4UE6A

Structure of methylene blue-treated anaerobically purified d. fructosovorans nife-hydrogenase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title [Nife]-Hydrogenases Revisited: Nickel-Carboxamido Bond Formation in a Variant with Accrued O2-Tolerance and a Tentative Re-Interpretation of Ni-Si States.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 83
structure length 262
sequence length 262
chains with identical sequence B, C
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ue6A01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ue6A02
4UCQA 3UQYS 3ZE9A 4C3OB 4GD3Q 3USES 1H2RS 4URHA 4KO1S 4KO3S 5A4FS 5ADUS 3CURA 3ZE8A 1UBJS 4TTTS 1FRVA 5D51S 2WPNA 1WUKS 2FRVA 4IUBS 4UQPA 1WUHS 3H3XA 1UBKS 1YRQA 3ZE7A 4UQLA 4UD2A 1H2AS 1CC1S 3AYZB 4U9HS 5JRDS 5JSUA 5A4MS 4UE2A 3USCS 4KO2S 1UBRS 4IUDS 4UCWA 5JSYA 4UEWA 1E3DA 4U9IS 5A4IS 1UBLS 4UD6A 4UCXA 4OMFG 4UPVA 1FRFS 1WUIS 1UBHS 1WULS 3CUSA 4KL8S 4UEQA 1YQWA 4KN9S 4UE3S 4UE6A 3MYRA 1YQ9A 3AYXB 1UBOS 1UBTS 1WUJS 4IUCS 5JSKA 3RGWS 3ZE6A 4CI0B 4UPEA 5JT1A 5JSHA 1UBUS 1UBMS 4KO4S 3ZEAA
chains in the Genus database with same CATH superfamily
2QX4A 4M8SA 1V7ZA 1RWBA 4IL5A 1R15A 3AKEA 2C9MA 2DFPA 2HDHA 3QQ5A 4PZDA 3TVDA 5A4FS 2DQYA 5AMXA 2EGUA 3I6YA 4J43A 4CKCB 4ACAA 1ABBA 1V4BA 5K2MA 1RXSA 2D4AA 3CEHA 3WC4A 4HNTA 3ROXA 1WABA 1KO7A 1AN9A 2FU5C 4OHFA 4M7OA 1PSZA 1VP3A 1PFYA 1QLHA 2FN7A 2WSBA 1E2KA 1XZHA 2AC7A 4LAFA 5B53A 4CODB 1NRWA 2WIDA 4DIMA 2MYUA 2P1ZA 1Z2PX 3GVPA 9LDBA 3FKSA 3HPRA 1QVRA 2VXYA 3GEIA 4PXSA 1YJBA 2QNBA 3NANA 4UTPA 3DYBA 4A0RA 2IYZA 2B6NA 4ZOQI 1YZLA 1FXWF 4K28A 2YXNA 2OK7A 4P34A 3H0KA 5T8KA 3ZWWA 3TPZA 1R8SA 2J46A 3RJZA 4TQUS 5FWXA 3V8PA 2PMCA 3GJYA 3P0RA 3A32A 4EIWA 1ELOA 1GZUA 4EHFA 4G41A 2QZSA 2UVDA 1SCJA 3ML1A 1KDRA 1YZ3A 5CYGA 4LGMA 4UUQA 5JMWA 5LUAA 4CR6A 3GO4A 3A1WA 1JSLA 2OL4A 4JP2A 1WZEA 2HA2A 3N87A 4CFSA 3ZJVA 521PA 3FCAA 2QN9A 4QKQA 1VL2A 4GXQA 4X3PA 3U26A 3NORA 2DHEA 4X1IB 3B7GA 1SU8A 2DCUA 1VIDA 1FU8A 2AOTA 5I3ZA 2IX3A 1YQWA 1OFTA 4OLAA 2IWRA 2GHTA 3R6WA 1J8VA 3KBOA 4FOPA 4AAYA 3OMLA 1GZ5A 3FTNA 2CHUA 5FLXA 1J39A 1L7QA 1HM5A 5CAEB 4ZT4A 4W5WA 4E4TA 4FOLA 4WJKB 4B3MB 2HF8A 1PDWA 2GF0A 2OCDA 2P67A 2XNKA 2BGTA 3E70C 3PJEA 4ISBA 4MP3A 3K0AB 3DUFA 2A30A 2YIJA 5AJYA 3ZDZB 4V1CI 3DDWA 2W8BA 5FH9A 5KYTA 4DV5B 1BXGA 1COWA 1RRKA 5HMMA 1XX6A 4NH4A 5BSRA 4BDTA 1UP4A 2FOLA 2GN6A 3ND5A 2Z2ZA 5LQSA 1N9GA 4LYHA 1YDHA 4IIBA 5TVKA 3L7JA 3E5MA 1NI3A 2AS0A 3CPHA 3CPEA 1W0KD 3FLEA 4OSOA 5ENZA 1ZD9A 4N47A 5LDDC 2H3HA 2AW3A 4URUR 3PHCA 4ZI7B 2XMDA 4U02A 4DQXA 4KQFA 3CR8A 2JATA 1HYQA 1A9YA 4C89A 4EMTA 1CXZA 4PPGA 3M89A 1G59A 3JQBC 1D1SA 2JLXA 3MCVA 1QIFA 1U1EA 2IF2A 3ORHA 2XE6A 1BXGB 4GEKA 3R5SA 4B3IA 3HJGA 2XTMA 3K8YA 4NMWA 1CUAA 2UYQA 1K6JA 4AS2A 1WUHS 5REQA 5EJEA 1B1CA 2GH1A 2QLMA 2I80A 5K6AA 3MG9A 1VGRA 3CF2A 3IVRA 2VDMB 4LCBA 5GV8A 2Q9AA 2G6BA 1JZSA 1YS4A 5CNIA 5JVDB 3O8OB 3DGFC 2EBHX 4HEA1 2VYFA 1DEXA 2INGX 3E48A 4TRNA 3A28A 4FFBB 5CLJA 3WQSB 3FDZB 1R0CA 4YJ3B 3JQRA 4PO3X 2C3MA 3OE5A 2QPOA 4Y2TA 3R5FA 1WY7A 5LMUB 4DRXB 4G24A 3B1KA 3AIIA 4GHWA 4AJHA 3U6BA 2EU8A 2ID9A 4JYMA 3L4JA 4EY3A 3PKJA 4WZZA 1F7UA 1CUZA 1LBSA 3PFKA 2NTVA 3EEIA 3SOZA 1CY4A 1RC8A 2FYTA 4MMYB 3TSOA 3G0OA 2PGAA 1V6AA 1WV0A 1P7WA 3ACCA 3THWA 1V5IA 4J91A 2WSMA 4Q37A 5EP1A 3VPSA 1NW4A 1P77A 3MOIA 5A06A 3CT6A 4JUIA 4Q4HB 3MWEA 3OJLA 1GPUA 3N5KA 5B2EA 3P4YA 3OTOB 2GPWA 1SOVA 4QO8A 4XDHA 2JARA 3BL5A 3FDFA 4MVJH 5E1MA 3KEQA 1BDBA 2FEWB 4BKPA 4S1PA 3T54A 5HYVA 5IK2D 3LS2A 3TW8A 4M53A 2YX1A 3U7GA 3R0XA 1OA1A 1ZLXA 2AN3A 1UXJA 4HH0A 1YONA 2F3TA 8ATCA 1TB4A 1J07A 2HJHA 2DR2A 4RHYA 3L0PA 4IX1A 1Y48E 3GRRA 2ZIZA 3GY0A 3FCYA 4WNYA 2BFWA 3WWZA 3AU9A 1FDIA 1O57A 3F4KA 1F2TA 3NWBA 1XO1A 4OSPA 4TMWA 4E07A 3P5BA 2JD2A 2Q29A 3HKBB 1IL0A 5I7HA 1XMOB 1V11B 4D46A 2A86A 1PSWA 4YGXB 3H65A 4F3YA 1EIZA 1KS2A 2ZETA 4L3VA 3T1VA 2QQ0A 4K40A 2WKWA 1W8DA 1T5TA 2NU6B 1O95C 2PJUA 3RGWS 2IKQA 1K0FA 1QDUA 2XBUA 3A1FA 7YASA 1WXFA 3WLAA 5C7LO 2ZVQX 5AXDA 1Z5OA 3FYHA 1IJFA 1ORDA 2VDWA 4IYRA 4Q6BA 3KQMA 2VK2A 3BDVA 3HXMA 3RVDA 2AMYA 5LMZA 2F4NA 3CURA 4Q82A 4C0JA 3SSOA 5IC6A 4EW2A 5AW0A 5EIOA 3MT8A 3HKBA 4XGKA 4OI1A 3MUFA 4GPEA 4HZIA 2E4VA 1ESMA 2O1XA 4MCJA 1T5OA 4CT0A 5HK9A 1PNRA 3N8DA 3EC7A 2D1YA 3RSFA 4ILEA 2DRIA 2ATIA 1FFBA 5BT8A 2YYSA 3ABZA 4QXMA 3WO1A 2JJYA 4HFMA 4KRXA 1TAHA 1MRNA 3FA2A 4URFA 3RDPA 1XYVA 2E3JA 2MSEB 5K8LA 5A5VA 5KTNA 4NCBA 1JXAA 3QUCA 4JOCA 1ZWKA 5A0VA 5BMOA 2J3KA 1AX9A 1RLOA 3GJZA 4PYOA 5JAIA 2HSZA 1HNXB 2OAGA 1ZIXA 2AE2A 3VOBA 3ZWPA 1AKQA 4YMLA 2JAQA 5AI9A 1CLUA 3IJRA 3STHA 1YB1A 4ZVRA 4F2PA 2YASA 4PQRA 1KK1A 3NEYA 3W6PA 2R44A 1T8TA 3OJFA 3KQOA 2H54A 2YJ6A 3A6JA 3QNWA 1B6TA 4X3CA 4A82A 5TLSA 2FR8C 2GLTA 1GEGA 1OQAA 1FF9A 1GAWA 1JXOA 1PQ4A 2GF2A 4KACA 4WN9B 1S6YA 1THZA 3ZVNA 2HQBA 4MUBA 2ILVA 3KAQA 4MYSA 1GVHA 5DLDA 3Q72A 3U61B 3SS7X 1E4EB 2Z8YM 2EKQA 3DMPA 4MGYR 4RAOA 5JNRA 2C9YA 1MXHA 3KR9A 3VZCA 5KNCH 3ENQA 2W98A 2I9PA 2AUNA 1XTIA 3L07A 4B34A 1XN4A 2N0SA 4W5JA 4ZHQB 3NC1C 4CIYA 4M1TA 1EIWA 1JHVA 4E08A 3LBIA 