3IB 5I2YA 4WURA 4DXFA 3B1LX 1ICWA 2B8FA 3KUPA 1WGYA 1XQQA 5G5HA 1EF1A 1KNAA 1E5WA 1ILPA 2JSVX 4JI2L 1HQRD 1RF2D 3IFDA 1NENB 2EJMA 2EXZA 2EVBA 2JN4A 4N9PA 4IFDJ 2RCNA 4S17A 1TBEA 3SHQA 3PO2B 5EQ0A 3BDOA 5HHDG 4W9JA 2E8GA 4RFBA 2RBMA 3AFPA 3S24A 3PRMB 4BAXA 5DCNA 3I72A 3BDCA 2A8VA 1JB7A 2F0JA 1RTNA 2CQAA 1HZ6A 3QJYA 1E0BA 3S14H 4LFBQ 4ZAIA 1TZ1A 1R4MB 4BBRH 5FLXE 2L52A 3RZDH 2L3ZA 4M8MA 3MVVA 1E6EB 3NPPA 2F0NA 3FPUB 3EFCA 2OXPA 1UNSA 5FO8B 1VQNA 1ZDXA 3H1UA 4DK1A 2PI2A 1A70A 3TUOA 3AEEB 2WXPA 4A8XC 1ZXHA 1N61A 1KDBA 2B2YC 4WH4A 3PGZA 4TUUA 2K8HA 2E5LL 1PRTB 3D4WA 4TKOB 4ZRPA 2K03A 3TP7A 2A1AA 4YTMB 3JW0X 2L9HA 3PREA 4BA1I 2UYZB 3PO0A 5KNCA 3PHWB 1QOGA 4KSLC 5F2DA 3L7ZC 4A3MB 3D0FA 4DUZQ 2X8XX 2MHVA 2CJOA 5JEAJ 2ZJDA 1PRTD 2M0XA 2R92H 3NBIA 4KD3A 1VF5C 5LL6S 2MBBB 3W5OA 4XTCS 4E6IA 5A2QE 4DR5L 2X6GA 3H0GH 1GUAB 1MPEA 2EXDA 1PFNA 2I2YA 1HXYD 2GB1A 1FFVA 2WLBA 2KCMA 1PZJD 1WIAA 4HR7B 1SR3A 1XO3A 3FC4A 4TQ0A 4IUUA 1Y8PB 5JH5C 2H1EA 4WORA 1JCKB 1YHQA 2WXGA 2KNBA 4L5TA 3TEXA 4Q5VA 5IT9E 5HKHA 3NG0A 1CKMA 1RTOA 5K36H 4POFA 1RFAA 2M19A 1SBBB 3RNGC 2BS4B 3NP8A 2YLMA 2E76C 1K8AC 2UUAQ 1HFNA 3UI3A 1BT0A 4A9AA 4JI1Q 4DQOC 4L2YA 3Q8FA 1SIJA 1UE7A 1L0XB 2CHZA 4XX5A 4HEDA 2EYPA 2EE1A 1I94Q 3K0YA 3S16B 2XWBB 5FLMG 3KJOA 1MG8A 1OTRB 2NR2A 2RDBC 3ZLZA 3I63C 3GTKH 2PI2E 3KDFA 2WP8J 4GLSC 1R9TB 5TSSA 4H13C 1CT1D 2HJ8A 4LUZA 3RZOH 2K39A 4JI8L 1OO9B 3TL5A 4TV3A 2H4OA 1QT9A 3MC9A 4OVUA 1TY0A 4C3HG 2KLCA 3M3YH 4U68A 1TQOA 3AB5A 4OO1G 1TKGA 3I91A 2LRWA 2M8SA 1B7YB 4EQOA 1I3QH 1L2NA 4DV4L 3N20C 3FILB 1HCZA 4LF8L 1RCVD 3QB3A 2KTRB 1MSGA 1B1ZA 4K8IA 4UDUC 1R4QB 2ZJQA 2NTSA 5ISRA 2NVXB 1N60A 5D3IB 1WXMA 3IVFA 4FULA 2Z1CA 2GLSA 4F7ZA 2H89B 4K7WA 2J53A 2RHSB 4YL8A 4BWGB 4G4KA 4CDFC 2D3GA 3S1RB 3GTOH 4HMIA 3X3MA 5HG2A 3SDLC 2BPSA 2RD0A 1XNRL 2KWCA 5KNBA 2AYOB 2EJFC 2KOLA 3B2GA 2IO0B 2L1AA 2V3NA 4B3MQ 4JPBW 5IP9G 3IG3A 5AEKB 1Q86C 1HZCA 4AQYQ 1UGMA 3CAMA 3OHXC 3MTSA 3KOJA 2A6EC 3LGJA 4UP9A 2EY2A 1XYIA 1GHKA 1O7LA 2FHTA 4P74A 1MSHA 3AULA 1IBXB 4NJ7A 3H3VH 4ZOHC 3OAWA 1X65A 1WGGA 4DR1L 1DOMA 4FADA 3PO3G 1JOOA 4LNIA 2F0IA 2K5DA 3R3OA 4YXDB 3PV0A 5C0XH 2BKRB 1B8AA 2B8GA 3KK7A 5BYSA 3STBC 1EYCA 2Q2TA 3I4MH 3K5LA 2JA5B 3Q8AA 4LF5Q 4LK1C 1J8CA 4JI5Q 1TS4A 2A73B 3K7AH 1SSNA 4DR3L 1HNXQ 2J7ZA 2MJEA 5M5XB 5MPOA 3P1MA 3WOFA 5KHOA 3ZRFA 2YTXA 1PTOB 4RNAA 1NMGA 2OEDA 4AJWA 1U5KA 1EO6A 4A3JB 2CW0D 2JQRB 4CDCC 3ZNHB 1EU4A 1EY8A 2IJ0A 3OYYA 3PUVA 3OJ3A 4RCOA 4CJ1B 3N1YC 3ER0A 2KMAA 2DN8A 3GTPH 3FEWX 1V1PB 4N8X1 1PTOD 2NBFA 1CFMA 1D1KA 2FFKB 3W5UB 1FXIA 1J8IA 1JT8A 2EYMA 4DHZB 1IYFA 2W9NA 1X55A 4GB9A 4A3KB 4BKTA 4ZHOA 3VRBB 1N36L 5C4HA 3U4EG 2JEAI 2PW9A 4H0LC 1HUNA 2N9PC 3ONSA 4ASWC 3DUZA 4LF9Q 1ACCA 3PT2B 1SRUA 1JWUD 2KHSA 3S2DH 3MEHA 2FAZA 1Q90A 3AV8A 3ZKJC 3DLLA 1Y1WG 