4UE6A

Structure of methylene blue-treated anaerobically purified d. fructosovorans nife-hydrogenase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title [Nife]-Hydrogenases Revisited: Nickel-Carboxamido Bond Formation in a Variant with Accrued O2-Tolerance and a Tentative Re-Interpretation of Ni-Si States.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 83
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ue6A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ue6A02
4KN9S 5ADUS 3ZE9A 4UD6A 4KO2S 5JSHA 1WUKS 1UBMS 4KO1S 4IUDS 1CC1S 1UBLS 3ZE8A 5JSYA 5A4IS 1H2RS 4UE6A 4UCXA 4CI0B 1FRFS 1H2AS 4KO4S 4U9HS 4UCWA 4IUCS 5JRDS 5JSUA 3MYRA 1UBHS 1E3DA 1UBTS 4GD3Q 2FRVA 5JT1A 4C3OB 4KO3S 1WUJS 4UD2A 4UEWA 4UEQA 5D51S 3CURA 1UBJS 1WULS 3USES 1UBUS 4TTTS 3USCS 5A4FS 3AYXB 1WUHS 1UBOS 3AYZB 1YRQA 4UE3S 5A4MS 4UE2A 1WUIS 3ZEAA 3H3XA 3ZE7A 4UQPA 1YQWA 4IUBS 4UPVA 4UQLA 1YQ9A 4OMFG 2WPNA 3UQYS 1UBKS 4UPEA 4KL8S 5JSKA 4URHA 3ZE6A 3RGWS 4U9IS 1FRVA 3CUSA 1UBRS 4UCQA
chains in the Genus database with same CATH superfamily
1OXUA 1EDZA 3FNHA 4H2DA 4NHOA 1BH6A 4AP6A 3T3PB 3G2PA 1H3FA 2XNSA 1P0QA 3GJ4A 1ZA2A 5A6SB 3ILHA 1T5HX 2FUCA 1AK9A 3JSAA 4TLAA 3MXTA 1XO1A 2HBQA 1W75A 1XVAA 3GFFA 2P6UA 1MBZA 3BICA 4HAUA 4B71A 1NXTA 1GO2A 4GRAA 2R6DA 4ZCQA 2JGDB 3ROZA 2PLRA 4IVNA 3ONWA 5DYGA 1NW7A 5TPZD 5A3QA 1Z34A 4RTNA 1E2NA 1XR3A 1G5FA 1E6CA 1HDEA 2DPGA 2WPNA 1L5YA 3DBHB 1O9HA 4GBJA 4YHBA 5HQJA 5I8ZA 3WLKX 5GTDA 4ZOQI 1JB9A 1KSJA 4UXIA 2EU8A 4FNGA 4BECA 2QAIA 2QP9X 1WBBA 4F9EA 2H48A 2DJIA 2A14A 1MB2A 3BSSA 2CFRA 2MYTA 3KUCA 4IXWA 4XJSA 3OWXA 1VKRA 5EMHA 5BWMA 1BYUA 4E21A 1IULA 1TX4B 1VE9A 1W581 2F1KA 2FQWA 2I03A 1N6LA 4JR0A 5HA5A 4BNFA 2QIOA 1OLSB 4EFLA 1SVIA 1X8KA 5L53A 1SVNA 2G7MC 3THRA 3BZWA 1JEAA 1KEEA 2C7PA 1MNAA 2QT0A 2E1PA 4YMWA 2FX3A 2J3MA 2Q0SA 3MS7A 1T9BA 4R3NA 4AM8A 2JFGA 4KQHA 5F12A 3EA4A 2G82A 2X5NA 1UIRA 1SCKA 4DMMA 2BBSA 4U9UA 4DF3A 2RGCA 2HXYA 3GJ5A 1KYYA 2A92A 2ZJ8A 4JX8A 3ZWVA 5AVYA 1CX9B 2WAOA 3CRRA 3GLKA 4J49A 2NX2A 5CCDA 1TFRA 2OCLA 3FOBA 2IVFA 3B8EA 1T8WA 2P2GA 4GECA 4A1OA 1PU2A 3QNUA 3S81A 2HAEA 2HADA 4ZCRA 1TCCA 1SVMA 4MUMA 3MJHA 2FU5C 5F4ZA 2FXIA 2ODTX 4IWXA 3Q3CA 3WKCA 2O7VA 3K0CA 3OM8A 3K70D 1IBLB 3E5MA 3HZZA 1UF9A 2W5UA 3DZCA 3QNMA 3MJ4A 3NHRA 4X63A 4JEMA 3H5VA 4LDJA 1AE1A 4LXYA 4S1VA 5KEIA 4KG7A 1TO1E 3GJYA 1GPLA 3SQOA 4BGEA 3R0VA 4U7WA 2OILA 3S29A 1T0JB 2EBHX 2GD6A 2QDXA 1IZYA 4Q1BA 5TMDA 3UJ9A 3V4OA 5BSVA 1FRVA 3UAOA 2A9KA 2QN6A 5IH7A 4LXIA 3CNOA 3SYNA 1EFHA 1A0OA 3HHPA 1KZ7B 1ECFA 3D3QA 2WMDA 5EYPA 3IBYA 1SKYE 3CYFA 4G97A 1L3BA 4LJ5A 4U2FA 2VF5X 1AH2A 2HEIA 1R4NA 3QF4A 5GGXA 2N1BA 3FYTA 2YJ3A 3IEUA 4CEHA 1EFRA 2DPHA 4JUFA 4A16A 2PL5A 4FCWA 2J3EA 5DE3A 4BE9A 3HYSA 2WU0A 3GNQA 1R0BA 5FWAA 1OBVA 4XWAA 2PWPA 4MCAA 8ABPA 3RYCB 1U9YA 4WBNA 4L50A 1SK8A 4TV8B 2WT9A 4UZFA 3AUFA 4FGZA 4Z54A 5A06A 3BGOS 2K7ZA 3NT5A 4M8NE 4B6OA 1H4SA 3RS7A 1SH7A 3T06B 7ADHA 3NYRA 2YW2A 3QA3E 1Y33E 4E2XA 1P8AA 1S3FA 3UWOA 3FYSA 4G1MB 4YACA 2FR1A 1U2RA 2NXNA 3N87A 3MS2A 5B6PA 2NSJA 1I6LA 3AERB 3OX1A 1OU0A 2DWUA 4O29A 1CC1S 3P2IA 4HQLA 3TMKA 3ZN2A 4YUWA 2YXBA 2RC5A 4E15A 1HTBA 4YCAA 5JDCC 1PZMA 1N7GA 3EUEA 3GLHB 4XQEA 4FKZA 4WMLA 1HORA 1X7XB 5IJ0A 3ASYA 1XKQA 1TTQB 3F90A 3FUTA 4HZGA 4ZP1A 1KDRA 5FEMA 5AW1A 4NNPA 3EC7A 4EWLA 3KSDO 1GNVA 4MZDA 1ONBA 2QRVA 3SZRA 1SB8A 1HOTA 3W2EA 1LDMA 1DZ3A 3CEHA 1W46A 1GAEO 3U48A 2HW8A 1HT3A 1TTHA 5I4BA 3OZWA 1BC5A 3WNVA 1DKMA 1JQEA 4I9UA 1ZIPA 2WUDA 5GOZA 3AEYA 4MAFA 1H1LA 4RETA 2RGGA 4KQXA 5DKFA 4BB9A 3OFJA 5C7YA 5HZKA 5JEDA 3PJDA 1I2ZA 3R4VA 4TOIA 1SBQA 3LDAA 2IH5A 1G21A 3REQA 3Q7TA 3WK5A 1T1EA 3BMNB 4JA0A 5G41A 2GYVA 3HXTA 4JB2A 3KSBC 3H65A 3R5TA 1M0WA 1ND5A 3VVCA 2WR8A 3CPJB 2ONZA 2W0SA 3HA5A 1HYGA 4HSGA 3RBAA 2PR2A 2OV6A 1XD2B 2V45A 1UBUS 3UJHA 4C5BA 3CF6R 4Q1CA 2WKPA 1O87A 4RK0A 4ZQEA 4AZ3A 4CUJA 5T5QA 2AJDA 2E37A 2E4WA 1VE6A 3IIKA 1XCOA 3N2GB 3NPAA 1PUIA 2HBZA 3BGVA 3BSFA 3UWPA 2I34A 2PBFA 4HATA 4OD0A 1CJBA 1SU6A 4ACBA 3GBSA 4YDRA 4LTMA 2NYVA 1VJTA 3KE8A 4ECEA 3VPDA 1VYUA 1YKSA 3RJ9A 3ETDA 2CNOA 1GA6A 4WZAA 3CJRA 5IRCD 3IPRA 5KYXA 4NXNB 3GIDA 3T1QA 3DCIA 2AGVA 2VZEA 1J25A 2GEJA 5DH9A 1NVMB 5D1HA 5FPQA 1UAAA 4KR2A 1HFKA 3A6GA 5LZ7A 5DK6A 4A10A 2VRNA 1VHQA 4YAGA 1E98A 1Y1QA 2WJIA 3C6ZA 3DWGA 2W2PA 3PQCA 4OJMX 1IN8A 3O8LA 4PLCA 3A27A 3DE7X 5EWJA 1E9RA 4Z4GA 3AYXB 3NAGA 2G0NA 1ORWA 1GNPA 2PZFA 4KAXA 2ZBPA 2D5CA 4H7FA 3GVHA 1DNPA 4PG8A 1VB5A 1ZGJA 2W8BA 2Q7OE 1R0ZA 3R8CA 2XCUA 1KWGA 2YKGA 3ND8A 3MMZA 2RHMA 1M6NA 1Z8NA 1QFJA 4B0OA 3EMVA 4RK7A 3R8FA 2BMAA 2PBZA 3PP8A 1KQFA 1A97A 3HCWA 4CG1A 1KMNA 3GP5A 4O4LA 5BSGA 4HPJB 3L8EA 4AS3A 1JIVA 2OBXA 3SQNA 2A9OA 4TMVA 1LPSA 1ZVJA 4HWSA 2QRKA 4JQOA 3R0JA 3A36A 1E2JA 3QWHA 4AB1A 1JSRA 1IWBB 2RHOA 1QRUA 2IITA 4BRWA 5EHZA 5KNCH 1IVSA 1X74A 3R9KA 4EHDA 2B3TA 4X44A 8AT1A 3RYIA 4FYJA 2JGEA 1QQAA 2ZTMA 1GPAA 5KINB 2OC9A 4NE2A 1NMQA 4W9NA 1G64A 2B7CA 2OVFA 2XZLA 1KQNA 4TSRA 1EBBA 3AUYA 2DTDA 3KJHA 4OX9Y 3MTIA 2FPLA 1YDWA 3Q2OA 1DMRA 4PSDA 4KN8A 5C34B 1P6QA 2ABWA 4PX2A 