1TQHA 1K4KA 4GPBA 4QUEA 1H5NA 1NVMB 4PCLA 2X0DA 2QTAA 4AJ9A 3MINB 5F9HA 1A7JA 1VHTA 4MYRA 1N3IA 1KVUA 1Z7BA 3O0DA 1W4RA 2EWVA 4PFSA 5K0BA 1K3TA 1L5HB 2WWHA 3IOBA 4JP3A 4YUAA 4DMMA 2CXQA 4JYCA 5KPDA 1ZS9A 1FP4A 1PJLA 2AZXA 5IJ9A 5E95A 1J6UA 3TG2A 1L5ZA 4QQRA 2BYTA 3RRZA 1RXVA 2QGFA 3E84A 2OVFA 1QCDA 4KG7A 4NU8X 4PYKA 5ESDA 3C6BA 5BY2A 2CVOA 4NV3A 3JASA 5BSVA 1KMMA 5HX7A 1F3LA 2ECKA 1YRWA 2XR1A 3ILHA 5B3LA 2D2XA 2QBYA 1QK3A 4LDZA 4EUFA 3W2FA 3C24A 4G36A 4QU9A 2QQFA 4RIFA 1V3UA 1DX4A 4ZAWA 1RKQA 4M98A 4N7BA 3PLRA 1CQZA 1G8AA 3M7IA 3DDHA 4LC0A 4WD3A 2PGJA 3CO5A 4IIJF 4L4XA 3QPAA 3H5RA 4RFVA 4RUKA 1M0EA 1X38A 3JARA 3MHPA 4HB2A 4Q1CA 4QEDA 4RLQA 3D9QX 4UU7A 2W4QA 4JFAA 3SZ3A 4RDIA 3EXFA 1FDSA 1X1TA 2QX7A 4E46A 2D1SA 5AD1A 1FXWA 4B3RB 2HKIA 3WKAA 5FORA 2PX6A 3WGVA 2Z09A 5AI4A 4L3WA 4AUMA 2ZM6B 2Q5CA 4R3UC 2W6MA 3RIYA 5JMPA 3SIRA 2PTHA 1ZN2A 1DNPA 5ERGB 4C7XA 1NI5A 2VJCA 3TI9A 3IQHX 2I91A 4G9EA 2OBMA 4R9VA 3P8ZA 3DVSX 3EZ9A 5I7OA 2VYND 2QY9A 1IM8A 4GLOA 4P7FA 3JARB 5E6SB 3SQWA 5H70A 1JH9A 2G9VA 3QSGA 4KDCA 3ICEA 1R12A 2QVLA 1P6UA 4IDFA 2AN4A 4FB5A 1BJRE 4FMDB 1DQYA 3UJ7A 4RDXA 3SDZA 1N2ZA 5CFQA 5IJAA 4MULA 1FDVA 3MTQA 4NNJA 1CS0A 1ULZA 3M1IA 3GNTA 4HLUA 4L15A 1ULAA 4D6PA 4DIOA 5CB0A 2B30A 3GUHA 3BQMB 5GMOA 5CHEA 1ODIA 2I2AA 4II3A 1EFRA 3B1ZA 3CWZA 2AD5A 3KSZO 3I5UA 4W8OA 5FBKA 3WGYA 4TTJA 3CRMA 3BBLA 5EE0A 3WGZA 4C07A 4MVJG 2O3SA 3ZHTA 3RRBA 2YZKA 5GJVC 4L9AA 4CGZA 2JFFA 1P4RA 1TMYA 1BDJA 2JIMA 1HDZA 2O20A 1KY3A 2P2NA 2WLTA 3Q7SA 3CRZA 4GXNA 2JZOA 4OMUA 2AG6A 2G9NA 3S70A 4DOMA 1IDN1 1RZVA 3KYBA 4LMRA 4O2BF 4HX5A 3RS8A 4H6WA 1Z2OX 1C7IA 2J5KA 2P2YA 2VEOA 4GI3A 3ZQKA 1U9ZA 3H86A 4RDHA 5BV1A 5AVRA 1QU2A 2PKRA 1TQ4A 1VE7A 1H65A 1ODKA 1XTUA 1LZKA 3V4FA 4ALNA 4X5OA 4ZJZA 5I01A 1FBNA 4O59O 3TFOA 2JAXA 3SFTA 5LNK1 2H1LA 3RU2A 3NIWA 2C3UA 2P9EA 4K8OA 2HLDD 4XD2A 4U2KA 5G1OA 1Z83A 2MU1A 3JD0A 4NEHB 5I5GA 2GXAA 2OO5C 2Y9MB 4IQ4A 1ML3A 5CJ2A 4Q05A 1ZCBA 1XCPA 1JJAA 2G4LA 4EW1A 4PG8A 3ROEA 3FPFA 2QX9A 3LU1A 4IIHA 4NZNA 2WKPA 3VVLA 3LQQA 3B70A 1GLGA 2ECPA 4RKQA 2AQKA 2PV7A 1ZNQO 3BXXA 2RHOA 4NLLA 4D97A 2H00A 5CVCA 1GLNA 2BM1A 2OOKA 4JEIA 4N7JA 1PFUA 4Q3DA 1Y8RA 1A9OA 3KJHA 2YVLA 1J23A 1NUSA 5C37A 1FVXA 3B20A 1ADGA 2NTJA 1YHNA 3O0TA 1KK0A 3DBRA 1JDJA 3HBFA 1A2QA 1ECCA 3AB8A 1N6OA 3GB9A 1SKUA 1JLMA 4CEIB 4PHCA 1RHMA 3QTBA 3L4EA 2IP1A 4RDCA 5C8YF 2W2LA 1XR3A 1I51A 3DVAA 1QO9A 2ZXUA 1NUHA 1CYEA 3QVMA 2OAQ1 2IGTA 1W19A 4X94A 2FPPB 2GA8A 3K5HA 5JO0A 4IKOA 1W29A 4PZUA 5TMDA 3U7JA 3OUTA 4LV6A 2GJSA 1ETUA 2OHFA 3GELA 1R64A 4XGRA 3FYUB 4RVDA 2XE8A 3WL7A 5AVXA 1F6WA 1QCYA 1S96A 1Y1TA 3EEBA 4L9WA 4MUJA 5TEWA 5CB4B 1TGYA 1QFZA 1UBRS 3H5LA 3UMRA 1BCSB 2VG8A 3TSZA 4HX2A 3W5AA 3DTVB 1U8UA 4JLAA 3U9TA 2VATA 3ZWBA 2QQEA 2MTBA 1KY2A 2IZ1A 2MMCA 5JJLA 2CXPA 3M1AA 5KYWB 2Z4RA 1VE3A 4PSUA 4GWLA 2UZ4A 1QG6A 2R6R1 4C29A 1JSXA 2KB0A 2YW9A 5JFOA 4DC1A 1NW9B 4L0QA 4UEJA 1RNLA 4DBLE 1QYCA 1FRVA 4G4SP 3NWPA 1N2BA 4Y2PA 3F9IA 3L7YA 4Q4CA 2OG2A 4CNBA 4WBNF 1AIPA 1CUSA 5FA5A 3AHDA 4QOFA 2DMRA 3DAYA 4U9HS 3FTCA 1ZGCA 1ZI8A 2G9UA 1RYEA 1QAQA 4RWEA 1ZCJA 4TROA 5DRTA 5JYEA 1E9VA 1HTTA 1IPHA 2HMVA 4DSOA 4M76B 4YNBA 2A14A 2E55A 4GM4A 4D9HA 2WF9A 4NICA 4QIHA 1LLUA 2X1MA 1CX9B 3LYHA 5FIUA 1KP9A 5FOVA 3H5VA 1UADA 2XXJA 3QIAA 3INGA 3STTA 1J00A 4P2BA 4JJFA 2GEUA 3UVEA 4L0MA 2WYOA 3FNQA 4QBIA 2ZSAA 4V0ME 4ADSG 4GGOA 1T9ZA 3TBKA 4DNPA 1VLMA 1BX1A 2HHCA 1OVMA 2VF2A 2HSWA 3ILVA 3N8KA 2BFMA 5ER9A 5JCJD 1X6VA 1VL0A 4YAEA 2P30A 2RAUA 3DT9A 1L5HA 3FIJA 4B47A 1F0YA 3LO5A 4CV3A 4ZN6A 1X80A 1ST2A 3CYFA 2PNFA 2XKBA 3IIKA 4FLMA 5KKCA 1SCKA 3A4IA 4WKNA 3HI6A 3ADCA 1XLTA 4WFQA 1X1EA 5BSGA 3RIXA 2VNAA 5ALJA 2PCJA 4TWIA 4HGQA 2IYOA 2PQMA 1CVLA 4BGDA 1QRRA 2BKEA 5J4VA 4MB6A 3Q8LA 3BJZA 2XUQA 3DDSA 1QZTA 1MAAA 3R6DA 1ZGHA 2BFCA 3IS3A 2F43A 3IUJA 3B8EA 2DWQA 3GLFB 3REQB 2XYVA 3FETA 2AV6A 1V39A 4AYTA 2UUBB 1NDQA 1NKSA 1NQVA 1TKAA 1VBKA 1QV6A 3PEUA 4HYEA 4XCVA 5EKDA 1NXTA 1XHEA 3TIFA 4FFDA 3UG7A 4EYSA 4FMPA 2XYHA 3RANA 4ZOLF 4JLKA 1L5MA 1DCMA 2PKEA 4RZ3A 1R9NA 5CX1A 3DEJA 2QP9X 3T7IA 4IQGA 3IHLA 2A67A 4IWXA 2GTHA 2R65A 2G3YA 2O7NA 4RM3A 5K3FA 4ZVQA 3UUWA 3UB4A 3V7UA 2FUG6 3B82A 3LY7A 4LVCA 1ZINA 4A6XA 1DOHA 1RC1A 1C1XA 3BS4A 2YMPA 3LA6A 4PTLA 4JJZA 3R3XA 3WGGA 4RTJA 1BWSA 3U81A 3N53A 2B1GA 2QMEA 4BN5A 1ZJWA 3OLZA 5HFJA 5FAKA 1FJHA 2JAOA 3E2PA 3QUTA 5AKLA 1MC8A 3ZWOA 1ONBA 2EX0A 2VHVA 2XQFA 1RI5A 4QULA 5FP0A 1ZM9A 2F62A 3QJYA 5IWCA 2CLSA 1RQRA 4RO0A 1WTCA 5KTKA 3WGIA 4B6OA 4G65A 1LI7A 4CMCA 3VNRA 3OZVA 2CLKB 4D81A 3LQFA 4OHWA 4QWMA 1QHXA 5IXJA 2DUNA 3SSNA 4HLDA 3ZWCA 2FJ0A 3RUPA 1YMUA 2Y1FA 2BFBB 2WSIA 3HKCB 2P9QA 2DPMA 2EV9A 4UEKA 4XQGA 3T1QA 1FMTA 3TJMA 4CI0B 1QGZA 4PG4A 1OFIA 4UHCA 4V3CA 1TIKA 2VXBA 1YFKA 1NFQA 1U6IA 1M6WA 1NP3A 3U7QB 4S1TA 1M2OA 5FPSA 5BVGA 4F2WA 1U0OC 2ZBQA 3L05A 4GX5A 3UAOA 1GDTA 2HQ1A 4XYBA 5EJ2A 2HUNA 4NIMA 1L8OA 5INTA 2I76A 3GBSA 3NP9A 4BVBA 3RRFA 1JYFA 3MTGA 5CT6A 2TMYA 3PNVA 3Q8XB 1VL6A 1DBVO 2FQYA 5IT5A 4RTNA 2PX8A 3SQMA 3SS9X 2C5BA 3H8JA 3HYRA 5AICA 3AW8A 2ADMA 2J5RA 1SVNA 2JG3A 3I45A 