4KV2A 2SEBD 4XYCA 2NVTB 2WXQA 1BXTA 2ZT9C 3U50C 5D65A 5CC4A 5M3MG 4A3DH 1H4RA 3PQIA 4MNOA 2KVZA 4EE2A 1J5EL 3KWLA 2O2LD 2N8NA 3LJ3A 1VLBA 3I5JC 4EZJA 3T3NA 3S9WA 2KDIA 1C4QA 2WXMA 4FBJB 1OGWA 2F0SA 2K01A 3GP7A 2DZKA 2FCSA 2Z9HA 4LFAQ 3A8KE 3PZDA 1IP9A 2NN6H 1WY8A 2Y0SG 5ELNA 2F1MA 4BS9A 3D32A 2I5HA 5ELOA 4WFN3 1SF0A 2N78A 3HOZB 5EE9A 4HAEA 1PH1A 3HKZG 4XDXA 5IP7G 2MRPA 3FILA 2KTRA 3RNCC 4XWWA 2PTLA 4B9KA 1V81A 2JF5A 4OIJA 4IUMB 1SMYC 5FLXL 3A33B 4HRSA 1HH2P 1IHZA 3IT4B 1IUEA 4G0NB 1SE4A 2JYOA 4B6WA 1FXTB 4Y7NH 1NYQA 4KDIC 1XLQA 1STEA 3OWEB 2XBBC 4O42A 1F9SA 3S1NH 4JI6Q 2CU1A 4P71A 5ELBA 3Q6BA 2XWJB 4B3TL 4A3FB 1LTAD 3UQAA 5CTRC 4C4VB 3Q8DA 2A68C 4I7ZC 2Q2IA 5H8YE 4DK3C 2L00B 1X3PA 3CRLC 1IBXA 1BKBA 1HZ9A 3OW7A 1L0WA 3DEOA 1V97A 4L5QA 4G11A 5L95C 1C78A 4A3BH 3HVZA 5JJZA 4KKTA 4DA2A 2YU9B 1ZPSA 3TCAA 4DXGA 3HOUH 5CR3A 1PYBA 3A55A 2JA9A 3IAYA 2KJXA 1SLJA 2NZOA 5A2QL 1TT2A 2AWOA 3RUZA 3RLNA 1T0YA 4WWNA 2D2CC 1I4PA 3TP5A 1WTWA 2JA8H 2PE9A 4YSYB 2LGYA 3H15A 4NP5A 3PSEB 3W1SC 2Y5PA 1E0ZA 4DV1L 4HLEA 2F0UA 4HIKA 4X66Q 2R61A 1QF6A 2NZHA 3M4PA 4QAYA 3AEFB 5IT9L 1X3FA 1IW7D 2MP1A 1C1YB 1GPXA 1JE5A 1V1PA 2VQEL 5L37A 2GMIC 1T0SC 5DEHA 3X0WA 5J18A 4GOPB 3M95A 4ANUA 1TZOA 2UUCQ 5ELEA 1YNJC 5EPKA 2J4XA 2REXA 2LJIA 1VZ8A 3I4OA 1E3PA 1F2ZA 1U9RA 4C3IH 1DD2A 1H95A 1BUIC 3K59A 5NUCA 5I6YA 3OTOL 3DWGC 3IKJA 3DWPA 3UDGA 5IGFA 2KHWB 1YNXA 1WR6E 1YJNA 4U673 1X3GA 1D7QA 3IFWB 5EE0A 4DK6C 2OWOA 3I4NG 2VUMB 2V4LA 2HHHL 1XT9B 2ZPNA 1CI3M 4WJOA 2BQQA 3WIMA 2C5CA 2Q2HA 3PO2H 4YSZB 2LRUA 4MGIE 4O1NA 2IBIB 2FCMA 2KDFB 4TKNA 2IO3B 2ASBA 1K52A 3PIOA 3ZTDA 5M3FG 2JJQA 1YNNC 4ILWA 2VQFQ 3S14B 2DZMA 3ULPA 3W1BA 1DJRD 3V60A 2JZZA 4JYAL 3PGEA 3L0OA 4LF6Q 4X3SA 2MBOA 2RSOA 1V49A 1WWTA 5IYCG 4A3LG 2IGDA 1Z9FA 3SR6A 3CXCA 4JOIC 3L10B 3PLUA 4ACFA 1ZGUB 2LVOA 4KI0A 4C80A 2QGQA 1LACA 3OG5A 2D10A 5JPMC 4DUZL 2FJ2A 2B2WC 5CHFA 3TBLD 4DWFA 4IKGA 2OHFA 4Q2JA 3VR8B 3EN2A 2Q8IB 2UWQA 3VH3B 4C7ZA 1SNOA 1B3QA 4QIWB 4C3JB 1VQ4A 1X9NA 1WXSA 3D6CA 1VQAA 4IM0A 4BBNC 1S5FD 1QZGA 2M00A 2JP1A 1JQ4A 4DKAC 1STHA 3E0JA 3IXSA 2BB5A 4A3MH 4ZUJA 4FLHA 4ICUA 2ZXRA 2EYJA 3I8ZA 4DV0Q 4E74A 3ND8A 2R92B 4MSQB 4KKSA 2EYLA 3H09A 3PF5A 1YVCA 3CKIB 3E0EA 1KDAA 4FP5D 1HNWQ 4X6AH 2LVQA 4E71A 3RPFC 1YITA 3PV1A 1VQFA 5LMNQ 4KJNA 4HJAA 4DHZE 3QAQA 1HZAA 2EY6A 5HURA 2RPQA 5CV5A 1DM0B 3CP0A 5C5LA 1EF5A 1A15A 4IC7B 4OW0A 1OTCA 4AS1A 2PEAA 3LB8C 5GAHC 1BCPF 1VQBA 3I7FA 4P72A 3CCJA 2XTIA 4OGQC 1TXYA 3TREA 1XF5L 3Q69A 4C4VA 2V0GA 3HZXA 3ML9A 2F0HA 3K5OA 4JI1L 4C56C 4A3CH 1LABA 4IPDA 2JA6B 4W9DA 3NE5B 3U4VA 4NXMQ 2F03A 2NBVB 2XSCA 2NVQB 2WU2B 4LF4Q 3A7LA 3DVNV 5H92C 2VH2A 3S2AA 3J81j 3MA2B 3C3LA 3MHBA 2IT1A 1UGJA 1IKLA 5T8IA 3RT3B 1K8MA 1N33Q 1E24A 5IOCA 2K5VA 2QDFA 3RFZB 4EZLA 3AE9B 2F4VQ 1NDDA 2MA9B 