4UEMA

Uch-l5 in complex with the rpn13 deubad domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
309
structure length
281
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKRFNLMAIVSDRKMIYEQKIAELQRQLAESMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
total genus 86
structure length 281
sequence length 309
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uemA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uemA01
4JKJA 3TB3A 3A7SA 3IRTA 3RISA 1CMXA 3KW5A 3RIIA 4UEMA 4DM9A 1UCHA 2LENA 3IFWA 1XD3A 2ETLA 4I6NA 3IHRA 3KVFA 4UELA 4IG7A
chains in the Genus database with same CATH superfamily
3AEAA 1I94T 2H3RA 5LMNT 3UFGA 4P0AA 5L3GB 3RIAA 2C5JA 1SUMB 2LENA 4JI8T 5L3DB 1IBLT 3H3MA 3K1SA 3QB5K 2C0SA 1T98A 3A7MA 3PV0F 4G2AA 4X65T 1KFYA 4ILUA 4EGWA 4HFDA 2EHOC 4OHFA 2JQ9A 2PG8A 1KNPA 3AA6B 1JNRA 4TN7B 2M6IA 3CX8B 5LBQB 4YXDA 1ZOYA 2BKPA 4I4TE 5LYJE 4DR3T 2LLYA 1KNRA 1QSDA 3LK3B 3CX7B 2J4GA 3AE9A 2IIUA 4HFHA 4PW8A 2SPCA 2XQ8A 5IHYA 4EIWA 3F57A 2VKJA 4FI5A 4DR7T 2DHRA 3C4ZA 5BMVE 1N32T 4PJNA 5AQUB 1O3XA 3LSVA 3ZYKA 1OXZA 2M67A 5JR9A 5LGUB 2CCQA 1HCIA 3P50A 3PUSA 3LK2B 4GYSA 4YT0A 3ETVA 3RYCE 5LGNB 1T8BA 1N33T 3SWHA 3TLVA 3MXZA 5KX5E 2D9DA 2XM1A 3DTOA 4OFZA 1FJGT 3AE4A 2VL0A 1YQ4A 4LF4T 2Q9QD 2PFVA 4X1KE 4C90A 4B3TT 2WAUA 2ETLA 3KVFA 4DM9A 3ZSTA 4IG7A 4HE8A 3HR0A 4COFA 5HCJA 2E9XD 3CPZA 5JTGA 2IUBA 4B6XA 4ZI2C 2NTXA 3QOFA 3EDUA 4AQYT 4IHJE 2DL1A 2FUPA 2WDVA 2LJLA 4IDOA 4AQFC 5HEUA 5EK2A 2L9QA 2LT3A 3LFMA 1YXRA 2D2SA 3NWIA 3PUZF 1OWAA 2CEAA 4NUUA 4V1Av 5EZYE 2VWAA 5FXZA 1X79A 5KMGP 2XTLA 2V7MA 5LHGB 1BR2A 2XUEA 3PU3A 1CUNA 2J62A 2MYSA 4U7IA 4U2ZA 4ERRA 2WQYA 2I0MA 2VASA 4DUZT 5ETWA 1UURA 2X9HA 4IE5A 3PUVF 2R6GF 3QC9A 3ONLC 4ILBA 4WBNE 1IJ6A 4I0UA 4GOUA 1YD8G 3AEFA 4EEBA 2VQFT 1SA0E 4FJOA 2Y6XA 3OJAA 2E9XB 5ABFB 5AQGB 3FZHB 2DWKA 5AQPB 4IREA 2XSAA 3ESLA 2BBJA 3JCFA 3PJAJ 5FVKA 5LA6E 3UTKA 2VVNA 2Q9QB 2KNDA 3O1JA 3V5UA 4E7SA 3N2OA 3J7Yq 2UUAT 4P0BA 3ZEFB 3FBLA 4IDZA 3IF8B 3HKBE 4PJJA 3QNUA 3RQUA 2C5IT 3BK9A 3MK7C 3FZKB 4QX8B 4A97A 5AQJB 2CBIA 5L3EB 