3VMFA 5JISA 2R00A 3PZRA 2QTVB 5ILQA 4WK2B 5HMMA 3ASUA 5B4VA 4ZEXA 1XZEA 4X20A 4OQNA 3R9IA 4A8JB 1IY2A 1GNLA 1M2OA 1BVYF 1YH3A 2WTEA 2WWRA 4NFHA 4FDMA 3D3NA 2FEAA 2UZAA 2LP4Y 3EFHA 4R16A 4WOPA 5CYPA 3S8YA 4MUFA 4E13A 4TLBA 1MJGA 4BO9A 4Z7NB 4ESVA 5FO1A 1RFGE 4BEBA 4MMYB 1GKUB 1U94A 3ZDRA 4EY7A 4D8YA 1J24A 5AKYA 1AO3A 3T1VA 1RZRA 3LGXA 3RM3A 3FM9A 4XIFA 3A9SA 5JNRA 3L7BA 1SC1A 4FD2A 2Q3EA 3GD7A 3K1TA 4LN1A 5KHLB 5I48A 5C7OO 4NMMA 8LDHA 4Y9TA 9ABPA 4QULA 4CR8A 2WM2A 3HEAA 3F4BA 1BE8A 1C1XB 5GV8A 4EG6A 1A8HA 5JWRA 1MO2A 1P1KA 2BT4A 4HTAA 5CNJA 3IX7A 1J0AA 1IK6A 1PZGA 3L7YA 2IEIA 4KQMA 3GT0A 1W4AA 4HH4A 2PGIA 3ICOA 3D4NA 3QHQA 3BFVA 4UW9A 5KKCA 3UMFA 4Z3OA 2CMFA 2DFLA 2HRQA 3ENKA 3CUEF 4I8DA 3JARA 4X1IB 1Q7BA 2JDID 4AKSA 1JP7A 5AOAA 2FPOA 3CQ9A 3MB5A 2BMJA 1H69A 1OLUB 2WZCA 2ES4A 3JQCA 4RQTA 3SFTA 4D02A 1T4MA 2WIBA 4M8IA 2CDAA 3L18A 4QWMA 2PS1A 2YC4C 3KZCA 3UAXA 2ZSUA 4UEKA 3ANNA 4I55F 1QGAA 1U1GA 2CLIB 3KQPA 3MJDA 3HJBA 3OLXA 5IJ9B 4ZT4A 4F46A 4FW8A 3V32A 1YVRA 4IW3B 4R9UC 1DRVA 1ST3A 3FIJA 5HFJA 1FYVA 4EECA 4Z8YA 2OGUA 1G55A 5CX1A 3UF0A 1HYEA 2BFFB 1BS9A 1SUAA 3FOWA 2AN4A 1VLZA 2R7MA 4INPA 4JUDX 4M0KA 1I80A 3F7MA 1ZICA 1NVVR 1G9XA 1GHTA 1ISGA 2JFBA 3CEAA 4GW3A 4TL6A 2RD2A 2E4UA 3DV0B 1C3XA 4IJWA 3WGKA 1BVHA 4Q9IA 4KR0A 5FX2A 1CT9A 2ONYA 4GI2A 4I08A 2UVPA 3EXFA 3PEWA 4MEAA 2AEJA 1P19A 1HURA 2BFCA 2QTZA 4BLOA 4JGIA 3GGGA 2C9BA 4TV9A 2BCGY 3OHMA 1RM3A 3AHIA 4IKOA 4QTXA 4EY3A 3EIXA 3JQPA 3IQWA 4AZ3B 4U7FA 3E58A 1AHPA 4XWGA 5BMVB 2C2YA 1AQYA 2WJAA 2VCYA 1AMOA 1ZMRA 1FU4A 1OSNA 1JQJC 3QK7A 4P4TA 3EB9A 1KETA 2W6ID 3FMFA 4O5OA 4TQUS 4I4TA 4Q9HA 3RSLA 5CBPA 3E5NA 3HCBA 1AB5A 1I1OA 2JLSA 3DL7A 3IUNA 3T5GA 1O54A 2Q4OA 4NJEA 5A4AA 5BSHA 4EABA 1YRBA 4PVDA 3C2QA 1UKAA 5CLLA 3D6AA 1XZMA 5JTUA 4D4KA 1G9SA 1NQ5A 4OBBA 5H83A 3G1UA 3TD6A 3C3EA 1VJRA 4L3WA 1FFXB 2D62A 4WHMA 4A2CA 4DWVA 3DTVA 4MR9A 5JU6A 4AY2A 3JSXA 1IBKB 1Y3AA 4RZSA 3ROFA 4L27A 3EFBA 2XT6A 2WPDA 4PYMA 4R0VA 5EMJA 2WHYA 5JS8A 2FP4A 2JL1A 2BHLA 5LOVF 3FI0A 3ID6C 1PQWA 3RI3A 1NXQA 1TM4E 1ACMA 1LW7A 3T5BA 3TKAA 4EI7A 3UPTA 1MJFA 1GITA 4ZCLA 5DNAA 4IEFB 3RVJA 5FNZA 2P2ZA 3PJFA 3IILA 1EFVB 3A70A 4FMPA 5DP1A 3DULA 2RH5A 3GQBA 4ERNA 5AW4A 5CCXA 2W6NA 1Z26A 1O5IA 4JX9A 3RRXA 3U40A 5EUBA 2KYRA 4XM0A 3LKVA 1E2IA 3B48A 1REQB 1NTRA 2JGNA 4ZARA 3WLTA 1F5NA 2GEVA 3AU8A 4AL4A 4J2TA 2WQ6A 1P6XA 2QL9A 1LZKA 1OVMA 2Y93A 3KV1A 1XF1A 3L7AA 4B5KA 5L3QB 4O2AF 3NONA 3ZXYA 1N77A 5ENDA 1NG1A 5THQA 3ZIUA 4DBVO 3QXCA 4ZEWA 5KJEA 3T9AA 2P0EA 4F3RA 2VPXA 5B57C 5KQMA 2Z6QA 1ULHA 3PGLA 4C2BA 2F4VB 1TJYA 2O1XA 4I5DA 3PNLA 4JYPA 4M1KA 3DPSA 1TOAA 4QGAA 4E14A 1RZVA 3FSEA 1K2WA 1M75A 1VPEA 3S2IA 2QUBA 3L8ZA 4B40A 1XK7A 4AWAA 3VHLB 3G8AA 4DXHA 5AR1A 1RJDA 2CSUA 2A88A 3ITDA 2RCNA 3N86A 3OEED 1LQ2A 4H0NA 1C9YA 4L5AA 2M1ZA 2HK6A 2A57A 3JYLA 3MK31 4Y1GA 4B79A 5A9RA 1ESNA 2VDOB 2RGNA 3AL0C 1LK0A 4PO8A 2ODEA 1KY3A 4HFMA 5DTRA 1T1IA 1DC4A 2JCXA 4OP1A 2P8JA 1QHYA 3O47A 2Z30A 4ZO4A 3T7JA 4F3YA 5KVSA 1U8AA 1P2BA 2CXOA 1OAKA 3TAHA 1IUPA 4BMXA 2WILA 3V9PA 2QRHA 1X94A 3HGQA 3QV2A 1E4YA 4KOAA 2EDAA 3IAM1 4R31A 4CMEC 1L5MA 2YWJA 4EJSA 5LKAA 4KNWA 3BIXA 3NHKA 3FSJX 2VYND 3C3CA 1JKJA 2Z57A 4PAMA 5FPPA 4ZDKA 4IUBS 4AXXA 3A1EA 5G0TA 5GJVC 2W6JD 1JYSA 1JXOA 5IBRA 4B2YA 4UC0A 3LZCA 3WWCA 2WZQA 3S7ZA 2ZJ2A 5MN5A 5CW1A 2Y6VA 2YV5A 3EFOB 3ODPA 3X1YA 3PT9A 4E70A 2X6RA 1L5OA 3DZGA 3NHJA 3D4PA 4B48A 4YP1A 4C3VA 2XBMA 5SZHB 2CMGA 4CUKA 1YRAA 3QTTA 1ZJJA 5C0OE 2WV9A 3GEDA 6GPBA 5L45A 3BTSA 4CMKA 2PTHA 3Q9LA 3HKEB 1ICIA 2QRZA 1UBTS 4UOEA 1A9ZA 1UWKA 4F93B 3K8YA 4LGMA 1E60A 1D7AA 3N8KA 4OKIA 2E5WA 5FPTA 4CDRA 1NBMD 4YPFA 4JFAA 4PCVA 4TKZA 3LCVB 4AJHA 5EIBC 3T3GA 5KVAA 2ZAGA 3JAKA 3M83A 2DHEA 3PVZA 4ZT6A 5HDBB 1VJCA 1X7WA 4HTFA 2HMVA 4J76A 2FH5B 5DHQA 2RONA 3RAJA 2QGZA 5I3CA 4DA9A 2P91A 5LQRA 1LSUA 4M0EA 3DE6X 4I1IA 4BN4A 5LMZA 3V6LA 3QLUC 1T15A 2XJ4A 1DPGA 2GXQA 1EUYA 2KE5A 2CZQA 1GL7A 2H4FA 2KQUA 5TEVA 4KW7A 2GHTA 4YRAA 4OI4A 2CWWA 1JEYB 3LOUA 5JZSA 2O1EA 1JZQA 5JO9A 5L3ZA 4KLNA 1NJFA 1T2UA 9LDTA 1K2VN 1GXSA 2YZ2A 4L9WA 2K2QB 3GUZA 4DUGA 1Z0ZA 2JIZA 2YASA 4IVRA 1B00A 3WHPA 3GRKA 4HQNA 1MAWA 4DV4B 4BCCA 4TKVA 4JSTA 5DM1A 2R6JA 1Z6ZA 1ZJ6A 3KELA 3M89A 4ZHQF 3TSZA 2HWWA 4KGZA 3F73A 2LKDA 5CM8B 2OV2A 4ENVA 5CJPA 1UCFA 1Y5NA 5HHTA 3HJFA 1P9LA 1ZI9A 1PBTA 3HUDA 1H0KA 4YCSA 1QK3A 4A8PA 2HJRA 5BR7A 4ZVLA 4YJFB 3WGZA 5HX7A 4W5RA 4WADA 1AK2A 2QD4A 3DUFA 4Z86A 3FVRA 2XLBA 5BV0A 1POWA 5JYDA 3O73A 1GNSA 1R0XA 4RLSA 3ZHZA 3AGQA 2BBOA 5BSRA 1HDRA 4LWPA 5CDFE 1OAOA 1XCGB 3AUJB 3M4NA 5L4SA 2FPXA 4R3UC 4AF6A 4JNKA 3HVKA 3U13A 4YQYA 2OQRA 1Y1RA 1VI5A 3O03A 2CL0X 4ZTUB 5CA1F 2GAOA 4NE9A 1I4WA 3H86A 4QEKA 1N4AA 4DDKA 4TM7A 3L8MA 1FUIA 4UBLA 4RMNA 3VU3A 1E6EA 2ZR7A 3V4ZA 3U6KA 1MFPA 3R9WA 3W2HA 1CUXA 1QLWA 2J5BA 3ESYA 3K3PA 5EPOA 5IC5A 1C30A 3FIUA 4TYWA 5LFAA 1JAZA 3FBTA 4GM4A 3O8DA 4V2IA 3SBDA 4YECA 3OKAA 4UVEA 3K94A 4KYTA 4QYIB 5A0VA 1C4XA 5JLAA 1XJ0A 2RGDA 2UXDB 2VWHA 4PLTA 1JIIA 1RPNA 4PSKA 3V2IA 2D54A 4P84A 3UH0A 3FOAA 1DUSA 1USKA 4P35A 1JSLA 4QJIA 3DDOA 