4KLKA 2IO2B 2JXXA 5FK9C 2UXDQ 4KTAA 1KC8C 2PVGC 4ME5A 2LKVA 3GTKB 3A8JE 4ARCA 1IBMQ 3NQIA 1WGHA 4HIDA 2Z4HA 4OXPA 3ZQ4A 1R9TH 2JA7B 5JVH3 4IFDG 2Q5WD 3Q23A 4HKQA 3BG3A 3BZDB 4IPCA 3AU4A 4IWQA 1P98A 3R2IA 4KVGB 3QOLA 3J81c 3FRPB 1WTXA 3QQ8B 2KX0A 4HMJA 3UIOB 1GUSA 1GVPA 4EQNA 4JK1C 1XWEA 4GOPA 5DPWA 5C3EH 2L1BA 3T4AC 3Q3OC 4K3CA 1Q7YC 1FFUA 2RQXA 3HOYG 3Q2AC 3L2PA 2CH4A 3MC8A 4A20A 4XWTA 4LF7Q 4A93G 2WGSA 2RF4A 3MHSD 1WJ4A 1LTBD 1G8ZD 2KJRA 2ICIA 3H3VC 1WTPA 2A69D 1YN3A 3SD5A 4IOCA 4ZRQA 5M9OA 3S1RH 3LX0A 3FPPA 3J80c 1E8ZA 3M9BA 1SSOA 3SK8A 3V61A 1QUQB 2QSDA 1WOCA 2NCNA 4C00A 3J81i 2H5XA 1AP0A 3N52A 3C46A 4EGVA 2R7DA 3NVYA 2B2UC 3TSSA 3L16A 1FMAD 2K6DB 4LNKA 4DNTB 4EOYA 3KF8B 2NTTA 4DNIA 4UPAA 1EEFD 1X3QA 1HNZQ 3I57A 1DXMA 4JW0A 1GUOA 2JRHA 1KNEA 3P7JA 1J6QA 5JEAG 2OTJA 2EMSA 3CMEA 5IOIA 1BF4A 1CMXB 1KFYB 2MJDA 1IBKL 3DBHB 1K50A 1OFFA 3AE5B 4JBKA 4GXBA 4CBVA 2ZVOA 3IRBA 4M1UB 1E7ZA 3J80i 2JWZA 5IO9A 3CHBD 2KVRA 3CCLA 2CS4A 3VTUA 5C23A 2B2TC 5CV8A 4IURA 5M5XH 2LFIA 2LXAA 1I6VC 2QDBA 5EBDA 2WX1A 1NMFA 1PTOH 3FKIG 2NPTB 3NVWA 4PZ7A 1Y69U 2UU9Q 4HXDA 4W9KA 3GO5A 3H94A 2RKSA 2NS5A 4XE0A 4L1BA 4HN7A 2KUMA 1WGRA 3ZVVA 2YTVA 1Z7TA 1U4RA 2L12A 2SDFA 1F2YA 1AFPA 3P4RB 5C4ZA 1K3RA 5FKAC 2LMCB 1J0GA 4JG2A 3KUCB 2MEKA 4I65A 3I3TB 1QZHA 1CUKA 4MGKE 3V6EB 5JJIA 1WRDB 1XLPA 4HWIB 3E56A 3BINA 3GD7A 2BE5C 1PLFA 2DX5B 4A3KH 1FEHA 4PYZA 2JY6A 4JI3Q 1II3A 3NUHB 4KN4C 1H9JA 1FCLA 1OQRA 4WQMA 2LD9A 4DF7A 2F0KA 2MH7A 4GKJL 2FIDA 5D6JB 5KHQA 1G91A 3WCQA 2NVTH 2WKCA 1CKNB 2CHWA 5AZGA 2PZUA 1WZ3A 1V1QA 3CC7A 2KWDA 1SYDA 2G3QB 2FMCA 3H3VI 4R4OA 4JI0Q 4J6HA 3A5ZB 1K8OA 3QK0A 4IJLA 4B3SL 2QMTA 4OELB 4IO9A 5C4JB 2EDGA 1VZ6A 3Q8CA 3SEBA 2KQSA 3AU7A 4YTNB 2HIXA 2CQOA 3DBHI 4C1NK 2M2LA 2CKZB 1FO4A 1KABA 2EYOA 1VQOA 2A5UA 2BBCA 4GDLB 2WDVB 1JQYD 1WD1A 4HPPA 4KK7A 4NQKE 1EFID 3HOZH 4IW0A 3DWQA 4C3HB 2RR9A 4QIWE 4DV3L 1S5BD 2F0PA 1P8LA 3GTJB 3EIVA 4FJYA 4K5WA 3Q3FA 1J19A 2G4DB 1A5RA 5IYBG 1ET6A 4C7YA 3I55A 3RI7C 2F0TA 3CSFA 3HOVH 3WDNA 3QG1A 1OXTA 3TS0A 4JI4L 1IYJB 1JW9D 1VCBA 5CHVC 1EIGA 4JBMA 3RZFA 1K53A 1C4AA 3CSTA 2LFNA 1MBYA 1BCPB 1QVCA 3DWAA 3IHPC 2WXJA 1GNUA 3LDZE 4XDDA 1UH6A 1QUQA 1J7CA 2PE6B 1FR3A 2WAQG 4DAMA 5J39A 3U8ZA 5BR8L 2QJLA 1F9JA 2I1JA 3DOWA 2PVOD 2WKDA 4JV5Q 1N63A 2DHZA 2PPBC 2INPE 3DHIC 3A56A 1MD2D 1SE9A 4X65Q 1I5FA 2AKWB 1VQGA 3KF8A 2DYBA 5DM73 2RSUA 1BCPD 1GD7A 3RCZA 1EYDA 4AOFA 4A3PA 1IL8A 2GBJA 4NAWB 4K2LA 2A6HD 4R4QA 3J80L 4LJOB 1SN8A 3PO3B 2ZPYA 2IDYA 4PK1A 2YU9H 1WTOA 3JAMc 3F2UA 1HA5A 4RKLA 4XT1B 1WX9A 2QHOA 3PUYA 5CV6A 3DBSA 1AEXA 5C3WA 3GTMB 1LTID 1GXDC 3M4OH 1L7YA 1VRAB 4FXCA 4RWSC 4MACA 3J7ZC 1V86A 3HK0A 1GKHA 1E2ZA 2ZVNA 1HE8A 2PMVA 1ENCA 2NN6I 1Y1VG 4X64Q 5C44H 2NPTA 2QC8A 4BKGA 2VL6A 4OX9Q 2J7QB 2KHJA 1OXSC 1PYWD 3EVQA 1A62A 