1SO8A 3BEDA 1AF7A 3DT6A 1A88A 1IDOA 3FR8A 3AR9A 2HJWA 3KJIA 4N65A 2XA1A 1UZAA 3EMDA 5IYZB 4TLMB 4I5EA 1GKYA 3CLSC 2VZ0A 1GWNA 3MMNA 1ZUHA 4C78A 3NCTA 3UWPA 3LYLA 2FA9A 2BFFA 2G07A 3LKVA 1KY4A 3LVQE 4DLTA 3GDHA 5KX5B 3ZY2A 4YACA 2XNJA 2P75A 3AF3A 3P4XA 4K9DA 4YAOA 1HA3A 3K8ZA 4B2YA 3TTVA 3FZYA 4J94A 4DMCA 5GJBA 2GA9A 2Y99A 4Z4FA 1Q7CA 2ZQZA 5DHUA 1T25A 1ZA1A 4TXJA 3L82B 5AW8A 5ITVA 1M2KA 3F97A 2IY7A 1C81A 1ZKMA 2FXVA 3U37A 4B3HA 1EUDA 2ANCA 2Q3CA 3D64A 3WO0A 1CQXA 3NHKA 4KXXA 2ZKIA 4O2AB 5JZSA 4Q3LA 5K0SA 2VPYA 5BRNA 3Q3HA 2GAJA 4MPJA 5H16A 3C5HA 1L7OA 2CFRA 1S9HA 2B37A 2TYSB 1PJ4A 2VJLA 3LUHA 2X2OA 4Y9UA 4I3HA 3WQRA 2IXAA 5EQJB 1GQQA 2V4MA 2PRZA 3DA8A 3A27A 1JL3A 2GPAA 2Q5OA 3I1YA 3HB7A 3SICE 3IMEA 6AT1A 1ZOOA 1MC5A 2IS6A 2VKTA 3AWIA 3LXUX 3TJRA 4ESOA 3E9MA 4I9GA 1P1HA 2RJ3A 4N5MA 4QELA 1GR1A 1OJ7A 2BMEA 2C61A 2Y3IA 5LQKA 4H2DA 1YR3A 2D2VA 1Y5LA 1XA0A 2GD6A 2ONCA 4J0EA 4WW0A 4DWOA 4ZI2A 3COPA 3O4FA 3CG4A 3VH3A 4AMVA 3H19A 1EDEA 2JPDA 3M5DA 4G1CA 4XX0A 3ZJ4A 2JEZA 2XQIA 2WJAA 4G1VA 4G4IA 2IXTA 4AS3A 4DT1B 2XRZA 1XVUA 3K20A 4QM7A 1M1UA 3AWDA 3DE2X 3ZHBA 2BMAA 4TM7A 5JPCA 5BYKA 1TOAA 2BMDA 4P53A 3SOPA 4HI0E 1K9VF 4FILA 5CNJA 2G06A 1Y7PA 2XECA 1UK7A 2ATCA 4NOMA 5G53C 5A7GA 3JRXA 3G0GA 1YJXA 3SCZA 1W75A 4BPRA 3N3AC 3QE9Y 3TLEA 3DHNA 3QX9A 3SPXA 1BA2A 4L16A 3GP8A 4P7KA 4QDJA 3L7LA 1U80A 1XU9A 5EHIA 3RLIA 3WB0A 1QFJA 1XKTA 2P65A 5FI5A 3IAEA 2GNAA 3PNSA 1H2AS 1UANA 2DZDA 9GPBA 3GA7A 5LMNB 4OAOA 4TKLA 1LDMA 3VHXB 2J6BA 3WMFA 1P1IA 4ZD6A 1L0BA 4FEGA 2DY1A 5KQRA 1YHYA 2NTNA 2O8FB 1OWMA 1ADYA 2AA3A 3NT4A 1IULA 3H1GA 1F0PA 4ZYYA 4Y2XA 1RBQA 5IVPA 3KSAC 2ZPAA 3DOEA 3IE1A 1ESEA 4N7RA 1L8XA 2XNCA 2C78A 2H2WA 2PYZA 3QK7A 5DIFA 2J45A 4DZZA 2QTVB 2ISQA 4K6CA 1IXSB 1A3CA 3G7NA 4P4SB 5IDYA 4TWJA 3E3LA 1XFAA 2XODA 3ZJUA 4D9JA 3P9RA 4PTZA 3CW2A 3VO2A 3LQ2A 4MEAA 1ID8A 3NVMB 5DOZA 4R2IA 1KQPA 5K3SA 4YJDA 4L8FA 1WD7A 3SLRA 1YZGA 4ZCLA 4EHKA 5A04A 4KLCA 3ET5A 2W42A 1G16A 3IUNA 3IHTA 3X1KA 3PE3A 3RVOA 2BBTA 3KKOA 3OQ6A 4J2OA 4X9XA 4IMRA 2DJ5A 4MEJA 4OMDA 1JG6A 3O8LA 4JA2A 1ORIA 1Q92A 1ZWLA 2C5GA 3C45A 4DUGD 2J30A 4EARA 1NJFA 2VF4X 3H9GA 4J0IA 5BXQC 4HAOA 4ZV4A 1Y8CA 1TW2A 1RVV1 2O5VA 2JIQA 4GL2A 3OE4A 4FHGA 4H3KB 4QDOA 4DLSA 4LF8B 4YI5A 4NAHA 3W1EA 4TVBA 1SQ5A 2V9ZA 3HXKA 4X3OA 1G3RA 1L7DA 4H7HA 2OSVA 3DOFA 5C4IA 2Y1LA 4LK3A 4GOMD 5AUPB 1K5GA 1UDAA 2P3SA 4N49A 5EMJA 5L4NA 3ZDDA 2WT4A 4FBLA 5DM60 3Q15C 3WSWA 4DTIA 1GYQA 1U7HA 3PNPA 1O95D 3F6CA 4IV0A 1Z62A 4YLGA 4JI1B 4AB1A 1VM6A 5LOVF 4JXKA 2O7VA 3VZPA 1JPNA 1QG4A 3N70A 3ZKWA 4AIIA 2WUDA 2W0SA 4DN6A 3GFRA 5KVCA 3E9NA 3MB5A 4ITUA 1A9PA 4L6IA 1JDBC 3EIHA 5FBQB 4YRKA 1Z17A 3M6MD 3EAFA 1GM5A 3U31A 2YZ7A 3ZV3A 2I34A 4EG3A 1Q2XA 2YXPX 1H6DA 2RHCA 4FYYA 4IS2A 3O74A 4LJ7A 1HYHA 4ZALA 5DN6D 1U63A 3H05A 3AR5A 1NJ2A 4LECA 4YQYA 1JHOA 5E8RA 3V1NA 5JBIA 4HQNA 2HYDA 2CDRA 3PF9A 5DFAA 5B1IA 2PD6A 3ESXA 2QJTA 4M7RA 1TPYA 1BOOA 5EXDA 3U1VA 3WHLA 1OI2A 1SVSA 5JD6A 1Y42X 2YINC 3NAZA 3O93A 4XFJA 4ZQIA 5KCMA 4F12A 4A36A 2UXDB 2PN1A 2YZGA 1JJBA 3HMQA 3PTLA 1QG0A 3HA5A 2NYAA 2NSLA 1KMCA 3O4GA 4DMRA 4O3MA 4NHOA 2O23A 3RUDA 3RTDA 3DJFA 5ALRA 3GLUA 2CLHB 1G17A 3NHBA 4AN0A 4GT1A 5KEIA 2HPAA 2ILTA 4ZPJA 3KUCA 3I28A 4QU0A 4XDGA 3AGQA 2R96A 4KOEC 4B3TB 4LGCA 3BGWA 3PLNA 2G71A 5BR8B 3AEUB 1AGRA 4LTMA 1KJQA 1XZCA 2G88A 5K0ZA 3TGPA 4GOXA 1ZIDA 2QTRA 5TQ0A 2NO9A 3OC0A 3OQOA 4OM8A 1U7TA 1XXHA 1A9TA 3HP1A 3M6XA 3G5MA 3T6KA 2YCBA 3NB0A 4A26A 1OAAA 2FEOA 4QTZA 2VTBB 2VT2A 1ORRA 4PZEA 2XVZA 3MJSA 6PFKA 3LD9A 4EH1A 2PAFA 3FYCA 4Z7JA 3UB2A 3DNMA 2EDAA 3CVXA 1DARA 3VYRB 4G5QA 4CM1A 2H08A 2BZ0A 4Q4JB 3TUJC 3Q7TA 4L5AA 1TEZA 4LXTA 3IX7A 4L5JA 4DHEA 5CFOA 1UMBB 3TKYA 2VDUE 2F8MA 2O7SA 3EYWA 3TD9A 3N76A 1VHQA 3VO1A 3LTNC 4JJEA 3MQFA 5BOSA 5HDQA 4RFSA 3EXG1 4EY4A 4ASUA 4YDHB 1ANKA 2G9ZA 1ZH4A 4UOEA 1T1RA 3DDZX 3KQHA 4URZR 5ALFA 3QKUA 4AZTA 1OYVA 3BG5A 3FPBA 4PEVA 3LQKA 3VISA 4DEVA 1OH5A 4LJ4A 3EVDA 2RK6A 4WKGA 5HS4A 1FUYB 2OCBA 4IHKA 4LW8A 3E4DA 4ZVTA 3MK31 4CIDA 4U3JB 1PR1A 2QOEA 3AESB 2QUIA 3Q87B 1UF9A 1EFRD 3G2OA 3I72A 4M9XA 5LZ5A 5T6BA 4XX0B 4YV0A 4NOLA 5JCZA 2VJKA 1Z4IA 1K97A 1UJ2A 3TAXA 3W8RA 1JKXA 1GD1O 2ECQA 3ZBTA 2GEDA 2AJCA 3QTTA 4RKRA 5AJZA 5G0SA 3ZG6A 3ADBA 3PEYA 4F3KA 2WNHA 2VXCA 4RD3A 3GGOA 4CNQA 1P1CA 2FPGA 3TVYA 5ALNA 4V24A 1QWSA 2AW5A 4KLAA 4QPZA 3VYUB 8OHMA 3AUJB 1YQQA 1G5FA 3Q6MA 3TD2A 1C5KA 5BSTA 2HA3A 2V97A 2VT6A 2O8BA 4IFBA 3K70D 5CCDA 2ODBA 1G7RA 4PZ0A 2OEPA 2J87A 2OBNA 3ORQA 5E3JA 2X0JA 4RVUA 2O3QA 4UNIA 2W9XA 1J22A 4G1FA 5D51S 2X41A 1RI1A 5K3DA 4R2WA 3W8EA 3ZHCA 1PG5A 2PUFA 1AQUA 1IHUA 1MR3F 2SHKA 3KWMA 3OURA 4RMJA 3QFCA 1AURA 3ORRA 4AXBA 3IUSA 2JH8A 3NTXA 4M1EA 3PCRB 4CYMA 1VKJA 3HEBA 3LT1A 5KOYA 4NVRA 1OFUX 1U0HC 2VNJA 2FQQA 3TS1A 2ZUUA 3E22B 3FB1A 3LAWA 2AOUB 2V0CA 1U7UA 2ORIA 3EFBA 3HXPA 1A1VA 2ZRGA 3ABOB 1B8NA 4YFYA 5ALYA 1C9YA 2QNIA 4HC4A 5D3QA 1YFJA 4XB6B 3DC7A 2Z6VA 4TSKA 2GASA 3QOWA 2WU1A 4F2GA 2XWSA 1IXKA 1PNOA 3KCNA 3RSCA 1SRQA 1RFGE 3TZHA 3BXOA 3FKQA 4BLRA 3K96A 2FETA 4L6CA 5DM70 1BFDA 5FO0A 2ID4A 4JLPA 4PQGA 