2X9GA 1KY4A 1U2QA 2D0PB 4NK5A 4EFMA 1OLOA 1ISRA 4CM8A 4JYAB 5K3BA 2O2DA 3DPIA 3KKLA 2FN8A 2JZNA 1TLLA 4JLKA 1FQJA 4DQXA 2VDQB 2WC1A 3PEFA 4EHAA 2CCJA 3SBXA 2A84A 3CA8A 3EPPA 1Z6AA 4IUDS 2JFVA 2X3FA 3KVVA 3L07A 5M34A 3A4IA 1CQIB 2GQ0A 1CJMA 3IC5A 3QE3A 4IDQA 1AN9A 3Q98A 3ZIAA 4DIBA 1F9EA 1L5QA 3WICA 1M8PA 3M34A 1G7RA 2H7XA 2FW0A 3I53A 3NNNA 4QTTB 3V8NA 3VKWA 3ZDZB 3ZEAA 2R6R1 4B31A 1O4WA 4J0QA 2JAUA 3TIVA 3KETA 1DCMA 1UXGA 4TQ9A 2DETA 3UFXB 2WJVA 4BNWA 5GONF 4BYMA 4GVXA 4IEIA 3FGOA 1XRSB 5FBWB 2D0DA 1CWUA 1GPDG 3QW2A 2EJTA 1UOPA 1ZK0A 2VJPA 4FFBA 1EK0A 2GXUA 2ZI3A 3EXG1 3UMRA 2FWBA 2B9VA 1Z28A 1ORVA 1OFIA 1UAGA 4MXDA 4IJMA 3LU1A 3VOTA 4ZDWA 5FOUA 3RABA 2OO5C 3ILYA 5FWXA 4AIRA 4K9DA 3E22B 2BLLA 4RH0A 5SV2A 4YT8A 2PUCA 4HUJA 1BGXT 1J2RA 2QW1A 5DX8A 2OFFA 3PV0A 1E32A 1OI4A 3DQQA 4O2BF 2YINC 1GTZA 4LDQA 5HR5A 2ZYTX 2O54A 1YUBA 4RJJA 1L7NA 1S4MA 2XRZA 3QX3A 2B4RO 4O1IA 2Z0MA 4A7PA 3EVNA 1X14A 2F59A 3OPYA 5CTJA 1B8PA 2NVUB 4F5YA 1PNQA 3QW4B 4HVCA 1JALA 2V98A 4TXJA 1PF7E 5CNMA 1YNOA 1FDSA 3CRQA 4C7JA 4RTMA 1ZP6A 3BF8A 1OXVA 2PA0A 3IJRA 1G8KA 3TXAA 4KNYA 3II6X 2A3NA 1UJMA 3IKMB 1ADJA 4JUIA 3TW4A 3EISA 4OJQA 3ZHYA 4CKBB 1EEXB 1RHUA 2FZEA 2FRDA 5AW9A 5BUCA 3FMGA 2I4TA 3KJGA 3AERA 2O8BA 3G2HA 4NEGA 4W8GA 3M1YA 2I87A 3IUEA 1UXIA 2O6HA 4M36A 3U3MA 1NONA 3WLAA 1XTIA 4MGEA 4REMA 3JWHA 4KXNA 4Q9KA 3BWBA 1OPRA 4EVSA 3NIBA 2KMLA 1Z0FA 1O77A 2WJJA 4QECA 1PL7A 3SPXA 2BUBA 3OCCA 1W4ZA 1WVIA 2NXWA 4AJ4A 1Z07A 2I3BA 3I2HA 3IUSA 5C8YB 4F3CA 3LS2A 4KOEC 1G59A 2X8AA 1OFVA 1Y63A 2VP3A 3JAWB 3NHAA 3A3KA 4OXQA 4ASUA 1X6VA 1K92A 1UDWA 1KQOA 3DNPA 3ICCA 5AHRA 4ZRMA 5JSFA 1WCIB 5FLXA 1QSGA 3SEZA 3B6JA 4D2IA 5TV2A 4EFNA 4Q4JB 5K0SA 2C97A 3BIOA 2E7ZA 1VP9A 4ZOLF 1GSOA 3NGMA 3SD7A 2XRYA 1N0VC 1XVLA 1Q1GA 1QRDA 2WK1A 2O2GA 1HDGO 4IILA 2PLFA 4YJFA 4L8FA 5DBHX 4FHDA 1QHFA 4TL8A 3ZCSA 4BLRA 4N6OA 1ONNA 2QTMA 1B8VA 1JZSA 2ZT5A 4IOMA 5T4FA 4FSHA 1ZI8A 4I1SA 3FROA 3SS9X 4D43A 2PIAA 3PUXA 5L7YA 2OCYC 4PGMA 4IY1A 2WD9A 2NUAB 3Q3GE 1HDZA 1PGPA 2Q9UA 2ZBGA 1N2OA 3FKJA 4F11A 5K6AA 4X54A 5IYZA 1Q6YA 3G13A 3VYUB 3B36A 2VC2B 1TM1E 2HB6A 2JFQA 2YHAA 1BN7A 3DF7A 3LUAA 4GYYA 4ZJUA 3KWMA 4K9PA 4QUEA 5DN6A 1NG9A 4RZ3A 2V8OA 4YRJA 5E3HA 1GQFA 4QUDA 3M1LA 1JT2A 2A7QA 2C94A 4OXNA 1DAOA 2FJPA 2R65A 1NM5A 5H59A 1XQVA 5DHUA 2DCMA 1JR4A 2FSVA 5EFZA 4D7AA 1UMDA 2Q6TA 5D3MB 4ZVUA 5DZSA 4LYYA 1A8IA 5JS1A 5F9FA 1GPJA 2VPQA 5IANA 3L43A 3LQYA 1YAJA 3HUEA 3CLSD 5JJBA 2AZDA 3ZTTA 2IQ5A 2TSYB 2JGJA 3F74A 4L8VA 4PC6A 3N0VA 2FWAA 3PNKA 1ESCA 3IFSA 4TXHA 4OSOA 1EUCB 2ID8A 4A6DA 5KJCA 1DQSA 1ODSA 5EZ5A 1U81A 1W9HA 1AQUA 4N4AA 4OTZA 4PQRA 4CMHA 4PVCA 4M1SA 1CRWG 2V7VA 2I9KA 2H4ZA 3F3SA 1SCUB 1Y7PA 3L7DA 4HPWA 2XXAA 4KFSA 1OX4A 4JKOA 4ZCTA 3WI7A 4PQYA 4DDVA 1VHDA 2L2QA 2YIVX 4M1ZA 1R8SA 3RIHA 2P2YA 4NR0A 4FONA 4ADSG 4BEWA 1KKUA 4Q1EA 3SI7A 4CLEA 1LQTA 1S8AA 3DMGA 5JZ9A 3CW9A 1B43A 1EE2A 1GG5A 4N0QA 3DVRX 3I45A 4Q05A 4N47A 1C9DB 4L4ZA 3WLPA 1FB5A 5TQ2B 2PEZA 3T7DA 1K7XB 3C7CB 2YCBA 2AIRA 3BD8A 4N3GA 1EVLA 3IOYA 3WBBA 2OBFA 5BPHA 3A7DA 1IZ9A 1ZOLA 3GP3A 4C05A 1L7XA 1J8YF 2Y1XA 4QELA 3WGTA 3QJGA 3PFFA 4C03A 1T6XA 4X85A 3SXUB 1CDEA 1YQWA 1NDHA 4EMSA 1G2PA 2NV0A 1B74A 1HYBA 2HZ7A 2F9FA 3ZY4A 1X15A 3TGWA 2AQKA 1MRZA 1QAOA 3BIJA 1WSBA 5JAPA 1G1AA 1UPBA 1Z4MA 2UUOA 4RD0A 5KSZA 3UPUA 4RACA 3X2EA 4ZVOA 2RI1A 1A5SB 4NENA 5EP1A 2QAJA 1R4MA 5BN5B 1WABA 1Z74A 5CB4A 1I3OA 2CNNA 1EQ2A 2G83A 3WLSA 4EMBA 4P22A 1SIUA 5BQ3A 3EAGA 1MUUA 4YC7A 2C84A 4H77A 4DCGA 4XPIB 4JBGA 1A3CA 1NAHA 3A4VA 3CKYA 3CX8A 4MUKA 1KAGA 1KPHA 2HDNB 3OPVA 5JSQA 5F5LA 2WG0A 2R1VB 1CS4C 1EFPB 5G0SA 3RLFA 4KWEA 2IUYA 4RKFA 1AGXA 1PNOA 1ZITA 1T3SA 3SHTA 5K4GA 1DBPA 1P0CA 2ZS8A 3BUSA 1E77A 3M5WA 4EATA 5JY1A 3IALA 2I54A 4KMSA 1ZGBA 3S2GA 3TNLA 3W5UA 5IAGA 1VYVA 2J41A 2DE0X 3DE1X 3EY4A 3CF4G 3EW9A 2B94A 1TEVA 1WHSB 3DMFA 4FHEA 5JPIA 4GKKB 3FMIA 4NS4A 4JQCA 1TCUA 1SELA 4I6JA 2Q1WA 4WH0A 2JH3A 3L0PA 1RI4A 1JJAA 1E5LA 4HCJA 2DHRA 1V95A 2QE7D 3A6DA 4NBNA 4BAGA 1ID8A 2J9FB 4LOLA 2ECKA 5CFNA 2DTEA 5JMPA 3IP6A 1OW3B 4J4HA 4OLBA 1EM8B 3QEOA 3CURA 5CR9A 4QRIA 2WAAA 3LPAA 3F1KA 2QJFA 4YGYA 4UE2A 5JBQA 1SBHA 2ZBFA 1E4EB 5DYIA 4IO0A 1QE0A 4BX3A 4ZIRA 3KHUA 2I22A 1M67A 2XWQA 3DF9A 1AU9A 2WYHA 4XX1A 1AQJA 3L4JA 2NMVA 3BXGA 3B38A 3U31A 2PLWA 3Q3EA 3LDFA 4Y6LA 2XUZA 1CJUC 1QFZA 3KEMA 3LY9A 1QBGA 4OEHA 2AFIE 2VHQA 4KLRA 4NBTA 2B8NA 3EH2A 5FD8A 2Y9PB 3IOEA 4QQFA 1GZUA 3OE1A 3ZVNA 3NC0C 1ZCBA 5HK8A 3EG5A 3EWSA 2CVQA 3MTDA 4N3NA 4DHEA 4EB8A 4HAZA 4RLFA 3KQYA 2Z6AA 1LDGA 3DBOB 1NX6A 3K05A 2ENUA 4MR7B 2ZITA 2NNLD 5TQ2A 4V0OA 3I8XA 3OQBA 3THWB 2G5CA 3M1IA 4ENWA 5IDVA 2J3IA 3HY4A 3M0EA 3MJCA 5J23A 3VO2A 2VJMB 2O52A 4JXZA 1CEXA 3WGJA 3FBGA 4MDEA 1QHEA 1SUCA 3D1JA 3DBLB 3RWMB 4JI4B 2JF0A 5KQGA 6ABPA 2O23A 2FSUA 4CM7A 3EEBA 4AXBA 2CJXA 1EGMB 2AQHA 2NTVA 4BIMA 1Y1LA 1LVGA 2NUAA 5DWQA 1XEWY 2EHDA 3DMTC 1JHQA 1G41A 3RUPA 5HCNA 3ETCA 1QQTA 1XLWA 1NC3A 2NXCA 1WVMA 4WBXC 1PSDA 2FW1A 1QP4A 4XE5A 1ZR2A 1U3UA 3FCSB 3E8SA 2CW5A 2WNHA 3IUBA 3KLMX 3SZUA 3EAQA 3T41A 1GNTA 5AUQA 4KIJA 