2OCEA 1I7HA 4RGNA 2LWPA 1D8LA 2LMCA 1V9JA 2VZAA 3AEBB 1EY4A 3AMZA 4OO1I 1GB4A 2HT1A 2MNAA 3NBHA 2C7MB 4BOZB 4M0WB 2C9OA 1UBQA 2IYDB 2KWVB 1JB3A 4DV5Q 1LT5D 3M3JA 1WYGA 1VMCA 4GIVA 1S3OA 1KF6B 3A74A 2R2OA 2VXWA 3VUWA 3RNBC 1EQQA 4W9IA 3VQIA 1L5PA 4DK5A 2ZW0A 2D3BA 4DN4M 1KDCA 5IWAQ 1BDOA 4A76A 4XGAB 2VUMH 3KH0A 4X57B 4EX5A 3GE8C 4B95A 1Y1WB 1NR4A 1CKNA 5C6AA 5JZEB 3OOCA 2D3AA 2HD3A 4J3OD 4YY3L 2OJWA 4GGQA 4URKA 2O5JC 1VDVA 3BK1A 3D3RA 2VH1A 1PRTC 3K6OA 1ZUD2 4FF3A 3ZJVA 3CCEA 3N3KB 1RLFA 1EIHA 1EZ8A 3FVQA 4UP7A 1QVFA 5JJLA 1P1AA 3CD6A 3W1GA 2JVCA 4L23A 4IJHA 4LAAA 4LWCA 5CORA 3PPAA 4QMGA 3T13A 2RVLA 1XPRA 2Y0SB 3U9OA 4AQ7A 2ZEQA 1BBWA 4GDLA 1JJ2A 1VQIA 2KFKB 1EY5A 1N5XA 1NUCA 4F7XA 5A35A 3TMEA 5CMDA 4QUFA 3HKZB 3RLFA 3AM9A 4IUNA 3D4RA 4Q0FA 1YD8U 5IAAC 1N32Q 2O5IC 2K5QA 3J7AV 1VQJA 4C3JH 2J0TD 1K51A 4HCSA 1D5XC 5M5YB 2KYWA 1H8CA 4ME3A 5FJ8G 4A6QA 2PZTA 4X62L 2B29A 3H7SA 3ML8A 3P4PB 2ZZPB 4PYUA 2MCNB 2K05A 2CU3A 1G6PA 3A54A 1I4QA 1QLBB 3T16A 1P3QU 1HR0W 4XYOA 1SYCA 3FAHA 4DV7Q 5KGUA 1HR0L 3NRZA 4IUVA 4I6PA 1NTGA 4ITKA 2YEPB 3ZO5B 1QVGA 1MIUA 1CA6A 4N9TA 1X54A 3GE3C 3T1YL 4FF2A 3KBXA 4IWPA 4RF0A 2NWGA 2WFWA 4JC0A 1KLUD 2MPMA 3Q14C 1U4PA 4EQ5A 4NAWA 2SOBA 2JA6H 1LYLA 4BBSH 2N88A 1RWSA 3N1XC 2C5LC 1XTDA 2NVQH 1LFDA 4B3RL 2PMZB 1BO0A 3PIPA 3DVNU 1A3TA 1NCVA 4X3KA 1GJXA 5KYLA 2CH4W 2QIEB 1B9NA 3PUXA 2VNUD 2UU7A 4II2B 2WIIB 1WM3A 2F3VA 4LK0M 4BY1H
chains in the Genus database with same CATH topology
2G9HD 4N59A 1LLRD 1ILQA 4RH6A 3GQBA 2BB6A 2PNRC 4TQUS 1HQMC 1RHPA 3N6RA 5M5WB 1EEID 1TY2A 3OWFA 2D5GA 2M0AA 1C4PA 1SAPA 2CVRA 2Q8RE 4GDKB 1CHQD 4K8JA 3G7LA 1XLOA 3HEJA 1YN5A 2EKIA 2HUGA 1TKYA 5C3EB 4YT0B 3J7YW 2IPKD 3KBGA 4M0WA 2A5HA 1VZ7A 4CHTB 4CJ2C 2L32A 2K3UA 1VMPA 1XCQL 3LNNA 1TIID 1EQVA 2W54A 4C2MB 3MFYA 3I90A 1BBXC 1YJJA 2WXOA 3PUZA 3NVZA 1C48A 1FYCA 2ID0A 3PZ7A 3I4NB 1GAQB 1GUNA 4KGSA 2CW0C 5IGBA 1RD9D 2E74C 3MP9A 3KQ4A 2F0WA 2YYZA 4QUCA 3P63A 4NW2A 2JWUA 1EOTA 1ZXTA 1PTOC 5E6JA 1PDXA 1G2SA 3PIO3 3ZGZA 2BW2A 1GOZA 1J7BA 3IT6B 3W9CB 4V0BA 4RAUC 3SFEB 4ZKBB 4FXGC 2EYFA 1L0YB 2L4NA 1WTVA 5KIXA 3EJIA 3DEPA 2N9KA 5BMHA 5DM63 1O78A 1E9MA 3BS1A 2L5TA 4B9WA 3GV6A 1JWMD 3P4QB 3LYYA 1P7EA 3NTHA 2K5WA 3I3CA 1T3QA 3TEWA 1D1IA 1DOIA 3SR1A 4FF1A 2K7VA 1ML0D 1Z47A 4DU9A 4DAPA 3IL8A 3HP3A 5EBCA 1JC7A 2KCCA 3MJ5A 3GTLB 4MM3B 5EE1A 1SB3C 4XQQA 5LL6X 4TMAB 2KCNA 1SJED 2Z8LA 2V3PA 5CBEE 1F9RA 4XIGS 1B3AA 4XQNA 2K28A 1SYGA 3D31A 5EGTA 3A8IE 2LUMA 5JXVA 1IYVA 3B2FA 4PMBA 2N55A 4RCNA 2QKIC 1JRPA 3VYRA 1D5ZC 3NUCA 4C3IG 1MI0A 1UWXA 3DMUA 4UAIA 5T1IA 4OZAA 4KN7C 1SNQA 1D5MC 4IUQA 2DYOA 4RKBA 1UAPA 2IX1A 1F77A 3SDZA 4ZK9B 4OO1H 1H9RA 3URYA 3NWSA 2JXTA 3HVDA 1ZXIA 3QO2A 1NVID 4A93B 1ZOYB 3HOVB 1KH0A 3CWIA 1D6EC 1F2LA 2V4IB 3Q22A 1DGJA 1VDZA 1Q1EA 