2QX6A 3TO5A 3Q5DA 3AC0A 1BDIA 4F4JA 5I45A 3HCBA 4WZ6A 5JAMA 1JEJA 1NL3A 4KI0A 2VSOA 4AUNA 2Z1MA 4PF1A 5I8PA 5K6RA 3EMBA 1OR8A 1NBME 3THXB 2IS1A 3EOZA 5J1TB 2WIBA 2P91A 2X5NA 2FDXA 4GI7A 3T0FA 2ZYIA 3OMXA 4RYLA 1ULUA 4NZMA 2X6TA 1DG1G 5KYNA 5FOWA 1NVUQ 1U2GA 1B8VA 4MKIA 3HJHA 3M3PA 5TQ2A 2P77A 5BV2P 4FYJA 1K7CA 5KI6A 1EVZA 3ZTYA 3OI7A 4QLBA 5LU8A 3KZVA 5KYXB 1HKHA 5CDGA 2FX3A 2ORWA 2W00A 4C7MA 4EI2A 3C1TA 4JOBA 3UGKA 5B2ZA 4LTDA 5EJGA 4URVR 5EPUA 1E3LA 4YMVA 3SWWA 4GYWA 3LUCA 3KKMA 4EA8A 4D82A 3BWCA 3G8YA 3CMMA 1Z7YA 3HDGA 3HVJA 5T4HA 5TX7A 5I7UA 1MOSA 4L9RA 4JLDA 4DCPA 1NMXA 1EFVB 4E2FA 1SA0A 2D59A 4FW9A 1UP7A 2OOSA 3D7KA 3SJUA 5IF9A 1PV2A 3OH8A 2YS6A 1U1DA 1QX3A 3K2QA 4WKBA 3CQ9A 4IF4A 3ETEA 1JLLA 4U2BA 1TW3A 4Y2HA 3IKMB 2J3QA 4GAEA 4ZAZA 4MIYA 2YFQA 4LVUA 3RS4A 6Q21A 4CLRB 4DM7A 2D1QA 1Q1AA 2PH7A 4O1IA 5K0NA 4B2LA 2BGRA 5HOQA 5JYCA 1PWHA 1M6EX 1VLHA 4TKUB 2VQ3A 1FDRA 2AZMA 3AQIA 4MWBA 3MLEA 5FR2A 1YRAA 3PT9A 4L8WB 4KKXB 5IPFA 4ARAA 4S0ZA 3MJCA 1WX1A 1NQWA 2QN7A 3QX8A 3DB2A 2ZTLA 4RTSA 3A7DA 1DL5A 1BE0A 2CXXA 2VK1A 2I65A 3N6RA 2G76A 2BDTA 4IIUA 4AZVA 2B5VA 1D5WA 3I8OA 4XARA 16PKA 3F49S 4X64B 1NLFA 2PLFA 3FFBA 4DLYA 3JQFC 4JL6A 1XF9A 1A8IA 1XDSA 1ZISA 1VG8A 3WLKX 5K0TA 1G55A 2JGFA 1EUZA 3B1XA 1VQ1A 1NW6A 1C7JA 1GQ2A 1QYVA 1ZDMA 2ADOA 1KO8A 1SHZA 2AFIE 5FFFA 3AY0A 1EXNA 4HS4A 3RROA 2WC1A 3ZWNA 4CEHA 1BH2A 1E69A 3HWX1 5LFAA 1EXVA 1E5DA 1RWQA 1EA7A 1UQUA 2IEIA 1L1EA 4I08A 1EVQA 4KODA 1QIDA 2J3IA 3RRNA 2AXPA 2CB0A 2HNKA 5LBTA 4BMCA 4GI1A 3V80A 5BSMA 3WHIA 2Z6QA 3L1HA 3PX3A 2VTKA 1V16B 3AHEA 2XNHA 1P3Y1 1CP2A 3WGOA 2GARA 1A96A 4GC5A 3S7ZA 4CUKA 1FB5A 2NZWA 3A6PC 4X0EA 3C6YA 2WSLA 1HTWA 3WBKA 4U5QA 1AKWA 3HC7A 3CNBA 5EMMA 2G0TA 2H4WA 2K87A 4RELA 5IG2A 2B98A 3WLSA 1IPFA 3R6TA 3UK0A 3R9KA 2P8SA 4RANA 3RTGA 1FQOA 1VXOA 2IYPA 5T67A 1F2VA 1KEWA 1T5IA 1UMBA 4LSMA 3GVCA 4LJ6A 3A4MA 3UAXA 1P4GA 4LDNA 2JGIA 2WSSA 1NIJA 4AKSA 2WPDA 4BWYA 4BYMA 3OX3A 5FUVA 4DADA 2Y1KA 3TQOA 4TSFA 3OE7D 2II6A 1A50B 4RK6A 5CT9A 4BKQA 5HKAA 1MJ5A 1E1KA 1TEXA 2WHYA 2QTGA 1VHWA 3KHKA 3UGTA 4Y98A 2REOA 1PWZA 4PAWA 3PFBA 4WLEA 4TVSA 1E9DA 3IH5A 3QX3A 2ZYGA 3KHUA 1CDOA 4EFKA 2JIRA 2H1IA 3A9VA 1KC1A 3PXEA 2DSNA 1F6BA 3IVXA 5THQA 3EGOA 4TXLA 4BP8A 2IU0A 2JCXA 2B9EA 3MJVA 3CUYA 3AVWA 1AE1A 1GTVA 4W1SA 2VUTA 1C14A 4ZZIA 2NN3C 4XIFA 3EXAA 3OPYB 2PBLA 5JRZA 5LR6A 2CV2A 2PZFA 4OLHA 3QE3A 5BYBA 5KBYA 1WUTA 4UNSA 2HTFA 3UUEA 1N32B 1YR2A 4NP6A 1X14A 1OLXB 3IVCA 5FRDA 3CRW1 3K9BA 1G5TA 3VH2A 4BVHA 5IKEA 1UMCA 2DUMA 1ECLA 2GRAA 3CF4G 1CUYA 4ZT3A 1W1IA 5BQ5A 1E0KA 1HURA 4WK4B 3CH7A 2D0PB 3O03A 4GSKA 4EDHA 1PKXA 2XT0A 3QLVA 3ADDA 4S1WA 1HXHA 1N9GB 1U0BB 1JLKA 2YL2A 2ZEJA 2FZKA 2V7GA 4YC7A 2WHRA 4M86A 4N76A 5B3JA 3VJRA 1HEIA 2RIPA 3QZUA 3WDMA 4BGVA 4INAA 4PSKA 1SUCA 1BQ3A 1XTSA 4L5BA 3M3DA 5BMVF 3H04A 3B38A 2OFOA 1JWAB 4MQFA 1HNNA 4C03A 1DTEA 4HSGA 5A5GA 3ANXA 2VLIA 2ZU0C 4B4DA 4JJ8A 1J2YA 4IEFB 2J3LA 3AYZB 3OZ7A 1U6KA 5J4LA 1CRPA 2X9GA 1EGHA 5C1IA 3O1IC 3F4BA 3ZI0A 5AVUA 5KJCA 3PA8A 1XLVA 3EUEA 2FMUA 1N8KA 1XC7A 4R9NA 3KQUA 1HT2E 1BYUA 1CZUA 1JIIA 1ZSVA 3OP4A 5KYKA 3RS0A 2VHWA 3NH6A 4HDNA 1PWXA 4L78A 1Y8QA 3QNMA 3ESBA 3KE9A 3MPUA 1RXWA 1B41A 3CPSA 3VKHA 1L4NA 1KYIA 1WW2A 3P2EA 5DX8A 1HEYA 1S02A 2RSLA 2ZQYA 1M2JA 4M1ZA 3DS8A 4BWVA 4BZWA 4KN5A 2BGWA 1NOIA 1XRMA 2WV9A 1RQXA 1UIRA 1JFFB 2VHYA 2ZLBA 4MUNA 4P92A 5JNSA 4Q66C 4K26A 4WHMA 1HYEA 2LUOA 2OV6A 3OX1A 4CQMB 1JKIA 2JGAA 2UVQA 2ZYUX 1FYVA 2XBLA 3GRKA 2G8NA 2MHCA 4JC4A 4PC1A 4HRAA 3SHTA 5CG1A 2D5AA 3JD3A 1I5EA 1FYWA 2ZI5A 4CLEA 4KN8A 2HPVA 1MJNA 3BFXA 3DKPA 3R0IA 4FFVA 4F4UA 2IPAB 2V7QD 4XI9A 3N1UA 3DNPA 3PD1A 4XSVA 1UZNA 1X9GA 3THWB 4M1KA 1A04A 3FXAA 4O08A 4NAUA 3D8BA 1XKLA 4KAJA 2Z56A 2WYIA 3KDPA 3G8AA 2OB1A 4JAVC 4MV0A 3BCHA 4HGYA 4KO1S 1W4AA 2WI8A 1PJRA 3SYLA 2I2BA 4DIFA 3QBDA 2XUAA 1OREA 1Y80A 2FQ1A 4NARA 1EDZA 3HE3A 5HIJA 2C5HA 2AFHA 3ZH9B 3WLOA 1N36B 2V55B 1XEWX 4YRSA 4DNQA 3IP8A 1SPXA 2A94A 5CPFA 4XSGA 1DRWA 4MV4A 5ARBA 3B2NA 3OC6A 3A25A 3SC3A 4QYWA 1DC5A 1QRTA 3TRJA 1XL0A 3VNUA 3AP2A 4P4TA 4W7IA 3RYIB 5BV7A 3NFYA 5AIAA 2XXBA 2CZGA 1BEEA 1KERA 3NC0C 3NV7A 5AK5A 5HF8A 4JSYA 1R9JA 5J9FA 1L5GB 4F85A 5CA1F 4P98A 4K9PA 4WZAE 5BQFA 3A04A 1NX6A 2JI6A 3FMPB 2X42A 1YK1A 2NU6A 4B87A 2G8LA 2GFHA 5KQGA 4EJFA 4WFJA 3U4IA 5AJWA 3BTSA 2GN8A 4UAVA 5DW0A 3T1HB 3AM1A 4HD8A 4M60A 4MYCA 1OWPA 2VXOA 2WYHA 1G2QA 3B6JA 2AI2A 3NC4A 4S2UA 1JT9A 4U7GA 2Q4EA 1ZOPA 4IOKA 3TRHA 4KR2A 5H83A 4UE3S 4G8JA 1OWNA 2NXNA 3N6VA 3TIXB 3TX6A 3SQDA 4OQNA 1PR9A 1ZN7A 1TJ3A 2X14A 3HFSA 1GNVA 4XLZA 2FPIB 3JQ8A 2EFHB 3RARA 3U39A 1W76A 2E7ZA 3SR3A 4AKEA 4B4UA 2VYNA 4YAKA 1AKNA 3OCJA 2AB0A 3NNNA 3MCWA 3DEAA 3OE1A 2COUA 4XQEA 3FFWA 5CD1A 1QRDA 1TYZA 3D3EA 2Q5HA 3ZDRA 2YIVX 3NR2A 2D5IA 1XZPA 2NIPA 3ASVA 1XTVA 3E05A 3GFGA 3NM6B 4JEHA 4LJKA 4MS3A 3THOA 1AMNA 3W5JA 1FMCA 1V5FA 4PYLA 2R5WA 2GBGA 3H1PA 2WF6A 4Y8VA 1H2ZA 3VPAA 4QOHA 2AXEA 2JCSA 2RGXA 4BYGA 3D8TA 4DXHA 4EATA 2AXQA 4JGBA 3GD5A 1EE1A 2JANA 1WZNA 1YBHA 4X65B 4KRYA 3TJZA 1MUUA 1ZH2A 2E4AA 5DTMA 5A02A 3OZXA 5SY9A 1FFCA 