1SU8A 3IL2A 1E4OA 1L5SA 2ECPA 4Z9AA 3IMFA 2VPWA 1BEUB 1MA3A 2FN3A 4Q7QA 5BPFA 2BEVA 3LIPA 5FV4A 1JG3A 1E5DA 2AEFA 1XCJA 2YJ4A 1CUIA 4MPTA 5FDFA 5JEEA 4I6EA 521PA 4OHYA 2Z4SA 4URFA 5E2BA 4HBZA 4KK4A 1AKEA 2OFPA 2I1VB 3PHGA 4M0DA 4DWOA 2HIMA 3A2MA 1AUPA 1SMKA 3RVLA 5TS3A 2H5LA 4ZGBA 1QVWA 2FEXA 4CDGA 1JLKA 1JMVA 2HBRA 4JMPA 4MR8B 1L5ZA 4BKPA 1DU4A 4RWEA 5JWHA 1AQIA 2DFNA 4X1YB 4ZU3A 2HSEA 1CR6A 5EWMA 1NT2A 1FVXA 3BTUA 4CG2A 4EA7A 2UVQA 3HYRA 3K31A 3VPGA 5C4IA 5JZMA 4GPD1 2BM0A 4C6TB 4DYDA 2QMEA 5A4MS 1ZM7A 2A1UA 4C7KA 3BM5A 3D2BA 5LQJA 5K6TA 2IP2A 2ZVQX 2ZVDA 2ZRKA 1V1RB 1F7VA 3OO0A 1DHTA 1IN7A 1OWOA 3DLPX 1JLHA 3HMQA 4JR1A 2I3DA 4R84A 3B1ZA 1YBAA 5AVTA 2CYBA 4JLBA 3M4JA 3WNCA 1UUFA 2QIPA 1KO5A 1MMFB 2HV8A 2Q7XA 4RIGA 2ZS7A 4AVYA 5JS6A 3I37X 3PZBA 5KQPA 2CL5A 3DFKA 3E2MA 1RT9A 1QZUA 4PC1A 4Y1RB 3S5UA 3HTXA 1KC3A 3DE5X 4XM1A 4B81A 2GN6A 2OC4A 1WCXA 4E88A 5IBQA 2HCTA 5LMCA 3H9BA 3DAPA 4DV2B 4GOKA 4XFKA 1W5SA 3AI3A 1SUIA 2NTNA 2ZW9A 4PXYA 3KQHA 4O4JA 4RSRA 4LHEA 5GADl 4GLJA 3K0SA 1BDMA 1FTYA 2CF6A 1N75A 2P5UA 5IVDA 3DR5A 4PXAA 1E9SA 1NIPA 3B9BA 5E4TA 4AQYB 3T4XA 4GZ5A 4PTYA 5EJIA 4Z2AA 2P6MA 2F43B 2QQFA 1PKXA 1TU0A 1CQIA 2Z98A 4KVFA 5JZBA 5J1SB 3S68A 1C8KA 1N2CE 1K6EA 1Q74A 3K16A 4WA7A 4H59A 1GPWB 1NPTO 4HAIA 2O5CA 5BSMA 2FPWA 2HX1A 3JY6A 4L95C 1AKNA 4RPGA 3QQPA 4V0LA 2V6GA 3ZY5A 5CGQB 2FZLA 2JCBA 2V97A 4BBJA 1V7ZA 4EJ6A 1Z2NX 2C3OA 1PBNA 6YASA 5CNKA 3BDVA 1OBCA 1S9DA 5K7SA 1E3MA 2I3AA 1RD4A 1ICEA 1LSJA 1NXOA 1GUDA 3MWDB 2LZ0A 3ICVA 2ZJ7A 3LHDA 1RQ2A 2WKQA 2PUJA 4Z0TA 4F3NA 3OLQA 2R8YA 2E4VA 1QIEA 3L79A 4PYRA 4BL5A 2M1XA 2ZRDA 4I4TF 2F3QA 3WGLA 4P5DA 4P83A 1OKKD 1XRPA 3QKIA 1RWBA 4IF4A 4QPNA 1NUPA 4U0JA 5DTEA 3UFBA 4ATNA 1T2CA 1CTQA 3DNFA 2ZYDA 2I6UA 4MK4A 4DIKA 2ZIZA 3F71A 3MGCA 4RKRA 4HLDA 5B6JA 1P0PA 1YDMA 3PDUA 5KTPA 4DQUA 5AK4A 1JEYA 2OUIA 3LXXA 1H8HD 3GLIB 4WESA 1Y1KE 3OQ6A 5LP6C 4ALLA 4ES6A 1XF9A 1BDBA 1N0HA 3T4EA 3ELYA 4NMXB 3GEHA 1U28C 2D2XA 2AMYA 3CFYA 4KN9S 3ZLTA 5EJ6A 1DIOB 1CD5A 4DV3B 1Z5UA 4E51A 3L06A 4DMGA 5H4GA 2KPOA 3B70A 1YDEA 2YJ5A 5BWNA 4PO9A 3IBCA 3ZCRA 1SKMA 1XMVA 4YUYA 4ZDJA 1QOPB 3UXYA 1SIWA 1HA3A 1S6YA 4IDNA 4WLEA 2WVGA 5DYYA 5BT9A 1AS0A 5AI6A 5K0CA 2HJ9A 1CE8A 2I6GA 2G88A 2FSVC 1KI2A 1V7PC 4L5CA 3SC3A 3MJSA 1D4ZA 1Q0PA 1NNEA 2WTUA 4J3NA 3OHPA 4NPHA 4P9NA 1FNMA 1TAQA 2PUWA 5BWBA 1JTEA 1Y6FA 2ZIXA 2QG9A 2JJYA 3IE0A 1OX6A 2AI3A 4OUDA 4Y7CA 4AF8A 5I9LA 3O92A 3HBAA 2YIDA 3KPVA 2BHNA 1LLUA 4IGIA 3QV1A 1PJAA 4NU8X 4TZKA 1XA4A 3MWJA 5JH7B 4O3MA 1OKKA 1RS0A 1SXGA 2FWJA 1YSCA 1JPUA 4LY6A 1VBFA 2OBBA 13PKA 3HACA 5L7TA 4A0QA 2B9EA 1K06A 4JHXA 3AOGA 3PNVA 5HWSA 2VCHA 1N5LA 3LG2A 4HLQB 3SGLA 1W76A 4BTEA 5IM4A 5JVDA 1TMYA 2V8BA 3TLCA 3WWZA 1XU7A 1T4CA 1EZ4A 2JH8A 1FPMA 4G84A 4AJOA 4K3VA 1YVDA 1LF0A 1P7PA 3N2IA 2FW7A 2VHZA 4LNUB 5IBPA 4BO7A 3CG0A 4FFPA 1NVWQ 3KKKA 4XEUA 4DIDA 3V8QA 1NI4B 3FYDA 5D6NA 2QUZA 1GTJ1 5BOSB 3N74A 1WD5A 1RJWA 1H22A 3S4YA 4CL3A 2BVNA 1RRGA 4BFLA 5IJZA 2ZB2A 4GEKA 1T8SA 1TAHA 1P5HA 4ALMA 5FB3A 4DUPA 5IYZB 3PENA 1FNDA 4PC7A 5KOJA 5BR8B 4WCFA 1EFVA 2GRJA 1W2GA 4H7JA 1NXXA 2WWIA 5A9SB 4XX0A 3C74A 1JL3A 2AWNA 4R8SA 4PGAA 1N6KA 1IZZA 1KAMA 1NSYA 3UB3A 4XJXA 2A5YB 2HQSA 2I7CA 3FTQA 1MIOA 4TYQA 1XYYA 1C1DB 1ZISA 3DOHA 2QN7A 4OU4A 1GWNA 5AM5A 1Y6RA 2QBYB 4PZYA 4UAJA 2OHFA 3T7CA 3UJAA 2FE4A 3I4LA 4BMVA 4BRUA 3S2EA 1T0HB 2I2WA 2QTHA 1F0YA 4IJ5A 4HB4A 3R41A 1PGOA 4BFSA 1ZK4A 3BRCA 1L5WA 3PJEA 4HNGA 2C58A 3MT7A 4BB6A 1W5TA 4XSVA 4LF8B 1T29A 4EVQA 1F8UA 5ELXA 3PE4A 1EGVB 1R15A 1WZEA 1OI3A 3AM5A 4HZIA 4PIVA 1V25A 4NOMA 3TX2A 1SEVA 3MCZA 2ZIEA 3P2MA 3KVRA 1YI1A 2WUVA 1EG7A 1VL6A 2QMOA 2Z08A 1M2JA 1DWQA 3CLVA 5FWDA 5BMVA 4TKLA 2XYHA 4AKGA 5A3VA 1R4AA 2YXEA 3TK1A 2FA9A 4HNAB 3EMKA 2OK7A 2P41A 2X0IA 3M6AA 2WHPB 3M82A 3MMNA 5KNBD 3V7WA 3TBHA 2VTVA 2ZWVA 4IIBA 5LKRA 4HDMA 4N40A 4R7ZA 3TO5A 2Z1DA 1S8FA 3I8SA 3F97A 5FLEX 1W1UA 2BEWA 3KOUA 4LTDA 4NZOA 4RHEA 3WE7A 4ZO8A 4CBVA 3ZG6A 3NBFA 1KA9H 1FFXA 3LM8A 4KVZA 1HKUA 2CVZA 3CJQA 1KAEA 3TEMA 1MX1A 3DVAB 1A4RA 1NI3A 2H1RA 1UPAA 2WTMA 4KVGA 3WWEA 1KMMA 1RC1A 4LQLA 3U44A 4D9IA 1I4TD 1ZW6A 3HJTA 1CQWA 1L7QA 1RWMA 2N9UA 2QPTA 2VYVA 4MVWA 4W9RA 1SZPA 1VPVA 2OV4A 4M8SA 2E82A 1V48A 4V0RA 1ORIA 4YX9A 1PFYA 4HRAA 4LSGA 4JQYA 1HNWB 4EP1A 3ZWXA 2VF2A 3AU9A 1BE6A 3LHFA 5SYMA 3WLMA 5BWCA 3EIQA 2YMMA 4N12A 5NULA 1PS9A 3V2UA 1K8QA 1D6SA 5IDYA 1WDWB 3CCBA 3HU5A 3TGPA 4DQVA 1M1YE 3S99A 1TVKB 3DXZA 3HKBB 5AO9A 3T99A 1WZNA 1B0ZA 3UYLA 1A69A 3M9WA 4KJZA 1XSEA 4QJ5A 1T0IA 1N34B 4HL6A 1NF3A 2GT1A 3ICPA 4UUQA 2RBGA 3OMWA 4D9EA 1NASA 1EVJA 5GM2A 1QQ5A 3BH7A 4FOOA 4KX3A 3KDSE 1DBVO 1NKVA 2RGWA 2Y05A 1QYIA 2VSOA 4QC2A 3D5EA 3KJEA 4JLNA 4JKIA 1ZC4A 2ZRPA 1SCAA 1QLHA 4L7VA 1ZRHA 1E1YA 2BMEA 1XYGA 3OIWA 3PKZA 3EZ2A 1H9CA 2ZJ3A 4DCPA 1UQTA 3O0TA 4C06A 1NPYA 1NUQA 1VCHA 3NG1A 3F8WA 3FOZA 4V38A 1F8GA 4A6XA 1UXHA 3KSZO 2BGRA 3DVLA 1E7YA 2AOUA 3TRIA 2XUOA 4D57A 4GR9A 1NJGA 1CY8A 3I23A 3CVUA 2ISCA 1J2JA 3QEMB 2PAAA 3RTEA 7GPBA 1KFCB 1U8CB 3C5WP 2Q21A 4LA4A 3VU0A 4C43A 1EDOA 5AKEA 4DMKA 1M7GA 1WTCA 