2BYTA 3P4SB 2EY5A 1SNDA 2H88B 1I4HA 1TU2B 3OPOA 1ET9A 1C76A 1IW7C 5G3LF 4IUTA 5AFWA 1ZYRD 1S5DD 4FVMA 2WS3B 2XNAC 3SE0A 2IGGA 3U9SA 2WB1B 1I4XA 1TS2A 4LJZC 2F0FA 5C0XJ 2DY8A 1JICA 4P6VF 5FO9B 2DNEA 4ZYSA 3M4OB 4BA2I 4YSXB 3MXUA 2KQ3A 1HPCA 3NTIA 4IUPA 5C44B 1DOLA 2K5PA 1WD0A 3FKIB 2NYZD 2Y5CA 1IGCA 4R8IA 1FCCC 1Q12A 4N6EB 1FNVA 2LEKA 4US9A 2IWHA 1F9QA 4YTPB 2JU6X 2ICEC 3PUWA 1WRIA 1TR5A 3S2HB 3BYTB 1FD7D 5DNFA 4KMUC 3SXHA 3AE4B 1IGDA 4NZLB 1DOKA 1NR2A 5HFYA 2FE8A 1JALA 2HTME 1TS5A 4DK0A 4KKUA 2F0LA 5CV4A 4WAFA 3SK4A 1FGBD 4KY5A 2AQ2B 2E3TA 1TWFB 2WXRA 1HTLD 1GUGA 2KDMA 2LHEA 2SAKA 2RPVA 3BVMA 2FMMA 3J81E 4IOIE 1CZGA 2F3WA 3Q24A 3ETRA 5C3XA 2BT6A 2LGIA 1G2TA 2F0QA 5C5MA 2BDOA 3VR3A 1F2MA 3AE6B 2KN4A 3Q6SA 3J7AF 5JPNC 2E2DC 1HRJA 3BK2A 5KRUA 2K04A 3J80E 3EROA 2K32A 1TVXA 1HZ5A 1C4CA 3OSOA 2NB0A 2D62A 1TWHB 3AEDB 2WAQB 2QEJC 1FNUA 1STYA 1B2TA 1CM9A 1QJOA 1JWAD 4BBSB 3TEZA 3R2TA 1QOBA 3SK6A 1LT6D 2L0CA 1MVKA 4K6DA 1TS3A 2A69C 2E75C 1AWDA 4BY1B 1G6ZA 2RSNA 4K5VA 4F88A 1F9PA 2R93B 1SNCA 1L4DB 1SYBA 3SFDB 2L83A 1EWHA 1K83B 2JZPA 2ZW1A 4A90A 5DAUA 2FUG1 3V96A 3H8HA 2PW5A 1OXVA 4G57A 3FMCA 1SFOB 3NS1A 1IYUA 3VR6A 4X3TA 3V05A 5D14A 4ZRZA 3ITPA 1PUTA 1WCMB 2CJNA 2WXNA 1S5ED 3E5SA 2BOSA 3W3AA 4L63B 5JAVA 4OZBA 5CV7A 2FINB 1B50A 2EY1A 3W5VB 4JE3B 1SYEA 2G1EA 3IAS1 1HHVA 1MHHE 2K33A 1I6HB 1TWGB 3S1QB 4K6LA 1CZWA 2NVYB 1DONA 1ZKOA 4NJCA 1EL0A 1KTKA 1Y56A 2N9LA 1JWSD 5G3LD 3K58A 2F0OA 3W1SA 1RKNA 2D9UA 1EY6A 4CJ0B 1NSNS 1ZDVA 3NVVA 5CYUA 5KNDA 1EY9A 2NZ1D 1UEAB 1L6VA 1PMRA 3GTGB 2IL8A 1SNPA 2PO4A 2KQ4X 1QQRA 1YN4A 5ELDA 1ONLA 3AE7B 5C3JB 3BYYB 3D6WA 4MHEA 2KACA 2JYTA 1CHPD 5BN3A 1A2TA 2PCFB 4CKEA 2BS2B 2EOTA 2WXLA 5FO7B 3NWTA 3JAME 4F87A 5E4XA 3TZUA 1WVLA 2YEPF 3AEAB 1HA6A 5IGEA 3BVGA 1QNUA 2DY7A 3Q8EA 1W6KA 3BDLA 2JSOA 3S15B 1E2WA 1XX8A 2WP9B 1VJKA 1F0ZA 2NUCA 1JMLA 3MC0B 2BDNA 1FNWA 1BUVT 3E9SA 1BOSA 2B2VA 2WDRB 1JOQA 3I73A 4J8QA 3AE2B 1B44D 4XXEA 2LS01 3DHQA 4IFDH 1BCPC 1A3VA 1TYGB 4KV6A 5IGDA 1CJEA 5I4DA 1HTPA 2A6HC 4Z9CB 2BS3B 3DM1A 4DFAA 3H6MA 2XIWA 3SHLA 1Q10A 1C8CA 1KAAA 2QF7A 3ZJTA 5COYA 3OIPA 4RHSA 5IGCA 4H7BA 2MGSA 3J81L 4MIUA 1OQQA 1PZID 3MHZA 2ONQA 1LO5D 4JX1C 3P20A 2DYMA 3TBIB 4JWUC 5C4XB 1YMHE 2DLBA 4OVZA 1Q3LA 4WJWA 1FM0D 1BR9A 1EY0A 1QOFA 5E4WC 1DOYA 4HTHA 1UWMA 5LNK1 1RM6C 3QWNA 1ZE3D 5JEAH 2KMMA 2SNMA 5JOBA 4ZUIA 2B63B 2MJ3A 2N7JA 4TSSA 1BNZA 4HJGE 1PGAA 1WXQA 2W3SA 1SYFA 1JE4A 3U7ZA 1QB5D 2ZXPA 5K36G 2FBWB 4KKJA 2J52A 5G5GA 3HRZC 1XLNA 2HQEA 1KRHA 5HI1A 3BIID 2GI9A 2PIAA 2F0DA 4FXDA 2E2IB 3M7GA 1QKZA 2IX3A 2X69A 2DBYA 3TP8A 3R93A 5BYRA 2F0VA 3LWEA 2W82A 3VYSA 1HUMA 4KY6A 3MXPA 5EKIA 1WGKA 1L4ZB 5M3MB 2XVSA 4G7ZC 4PMCA 2ON8A 1OXXK 4A3EB 1GUWA 1EWYC 2LY7A 4FYDA 1B53A 3MAQA 4IDIA 2AWNA 2F0EA 4FO2A 3NZ3A 3TN2A 4DAYA 2AX5A 