4LZNA 5EJMA 1X8XA 3RABA 4DRZA 3ANMA 3IUEA 3BHMA 1SBHA 2YUTA 3EXHB 1WG8A 4Y1FA 3AKDA 3R24A 3KXPA 4W5RA 1E2EA 1SN7A 5AW7A 4ZFNA 3HCCA 3I2JA 2XMGA 3D1VA 4LCEA 1W46A 3CZQA 3HH8A 3OO0A 4RVNA 3AETB 5AVKA 7AT1A 2X7HA 1VJ1A 4A5OA 3DL2A 4PIPA 2VDPB 1VIYA 2ZANA 2FVXA 5BSKA 2UXBB 2O0HA 3K8OE 4US0R 3NWEA 2HLPA 1H9CA 4FR2A 1F12A 1NLMA 2REBA 4HCJA 2YBEA 1Q20A 2VOEA 1L4MA 4QHSA 3FCOA 3I64A 4K6KA 4CTJA 5KHLB 4EGSA 4AUKA 3EXHA 3KUUA 4I4IA 3TXYA 4YT4A 2WV7A 1XNGA 2H9AA 4M0DA 2FMXA 1O3YA 4DCUA 5ELXA 3HRIA 2Q6IA 2UZ1A 2NG1A 3GFFA 5EWLA 1YKFA 2C3YA 2ISSD 3BE5A 3CLRD 4K6GA 3T3MB 3UIEA 5EGSA 3UKOA 3IC5A 4OAPA 1FP4B 4AC9A 2V3CC 3W0LB 2R7NA 4EY5A 1Y6JA 1R0LA 4ZI7A 3H87A 1HLDA 4DMUB 1PV1A 2YRXA 1YA8A 2FPKA 4D3ZA 3ETCA 3URKA 1GZ7A 1NKVA 1TI7A 1D6MA 2CLFB 3L0CA 3NWOA 4PS0A 2ZRCA 3Q1LA 4UQPA 5TS2A 3GLFE 1M75A 5CA0B 4KGVA 2NO1A 5ECYA 2UYGA 5FA8A 5THKA 4ENSA 4GF5A 2DE0X 2HIAA 3FG9A 5AM2A 3SBOA 2O2CA 2YIDA 3QLJA 5ERYA 5FTKA 3V42A 3PTZA 1I13A 4DM4A 3BFKA 3HP4A 1IUPA 4DV0B 4HEHA 1N6NA 1FP7A 4ZQBA 1G8JA 5LN1A 1A5AB 1E66A 1XDZA 2G72A 2OESA 2XAAA 4QFBA 4R1OA 2Z6UA 1TEVA 2OAP1 3IO3A 3PT5A 1Q11A 2ZB4A 2G80A 2O3RA 3HWWA 4X7BA 1A7KA 2Q3HA 1XWFA 1H05A 1NZFA 2A33A 3NDIA 1TCVA 2VRCA 5EN4A 3ELWA 4DB4A 3JV7A 4BTVA 3TIIA 1Q1GA 2PDAA 2MOKA 4MYUA 3RRYA 3IT1A 4G23A 2XMQA 3JQ9A 1J5XA 2OBFA 3VDMA 5JH7B 3BRQA 1NTRA 1RZ3A 1W36D 4R6WA 2CBXA 3FI9A 1EWKA 3P0JA 4LXYA 1MJFA 4QECA 5ALZA 4CG2A 2HREA 4AQ7A 1JG2A 2OQ2A 1F9EA 3EFEA 2VRBA 1I6WA 3LY9A 4TMKA 3GW8A 1IEWA 3FBGA 1UBOS 4Y6QA 1J2EA 4LMBA 3O4RA 4GZ3A 3OX2A 4HGOA 4D99A 1VPWA 1UZMA 2QEQA 3IA2A 1ZH8A 4BO7A 4JYZA 1ZU5A 4FDVA 4QVKA 4BNZA 3QVJA 3KUXA 1IRXA 1GV1A 1Y5RA 2ZWPA 4NONA 2G17A 1WDKA 3KXDA 1ABEA 3FCCA 2C9ZA 4MUAA 5ICEA 2WABA 4KFTA 3EEYA 1NNSA 5EXSA 1JIJA 1UK6A 3UWDA 2DKNA 2I2DA 4C1NA 2OO7A 4S2EA 1GRCA 3JW8A 1FY2A 3AW9A 4JENA 1OTHA 3CLTD 1P7YA 2GM3A 2P2CA 2X4IA 4HF7A 5IT9A 3KTOA 1GTJ1 3M1YA 5DCYA 1NXWA 4MV1A 2J0QA 1AB5A 2YWGA 1CU1A 2HLNA 4UCQA 3L84A 2V6FA 1P5JA 3ESZA 4O2BB 3RUIA 4U7DA 2WA2A 1XDBA 3DFMA 1ETHA 1ZU4A 1GUBA 1PR5A 3AJDA 3MJDA 2FMIA 1V45E 4KQWA 3TTTA 3KPYA 2D5CA 4R01A 2CHGA 4X8OA 1WKCA 2DBQA 1QBGA 4YO7A 1U1IA 1RIFA 3MTAA 4EB6B 2XLBA 4QRHA 5DEIA 5IT0A 1E60A 3FCEA 3MJ4A 1L6IA 1TZ2A 1X2EA 1YZTA 2C59A 1LX6A 3H5TA 1VJDA 3JD1A 4EJ2A 1XTTA 1C9DB 2ZWOA 1FTSA 3WHKA 4CKEA 3OTGA 1JV2B 3FPCA 3VI3B 2CLEB 1NBAA 2VLBA 4MGEA 3FUWA 3K0FA 3L7AA 4QARA 4YA6A 4BIIA 4NI5A 3U3MA 4NECA 1M6HA 3RFCA 2YVUA 4BC0A 4DAEA 2WNIA 5AW6A 1E62A 1HR0B 4DXAA 1ZJ6A 3K16A 1UWVA 5JD4A 3LW8A 4ABTA 4WCFC 2X9LA 1YS6A 3A1CA 2GPNA 2H65A 1Q3KA 1CRLA 1E7YA 1M6VA 2W22A 4OATA 2IUEA 3T1NA 4CMAA 5C3MA 3DTVD 1E6WA 5K99A 1H1DA 2A3RA 4Z0PA 3UHPA 1PNTA 1JAXA 1VC2A 3IALA 4EPTA 1EFLA 2WKRA 1M8GA 1T6XA 5FUBA 3ONDA 3Q9LA 3H2GA 3WKCA 4NH0A 2NSJA 5EAIA 2P4EA 1OXUA 2Z9DA 5ED0A 4CMBA 5B6IA 3C3WA 1NRIA 4P35A 2RH4A 2I8LA 2NUAB 4XOIA 2PPVA 1T6BY 1PAUA 3I83A 1LF5A 2Q4RA 3SZLA 2V1UA 1G5PA 2FPIA 4MTCA 3INNA 1E0AA 3H8SA 5CVEA 4BNFA 2DPGA 2AZ4A 2UZIR 1LDBA 2HZBA 5A4DA 3ZXUB 2BGUA 4CIBA 4GH5A 1LS6A 1ZIOA 2P3QA 1IM5A 3BWEA 4RQAA 2GJ4A 1BMDA 1THTA 4BU1A 5HA5A 1QONA 3EF1A 1TUGA 3SYKA 3G0HA 1MVNA 3F6PA 4ZGGA 4DB2A 3W9SA 4MUYA 3W2GA 4XVUA 4YIHA 1AGPA 1OFUA 3I2FA 1X2BA 1EHIA 1JDPA 3A2LA 1F2UB 5EIHA 4JS0A 1MBZA 1ESCA 4URXR 4B8YA 3K3PA 4R16A 2I4OA 3IQXA 1GKLA 2WE8A 3LP8A 3DBLB 1UEJA 2DFLA 3QI2A 1MENA 4FC6A 4GP7A 4IRXA 2CE2X 5CM2Z 2AFHE 2R48A 3JXEA 5EE3A 4ZK6A 1Y3DE 2XI4A 4H77A 3STXA 4ALMA 1A2BA 5AOCA 1R9GA 2HMWA 5JSKA 5LQJA 2HBZA 4BFCA 4BEVA 4CG3A 3GEMA 4LWZA 3BORA 4N6NA 1PS8A 1M76A 1DC6A 1FRZA 2W83A 3CX6A 5AVJA 5L51A 5GVSA 4RTPA 3D7MA 5HF9A 4D79A 1YUMA 4J2TA 1NG9A 1Z0IA 4P4GA 1PJCA 4CM8B 1WETA 2D7DA 2QGZA 2W2KB 4J07A 4XZ3A 4QD3A 4QBGB 5BRJA 1RT9A 2FWJA 4F6RB 4Q9JA 1E7WA 4BNGA 1O77A 3L9WA 3WMGA 3CA8A 4WOCA 2PQ6A 3KLOA 4H27A 2XWJI 2CXRA 5L95A 4FZ5A 2V03A 1M72A 3SR0A 1SC9A 1D6NA 2HNAA 4XRGA 3DAOA 2ZSUA 3DFFA 3O9MA 1SG6A 1RABA 3W9YA 4DL9A 4LFCB 2Q0SA 4BVEA 3ZN2A 5I6DA 4AZ3B 1MNQA 1I36A 4XGIA 3HVUA 4EJSC 4BE7B 2DFTA 1BS1A 5AHRA 1R6XA 3VU0A 1HZJA 1DUVG 3KTDA 3AHGA 2B4TO 3MQ2A 3B89A 4OK5A 2P1RA 4QXAA 5KNCD 1QKJA 2H1VA 3WGNA 4HTFA 1CNFA 5CEFA 1EXWA 2GYWA 4IP0A 4G8DA 3AY3A 4ZRDA 1W85B 4KDRA 4EFDA 1E9CA 2QN2A 1CZKA 4H1HA 4W99A 4XB2A 1DXYA 1MO4A 4JQYA 3T61A 3VNBA 2V7XA 2BKXA 2NSYA 3QVKA 3M6VA 2NO7A 5I7EA 1JA0A 1F8GA 5AJTA 3ROFA 3QPUA 5J2UA 2BL4A 2EL7A 4D44A 3IAS1 3JALA 4RXTA 1R8YA 5SYNA 4NFLA 1TZBA 4AF8A 4C22A 5C80A 1JJIA 5CH5A 5IZ4A 5D6OA 4HDRA 4RPIA 4QBKA 4GM1A 3PTAA 4WRRA 1K08A 1Y5IA 4GZ5A 2D2EA 3EUFA 2QRQA 2A5GA 4HTFB 1EUQA 4JLOA 3N86A 3WL3A 2DBVO 1RYFA 2H5EA 2HADA 3GCWA 5K0LA 5BW8A 1LDNA 2CB9A 3WTCA 9ABPA 4V1CA 3D6AA 4QDUA 1V48A 2HPZA 3BHJA 3MTDA 2HGZA 1XLUA 2C9OA 2E48A 4FR0A 1E2LA 3PQ3A 4E6PA 5BMVA 5IAOA 3R5JA 5CXSA 5GM1A 4FKZA 3NRBA 4LOLA 5E6RB 3ND7A 2VYVA 4H7EA 5HHTA 5COQA 1HDRA 1AK9A 3JU3A 3H6KA 3KKKA 5TC4A 4DRYA 4EDFA 3S7TA 1L3IA 4FNMA 4UBLA 2FB9A 5F4BA 4C9BA 5BWCA 4ID3A 5IANA 3MGBA 2PZKA 3FOWA 3QW4B 5KDOA 1CDZA 3CXRA 4IG4A 1Y6FA 2BDEA 2I03A 2NXJA 3PUHA 1EG7A 1T3GA 5A2GA 2VZ9A 4WBNA 4RZHA 1QC5B 4ZXFA 