3EZNA 3RW9A 5DHPA 1CNEA 4HG2A 1M6HA 1L4HA 1AGNA 1KZGB 2R68A 1M54A 4UTPA 3EXEB 5DLDA 4OK3A 2XITA 3ROTA 1GKLA 4UTVA 4L85A 1FZQA 3W8RA 5LZ4A 1Q2UA 3BJZA 4M3NA 3GMDA 4BLSA 1O0BA 5EHGA 2CFSA 4D8UA 4RS3A 3V48A 1R0LA 1U0SY 2GERA 1U2TA 2JHGA 4FS8A 4LRYA 3U4AA 5KHOC 1L5LA 1V5GA 1FCJA 3IPCA 1TGVA 3AKCA 3UHAA 4NCAA 3K30A 3VDXA 4IJQA 4EIWA 2YS7A 1UXJA 3BFKA 3THWA 1P1RA 4MUGA 4F9FA 1WZCA 1MXHA 1RYEA 3IQIX 3LGSA 4HHEA 1CF9A 1AA6A 2H1CA 1KYQA 2QF7A 3KTAB 2OHHA 1CS0B 4WBNB 2MDTA 1DOHA 2GI4A 2ZYHA 4RADA 4BY9E 1COWD 3DT8A 3UMJA 3WFIA 3H9QA 4YMSA 1YZKA 2QRQA 1H66A 2K5UA 4OL0A 1WMEA 5HTKA 1U7UA 2NO1A 2QAGA 4KWTA 4MVJP 5CIYA 4XLTA 1G3UA 2J9YB 1BROA 3OLZA 3KR1A 1ZK2A 1NW5A 3PEUA 1Y9ZA 3FF1A 3PDCA 1QHNA 4LY0A 3KLBA 3GI1A 3LRPA 4S35A 1S2LA 3N2KA 3IBSA 4H3HB 4BJ1A 1K7SN 3IGFA 4PCAA 4MB0A 1VHLA 3B78A 1M7BA 3DP9A 4EYOA 3BK7A 1UT6A 1GV0A 2I4NA 4GXNA 1EZZA 1XZBA 3JPWA 4EF4A 4YUZA 1Z38A 2YMQA 3C3DA 1EVEA 4BNYA 2DOKA 2RHDA 3PQ7A 2BL4A 4QVIA 1NF8A 1E18A 1T2NA 3BBLA 5FNVA 1BSVA 3EZYA 1P2DA 3X1DA 1H8ED 2K4MA 4O2RA 4UPDA 2QLFA 3H2JA 3IR5A 3LTEA 3I58A 3Q0EA 2QPAA 5JCOC 1XHFA 1ZL0A 5L9AA 5B12A 1ZJYA 1JECA 5FKJA 5JCXA 4MW9A 5KVVA 1ZFNA 2PV7A 4DY6A 2DVMA 2R7AA 1KI6A 2YBDA 5B3KA 1RI1A 3ZQ4A 3SU8A 3Q3VA 1T36A 4U00A 1F6DA 2IZ5A 2VHXA 3FNEA 4FOSA 3WAJA 4DSZA 4M7OA 4QBHA 3TJMA 3WRYA 2HU2A 1K8YB 3D6FA 4OHRA 4IQFA 4R8LA 4WK4B 2DCUA 4R68A 5DNVA 2W4MA 4M9CA 4L9SA 2ETVA 1YL5A 3TG8A 3F7TA 4OLJA 4UZSA 4NJMB 1D2MA 1XC7A 4HUTA 3QNWA 3ANMA 2A5LA 4G5HA 1CY1A 5H0IA 3SMVA 4XW2A 3RRBA 2VTKA 1NNI1 3GRVA 4LC9A 3DW3X 4WASA 1SBZA 2UZ1B 3N5KA 1YF3A 2CVPA 3ZLJA 4ZYLA 2R8ZA 3SM3A 2PFGA 1BO6A 1U90A 2NUBA 2OZLA 4IKEA 3SJCA 3ZE9A 2QD2A 4MDFA 1PV4A 2YOGA 3DCNA 1EDBA 2C5BA 3HH8A 2HN9A 4POAA 4FIDA 1E3TA 3FAZA 1I2DA 4UUMA 3T3HA 4BP1A 4DEYA 4L1KA 5B1YA 3LP8A 3HO1A 4WT7A 4Q93A 5FCDA 2JLQA 4RY0A 1MNQA 4YJ2B 2PV0A 2JHFA 2P8SA 5F9HA 1OIXA 1Q7EA 5FYQA 4NCXA 1KEKA 1TM5E 3KT3A 2XCTB 3C24A 3AJ9A 5LZ8A 2VSQA 4DNXA 1YE5A 1QRSA 2SICE 1OFUX 2VZ9A 3AJ8A 3IEXA 4JJGA 2G77B 5EERA 1YQ9A 4DE5A 4CM4A 2FUKA 4K40A 3QUSA 5E4JA 3CONA 4BO4A 4QASA 1L7PA 1KZ1A 2GHIA 2JIOA 1YQEA 3PUZA 4PZ9A 2FN9A 3BWVA 4FGKA 3ZVKA 3LLSA 3H4TA 3MN1A 1XI2A 3UJNA 4G23A 1OFTA 1S02A 2WJWA 3MINB 3QVJA 4QOIA 4HYQA 3SAJA 3G2KA 4NEHB 4R41A 3HXOA 4G26A 4BX8A 1XPOA 3OH8A 3RS0A 5CYFA 2W6IA 1U3VA 2XCSB 1ECGA 4FXOA 1G98A 1LA2A 3WYGA 3AOEA 3BEOA 2FK7A 2R7NA 5T7BA 1PTKA 3K0KA 4EW1A 1BMQA 5DNEA 3OWHA 2ACKA 5L51A 3FRJA 4Q16A 3RT1A 2YN2A 1U2PA 4QFBA 3EZXA 4JBHA 1MXFA 1A1SA 2CD9A 4NU6A 1SU7A 4R1LA 2FF5A 1E0JA 4LE2A 3SX0A 4Y0NA 4ZMRA 2RJOA 4OO3A 1FDUA 7AT1A 1QHGA 3QSGA 4GMXA 3RK4A 2REOA 4S1PA 2J0UA 2YV4A 1LPPA 3I73A 3H2SA 4ZOAA 2VRWA 4ME6A 5G0WA 3UM9A 5KC8A 1GTSA 4B2LA 1C50A 1EWTA 2AN3A 3ROXA 5CVUA 3CH7A 3TB4A 2CHUA 4CRWB 3HEBA 3FNFA 4LOIA 3E9EA 4OXKA 1E3EA 1KRWA 5D87A 3KBBA 2IBTA 1C7QA 3MT8A 1W0JA 4AN1A 4UUPA 4U9HS 3SZGA 4FNMA 5J43A 2VXYA 2PNJA 3C1UA 4MVYA 1L7OA 5U9CA 1KI1A 3GAMA 2ZE6A 5IBCA 5JQWA 2FUEA 4RDIA 4YHHB 3CR8A 5A2GA 4KAFA 4RMJA 3UBTA 4XI9A 3GLIE 1KBOA 1XG5A 2Q4EA 1YMUA 3GLQA 1EHCA 3HU3A 2O2CA 3PUJA 1LDYA 2DF8A 1CERA 2DR3A 4NBRA 4D26A 4PAQA 2QVGA 1G20B 2J1LA 4EHKA 4EY5A 3AYZB 4Z53A 3IHTA 3JTEA 3J81k 1ZESA 2OKCA 4AMGA 4N76A 1CUWA 2H4HA 2VRCD 4HBGA 1AS2A 1FTGA 3T38A 4G6ZA 2DFTA 3ROQA 2FFJA 1VG0B 3FWNA 3FDFA 1GCOA 3G0GA 5IULC 4BQQA 1WKCA 3UQZA 1KYWA 2JVKA 4LRTB 1BX3A 1UL1X 4TSFD 2JLZA 2DSNA 1GV1A 2QRJA 1EJ0A 2NXEA 3AFHA 4GM0A 2NNWB 2D0OB 4F04A 5CCBA 3GK3A 2PAFA 3QMWA 4PFKA 3QKSB 3HSSA 2JGDA 3EXG2 2EW1A 1Q95A 4N5IX 1NR5A 4X7PA 1U63A 3MEQA 4PSAA 1QTRA 4P82A 2VOEA 4CKEB 1FLAA 3JAWA 3F6PA 4DLZA 1EDEA 1IZ0A 1MJ5A 1GFZA 1VRWA 4EGJA 1R3UA 3I9V1 4CLDA 1KHTA 3D3JA 3FJOA 2JBWA 4YALA 4GZ3A 3ZIAD 3ZCUA 3W0LB 3TINA 3D8BA 3J7AC 3CX4A 2OQVA 1SFRA 1GZSA 3R76A 1G17A 1K88A 4YNBA 4K1XA 1IL0A 1JKJB 3OEHA 2X0JA 4A8HA 4N8DA 4AQ7A 1IJKA 3KLPX 4E4TA 2YY7A 4NEQA 1UWLA 4PYKA 1RM0A 1SCBA 2ZYIA 2PX6A 2D1SA 1BMTA 3DKRA 3OBBA 4CLOB 5JD5A 5T6MA 3CUUA 1LBEA 4GFDA 1ZZGA 4MI3A 3FNQA 2P27A 1P0FA 4C9BA 3R23A 3V2GA 2PXXA 3UPDA 2PT6A 2V4UA 2BGLA 2Q5IA 4DV6B 1Z5NA 3R3HA 2VT3A 2EBUA 2XNHA 4JR2A 3W8FA 3ZS8A 1KQGA 2X77A 3TDKA 3LCMA 2IHTA 1J99A 2VDKB 3CLKA 4MA5A 3OTIA 3CNQS 2DSTA 3R6WA 1TO2E 4OJTA 5LDGA 3QHPA 1Y3CE 4O3FA 4D4JA 3RASA 4N01A 3SHWA 4R2XA 5HBRA 1CUYA 3I0NA 1XQYA 2WWXA 3DEZA 4NBUA 4P81A 3DTYA 3N9IA 3MRTA 1J2UA 3ZV7A 3IMKA 1I3KA 2JI4A 4Q3BA 1KOJA 4QDTA 3P9SA 5K0GA 2I4OA 5KMGB 3KLNA 4R2HA 2FEPA 2WHPA 3LY8A 4RD6A 1U6JA 2OG1A 1UWVA 1DIRA 1GL6A 3VHRA 4MKZA 3MNFA 4P33A 4DR5B 2RBKA 2JGKA 2I2FA 3GJ7A 1QIMA 3C7TA 4IDHA 3WJAA 2TS1A 4RAQA 1UPUA 2ARKA 4M0PA 1FS6A 3D81A 1W4LA 2QAGC 2K7FA 5FPKA 4OBWA 2WPDD 2C4UA 2CJYA 1SKUA 2FR0A 1UBRS 2A2ZA 2RARA 4OY3A 5TQVA 4BNVA 2GM9A 5DRTA 3V55A 5AD1A 3C0KA 1ESEA 3RS4A 3WLEA 4FMCF 1DMSA 4XQ0A 2PGLA 3VNAA 4QUIA 1E9FA 1T1SA 4ETIA 5KYYA 4UOQA 1L8LA 5CVCA 3RT9A 4FGSA 3NBZC 3QVUA 3A4TA 4BFUA 1PHPA 1PT9A 1SVOA 3ZD6A 4F2PA 5TQ0B 2IPAB 1WSDA 5IKEA 1VJDA 1N5OX 2KLHA 2PS3A 2ZI5A 4IHJF 1JDNA 1P2SA 3A0RB 4AZSA 4DMLA 2IBSA 3K72B 4Q39A 2NM0A 3RVNA 3VVLA 1LLDA 5LWHA 