4OHJA 1IKMA 1AZPA 1EYAA 2V4DA 3LWUA 1QOAA 5AUKA 4YIJA 3RMHA 2GA4B 1YNTE 4JPSA 5C0XG 3L4PA 2W55A 1Q8IA 4ZKCB 4JBWA 1ZP0B 4A3GB 2WU5B 5IGGA 1ROEA 3E6ZX 4ZQ3A 5K5PA 2PKOA 4DNRB 3S1MB 4US8A 1SEBD 3EA6A 4R8NA 3HRDD 4N58A 3VYUA 1SNMA 1H9KA 4A3IB 2DWQA 3HOXB 1TKEA 1A2UA 1XXGA 5AUIA 2GRIA 1I4GA 1H9MA 4AYBB 3EQLC 3SVMA 1X32A 1JOKA 2EPBA 1S4ZA 2E6XA 3T53B 1A6XA 1FRRA 2KAJA 3Q0AA 1CK1A 2AQ3B 3CQZB 3G6JB 4NMZA 3JAML 4QCLA 1YQ3B 3PMFA 2F0GA 2JEBI 2WXHA 3EUB2 1WTRA 2OEOA 4KY7A 3MXNA 3ZYYX 1D4BA 1EZ6A 4B9XA 1E10A 3VYTA 1XCTL 4HROA 2NN6G 1PZKD 5EE3A 2WDQB 2BA1A 4J1MA 1B9RA 4R9WA 1LTSD 5IIFA 3ND9A 3QOJA 4PV1C 5M3FB 1GHJA 5KYIA 4NAMA 2MJ8A 4G7OC 5EKKA 1MI2A 3H91A 1LV9A 2WV6D 1NI3A 3L9AX 2MUYA 2XRQD 1TWAB 2VZKB 3MZ5A 2ACZB 1C79A 2RDHA 1U4MA 4H44C 4B0EA 3CIRB 2W3RA 2E2JB 4K2KA 5BYQA 1TKWB 2F0MA 1QOHA 3S17B 4LLGM 1EQTA 2VZKD 3AH7A 4QB4A 1U4LA 5I6WA 3T56B 1BMLC 1V8QA 1NAPA 3L3OC 1LT4D 2K9XA 3VA7A 3P1HA 2DNCA 5EPLA 3M85A 1ENFA 3RD4A 2VB2X 4P16A 2KVMA 5CBAE 4REZA 1VR9A 1HFGA 1RJTA 2L11A 4KJOA 2I38A 5E1FA 3T51B 4A55A 1CTMA 4B0MA 1XTCD 1CQVA 4RHRA 1LT3D 2RDFA 5EJWA 2A6ED 5ELCA 3U52E 3GTQB 1EM7A 1V8CA 2B2YA 4IZ8A 1STAA 1DZ1A 2WQYB 2M9VA 4NDXA 2AQ1B 4JWSC 1R4PB 4D2KA 1QE6A 1ZYRC 3HOWB 1C9FA 3C1EA 1BQQT 1DOXA 5GXGB 2HCIA 3M4YA 1T5XD 5D3DA 3GB1A 1H9SB 3AE1B 3HOYB 1V43A 1F2RC 2EZVA 3D8GA 3VR4A 1SJHD 4PNYA 1DYQA 1I50B 2R7ZB 3HG9A 4FXKC 2Z4IA 5EPJA 4EQPA 2I07B 2K22A 3NSWA 1AW7A 2F4IA 2WXFA 4YWGG 1CZPA 2G9DA 5LHY1 2X6LA 1RDPD 4RGOS 1EWCA 2KA7A 5I9OA 4LMQD 3V2TA 1DCZA 1ESFA 2JYEA 2AUKA 3BWUD 4MT5A 2K6AA 4RF1A 3ONAB 3ZJUA 4ARIA 2Q8TA 4KGTA 1C77A 1RODA 1CQFA 4HCEA 4IFDI 1E2VA 3C2PA 2TSSA 4KHVA 2B76B 1WTQA 1JROA 4ZLTF 2E2HB 1KLGD 1SMYD 2JXMB 2IW3A 2PW7A 1GB1A 4L8JA 4KHZA 2WXIA 4RA8A 4K5XA 2IX0A 5BN4A 1JORA 3PZ8A 3NTKA 1EU3A 5J22A 2A68D 2LHDA 1B9MA 3C8YA 3O13A 1F2RI 3P75A 2IGHA 4MH8A 4QF4A 3HGBA 3I4LA 4PQXA 4RGMA 3ERQA 4ULLA 3VA5A 1PDQA 4S3SA 3CU7A 4KX6B 4B08A 1VF7A 1O7ZA 1H9SA 2D5DA 3MWYW 4BBRB 2PQEA 1JWBD 3RZDB 1LTTD 1J9OA 2BCOA 2JX5A 3C1FA 1STBA 5FR3A 2VB3X 4FNFA 4IN3A 4CKCA 1YNJD 2Y3AA 1N62A 5I2XA 1XEEA 2AUJD 4MN3A 4CQNA 3NXWA 4PMWA 2BA0A 1ZEQX 2QILA 1M4VA 3AE3B 3SK5A 2WACA 5J1ZA 2B2VC 2N0SB 4K14A 2BTEA 4EVOA 1TWCB 1YNND 3DWMA 3TP6A 4XQJA 1L0VB 3H0GB 5HGTA 1FXAA 1S5CD 1EY7A 3GV3A 2KECA 1N5WA 1QCBD 3EGRA 1W6JA 2WINB 3V3XA 3U2SC 1FD6A 1AYFA 4V190 2ENBA 1Y1VB 2X38A 4H2AA 2EJGC 3K57A 1E7PB 1FRDA 1LTRD 2A74C 2KEDA 1P7FA 1SE3A 3GS2A 4P2CB 2RMMA 1B4OA 1QG7A 3I70A 3AECB 3VR9B 3I9V1 3B9JA 2CHBD 3IAM1 3KWVA 1JR0D 4C1NI 1MHXA 1Q1BA 3TEYA 3M7NA 2QCPX 1T5EA 1PXUA 4GZYC 3VRAB 4KKIA 3RZOB 4XDCA 3KLSA 3AB9A 4ID6A 5EKLA 1STGA 1UUPA 2B39A 3NK9A 3R8BA 3ABVB 4M8AA 3M3YB 3OMCA 5KEEA 1I3QB 2OF1A 1RYJA 1ESRA 4NKLA 2K0PA 5IODA 2O4XA 2XN9C 2XRSD 5I9PA 1PGXA 3K5NA 3W2DA 2SNSA 