4I43B 3IBPA 4ANJA 3IFWA 3CQCB 4JI6T 2XAQB 4B3MT 2Q9QC 2BG9B 3SFEA 2CPTA 1JNZA 1GQEA 3IA3A 2NW7A 3N9NA 2CE7A 3KBTA 5FKYA 2WZIA 5FVLA 5HEHA 3ZLIA 4I6NA 2XM2A 4JI7T 4JI0T 4JKJA 3B5MA 3S4UA 1SHZC 4PJMA 4CI2B 4IDPA 2IW5B 4AKIA 2UXNB 1KF6A 4X1IE 4QHOA 1D0YA 4JUYA 2DCFA 5HEJA 3AEGA 3HL6A 4ZI3D 3FHNA 3M65A 4ZI2D 2OV9A 3A7SA 2CWOA 4WNKA 2ODVA 2I6HA 4ISTA 4UEMA 3GA8A 2B1EA 5LP6E 3ZJ1A 4YSZA 3RGLA 2YEVC 1MMAA 4AKLA 4DMVA 5L3FB 3UQ7A 1HNXT 5JDHA 2UU9T 2EHOD 3KINB 2YU1A 1N36T 1IBMT 3JAFA 4AKRB 1W0BA 4LMKA 4Z8XA 1G73A 4CXXA 4YY3T 1XMQT 1XD3A 3J9X1 2HHHT 2B76A 4CN6A 3A8YC 3ONXA 5JRCA 2V6YB 1HTJF 4LF8T 3ZMZB 4YTNA 5J2UE 4JI1T 1NEKA 2EHOA 2LKHA 4O4IE 2DWGA 2E8IA 2IMLA 3RC3A 4DR5T 2NW8A 4H9NC 3W15B 4IE4A 3RIUA 4YTPA 2WY2A 2JRKA 1FIOA 2BDEA 3A5XA 4A5XA 2CXFA 1ZEEA 3ZMTB 3IRTA 1N34T 3L8RA 3MKDA 1XNRT 2YDSA 4DV5T 1KNZA 2A72A 2XQAA 2VB6A 1YQ3A 4CXWA 1M7KA 3FZMB 3RIIA 2PBIA 5CGMA 2CRBA 3ZPOA 4MBQA 3RKOA 3IEEA 2CLYC 3JC6C 3I9WA 1WYCA 3LJCA 3PU8A 4QH4A 4U7YA 5FYMA 3AE8A 3NVOA 5JDQA 2X0YA 2WU5A 5C3JA 4JEUB 1L0VA 3R84B 4EOZB 4B3ST 4CN1A 2W4XA 2ZM6T 5J1GA 1UX4A 2X68A 2XQ5A 5FY7A 4CZZB 2LEHA 2WWUA 3UU4A 3ZKRA 2V5CA 3JC6D 3EABA 2VKDA 3EI0A 2W2UA 4UF0A 4NPPA 3AEBA 3RH3A 2J47A 1MIWA 4J2CA 3N9QA 5F5WA 4EZ4A 2A2FX 4E7ZA 1YKHB 4O4JE 2Y48B 2N2NA 4TNWA 5L4EA 5LGTB 4XBFB 2WU2A 2VURA 4TNVA 2JMHA 3UU6A 1NAFA 5JR9C 2LSIA 3AAIA 3C98B 4HWFA 5L3BB 5AQFB 2XAFB 5L2LA 3C64A 4LFCT 1HNWT 2DLRA 3PDYA 3AXJA 3BQIA 4M1PA 2YDRA 2UXXB 4MFRA 1ZP0A 3N2KE 5E0OA 5AQHB 4ZI3C 2V6YA 2HN1A 3N5LA 3PUWF 2E9XC 2UXDT 2KSRA 5HXRA 4TUYE 2WZHA 3ZMVB 5JR9B 3K3NA 3VKHA 1VRBA 4AIUA 2RA1A 3KDSE 5A1LA 3E0ZA 3KW5A 1HG2A 4I55E 4DR6T 4AI6A 1XDOA 3N9LA 1HR0T 4N78D 3RYHE 1MIYA 2BVMA 4AXPA 1CHUA 1YKEB 4DV2T 3P4PA 4EZHA 1J5ET 4JI5T 3ZJ2A 2UUCT 4O2BE 2XAGB 3F2EA 5H6QB 5FXWA 4U31A 2XQ7A 4DV0T 2JMKA 1XDPA 2BG9C 4MALA 2UXCT 4ASKA 5HXCA 3MJXA 4L5GA 3T1YT 1U4QA 1D1AA 2K3WA 2KT9A 4HGAA 3KVBA 1W09A 3L09A 2GK9A 3ZC0A 3TB3A 4X1YE 2NOXA 2LHNA 3RKGA 5LNKA 3PUAA 4QXCB 4IGUA 3UU8A 3ZCJA 2V1DB 1HFAA 1KEYA 3N9MA 4QH5A 2G0UA 1LVKA 1WFDA 2X9YA 1UCUA 