1AGRA 2FPKA 1ZSYA 1HE2A 2ZQYA 2HYDA 2QSYA 1XGKA 3MPUA 4U9IS 2CFOA 5AK3A 4IFEA 3COSA 1ISSA 2CJWA 5FWXB 1O57A 1Z88A 2QZ4A 5ULLA 4ZZIA 3Q87B 2P6OA 1UKEA 1JFVA 3CT4A 3KEOA 3EZFA 4CTJA 5H8WA 4IMRA 3CV3A 3CVWA 1YS2X 4MVJG 3IAAA 2BM9A 1S4QA 2L19A 1NMXA 1DQRA 1S96A 1EFCA 1M2EA 1E1QD 4V0NA 3ZHBA 3R0QA 1Y5LA 4QTUB 5JZVA 1A88A 4X1KA 4EEXA 2Q50A 2I1QA 3KYBA 2IXBA 4M98A 2FI1A 1J97A 1AVTA 1BMFA 1M1XB 1PFWA 4QDXA 1OE0A 4RE5A 4HXYA 1PGJA 2BFNA 2FR8C 5A2QA 4NPCA 4PHGA 3T3IA 4BNTA 1VLLA 4JJEA 4P0QB 1K08A 1GPH1 1PLLA 1LXCA 3T7KA 1IQUA 4MRPA 3ER9A 4QDOA 1XP8A 2V4ZA 4DLKA 5AKIA 5ESRA 1EXDA 1GUBA 1PG0A 1QIGA 1V96A 3FYUA 5CH5A 4G0XA 2EWWA 1EJBA 3QBJA 1Y6ZA 5IAOA 2VP4A 1PD0A 2IL1A 1HSOA 4YV7A 4XOUA 3U7QA 1KF0A 4DR1B 1L9XA 3CIFA 3ZI4A 5F3WB 2JBAA 3N8IA 4BXOA 4I4IA 4AN4A 2A9JA 2GVDC 4HKTA 1I32A 1XDGA 4D4LA 4LV8B 2OV8A 4GRDA 1DC3A 3G1WA 3Q6MA 3STYA 1H2EA 3OMXA 4IGKA 3QKWA 3TKLA 1NQXA 5JAHA 2C8VA 4PR0A 1DTSA 3QWFA 1I3LA 2VYVD 1KFEB 2EATA 4BNGA 1SEPA 4ER5A 2C0PA 1FUUA 3BAFA 3PWKA 1JQLB 1FP1D 4MWTA 4HVLA 1Y8RA 2ZBVA 4DREA 3G23A 2XY4A 4KE7A 2B6HA 3Q3JB 4Q3NA 3M3HA 4X1YA 1NU6A 3JQGB 1K6MA 1CJCA 2ZZKA 3GG2A 2C95A 3FGNA 5ALZA 4DQDA 3SDBA 3CT6A 3JALA 3MJTA 3C5CA 2ROQA 1XD2A 4C0AC 5EJ9A 4IO1A 2M6LA 3BJEA 2J5QA 3DFFA 1TDJA 4C21A 3SF8B 3S1AA 5LIPA 1M5UA 4R71A 1O94A 4GH5A 3GAFA 4ZAXA 5A03A 3MQ2A 2D3WA 5KOIA 1FNBA 1XALA 2R7KA 1JEQA 1J0XO 4GI1A 4LJKA 1IWPB 2OGZA 3CLHA 3GLRA 3UHFA 1F2TA 2ZXEA 1BRTA 1E9EA 3E8XA 4OBXA 3ZQUA 3S55A 4Z7OB 1F2DA 1FY2A 2E4AA 3G9XA 1D6NA 3N0RA 2V4MA 1PFQA 2V65A 3ZOZA 4FZ5A 1Z0IA 2OL4A 4JLVA 4X6XA 4L4SA 3V7FA 4MLPA 4BKOA 2PANA 1SOAA 4ZOEA 4ZQGA 2GBLC 3CW8X 1NXSA 4LXXA 1IEXA 2B6NA 5BNFA 2MHCA 1E62A 3KALA 3QEKA 3E1KA 4ZT2A 3HO8A 1G20A 1XUOA 3H1FA 2VWQA 3C6YA 3HDGA 4R1SA 1I94B 3B9PA 4R51A 1CK4A 1JFSA 2ZJYA 4WDQA 3NIFB 3W3ZB 1D5WA 4FM9A 1VG1A 4D3YA 2FDCA 1UBOS 4TMZA 2EKQA 4PZDA 5G02A 4Q00A 3QYJA 1SVSA 2WM8A 1XIVA 2BGIA 5I9IA 4UTOA 4DJ5X 5TPWB 1T1GA 4ZYXA 1Z6PA 5LMUB 3B3FA 4IMJB 1PX2A 2P9FA 3E8MA 1I0LA 1A1VA 2O0LA 1VKHA 3CNEA 3JTMA 4C07A 1XZLA 1EGAA 4WBNF 1MX9A 1T2EA 4DLBA 4CV2A 1FMJA 3LH5A 2ZTUA 3VZQA 2PQ2A 1XTKA 2XYQA 1ZPDA 4YK7A 1IXYA 4RL6A 4PAOA 2CXRA 1VLVA 3PDIB 4E4YA 1CVRA 1Y6JA 2J3HA 2XMBA 2VP5A 4JCOA 1MGPA 3A6PC 4BLQA 3WZ2A 5KTYA 1DBQA 2E0IA 2RC6A 1ONPA 2QVYX 3HXPA 3QFHA 4ZAVA 5FBKA 2WJ3A 4UTNA 1ECBA 4EI9A 1P0MA 3K8QA 1JDJA 1KZ6A 2BM1A 1NU8A 1G4AE 2P40A 1XTVA 1VGRA 3FPAA 2P4SA 3ZNNA 1GRNA 1HLPA 4FNOA 2GXAA 1CYEA 5CTAA 5CMLA 2LUOA 4JBIA 2G80A 5ICFA 4F6CA 4I4TB 4KYVA 3WP0A 5CBPB 5AW7A 1ZJZA 2OCGA 5JS2A 4UBMA 5AKHA 4MUYA 5LCXA 1XLVA 5FIUA 1Z3IX 1DKUA 2BP7B 3ONEA 2E49A 4TZTA 3ZDCA 1DEKA 4UCXA 1QMGA 2I78A 1ZMXA 4RMGA 2F90A 2FLKA 2Z3ZA 3IUQA 3UK0A 2R1TB 4GPZA 2QV0A 1UJ2A 3TIIA 4BNKA 2EJUA 1NYRA 4G5XA 3UW1A 5IZCA 1HR0B 2ZATA 2A59A 3AILA 3F7NA 1D1QA 2CLDX 1T5LA 4UM8B 3CF2A 1EI9A 2BISA 5ESXA 4DSNA 3K9WA 5DASA 3UK2A 1T5TA 3K9BA 1UM8A 3D6JA 1XLUA 1GILA 1PR3A 2XA1A 3K1AA 4HP8A 1NF2A 2WIDA 4RDCA 4UUAA 5CA0F 4KMRA 2RHWA 3JASA 2BW0A 2CDRA 3LQKA 4JASB 1EMDA 5P21A 4ARZB 1WDLA 3AVOA 4E5MA 5IHXA 1FDRA 3WRXA 3LYLA 3GPIA 3DZBA 3NTVA 4X8HA 1IE3A 1FUYB 2P5YA 3RC1A 4YLYA 3TZLA 3DEHA 4UHCA 5COAA 4PX3A 1GCGA 1J33A 2JKZA 3GYGA 2ZRGA 4Y2SA 1GNRA 1CXZA 1YBFA 1HMPA 2PSDA 3AFIA 4JGGA 4KZKA 1WULS 2QN1A 2WTXA 3PI6A 5A5VA 2UUAB 1N1GA 5TC4A 4O25A 4MVJF 1ZNWA 1CZKA 2E21A 3AVTA 1HFEL 5KQRA 3B1YA 2RHBA 2UKDA 4RKWA 1CG6A 1G2IA 3LUDA 4GOLD 5JIBA 3SXUA 4YPOA 2N3ZA 3VO9A 4UAUA 3SNHA 3DEFA 4JUAA 3F6CA 5E1OA 4FZVA 1JGTA 4WQMA 3TS1A 3ZCPA 2IHZA 4LI3X 1QWOA 3D8HA 1OU4A 3ZHSA 5E3IA 1SKYB 2HU7A 1NYQA 3A1NA 3CX3A 1PG2A 3FOCA 3H19A 3R3YA 1MFZA 821PA 1DG3A 2H1HA 1UFVA 2JEOA 2QZPA 1P4AA 4PYIA 1JDBC 3ITNA 3NVDA 4RVUA 5BWLA 2C4WA 1OWLA 4JVNA 5JHGB 3ZJ4A 4B47A 1J7KA 3CNBA 4EOGA 1MPTA 2VJMA 4G5OA 2REQB 2ZIVB 4OXYA 4Q3DA 1HDYA 4K9SA 4MP6A 1W0CA 3N5CA 4DIFA 2ILTA 1R16A 2YN0A 3U26A 1KVTA 4EAAA 3O4RA 1TYDE 1TD9A 3L4EA 3F78A 1JFFA 3R5XA 4LBZA 2V7WA 4X1IA 2QTCA 1C81A 3QU4A 2A9PA 3OFVA 1X1AA 2O0MA 5KNCD 1L7DA 2XE6A 1XZJA 3RG2A 3IPLA 4IGAA 1Y7LA 2IX3A 4ZODA 2GN8A 4N7RA 2VUIB 1A72A 1K8ZB 4I3GA 3SCZA 1C0PA 4FBGA 4WNAB 2AEEA 3FWYA 4FYWA 4INAA 2HY7A 1NQOA 3DC2A 3SR0A 3HBMA 1YR6A 1XKLA 2F3RA 4G41A 4UULA 4XRRA 2AC2A 4A03A 1C1XA 2BMDA 2OORA 3KU1A 1YOVA 4BQRA 4ZT5A 3A1SA 1TCBA 3ENVA 3VZCA 4Z4HA 4BP9A 2EG5A 1T35A 3P19A 4L6IA 1HL7A 2V1XA 4PZUA 1N6PA 1AZLA 4I6GA 2ZCJA 4XOIA 2CKMA 3SJ7A 1PWYE 4U5XA 3ZVLA 3R3UA 2FOLA 2H51A 2LBPA 2VBCA 1S9HA 3SJZA 4NRDA 4KXUA 2BI7A 1NP3A 3Q9SA 3K71B 2CCGA 1W5BA 1CR4A 1P17A 4ZKEA 3KDAA 3HK2A 3JARB 2C99A 3HA7A 2C3UA 2ECQA 5E6RA 3TNJA 2YZMA 4S2EA 4B74A 3CZAA 1GJRA 3EWIA 2NYRA 2Z9DA 4FSDA 4MS1B 3F6SA 4TQAA 4B3XA 2O8EA 1SOMA 2PS0A 1XWIA 2P78A 1S3IA 2QI9F 3GUYA 3I30X 3OPYB 5FP0A 2ZB4A 4PLVA 3H2KA 4R2LA 4Z3DA 1ZM2A 5JJCA 3V3TA 3BRQA 1RHMA 2ADOA 2JHAA 2ZIGA 1XVUA 1M2KA 2V9CA 3Q12A 1X1BA 2VEDA 2PCLA 5F52A 2XDAA 3ORFA 3QZUA 2LVBA 2A0XA 4QBFA 2AQ8A 5T3YA 3W5DA 4A2PA 4KI0A 4RA9B 1C2TA 3DOEA 1B3BA 2H85A 3ZE6A 4KEAA 1VIAA 4MW2A 2QL6A 3T7IA 1A9SA 2IHJA 4OB6A 4OGGA 4PCLA 5CURA 2AHRA 3KSAC 