1G291 4CGYB 1SDFA 3GTOB 4ODGA 4TQ1A 2HDMA 4IALA 1GUTA 1TJEA 3AEGB 4L6TB 1QILA 3FDTA 4F8MA 1D2BA 3VR5A 4DAVA 2RDGA 1Y8NB 3EFXD 5CV9A 3HS0C 4OZCA 3AMUA 1R7SA 4LTUA 3AN1A 3I4MB 1MGSA 1Y8OB 2ZXOA 3MFGA 3K7AB 5BMIA 1WSPA 1AN8A 3AE8B 5E3FA 1STNA 1NYRA 1M8AA 4ABNA 3BVZA 1PRTF 4IQZA 3GTPB 4R3DA 4OIKA 1PFBA 2B2WA 3DXJC 5BN5A 3PIP3 1O7YA 1CA5A 3J9CA 1ENAA 4KGRA 4XYQA 1I4RA 3N9YC 2HDEA 3S2DB 3TZDA 3KLRA 1YJIA 2L55A 3CRKC 2PYKA 1L6UA 4A3DB 3NHHA 4DGZA 5ELFA 1SXTA 2RA4A 1FIQA 1HEZE 2R6GA 4G7HC 1OXUA 3IFTA 4FF4A 3KLSX 2WXKA 5BMGA 5C0XI 3T3OA 4BY7B 4TRDA 2BE5D 4HKZE 3VR2A 4XT3B 2HDLA 1PFMA 4C3JG 4OL7A 3LXFA 4X3UA 1QWYA 3P42A 2R3ZA 1T6BX 2KEEA 1V1OA 2PLPA 2I46A 4PT5A 2TMPA 1AZQA 4Y7NB 4RGTA 4ZHPA 5CGKA 2EYHA 3S1NB 3A7AB 5C2TB 4WRDA 5D7GA 1O80A 1YQ4B 1Z6HA 2M56B 2JE6I 5JVG3 1QNKA 1PGBA 3MXGA 3D4DA 4HSVA 4A3BB 3OMGA 3QIAA 2OT2A 2HCCA 3HOUB 4CKBA 3WOEA 2NMQA 1VCIA 2B2UA 2WNMA 3TDQA 2JA8B 5FOBB 1A3UA 1RFKA 1NEKB 4HEA1 3HUIA 1SE2A 4HSPA 1PFDA 3K5MA 2EELA 3Q8BA 3NQTA 1LTGD 1PTOF 5T1GA 3UI2A 3X3NA 2INNE 2J42A 2PZWA 1J7AA 2K1BA 4KD4A 2B2TA 3OIQA 4C3IB 5I2YA 4WURA 4DXFA 1ICWA 2B8FA 3KUPA 5G5HA 1KNAA 1ILPA 2JSVX 1HQRD 1RF2D 3IFDA 1NENB 2EJMA 2EXZA 2EVBA 4N9PA 4IFDJ 3PO2B 5EQ0A 3BDOA 5HHDG 4RFBA 2RBMA 3I72A 3BDCA 2F0JA 1RTNA 2CQAA 1HZ6A 3QJYA 1E0BA 4ZAIA 5FLXE 2L52A 3MVVA 1E6EB 3NPPA 2F0NA 3FPUB 2OXPA 1UNSA 5FO8B 1ZDXA 4DK1A 1A70A 3TUOA 3AEEB 2WXPA 4A8XC 1ZXHA 1N61A 1KDBA 2B2YC 4WH4A 1PRTB 3D4WA 4TKOB 4ZRPA 2K03A 3TP7A 4YTMB 2L9HA 4BA1I 3PO0A 5KNCA 1QOGA 5F2DA 3L7ZC 4A3MB 2MHVA 2CJOA 5JEAJ 1PRTD 3NBIA 4KD3A 1VF5C 5LL6S 1MPEA 4XTCS 4E6IA 5A2QE 2I2YA 2X6GA 1PFNA 1HXYD 2GB1A 1FFVA 2WLBA 1PZJD 3FC4A 4HR7B 1XO3A 4TQ0A 4IUUA 1Y8PB 2H1EA 4WORA 1JCKB 2WXGA 3TEXA 4Q5VA 5IT9E 1RTOA 5K36H 2M19A 1SBBB 2BS4B 3NP8A 2E76C 4DQOC 1HFNA 3UI3A 4A9AA 4L2YA 3Q8FA 1SIJA 1L0XB 4HEDA 2EYPA 2EE1A 3S16B 3K0YA 2XWBB 4GLSC 2WP8J 1R9TB 5TSSA 4H13C 1CT1D 1OO9B 2H4OA 1QT9A 1TY0A 4C3HG 4U68A 1TQOA 3AB5A 4OO1G 1TKGA 3I91A 4EQOA 3FILB 1HCZA 4WIPA 1RCVD 3QB3A 4UDUC 1MSGA 1B1ZA 4K8IA 1R4QB 2NTSA 5ISRA 2NVXB 1N60A 5D3IB 2Z1CA 2H89B 2J53A 4BWGB 4G4KA 3S1RB 4HMIA 3X3MA 5HG2A 5KNBA 2EJFC 2KOLA 3B2GA 2L1AA 2V3NA 3OHXC 3MTSA 2A6EC 2EY2A 1XYIA 1GHKA 1O7LA 2FHTA 1MSHA 1IBXB 4ZOHC 1DOMA 1JOOA 2F0IA 2K5DA 3R3OA 4YXDB 3PV0A 5C0XH 2B8GA 3KK7A 5BYSA 1EYCA 3K5LA 2JA5B 3Q8AA 4LK1C 1TS4A 2A73B 1SSNA 2J7ZA 2MJEA 5M5XB 5MPOA 3P1MA 3WOFA 1PTOB 4RNAA 2OEDA 4A3JB 2CW0D 2JQRB 1EU4A 1EY8A 2IJ0A 3PUVA 4RCOA 4CJ1B 2DN8A 3FEWX 1V1PB 1PTOD 2NBFA 1CFMA 1D1KA 2FFKB 3W5UB 1FXIA 1J8IA 2EYMA 4ZHOA 4A3KB 3VRBB 5C4HA 3U4EG 2JEAI 2PW9A 4H0LC 1HUNA 3DUZA 1ACCA 1JWUD 2KHSA 3MEHA 1Q90A 3AV8A 2SEBD 2NVTB 2WXQA 1BXTA 2ZT9C 5CC4A 5D65A 4EE2A 3KWLA 2O2LD 1VLBA 3T3NA 3S9WA 1C4QA 2WXMA 2F0SA 2K01A 3GP7A 3A8KE 2NN6H 2F1MA 