1WUYA 3KD3A 1H8HD 4OGLA 2UUOA 5DZSA 5LYJB 2X5XA 2VNIA 3OQIB 2ZTUA 4OJQA 4IH4A 3O7MA 3HFJA 3W9UA 3CG0A 4ONEA 4KO2S 1M2OB 2FE1A 4GPZA 5BVGB 3QBEA 1IE3A 1A2KC 1B74A 1T4GA 4OBEA 3EVZA 5JBQA 4IX9A 5AVZA 2QUZA 3D6UA 3K15A 3ZK9A 1ISFA 2HSJA 3D3WA 2I4TA 3HCWA 4P7BA 4RFLA 3X2FA 1I6KA 3HCPA 1FFEA 5AKJA 4YGYA 1F0NA 4YAGA 2Q28A 1KH1A 2QLBA 1D0IA 4QUIA 1FPMA 4QNNA 3BXPA 3KSMA 4HJXA 3T1OA 4GQAA 3T15A 1HUQA 4WZBE 1HG1A 2LRHA 2CKDA 1YC2A 1G5RA 3ZE8A 1MCZA 1XGKA 1RWXA 2W6NA 3DZCA 3K94A 2J59A 2X13A 3Q8MA 1J2UA 2ENUA 2WTNA 1W0KA 1YVEI 2PT7A 2CV0A 2YV4A 2L0XA 2O3UA 3NTVA 4NPCA 2JAUA 2PGXA 1I10A 2TMDA 3K1AA 4W82A 3H1EA 1Z5GA 2VP0A 4A27A 5EMLA 4NFSA 5BN3A 4R1PA 2GT1A 4OYLA 4W63A 2VN8A 2Q3JA 2VTEA 6YASA 1D2CA 4CV2A 3CUVA 1H2YA 2YDXA 4MMXB 1P2DA 2O2YA 5CVUA 2W2LD 2WT8A 3E8XA 4WZAB 1N2OA 1OWLA 2IIPA 4JWKA 1JDSA 5KKNB 2FZLA 1SMKA 3NCHA 3FYUC 3V9PA 1XK7A 3WHPA 4PFJA 2ZM5A 1ZQ1A 2QQGA 5AXBA 4CLOA 3FMVA 4L4RA 3QBJA 3BZUA 1XZKA 3QX7A 4M2LA 4BNXA 4XJVA 4CM9A 1JMVA 4TYPA 4E03A 4BJHB 4GG1A 4G1EB 4I14A 4D9KA 5KQPA 4DDMA 4I50A 4CDMA 1JIQA 1KAQA 3DW3X 2K2QB 3MZ0A 3JR7A 1W1WA 2WWXA 3JWGA 3ZYZA 3DM9B 2C2GA 5F4ZA 4QRIA 2EHDA 2N1MA 3I8SA 3USZA 5ICSA 3ETDA 5ARCA 3SLGA 1Z0JA 1E5XA 1JDUA 2Q5JA 4KX5A 1ZNXA 4NBKA 3G8BA 1CPYA 3CN9A 1ZNWA 4P38A 1UXKA 3B85A 4XX1A 2CMKA 3OOWA 4YP7A 5K3BA 1CUDA 3H3XA 3ER6A 4HN9A 2FK8A 1UIMA 1YL5A 4QQ8A 5IX8A 4UUPA 2X6QA 1U9IA 2JGLA 2ZSKA 2I66A 2L2QA 4BO2A 1N5KA 4WUTA 3T3DA 4BIMA 3DXXA 3UJ9A 2JA2A 4ND1A 3BF7A 3MWDB 2ZRNA 4RSGA 4BMOB 1YIAA 4EVIA 2QTFA 1IIBA 1QP8A 1MGOA 1KKMA 2P7HA 3MYRA 3ZV7A 1VSTA 5DJ5A 4QYSA 5CH3A 2HRRA 5DMXA 4CKXA 5JY1A 4DIBA 1XUOA 3E15A 3IR6A 4B6SA 3O3MB 1Z7WA 2YIMA 5I7WA 3RUEA 3EGIA 3Q7EA 2FLKA 3AOEC 4TQGA 4Y6GB 3PHGA 1EQAA 3U9SA 4YV1A 1DAPA 5F7OA 3IKLA 2ZBPA 4RD2A 2C4KA 2HJSA 4LE1A 1WW8A 5C31A 1X1AA 2WSYB 4IGFA 4B6FA 1E8MA 1SVOA 4Q48A 1NSYA 3AR2A 3BDIA 4N12A 3VPFA 1HDEA 2QF7A 1OU4A 1ND6A 4ND6A 1UT6A 2P9JA 4HTAA 5MGNA 4HZGA 3SJ7A 3W5IA 2KLBA 4B7ZA 4X92A 3L0SA 4RVFA 5C35A 2WG1A 4WNAB 2Q49A 3NHUA 1D4FA 1WPGA 1PJAA 2ZBRA 2CWWA 1D2MA 2B2CA 3RT9A 4KPEC 1C1DB 4YXWD 5CLIA 3M6FA 3BE4A 4F96A 2CCGA 4I4TB 5CU7A 1T9GS 3CX8A 3JQQA 4MWGA 3RS3A 3VZDA 3BSYA 4DANA 1V1JA 5I4BA 3TECE 4ED9A 1ZI6A 1UBSB 2VF8A 1W96A 3KQNA 1RZRD 1WSWA 4QNRA 4TVKA 3INRA 5HNKA 2N46A 5JISA 4LV8B 2FOXA 4ZC8A 4X1YA 2V0GA 4GX1A 3SZRA 3JPYA 4GM0A 3AM5A 1Z25A 4MB2A 3T12A 3X1WA 4OMFG 4UMFA 1C1DA 1E20A 1FUUA 3ETNA 4FX2A 5G41A 3AG5A 4MYHA 2ET6A 3R5TA 2W6JD 2J9XB 4S12A 1LWOA 3DE5X 3E3AA 1XCLA 2WFMA 4LQCA 1RAHA 1A2OA 1PGQA 1Y3BE 2VH2A 3FMFA 4GEGA 4EKNB 4XFKA 1R6DA 1BWPA 4F38A 4LI0A 2QIPA 3ECSA 1M1ZA 1SVLA 5LKRA 3L4KA 3KR1A 1Y8RB 4ML3A 2DBZA 3UJNA 1GPYA 1P6QA 4RVSA 1AUOA 5FLKA 3V9AA 4ZO4A 2BW0A 4AJNA 5SYAA 1QKIA 5HFNA 5JDIA 1I7SB 5DTRA 4HYQA 3M81A 2Y1WA 4ALJA 3AL2A 1YU9A 3BXGA 3UA4A 4DJTA 4I9HA 2IYUA 4MPTA 1QFYA 3W2HA 3GX1A 4IWYA 1SVIA 3GLGA 3OLQA 2XOKD 2ZSEA 2P1DA 4JL5A 4C7JA 1TC1A 2P9YA 2QVZX 2ZCJA 2IV3A 4DIEA 1J8MF 2O06A 2ZUTA 4TLCA 3FYDA 3HZRA 3BZWA 4E4RA 2DQSA 2I4IA 1KWGA 2VDJA 4E6EA 3KWLA 4B1FA 3C8ZA 3EDCA 4BMNA 3SZMA 3BCSA 3UPTA 4NR0A 1DO0A 1AN0A 1AQ6A 4NK5A 4J16A 3PBKA 4UAUA 1U2PA 1OGIA 3C98A 2VJNA 1E63A 1E9SA 3VX4A 1KAEA 1OI3A 3AI3A 3HFGA 1VCOA 4F4CA 1PK8A 1E2UA 2W2XA 1SPBS 2YJZA 1DC4A 1EK0A 1DPFA 3OAAD 2H2DA 3IHWA 4M87A 1QZUA 2SKCA 3S3TA 1I2MA 4CIXA 4B6RA 1OGYA 4QXPA 4DW8A 5IDWA 2B35A 1Y37A 1EE9A 3EE6A 4YMWA 3TG8A 4LF9B 3AEQA 3ZWMA 2J33A 5CRIA 4EQZA 4G4JA 3H0CA 1CT9A 4MJXA 4PHTA 5A0FA 3G17A 3TDNA 3AIOA 1V1MA 1WMAA 2QTZA 4L9SA 4EO7A 1SK8A 3LIIA 4YJGB 5EXTA 3M0EA 1P0FA 3K32A 4XVQA 2QKYA 5B3KA 2GYVA 4NZPA 1BU8A 1GNTA 2O0KA 4HSEA 4OBBA 5A6SB 4ER5A 1DG3A 2WHPB 1S8AA 1QXSA 3NVDA 1OHHA 4RACA 1XU7A 3A9CA 3JZFA 4F97A 3I0ZA 1I32A 3NAQA 2Q21A 3H7IA 3PDIB 4CLXA 2Q1TA 1NJ1A 3FRHA 2Q2WA 4MP6A 1MQAA 3UOAB 1G3UA 4C6HA 3AIKA 1O2DA 1ODLA 2JFVA 2I55A 4ES6A 1VECA 5TVGA 2WW8A 3CISA 4NPAA 3T99A 4GXRA 2OE2A 4MWOA 5A4IS 1KBQA 2PZ8A 3LK7A 2FFHA 2W48A 4XYGA 4QXQA 1XVVA 4BMZA 1KI7A 4GMFA 1QHGA 3ED1A 1AV7A 3BKWA 4TWZA 3ZR4B 2QAIA 4LZLA 4DTCA 1W5TA 1X9HA 2DBYA 1BMQA 4KFCA 4S1NA 5IS2A 1UZLA 4OX9B 2WE7A 3EW9A 4WSOA 3CZPA 4XQ9A 3PDIA 4CKBA 4LC9A 1KK2A 5FNVF 4E5DA 3TTSA 4NCXA 1OTXA 1CBUA 4RADA 5LD2C 1JSCA 2EF1A 2PMEA 1R9MA 1M6NA 3H17A 2ZE6A 4Y2GA 4FPXA 2ZUCA 3JQ9C 1UJMA 3X1MA 1WNTA 3EZGA 3KQWA 1KRWA 4TYWA 1GU7A 4ILKA 4L6AA 4CM7A 3WJ2A 4ZEVA 3L9XA 4CL3A 2FWNA 2ZTMA 1QIGA 4WZBA 1N5MA 1P1KA 1Z29A 2V9PA 1FU4A 3MMSA 2DUWA 2IFTA 3GRFA 1JG4A 1K86A 1ISPA 1UDXA 2C2BA 1FS4A 1JDBB 1REQB 3BXHA 3ELDA 4KJZA 2Y2VA 4FYMA 5ALMA 4Z3KA 3GT4A 3GJQA 1G7SA 1UOPA 5E7QA 4QGSA 2OUKA 1WBBA 4RK0A 1PZNA 4NBWA 1PQPA 5AI0A 3LFTA 3QV1A 4LZPA 3ZD6A 1O9HA 3KAJA 4PONA 4RGBA 1FW8A 4CHTA 5FWYA 5JROA 1QH8A 3RC8A 3LT2A 1JR4A 2NU9B 3PC7A 4DJDC 2ZR9A 1CR2A 1WE2A 2FTKE 2FP4B 1N2CB 2Q3EA 3B78A 2BN4A 1SC3A 3HB4X 3U4AA 2I62A 3O31A 1KXZA 3Q8WA 2OR3A 3KDAA 1Y3HA 1ODTC 1NLZA 3GU3A 3V4VB 3VU9B 4YMTA 1P9LA 4MRPA 2XKAA 3A3YA 3PR3A 4EGQA 2J4FA 1BEZA 3MLAA 1YOVB 1VL1A 1DWPA 1KIAA 1B2LA 1RJ9B 1TIPA 3C15C 3DE4X 1ISGA 2EAUA 1FLDA 3RG2A 1GCOA 1R50A 