1G63A 1WQ1R 4CR7A 3EBOA 4HAVA 3ZI0A 1IMJA 2EBFX 4GLBA 2AMJA 3H4VA 4JP5A 2IXDA 4L4RA 1JTFA 2NW6A 3TQRA 3WXMA 1ZI6A 1UBHS 4LRSB 5ICEA 3EULA 2O8DB 1QIFA 4MJXA 2HTEA 4FGJA 1YS4A 4QYTA 3ZWQA 3ZX5A 3QPWA 1SURA 1QZXA 3G5TA 1VDZA 2PL1A 4R05A 1SOVA 2RAVA 3I42A 1EEHA 2GN9A 3KP1A 3I0ZA 5EHNA 3EXIA 4B80A 1AM4D 4OHXA 4ZKDA 3UAYA 2JJMA 3GJ0A 4HRXA 4MQFB 1DJQA 1JVNA 3SM9A 4G1EB 4HEJA 4PS1A 3BGSA 5LZ5A 5JBNA 1BJKA 2R85A 4L02A 4LMPA 4JIGA 2OCXA 5IM5A 1B2RA 1YDFA 4CLXA 4GG1A 3S6JA 1YZGA 3ISTA 4YT5A 2QVXX 1FMCA 2C5EA 3G8DA 5DN6D 4XQCA 2O2ZA 4QXPA 3OQIA 3TSWA 3LBYA 3V1UA 3V1NA 1Y9EA 3O83A 2WWVD 1DEXA 3K1AB 1T1RA 5K3SA 5FWYB 3RUIA 4Z0PA 5BV8A 4K9OA 1N8NA 1FYDA 2O3UA 1L4EA 3WBFA 1PX0A 4WXYB 3Q10A 3W3AH 1DO0A 1ZM9A 2ZVJA 4L5YA 5E9WA 1EBFA 4NAVA 5HGXA 1UC5B 5ALXA 3SYRA 5CDSA 3P0FA 3L8FA 1SJ9A 1Z5VA 2JAHA 2WYWA 3CN7A 1TUEA 4FYYA 3KAJA 1ZUD1 2VJNA 3IT3A 3LVQE 3QVGA 2EKBA 2XT9A 4MUXA 4PFQA 3SG0A 2EKDA 1U5BB 4N5NA 5CFLA 5ELLA 3DR3A 1MC8A 8OHMA 1R9NA 5IJXA 4Z51A 2VJCA 1JR6A 4ND2A 2VG8A 4Q4AA 4RU1A 4D3DA 3BKWA 4LGYA 4DCUA 1DC7A 3OM9A 5ALTA 3LFTA 2HRCA 1K5GA 4JL6A 3BHIA 3GD5A 4C5AA 4ZZ2A 2HOQA 4S3MA 2NWQA 4G3XA 3C7KA 3RRNA 1YZFA 3VPHA 5FA8A 2H4WA 2V6FA 1HKHA 3PNOA 1DKLA 2JCYA 3IIMA 3WDKA 2FQXA 3LY5A 3H87A 1ZU4A 3TL3A 2IHNA 5F1YA 5LIRA 1M73E 3T1HB 1GDTA 1ZVVA 3Q7IA 3SC4A 4WOJA 4B2IA 4DVGA 2AC7A 1C1DA 3I1YA 3P9QA 1TKBA 1YBVA 1TMGE 1CDZA 3UMYA 3N28A 3QRWA 4BO2A 1B6TA 2XGSA 4EUKA 4LJYA 2QVZX 2ZULA 4X3CA 5F2NA 3OJLA 5H3CA 4EA8A 1CY2A 4HX2A 3DKIA 5FL7A 3ICWA 3OZCA 2EJCA 2QGNA 4ODIA 5BXQC 4XRGA 2JGAA 2XYVA 4BGIA 4C7MA 1E4EA 1W36C 1BKSB 1TW3A 2I7TA 3EDQA 4TGLA 1NBMA 3CGWA 3ZR4B 2B4KA 3GT3A 3ZK8A 4BUJA 3A6ZA 3GLHE 3WVNA 4CMCA 3ZW7A 4L74A 4L28A 3CZRA 3N7AA 4AZWA 3OLCX 2R6CA 1NBIA 3FB1A 3SQDA 4EY6A 3H2BA 3QFCA 4FTWA 4R3WA 2PPVA 3GJTA 4X5OA 4DCJA 4RLQA 1PHRA 1V16B 1JG7A 2XTMA 4C4RA 4HNTA 3HXMA 4RCVA 2YMLA 3B6EA 5BY2A 5C1BA 5LXTF 1CP2A 1E69A 1O96A 3OECA 3GWZA 2VJBA 2COUA 3H0EA 1XK6A 5C5DA 1QZ3A 1D9XA 2R2AA 4GUDA 4J75A 3D7LA 1NY5A 4F8YA 3CNLA 1UOOA 3NI2A 4U2KA 2D5IA 1XJ5A 2QT9A 5A4FS 1XMSA 1RCFA 4RIEA 3T95A 5GJBA 2EDCA 4M0CA 4B33A 5C5IA 2YHUA 5BRNA 1WOYA 2WF9A 1GXSB 1GTRA 1DAEA 5D8DA 1ULSA 5IC6A 4G9BA 5EZQA 4ZD6A 1ILEA 5ALOA 2QMHA 4WKNA 1RE1A 1QWSA 1DOZA 1PJ8A 4WKPA 4C22A 4D44A 1PW7A 1YR1A 4FFNA 2JLWA 4QSMA 1GFWA 3TN7A 4LYDA 4MRVA 4QXRA 2O19A 3G8BA 1EVKA 2D5LA 1NVXQ 2EEPA 4UBIA 3PYXA 5EKDA 2PJDA 4C3UA 3VR2A 1T4CB 1IHDA 1CNMA 3T1OA 5KO2A 2WTAA 3KQQA 4XIJA 1L1EA 5KQSA 1DINA 5TPZA 3S28A 3FH0A 4B6PA 3VMMA 1N5JA 4MUBA 3JRNA 4AK9A 4MYCA 5G1NA 5HRCA 4S0XA 1PJ4A 4K2AA 4QEZA 5JY6A 2CZGA 1ABEA 4JMLA 5E6RB 1UODA 421PA 1XA0A 3EEIA 3N2ZB 1ZO8A 4MI1A 2GNOA 4UXHA 4DANA 1CCWA 3GJ8A 4ER0A 1CR1A 1EVIA 3ZHTA 2FK8A 1TI7A 2RHCA 3GBVA 4EQ6B 1KVUA 2FR8A 2ZIXB 3AZOA 2EW2A 4FN4A 4MQUA 3IAM6 4BWYA 4A1FA 3SICE 2CV0A 2A0WA 3ORHA 1YHNA 1NURA 4YAJA 4BWFB 3RG8A 3RAFC 2BTOA 2G9QA 4JC8A 4DZTA 2P75A 3C7DB 3HWX1 3X1KA 1TGYA 5JG7A 4EI2A 3F96A 5TJHA 4RA6B 2F7SA 1U0NA 1WUHS 1ORRA 1ZK3A 2A67A 5JW6A 3H2YA 3ZH2A 4K8RB 4IHKA 3WRWA 2X8BA 3X1MA 1CPYA 2P0YA 3LI2A 3PG5A 2XTJA 3OA0A 3THXA 5KX5B 3ASZA 3IP3A 5B3LA 3DLBA 3D4OA 1WDTA 1JT9A 3K0AB 3NKFA 3OESA 2P9BA 5D5PA 3U7FB 1U7WA 2X9QA 5FXMA 4D6XA 1P7CA 2PUDA 1V8DA 2FPUA 1QB8A 3DTVD 1IY9A 5FV7A 3C8DA 3BA6A 2JFFA 3KQWA 3L0OA 4O5AA 4TQGA 5A4IS 1SBCA 2HZBA 1R8XA 3AJRA 2GPSA 5IEJA 2RK6A 2QZJA 2J0VA 1ATIA 1UP7A 2FFAA 2WMOB 3T54A 4F4JA 5LOVB 3L6DA 2P6NA 2ODWA 5B1HA 1HFJA 1V8ZA 3WIUA 4BNIA 1OLSA 4Q15A 4MNTA 4RUKA 1SBIA 4CMAA 1L5NA 2AI2A 5LQAA 1BFDA 3DFUA 4MYUA 2IA5A 4ECAA 3GCGA 4KWHA 3NTXA 4MO2A 4P6VF 4BJHB 1J9GA 4YMTA 4OHBA 4TV8F 2G07A 3P7MA 4ZYVA 5JZOA 3OQVA 4UU0A 2YIJA 2WAMA 4KV9A 2G71A 1RYBA 4YRTA 3ME5A 5FTKA 1U1CA 1RW4A 1YFKA 2LD4A 3NT2A 3IKLA 3DKPA 4HFJA 1W1WA 3MSXA 4J3JA 4RPJA 3P0EA 4B45A 4DM3A 1PTJC 2GK6A 4DSUA 4PZZA 2X86A 1XKXA 4L7QA 3PHHA 3I64A 1Y81A 3IIJA 4KDFA 3DAYA 3HLTA 4JI3B 1Q1QA 3PQFA 1JR3A 2EZ8A 5AKLA 2GYUA 1SRRA 1TA0A 2DQZA 3CZ4A 2EFGA 3NT4A 3Q7RA 4IJ6A 3PPVA 4TMXA 1DLIA 1R6BX 2HFKA 3PB3A 3UK6A 4QJ3A 5LLDA 2WJYA 1ZX1A 3NWOA 4KLCA 1I3CA 4GLFA 1U4NA 4MKGA 3QEBZ 1Z75A 4J7XA 2O9JA 1K4MA 4IM7A 5AXBA 1IY8A 5CCEA 1DUIA 2ID4A 3WY9A 3X2FA 2WQ7A 2CF5A 5K0ZA 2OUKA 2OMEA 2LPMA 4GZLA 5LQNA 1Y8RB 4U6QA 2HA4A 1YNSA 3F9CA 4PW0A 5F4BA 3SBEA 5IAAA 2C7RA 2WRZA 3B7WA 4CFSA 3QBEA 3QELB 3VTAA 1HEUA 4GM1A 2OD9A 4Q3CA 1MORA 3A2LA 3ZDAA 4J94A 4X60A 3MCTA 1FX0A 3OUZA 4UAVA 4EARA 1U2GC 4AS1A 5G53C 4ENRA 1P61B 2FMXA 4LGCA 5J4HA 2PJRA 4D25A 1U3DA 2IX9A 1I1NA 1KK3A 4E30A 1S3GA 3F67A 3TQFA 4DLLA 3QKSA 1QFXA 1YB2A 4BWGA 2VWPA 5FULA 1VMEA 4CIYA 3PPIA 1BJTA 1IM8A 1TT5B 3NWJA 5E1MA 5JJ5A 4Y18A 2CT8A 2WLTA 2RH9B 3DT9A 3L0CA 3QOWA 3G6WA 4DDHA 3KIPA 3OCUA 2IXGA 3C3WA 1XAJA 3DUWA 3J7TA 4MGHA 1MH9A 2J3QA 1YJAA 2X5KO 1Z83A 4G86A 1YJBA 5I7VA 4H6WA 4ZK2A 2OFOA 1FLNA 2B37A 1F0NA 3FPJA 5EA2A 1JSCA 4ZXFA 4CDMA 3G0CA 5JMOA 1SBYA 5C32A 1NDUA 1OTYA 1JKIA 2B61A 3EC1A 5IT0A 1CNFA 1N9GA 3IVRA 1TF5A 3PC6A 3EQ2A 4S24A 3VNQA 4GOND 1RYDA 3GRZA 4Z8XA 4EPWA 2IGBA 3DBLA 3O9VA 1L7EA 4MRMB 2VWGA 1O9BA 2XODA 