4BS9A 4WFN3 1SF0A 3HOZB 5EE9A 4HAEA 4XDXA 3FILA 4XWWA 2PTLA 4OIJA 1SMYC 5FLXL 4HRSA 1IHZA 3IT4B 1IUEA 1SE4A 2JYOA 1NYQA 1XLQA 1STEA 3OWEB 4O42A 1F9SA 5ELBA 2XWJB 4A3FB 1LTAD 2A68C 4I7ZC 5H8YE 1X3PA 3CRLC 1IBXA 3OW7A 3DEOA 1V97A 1C78A 3HVZA 5JJZA 4KKTA 4DA2A 2YU9B 1ZPSA 4DXGA 5CR3A 3A55A 3IAYA 2KJXA 5A2QL 1TT2A 2AWOA 3RUZA 2D2CC 1I4PA 3TP5A 1WTWA 4YSYB 4NP5A 1E0ZA 2Y5PA 2F0UA 2R61A 1QF6A 3AEFB 5IT9L 2MP1A 1IW7D 1GPXA 1V1PA 5DEHA 1TZOA 5ELEA 1YNJC 5EPKA 2J4XA 2LJIA 1VZ8A 1F2ZA 1U9RA 1DD2A 1BUIC 3K59A 5NUCA 5I6YA 3DWGC 3IKJA 3DWPA 5IGFA 4U673 5EE0A 2VUMB 1CI3M 2C5CA 4YSZB 4O1NA 1K52A 1YNNC 4ILWA 3S14B 1DJRD 4X3SA 2RSOA 1WWTA 2IGDA 3SR6A 4KI0A 4C80A 1LACA 5JPMC 2FJ2A 2B2WC 4IKGA 2OHFA 4Q2JA 3VR8B 2Q8IB 4C7ZA 1SNOA 4C3JB 4QIWB 3D6CA 1S5FD 2M00A 2JP1A 1JQ4A 1STHA 3E0JA 3IXSA 2BB5A 4ZUJA 2ZXRA 2EYJA 3I8ZA 3ND8A 2R92B 4KKSA 2EYLA 3H09A 3CKIB 4FP5D 1KDAA 3RPFC 4KJNA 2EY6A 5HURA 5CV5A 1DM0B 5C5LA 4OW0A 1A15A 4AS1A 3LB8C 1BCPF 3Q69A 2V0GA 4OGQC 1XF5L 3HZXA 2F0HA 3K5OA 4C56C 1LABA 2JA6B 3NE5B 2F03A 2WU2B 2XSCA 2NVQB 3A7LA 5H92C 3C3LA 3MA2B 3MHBA 2IT1A 1UGJA 1IKLA 5T8IA 1K8MA 5IOCA 3RFZB 3AE9B 5FK9C 4KTAA 2PVGC 4ME5A 2LKVA 3GTKB 3A8JE 4ARCA 3NQIA 2Z4HA 3ZQ4A 2JA7B 5JVH3 4IFDG 2Q5WD 3Q23A 4HKQA 3BG3A 3BZDB 3R2IA 3QOLA 3FRPB 1WTXA 4HMJA 1GUSA 4EQNA 4JK1C 1XWEA 2L1BA 3T4AC 1FFUA 2RQXA 4XWTA 1LTBD 1G8ZD 2ICIA 3H3VC 1WTPA 2A69D 1YN3A 4ZRQA 5M9OA 3LX0A 3FPPA 1SSOA 3SK8A 2QSDA 1AP0A 3N52A 3C46A 4EGVA 3NVYA 2B2UC 3TSSA 1FMAD 4DNTB 2NTTA 1EEFD 1X3QA 3I57A 1DXMA 1GUOA 1KNEA 3P7JA 5JEAG 1BF4A 1KFYB 2MJDA 1K50A 1OFFA 3AE5B 4CBVA 4M1UB 3CHBD 2B2TC 5CV8A 4IURA 2LFIA 1I6VC 2QDBA 5EBDA 1PTOH 3NVWA 1Y69U 4XE0A 3GO5A 3H94A 2RKSA 4L1BA 4HN7A 2KUMA 1AFPA 1Z7TA 1U4RA 2L12A 2SDFA 1F2YA 3P4RB 5C4ZA 5FKAC 2LMCB 2MEKA 4I65A 1XLPA 3E56A 3GD7A 2BE5C 1PLFA 1FEHA 1II3A 3NUHB 4KN4C 1H9JA 1FCLA 1OQRA 4WQMA 4DF7A 2F0KA 2MH7A 1G91A 3WCQA 2WKCA 2PZUA 2KWDA 1SYDA 2FMCA 4J6HA 1K8OA 2QMTA 5C4JB 2EDGA 1VZ6A 3Q8CA 3SEBA 4YTNB 3AU7A 4C1NK 2M2LA 1FO4A 1KABA 2EYOA 2BBCA 4GDLB 2WDVB 1JQYD 1WD1A 4KK7A 1EFID 3DWQA 4C3HB 1S5BD 2F0PA 3GTJB 4K5WA 1ET6A 4C7YA 2F0TA 4WWMA 3WDNA 3QG1A 1OXTA 1JW9D 1EIGA 1K53A 1C4AA 2LFNA 1MBYA 1BCPB 3DWAA 2WXJA 4XDDA 1J7CA 1FR3A 5J39A 2QJLA 2PVOD 2WKDA 1N63A 2INPE 2PPBC 3A56A 1MD2D 3KF8A 5DM73 1BCPD 1EYDA 1IL8A 4NAWB 4K2LA 2A6HD 3J80L 3PO3B 2IDYA 1WTOA 3F2UA 4RKLA 4XT1B 1HA5A 5CV6A 3PUYA 4FXCA 1AEXA 5C3WA 3GTMB 1LTID 1GXDC 4MACA 1VRAB 4RWSC 1E2ZA 2PMVA 1ENCA 2NN6I 1OXSC 1PYWD 3EVQA 1I7HA 4RGNA 2LMCA 3AEBB 1EY4A 3AMZA 4OO1I 1GB4A 3NBHA 2C9OA 1JB3A 1LT5D 1WYGA 1VMCA 1KF6B 2VXWA 3VQIA 1L5PA 2ZW0A 4DN4M 1KDCA 1BDOA 1Y1WB 1NR4A 5C6AA 3OOCA 4J3OD 2O5JC 1VDVA 3BK1A 3D3RA 1PRTC 3K6OA 1ZUD2 4FF3A 3ZJVA 1EIHA 1EZ8A 3FVQA 4L23A 4LAAA 5CORA 4QMGA 3T13A 2RVLA 2Y0SB