2QTVA 4IHJF 5EPEA 4B3FX 3KYDA 1N3BA 1WHSB 1ZD8A 2FH5B 3F3YA 3WAJA 1GDHA 3E5RA 4FYWA 2RJNA 3GFQA 1R10A 1FSGA 1N2CA 1COWD 1KR2A 1S2OA 2R47A 3HV0A 1B0UA 4L57A 2F6RA 4HLCA 4XEHA 3RYHA 2CYBA 5K09A 4GLJA 1AO0A 3AIMA 1XTJA 5HQ3A 1P1RA 5HS6A 2ZULA 5EHGA 2OC4A 4ON9A 2JFUA 4D5GA 1T3ZA 3WYEA 4XPIB 1O9GA 3MN1A 4XTRA 1MO3A 8LDHA 3VDQA 3HJNA 4HNAA 5KOHB 1G18A 2WKQA 4AP5A 3KV1A 2YQ5A 2RGDA 3N8NA 5J3JA 5FCDA 2XMSA 2UUCB 1DX6A 3IAXA 3BM5A 1UBHS 1KJJA 2NU7A 3AUXA 3GN2A 4WL0A 3GDFA 3UOGA 1BD3A 1IH8A 3QE0A 4NBLA 4E5VA 3GPDG 1UOOA 1UR5A 2PL3A 4Q03A 4UZEA 1K3UB 3M5CA 4IV8A 3KQQA 4Y2RA 2XQVA 5DU2A 4YAIA 4Z8YA 5H68A 1Q83A 1KPGA 4LXIA 4F5EA 5J4HA 1FZQA 3AINA 3FWNA 4MA4A 4BBZA 5LZ4A 4V0QA 1CNMA 4P9NA 4RL6A 5BN4A 2Y0PA 3GRZA 4KIUA 4B6GA 5KYUB 1AA6A 4JV5B 1T2FA 1QYRA 4R8LA 1MV5A 1P4SA 3LPAA 1DLJA 4HQOA 5D3MA 2F3UA 1M34E 2GPBA 3EXG2 1AKEA 4X84A 3VOAA 5DSXA 3OOJA 8MHTA 1SIOA 1K63A 3TNLA 1F2TB 4AO6A 1KH2A 4ARZB 1OXKB 3PFGA 1DJPA 2CF5A 3K4HA 1RM4A 1WRBA 5IDQA 2COKA 3KZCA 5T3YA 3WISA 1EFDN 2J8ZA 3IIEA 3I9FA 4AURA 1GL6A 2WB2A 2V7WA 2YHUA 3ZYCA 2YOHA 1FP2A 1ECGA 2DT5A 4BB0A 3CSUA 3QUSA 4EG1A 3ICQB 1EWYA 4TMFA 4XWYA 4BNTA 1RM5A 1XQ9A 4US1R 5IKOA 2CSUA 5F7XA 1M2VA 4C6TA 3KZXA 3PRHA 4OH7A 1BROA 2F1KA 2O2IA 1BN7A 3BH7A 2XIQA 3RFTA 5C5EA 4MS4A 4QGGA 4F93B 4AX4A 2HB6A 2NNWB 4GWGA 2PGIA 4K7JA 3BMCB 4KQEA 4R1TA 2CF6A 2D8MA 5FLEX 1ABFA 1WSAA 1R74A 4MQBA 3G9TA 5ILQA 4DQVA 4EA7A 2L17A 1CY2A 4YMIA 3ZW9A 1H66A 3DHYA 4LQLA 4CV0A 1WJGA 1SUSA 4HFRA 4R0VA 2BUCA 2Q1SA 2X58A 5BUSA 2XMCA 3GLRA 5JZ9A 2WJVA 3L18A 2C31A 3LZCA 1JILA 3I39X 2D54A 2ERYA 1JGTA 3SM9A 4URWR 4HPJB 4IGIA 4D1YA 3HL4A 5DNEA 4A1OA 4GVLA 3H2KA 2XUJA 4EKDA 4FUQA 4L7QA 4L4UA 3J80A 1N7GA 3I62A 5IVIA 4R5HA 3T7SA 1Z73A 5A4MS 3ONVA 3U3RA 3FDXA 3UENA 1DAEA 1LSJA 1SVMA 2Z5GA 3QTLA 3TLXA 4EO9A 1YHZA 2FWMX 4NCHA 4H35A 1DRUA 1VYVA 2CFOA 2H1HA 3HNPA 1XNJA 1H2WA 2EKBA 4ZO7A 1U8TA 3T52A 4CLHA 4OHPA 4F06A 2I6XA 2I33A 3KFLA 4IDEA 3ZLTA 5KX5F 1ORTA 1RMQA 5LUBA 3RODA 2EQBA 2POQX 5KYWA 1XSEA 3UFXB 1K0UA 4OEHA 4S24A 3U3JA 4JR1A 3JTMA 5COAA 2ZR7A 1OYYA 3GLIE 3IQIX 4BX2A 4OI0A 4DIUA 1FYXA 3ZTWA 3C8DA 1AKMA 3RF7A 3GEHA 5MF6A 3FTFA 1FUEA 3DE1X 3VR6H 3PF8A 1KYYA 3TTWA 3PQ8A 3SC6A 3WWOA 5J2TB 5DM1A 1POWA 1QO7A 1K88A 2QTNA 2RG1A 5ES3A 4DJJA 4F72A 1FE8A 3K30A 3CLHA 1WCYA 2WUWE 4L02A 3UYLA 4KXNA 1YS7A 4LDRA 1OAOA 3M6AA 3ADPA 1DJMA 2FSHA 4HAIA 2QWXA 3BK7A 4MP8A 3TNFA 3ET4A 3TLJA 3PPXA 4M9CA 1CUBA 3K71B 4REQA 5CYOA 4ZCSA 4IOMA 3KOZA 2UUAB 4B74A 4I1RA 1QM5A 1ZL2A 3UANA 2I5PO 4OYHA 4CRWB 3CEPB 4Y0NA 4FOOA 3K6RA 4ALIA 5IRCD 1S0UA 3AL0C 1Z35A 3ZOKA 1ODCA 1RZUA 2ABWA 1IZ8A 2OFXA 3B60A 4B3SB 4RQTA 4GOND 5EWMA 3I4CA 1XZGA 2OV3A 1Z0DA 5B4UA 2ZBFA 3LBFA 2QVCA 2GK3A 5F78A 1NVKA 3F2VA 2DVMA 1CF4A 5DGCA 3NGXA 1SKMA 1PG0A 2B5OA 1Z28A 1Z2EA 3R8XA 4MHSA 3KXKA 4UEOA 1TKBA 3H75A 4PO1A 1I3MA 3H5IA 2M6SA 4G0QA 4QFCA 1IN4A 4D56A 4S1VA 1ZD4A 2Q3MA 2Z30A 3QELB 2OBLA 3K1JA 1TLFA 4MLDA 3SXPA 1KK3A 2J9GA 3BX1A 1R18A 3VU9A 3ZHOA 3QVVA 3A7EA 2ZRKA 3SJZA 3TZKA 4KPFC 4D6XA 3TW0A 2QM8A 1C3JA 2W6OA 4QHYA 2NUPB 2Y1DA 2AIRA 1SCNE 3PWKA 1NGSA 3LHSA 1P2GA 3ZQ6A 4GKJB 2J4DA 1YASA 2DH5A 1I7DA 1A5SB 2J41A 3R3UA 3EVAA 1C8LA 1XLTC 1ZOLA 4UEQA 3B13B 3UA3A 1WHSA 5AM3A 3A1EA 4L8GA 1QHEA 4P0QB 3B8HA 4BQFA 1OC2A 5CIWA 1GSOA 1SQFA 2PIAA 4C21A 3COZA 1GTL1 2ENWA 4Z4GA 5HQ3B 1H2XA 3ZVMA 3M70A 1VHLA 4WDQA 3ROTA 3FGZA 4TTTS 5JASA 2CK3D 2GNPA 4J9UE 4L5YA 4M0LA 4BY9E 1A5BB 1NYQA 2XTAA 2W93A 4EKEA 1H4SA 1XZEA 4OP2A 4LYEA 2PMWB 3N2KB 3OT4A 4OQDA 4BOYA 5BWBA 2X76A 5AW4A 4BGIA 5E3HA 1NBEA 2FMFA 4F2DA 3RPEA 2QL7A 4DQUA 4I8DA 1NAIA 1Y34E 1ACMA 3KSRA 3GN1A 4KDEA 1P8JA 3ZGLA 2IY9A 2XLCA 1KZGB 1GZ4A 4BGEA 3CH4B 5EHNA 1Y7TA 2AMVA 4LRUA 4BJ6A 5BWNA 2QRVB 3CBQA 3CVJA 1X7YA 5D1NA 2XUPA 4P31A 1UEIA 2LGJA 1ZCAA 1Z6XA 5FUXA 5LZ7A 1P29A 3GMSA 2MSDB 4MRVA 2BIFA 4Q39A 4XIGS 4AMGA 3NHWA 1KAGA 1H2EA 1P5FA 1XYGA 4MQEB 2PKQO 1VSQA 4K6FA 2C3PA 4YROA 5CW2A 1H9AA 1ZJJA 3HEMA 1M1XB 3OKPA 2V3WA 2JH9A 1MAHA 5IJ0B 1RQGA 4TLLB 1BS9A 5JI2E 2W2MA 3D4OA 1A0OA 1E9BA 1Z5NA 2QU8A 3EWSA 3L79A 4GQIA 5BXYA 1J90A 2Y2UA 2XSZA 4R1SA 3K6SB 2XH8A 1CQJB 2OFPA 2G7MC 4B35A 2YH2A 2HJVA 1LI5A 1UJ5A 1TUBA 3INYA 3SI7A 2OHIA 4LBVA 2P3OA 5AUQA 1RYZA 3MMPA 4LC1A 1B6SA 2Q0XA 4TT3A 2M6KA 5YASA 1QUEA 3D7NA 4YRJA 2C04A 2UVPA 2XX3A 1LF0A 4OL0A 5F2OA 1VLLA 5BVHB 2H18A 1USKA 2OP0A 5JNLA 1KFKB 1U7ZA 3KEMA 1H69A 2Q3LA 2VBFA 3SHQA 4I19A 3S4YA 5EP2A 4BMVA 3SJAA 4DLBA 5T5QA 5ILGA 4NK4A 2YOFA 3KEOA 1B0ZA 4PAMA 5FADA 4QX6A 4F7DA 3WIUA 1F5SA 2IPXA 4PZPA 4C4YA 4DYHA 4QVIA 1FCJA 5JZMA 3KEFA 1V16A 2JI9A 1QYDA 1U8EA 1Z08A 3ZDEA 5EZQA 4UMEA 3ZQJA 5AOAA 5GZ6A 3MRTA 1VA4A 4BV9A 1FW6A 3CB4A 2OHHA 4ZO6A 1HQCA 2Y0BA 3IEKA 3GFVA 3R9XB 1Q2UA 4UE2A 1M6YA 4BB5A 5CIQA 3CRQA 1NP6A 4AX8A 2C3OA 3H83A 3KJEA 3D6JA 3LUFA 1OX6A 3AH8A 4GDMA 5EVJA 4XE5A 2IUFA 1KVTA 2H8KA 1QE5A 2OY0A 2XMPA 1VG0B 5TRTA 1PT7A 2Q45A 3IBTA 2W2TA 2HJ9A 4OF4A 1DQRA 1D7AA 1KARA 3QW2A 4DA6A 5AW9A 4KIFA 1MA0A 4CF5A 2JHPA 4F6LA 4TV8A 5CCXA 2FOIA 4RVOA 3LFUA 1JQ3A 3CWQA 2NQTA 4LGYA 1IBCA 3IJPA 5DV9A 3GQBA 5GJCA 1RI4A 