3HMKA 2TRSB 3V00A 4A82A 2C4VA 1LX7A 1I0ZA 1ZWLA 3FDZA 5D2CA 3PR2B 1SUEA 3TD2A 3JWJA 4I1PA 4Q4HB 4JZKA 1WF3A 3ND7A 3AX6A 2UYCA 4UEQA 1AD2A 5LVAA 1VE3A 1JXQA 3BTVA 5ED4A 5BN4B 2GVZC 1KFBB 2QM0A 5SICE 4LNAA 4H7PA 8GPBA 1DTWB 2J0EA 5AOBA 4N0PA 3FOEC 1OFGA 3LIIA 1HO3A 1P80A 4IVPA 5TNXA 5LU9A 2PD3A 2AFHA 3B89A 1U8FO 4OMFG 4Z3KA 1ZGHA 2G25A 3HCPA 1Y9AA 1KFKB 1N2GA 3RU3A 1U0EA 2CC2A 3R7SA 4YRNA 2BDUA 1I13A 3DDZX 1M2GA 1U2ZA 4YCBA 5CPFA 1ZJ4A 4ZC8A 4ZCPA 1V7QA 2W2LD 1A4XA 2I2XB 4EA6A 5F9MA 1YFJA 2JFZA 1B14A 1BQ4A 2OAP1 4UU8A 2VCEA 4CJXA 1E0DA 3AP3A 3SJBA 4UTZA 5JYCA 3Q7QA 2R1ZA 3EGIA 3R7WB 3VNUA 2Y68A 4HWTA 3ERCA 5DT9A 1RYMA 2A5JA 5HP4A 2ZUFA 1GPUA 1P4RA 1G8HA 1G5QA 1KRHA 2C8KA 2ET6A 5AM0A 3VZDA 3K0AA 3BJRA 2DQSA 4BO6A 3VA7A 1OTXA 4XARA 5CXUA 1UPXA 1E20A 1H5QA 2WEKA 3C4JA 4O4IA 4LHWA 4NF2A 3JQ8B 5DLEA 5EE0A 4JP1A 1P45A 3I32A 1FBNA 1G21E 3OQ1A 5EUCA 4S12A 3H4MA 5CIQA 1BFKA 3RE1A 1YE3A 1UBLS 3LPCA 2XSZA 3K32A 1OROA 2PEYA 2BMVA 2DC1A 2ZUSA 2QT1A 4C2UA 3AC0A 1PO7A 1XL0A 2DU8A 2H9IA 2OHVA 3IT0A 1YB1A 2H2IA 1Y1SA 3CWCA 2Q3CA 2QPOA 3F8TA 1Z15A 4EW6A 5HILA 4OUDB 1X87A 4CEIA 4ALKA 4MWSA 1EK5A 5IKOA 1Z6QA 1VL5A 1W6UA 3GDOA 3SQXA 4DB2A 3OAAD 4RVOA 3RYIB 2COKA 1TXGA 1J1UA 1HQCA 3L0IB 1OT3A 1OA0A 1UPTA 1K9SA 5KTMA 3L4BA 1T6NA 3FW1A 1V6SA 4Z9XA 4IJKA 1PJLA 1KMHA 2A7XA 5ABPA 3RROA 1ACLA 2RGEA 2NP7A 1X3LA 3M33A 4EKGA 3FFBA 1E79D 4G4SP 1OJ7A 2FXVA 3EY9A 4G5GA 4D5GA 2IUTA 3TPZA 1V1MA 4DARA 1O94C 2VDNB 2IXTA 2Y77A 3IH5A 2VI5A 2RAFA 1MJNA 4MQ4A 1JG6A 1W2HA 1GN9A 2C4HA 1E5QA 3HVHA 1JWAB 3M7IA 1VI2A 4ZI7B 3HKEA 2G1AA 4F4CA 4GX1A 4YBRA 1KVRA 3O8RA 2QY9A 2FPMA 1ZH6A 3K4QA 3QWIA 4AQDA 2HC9A 2R5NA 2DUNA 2OXTA 1BD3A 1CY0A 1Q12A 1VLQA 3VV3A 3PICA 4G0VA 5AM1A 2NYUA 3NP7A 4IV0A 3GA5A 1Z2EA 4G63A 4R5MA 1UKCA 4TXMA 5B37A 1QG0A 1WMBA 2R4TA 2EZUA 2J6CA 1BGVA 3KR0A 2FGKA 4AJ2A 4WJLA 1U7XA 5F35A 4EYQA 2JC3A 2JS7A 3KEGA 5TQJA 3P9YA 1D2HA 1Z47A 5BORA 1N2HA 4WSOA 2J3KA 4C6TA 2LE0A 3HA2A 4TUYA 2OA0A 4F12A 1ZIDA 1W8IA 1DKPA 2CJFA 2R1UA 4URWR 3ZZUA 2ODNA 4NCNA 3LX6A 2IY8A 4U2BA 4NABA 5ER6A 4G0NA 3F5SA 3UUEA 2D3TA 2WHRA 3GGOA 4MKRA 3L4BC 1KJWA 3D64A 1FXSA 2SCUB 3E3LA 3DFZA 3TDMA 3JQBA 1A71A 2MR6A 3CMCO 3EG9A 4NJMA 2H5JA 3MJVA 4I4LA 5H70A 1VIYA 3GLIA 3TZKA 2G8LA 1R6AA 4F96A 1RWOA 4H0CA 1I7NA 4KXXA 5C46F 4X94A 3J80A 4UBKA 1H0RA 1PS0A 5ECGC 3SZ3A 3MJEA 4MHTA 1JKMA 3PA8A 1JPNA 3H1GA 5CT6A 4RLHA 1QHIA 1QMPA 1BQEA 2G6BA 4NV0A 3AL3A 3FTCA 2XADA 3HDTA 3OPNA 1KKMA 3L0DA 4QBTA 4WINA 4JXJA 1WPGA 1DAKA 4WIAA 5JUWA 3VYWA 3JD3A 1N2SA 2H2WA 2VRCA 3ZHUA 3FZQA 3R40A 4OQYA 5C5CA 1T5OA 3KKOA 4MVJE 1EXVA 3UH1A 2V9ZA 3HJNA 1EPUA 3D43A 5GZ1A 3FLMA 2J3DA 2Q4DA 2QSJA 4J6EA 1WW3A 3EUWA 1IPFA 1VIDA 1KOLA 1HLDA 3BVPA 4TKUB 3OCVA 5A71A 4R98A 3NUZA 3AK4A 4JC4A 4A0GA 3IUMA 3F3MA 4S05A 3WLFA 2CXSA 5FOQA 4MAAA 4XXHA 5T6BA 1EP9A 1O6BA 1ANKA 2J7KA 4ND1A 4QDZA 2QYTA 4EKIA 2HXGA 2WHEA 4PFSA 4FMDF 4E7PA 1M6YA 2FMFA 2O8FA 4TWAA 3OKCA 3I92A 4RNCA 5CDHA 5KUTA 3TRJA 2PX3A 3EVFA 3BHNA 3V4VB 4WXHA 3RO7A 3PPWA 4YAFA 3EQ8A 3U6BA 2QXTA 4WZ6A 3KYJB 1XLTA 2FJUA 2GB4A 4X9XA 5TVKA 1ZCFA 1U0OC 1UXKA 2B4AA 4L8LA 3DPUA 5F2EA 3BL8A 1V43A 1K3UB 2YZKA 2BE9A 3RIEA 4N7BA 3REGA 1QE3A 1KPGA 2ID9A 1N2XA 5B58C 2XMDA 1AUQA 1R6UA 3GBPA 2BFBA 3TIXB 1NJ5A 4Y2UA 1UBCA 2QRVB 5EMNA 1OY1A 5K99A 3AEZA 3OX2A 3AWIA 1IC6A 2GF9A 1HLGA 3EIUA 3X0DA 1EHIA 2PT9A 2WMYA 6LDHA 3ZD8A 1RYZA 1N3YA 4IIGA 4B3BA 2VAPA 4MYTA 4C7XA 4JJFA 4O02B 2Q3DA 2EJWA 3NBYC 4DLRA 3MXOA 1XCMA 2IU3A 5KNDD 4BNJA 3G2JA 3MYRA 4LJ9A 4LZNA 3UMBA 1XNHA 4AJIA 3ED5A 1ISJA 1V8BA 4UCFA 3K96A 4YASA 4UM9B 2POQX 1D03A 4QU0A 2JFNA 4X93A 2MOKA 5HQ3B 3QE0A 3DD5A 1VIVA 1P5RA 3RVSA 3CLUD 4M55A 5D01A 5ES3A 1AT1A 3NVAA 5G40A 1WE2A 1IY0A 4NK4A 2W7TA 1CB7A 2YFKA 3EDCA 3SZLA 4ARVA 1FRNA 2QU8A 2ATCA 4BVLA 2NU6B 1ODCA 4HGNA 4ZCMA 3I12A 5AUPB 1LI4A 2WQZA 3B1WA 4GMHA 2XZPA 3LWBA 3STTA 3VKUA 1VJ0A 1IVNA 1ECPA 1U1DA 5CVJA 1POXA 4HYEA 4E2ZA 3IEKA 4EZEA 4LTNA 1FSZA 5BQ5A 3AF4A 4DMRA 3CG4A 4NBLA 3AUXA 4IMPA 1MB9A 1YRYE 2HV9A 3GH3A 1VL0A 3T3MB 1Y4DE 4PLGA 1OXTA 2YUTA 2YS6A 3DZFA 4HADA 4RZHA 4R81A 4Q7MB 3MBOA 4MWOA 1Y3DE 4JJIA 1VXOA 2OFXA 2HO5A 3EIOA 3JATA 4ZAYA 2MSCB 1WVGA 4IXMA 2GZSA 3EQZA 1HY3A 1IOLA 1ODFA 1V1RA 2CK3D 4D9KA 5JNSA 3GJZA 2ZJ5A 3JZFA 3WYBA 5JAIA 2FQ1A 2QNBA 4HXEB 4AROA 4LF7B 1Z37A 3AWDA 2QX4A 3M3PA 3TMAA 3EOAI 3FZYA 5LQUA 3ZQJA 3C5VA 4WEOA 2WT4A 2ZROA 2AOVA 4NTZA 2OAQ1 3WRVA 2GZRA 2NU7B 3MWFA 4HXFB 4GP9A 3P2JA 1LZLA 3HJUA 3SDZA 3V8MA 3D7NA 1DBRA 1RADA 3W8EA 2ORYA 3EDOA 3O4FA 3IJ5A 4B7CA 3IKTA 4IHJB 3R7DA 5AVUA 1EB8A 1JQKA 5HKAA 5AT1A 1UM9B 1BD4A 4EX7A 4KPYA 2OHXA 2YDYA 2BJVA 2IODA 3NTOA 5L3VA 1XL1A 3HL4A 4FZRA 3HZHA 2XBUA 4Z49A 4RJTA 3P0IA 3HV2A 1RTTA 4P3YA 2WT8A 3D7RA 2X1HA 3OEHD 4PN3A 1XJWA 2FX2A 1O8CA 3GVCA 3LSYA 1U8YA 4YMVA 3TQQA 1CVIA 1N2CA 1CR2A 4Y9RA 4NAUA 3TCNA 4N9WA 4ZZ1A 1SHLA 4YRSA 1JJBA 2WU1A 2LWIA 3TZHA 2PO5A 3WLHA 1AV7A 5EE5B 1YU6A 1FLVA 2PX5A 3A9VA 4DDWA 4HF7A 4WVLA 1XDZA 1KJJA 1FU7A 1LVUA 1MIHA 3KQOA 4G0UA 5KOJB 2E4ZA 1LTQA 1DAMA 1S3SA 4MICA 1HOXA 2OOSA 3Q2IA 1G5HA 5EIE