1IAPA 2WP9A 5AQKB 3LBXA 5ADXL 4YHHT 1HX8A 2LRLA 3L3PA 3I1AA 1MMDA 4TWFA 4UVAB 1BR1A 2IC6A 2HH7A 2E2AA 2K48A 3C51A 3ETUA 3H37A 3HKCE 4HFIA 2V6XA 3AA1B 4Q25A 4LF5T 4B3RT 2UXBT 2NWBA 4WYVA 1UK5A 2PJQA 5C2TA 3NZQA 4AKHA 3TLWA 4ZOLE 4YFSA 2KWHA 3Q5WA 1XMOT 1NWMX 1E2AA 4AQGA 2V7IA 3P7IA 1LVFA 4IE6A 3SS1A 3X1DA 4ZEYA 2X9WA 1HF8A 4DIDB 3EAMA 2CXLA 3T1HT 4ADZA 3OBVE 1VCSA 5AFUL 4X64T 4JI4T 1MIVA 2XQYA 2CM0A 5M4YA 5FXXA 3PTRB 5DQVA 4IDNA 1J5WA 2D0TA 2X9XA 2XSBA 2WDQA 2XY8B 4GK0E 1UUSA 2W00A 4H63H 5GONE 4OYJA 3UT5E 5HXHA 5JDGA 4X66T 3GMIA 2LHRA 4DV3T 2IC9A 5HCMA 3NRYA 3CQXC 4IE0A 5LB7B 4F8HA 2K5BB 1SE7A 3KFWX 4P1NA 5J2TE 4GKKT 2BS2A 3CWZB 2VQET 2JQQA 2PTFA 3K3QC 4EAHA 2FJDA 3AAAB 4TX5A 2W61A 4HWHA 4LMLA 4GYRA 4XZCA 2X0LB 4CI3B 2CMRA 5JQGE 2X0HA 2J1DG 2V7JA 3EUHA 4TV8E 3RQWA 4L9IA 5LMUT 1Z8UA 3G06A 3P4WA 3QB5A 2IHR1 2JJ9A 3AE2A 1T72A 4HFEA 3RHWA 4CQIA 4DV4T 1ZKEA 3GN5A 4O8SA 4DMWA 3RIUC 4OX9T 2AE9A 3N9PA 5AQOB 3UUMA 4LF7T 3UU3A 3Q9DA 3V5SA 3N9OA 5FL1A 3CIRA 5HWYA 4DV1T 2F4VT 3UULA 4DR1T 4ZZBA 3PUGA 1S35A 2C5KT 3PE0A 4YLHA 2FJBA 4ZHQE 5LJMA 2A9UA 3PUXF 1B7TA 1R8IA 2JQKA 3FZLB 5FL0A 3UU5A 5CJ5A 1S94A 4H9PC 4HKAA 3CVRA 2LKGA 3VR8A 1E7PA 3HKDE 4PK5A 3VHLA 5EK3A 3PUYF 3ZYLA 3IHRA 5L3CB 3AE1A 3SRZA 3TLSA 5ABEA 3KVAA 2VVSA 1IJ5A 3AAEB 4JV5T 2ODUA 3ZT5A 2VK9A 4IT4A 2FBWA 1WRDA 3OVUA 2WM9A 4JBWF 5AQRB 3DP7A 3PURA 2YU2A 4H9SE 4HFVA 2BKOA 3FXEB 2V26A 4UVBB 5HEOA 2BS4A 4PFPA 4CN4A 3LG7A 1XNQT 1LRZA 4DR2T 5AQTB 1Y64B 1M62A 2E5VA 2HN2A 2W62A 4IIJE 4PK6A 3HA4A 5H6RB 4EYUA 3F31A 3P8CD 2E5LT 3GN5B 2LSYA 3AVRA 3RPUA 3U3IA 1IZNB 4H9RC 2QYWA 1QLBA 4KBMB 2YN6A 3UUNA 1BR0A 3Q5XA 4LMJA 3TKLB 5ABFA 3ZT7A 4KX6A 5LHHB 2WMOA 5JDLA 4NXNT 3AB3B 3BQKA 3WAJA 5AQVB 2ZM2A 3O1IA 3OYXA 4ISSA 4UV9B 5HAXA 4LF6T 2L3LA 3E22E 3KBUA 4DBRA 3E08A 2FJEA 2KZ7B 2P9BA 4DBQA 2BBHA 3P4SA 5AQQB 2NP9A 2BZBA 1E1HB 2XASB 4HTEA 4ILCA 3TLUA 2CA5A 2LSKA 3AEDA 4QH1A 3RIFA 4JLEA 4MHCA 5CB4E 4CXYA 2RP4A 5CFBA 2L8KA 4BJNA 3KV9A 2CHOA 1KK7A 2V7KA 3UUBA 4UXNB 2DI4A 1MNEA 3FXDB 5FMNA 2BG9A 1HNZT 5HWXA 2WSSV 5AQLB 1ZV4X 4JI2T 