2GFQA 1N57A 2ZJ6A 3F9RA 5DWVA 3IV7A 4DR4B 4HY3A 5IUNC 4K1XA 2DECA 3ZGXA 3MNFA 4C3ZA 1VPEA 3L04A 2PWPA 1N5OX 1VCHA 2E4UA 3WS7A 3TTUA 1WWKA 1YUNA 2EFEB 3KBBA 4J0KA 5I48A 3FTQA 5HW0A 2B25A 5IJZA 2P6MA 2DFVA 3WIVA 1R66A 1XVIA 3QU7A 1JJVA 4R81A 3T3PB 2IPLA 3DD1A 1KOLA 4AF6A 1TNDA 2FEMA 5DISB 1SXHA 3STWA 2BUBA 2B3DA 2H0QA 4NQRA 2GQ0A 2JFBA 1FTQA 3W8FA 4AP9A 3P71T 1RP1A 1R6VA 2FZWA 4DYDA 3NIGB 5K8VA 1JN0A 1SHUX 3GXOA 4K86A 2QUBA 3JYOA 1VBFA 4ZT7A 3TF5A 1HFKA 1NR7A 4IMPA 1HDIA 3TLGB 4F1WA 1O08A 2D74A 3CH5A 1V8PA 5B30A 1C4KA 2NVUA 2OO5A 4FFRA 4TYMA 2PSHA 3P2IA 3S2YA 3WWPA 4NXNB 3V1KA 4A0SA 3FWKA 3ABSB 4ZI5A 3ZDXB 5CFNA 5AVYA 2XNSA 4OOEA 3KC2A 3SZGA 1NVDA 2DETA 121PA 2RGUA 4PM4A 1JDTA 2XF2A 3T5CA 5KYXA 3PEFA 1TMOA 4ECEA 1U3CA 5E7IA 2GK4A 4DV7B 5ESRA 5DBFA 4HDKB 3TB4A 1JQAA 3W2EA 1B23P 3LCJA 4DNFA 1F9AA 1Z4PX 2DQ4A 1WPXA 4MDFA 4KPGA 4HH3C 1BTOA 4MZDA 5J2UB 3DW1X 3KS9A 5B1EA 5AW2A 5B3JC 3EGEA 4OK6A 5CIYA 3RC1A 4OGKA 1N0HA 4HATA 3FZQA 3S0JA 5EWJA 1H2BA 1MX3A 5HP4A 3TW6A 2MINB 3K53A 3RU7A 1ZBDA 1OX4B 5JSQA 1EJ6A 1N2IA 2W0MA 3RASA 5I51A 3QVXA 4ZZ2A 3OU6A 2GHIA 3ZHSA 2R8OA 2C4WA 2V7VA 3PE6A 1C9EA 4K5QA 1P9RA 2F8SA 2H2FA 4KXUA 4E5MA 3HHPA 5L3SB 2JB9A 2ZUVA 3R41A 2IEZA 4N3BA 3RT1A 2WMDA 6REQA 4KLRA 1DRKA 1V5EA 5KWVA 1VJGA 3EXEB 3GYGA 2C98A 3FUUA 3NATA 5ULLA 3DL4A 1IHXA 3QRWA 1PVVA 4MR9B 3CE6A 5G4KA 1XMQB 2PGLA 1Z8DA 1KGDA 3SJCA 1WV1A 4Q16A 2GVNA 2WVGA 2DWUA 3DKRA 4RNCA 1E2NA 2OM6A 3PSAA 5JRJA 2GZHA 3KQKA 1XCGB 1CVIA 5IHXA 5K3OA 3TQTA 1DELA 2IYTA 2VQSA 3HCOA 3SBEA 3WADA 2E37A 5EJ5A 1DJLA 3QKWA 4TTAA 2ZJ1A 5A5DA 1ZVQA 3F7OA 1KZ1A 4YRRA 4BLWA 4OLBA 2Q4TA 3IOMA 3AO0B 4E4YA 3FOAA 3VGJA 1R16A 4ETMA 3MILA 1H4VB 1RFLA 3QA3E 1F51E 3VOSA 5I3CA 4FX5A 3J81A 4EUNA 2L42A 4QJIA 5JPIA 1Q17A 1POXA 5KYVA 2Q6OA 3FMOB 3AFGA 5BV0A 1NOKA 3MGCA 2APJA 3IMCA 3TOVA 1RAEA 1JX6A 2FJPA 2QNRA 4PAOA 3TRDA 2G83A 3KU4A 4AS1A 1XVAA 4PS1A 4FB4A 1GITA 1FP1D 2AG5A 2J0UA 4KXVA 2PVCA 5E0KB 1L5NA 2FPUA 3DH0A 4O0LA 3GLIA 4CTOA 4KR7A 2X2FA 5FAXA 2VR1A 3K6SA 4MIEA 1FNMA 3IT2A 3J7TA 2BSXA 2CLLB 3LKZA 2J9ZB 4YV7A 2O8CA 5DGIA 2PYDA 1X8KA 2BGKA 3WLPA 4WX2B 1MJGM 3DEHA 3B5JA 3UJBA 1MORA 3VQTA 5TQ0B 2HA5A 2HF9A 4B33A 2WAMA 1W0CA 4IZOA 2LD4A 2QL5A 4OQXA 2F3QA 3RYCB 4FC7A 3ZC3A 1NUAA 4E70A 3AVUA 2I7DA 3FNEA 2JI7A 2MSNA 4LPSA 2B20A 1L7MA 1NBWB 1NMZA 3O91A 4O02B 5KOJA 4Q1FA 3HCAA 3LUDA 2PRSA 2JJMA 4AYXA 2FPMA 2PD4A 3DBRB 4NYMR 4ZOLA 5FPKA 1KYZA 1W30A 2RGBA 3PQCA 2IHKA 4PLWA 3BHNA 1C7RA 3PUZA 1DJNA 1GVNB 4O4HA 4ZCQA 2O2ZA 2B4RO 1UUFA 2CVPA 3B3AA 3L7DA 4HWPA 4D96A 3AF6A 1MDFA 2J3MA 4X62B 2PTGA 4F71A 3VNQA 4F3TA 1K3FA 2ESRA 2GEBA 4KW7A 1G38A 3ZLJA 2ZIFA 2H1RA 3V97A 1EFPA 2YXDA 3D02A 2QT0A 4HVAA 4DPKA 1ZMTA 2EG9A 2XZPA 3AF5A 3S68A 1PUXA 3HYNA 4IGAA 2X1LA 4MS1A 5ICFA 1QOPB 1W88B 1JYEA 3HM9A 1QJCA 2KM1A 3GP3A 4HLNA 4IQFA 1OT3A 2NXEA 4WY5A 4GXTA 4DCMA 2Z5VA 3A14A 3M3HA 1RXEA 1FFDA 3NEJA 4BS9A 2Q1YA 1RW4A 1NMEA 1D2NA 1GGHA 2F7SA 2ACEA 2RGRA 1QMPA 4DF3A 3QH4A 1E2FA 4UHEA 3VPXA 2JJ2D 1IBKB 3UMGA 1P2UA 2I8CA 2VZLA 2ZDQA 4K3VA 1F8XA 1O0SA 3RHSA 5AIBA 1NF8A 4W5NA 2E2WA 3FUTA 3WGMA 2QAGB 2PA0A 2XUHA 3JZMA 4QAQA 4EFMA 1YDWA 4D25A 1CY7A 1USIA 4FGLA 3A9UA 2NNLD 1L1RA 1MEEA 4J0QA 2OYCA 2AG8A 3KYJB 5EMNA 5A71A 4ENQA 4YRBA 1U99A 1X7ZB 1TE2A 1Y8QB 2A9QA 3ZWXA 1XLWA 3FNRA 1W87A 2E18A 4CR7A 4Q9IA 2PSJA 5KC9A 1ZVJA 3KB1A 2WMNB 3OJEA 5DYGA 2YV1A 1Y6RA 4B45A 3JAMA 3MT9A 4QPJC 2HYIC 2EQ5A 1KRHA 2GILA 2BE9A 1CR6A 4ZVOA 2YJ4A 4F5ZA 5B7PA 2W2KA 3LO8A 1CZRA 3BGDA 2HAEA 3MC1A 4GPAA 4X91A 3I2HA 3H4VA 2RBGA 1KBOA 1VBNA 1FUKA 4INZA 3W2IA 3VZBA 4EG0A 5BN1A 2W5UA 2B8TA 3TLGA 1OH8A 3PFCA 1PF7E 2VDRB 5J2UF 1ND5A 3GA5A 1QHNA 4RV9A 2RI1A 3TPFA 2PR7A 3M6LA 1TJNA 4RPJA 4ATNA 5BVHA 5F3WB 3QXHA 2BR4A 4K1LA 4Z0HO 1YB4A 2V74B 1HF3A 3PQEA 4O4JA 3WBJA 4YPVA 3BH0A 2FSGA 3EGDB 3RKRA 4D9CA 2Z9BA 2W6IA 3Q2IA 1TF5A 1V35A 3KKNA 5LBIA 2IXBA 2ZYRA 3EIFA 1XRJA 3G6WA 4UM7A 3G85A 1UBTS 1XDWA 1Y9JA 3E7DA 4PGGA 5AOVA 3GAFA 3U19A 1N3LA 1SXJA 4X1KA 1T4CA 4EHBA 2CNNA 2Y6VA 5H3HA 3VSDA 4MA5A 2EG5A 5JOQA 1KC3A 2VT3A 1KEEB 5C8ZA 3ZXSA 2BTEA 3GG9A 5CX1B 1HOXA 2RH8A 2CXOA 4J4HA 3V3TA 4E51A 2VNSA 1OX4A 2LR0A 3ZKWB 5EL0A 1OXMA 2BH9A 2BRUC 4Y1RA 4OB8A 3MD0A 3V1TC 1VZ2A 1J0XO 1HE8B 3EN0A 4P0TA 3B5EA 1DTWA 2YN2A 1NFFA 2V96A 3KOUA 2ZIAA 4JLSA 3KVOA 3OEYA 3D43A 5MN5A 1G5IA 3EVCA 3QY0A 2B1IA 4BEJA 3G7UA 2DLNA 3P94A 4B7AA 1XQ1A 4RJ2A 1MG0A 2HJGA 4YBZA 1B16A 3GRVA 2QLLA 5AM0A 1ZP6A 4EG6A 1SD1A 1Y5NA 2HL6A 1XD8A 2J1LA 4M9ZA 4XR9A 4BCDA 4N18A 5K5EA 1O96B 4ZZ0A 1NUQA 4G8CA 4WCDA 1OBOA 4FNOA 2R1VB 1ZNYA 2H7CA 3BIOA 3JQCA 1QHSA 2A4MA 4KYVA 5JEDA 3HR7A 4UVHA 1FDOA 1HSZA 2ZRLA 4OHCA 3RS9A 1QC5A 5DNVA 4E1BA 2GN1A 4PLVA 4J0CA 3W5BA 4GOLD 3G5UA 3ECCA 2HIHA 1FTYA 4KSBA 2C1XA 2NOAA 3E3OA 1KP3A 2XWPA 4DG5A 4V0OA 4MS3B 4ACBA 4UM5A 5AJXA 3FY4A 3RWOA 1B8OA 2N1BA 5L45A 2GWHA 1OROA 4UUBA 4HUJA 3H0EA 5EZSA 5KCZA 2Q1XA 5T7BA 4H7KA 3ZX4A 4CG0A 4TRRA 1G6Q1 4RZXA 1GXSA 2QTMA 1DOZA 2AFIB 2C84A 5ESWA 3JZIA 5GPBA 1G64A 2EYUA 2Q6TA 3V46A 5E1DA 1BHSA 1TECE 3T9DA 5HXAA 2CVHA 5C46F 2MIIA 4LHWA 4J1NA 3E35