2ACZA 2ES0A 3NBXX 1WR6A 5HYAA 3K8PC 3M3ZB 3VRBA 1OEDB 3UFEA 4UR9A 3CX6B 2NTYA 3AEEA 1D0ZA 1UX5A 4UV8B 4PK4A 4H63V 4IL4A 4X5TA 4YHJA 4AQFA 4HWIB 5LHIB 2QRXA 3DJBA 4KI0F 2HPJA 2MOZA 3CMLA 4IE7A 3EVYA 1T7SA 3JADA 4WZXA 3KV4A 4G63A 3MZKB 1IBKT 4HN9A 1HS7A 5AQSB 1WR0A 2CBJA 5JDFA 2LOPA 1DU2A 3N2GE 3AXJB 2V7LA 3UUXB 2BG9E 3L39A 5DQWA 1UGOA 1OEDC 4ZS3A 1QUUA 4JEHB 3ZN1B 3ZYMA 5FY1A 4TWDA 1Z0PA 3C4XA 3OPCA 2JPFA 4U72A 5JDNA 3NRXA 4TZ4C 2XPKA 4NUVA 4BAYB 1ZHCA 3TLTA 4AISA 4OYKA 2JQHA 2KWIB 3MACA 4HWDA 2KXPB 3C4WA 4L0RA 2OLTA 1VOMA 3CKDA 3U78A 2H7OA 3QK6A 4QWNB 1CMXA 3CK6A 4NIQA 3FBZA 3SFDA 4Z90A 2XJ7A 1FEWA 3ANWB 4U3CA 3Q5DA 5TAOA 4KP3C 3AE3A 4LFAT 2LM2A 3GWHA 3AE7A 3LK42 2V8SV 4O4HE 4EXTA 5ABHA 2W0GA 2VKOA 2X51A 3RYFE 1OEDA 4DUYT 2IDOB 4HFCA 1VCTA 4KUMB 3VRAA 2YKSA 4EEDA 1I6ZA 5FY0A 4GK5E 5AQMB 3FZFB 2WBLA 1WYBA 2H7VC 3AE6A 4UELA 5IWAT 4JI3T 4HEAA 4I50E 5LXTE 2K9AA 2QGSA 1H7CA 4UIGA 2W63A 4UF0B 4C91A 3B13A 2H88A 5L4HA 4IL9A 2KINB 3ONJA 4PNIA 4WW0A 5F8PA 3T8OA 5KXJA 4NXMT 3BQLA 2E9XA 1XWMA 5JREA 4JYAT 4BA9A 3VKGA 1MMGA 1Y01A 2ZM0A 2LRKA 2WCAA 3HI2A 3ZMUB 4HWCA 4KHPT 4EYYR 2X66A 3LDQB 2XQ9A 3C50A 1FMVA 2YOEA 2D0UA 4KHZF 5C8YE 2CLYB 4KMCA 2UUBT 2FJAA 3I0OA 5DABA 4AKGA 1V9DA 5DJQC 5LCYA 2XQ4A 3MA9A 2YK0A 4QXHB 5JDMA 3Q5EA 2YINA 4X20E 2BVLA 5FP3A 4BJMA 1FMWA 5LJNA 4WBOA 2IAKA 4PAGA 4U2YA 4UVCB 5CA0E 4YTMA 4K0KT 5JRCB 5AQNB 5EK4A 1W0AA 3VU7H 1YW0A 4U74A 5JVDE 3H3AA 5L47A 4X62T 4PJLA 3RI5A 4IDQA 2H89A 5FNVE 2MBGA 4DR4T 2LE8A 5FXVA 4DNDA 3ANWA 5IYZE 1UCHA 2NW9A 2Z6EA 2OA5A 4DV6T 3NZPA 4ZI7E 3FB2A 3OYZA 3O9XA 3K3OA 4XAXB 3VR9A 3O4XE 1WLXA 4HFBA 3AA7B 3RYIE 5IUXA 2QA7A 3ABVA 3KV5A 2RPAA 4K0UA 4QX7B 3RRCA 1MNDA 2MTQA 3UQ4A 5LOVE 5HXEA 3SOLA 2ZMAA 3AE5A 3AVSA 2V5DA 3I9YA 5HEGA 5J0ZA 3PUQA 5ABGA 3P4QA 2M6BA 2MAWA 5KDMC 4GIWA 2Y8DA 4EB6E 4O2AE 5HXSA 2XHEB 2WS3A 5JH7E 1G8XA 1W9RA 1HX1B 2MPKA 2XQ6A 2KMFA 3R6NA 3AECA 1LKXA 4ILAA 2WDRA 1D1BA 2JIWA 1AJ3A 3AA0B 1D0XA 3WI3A 3LBXB 3RLFF 4A98A 2YDQA 2VKHA 4QXBB 5LG4A 4LF9T 2N9DA 1WCRA 2A3DA 2LSGA 3NKZA 3CQGB 4QKNA 2LOSA 4CI1B 3PJAA 4ZXLA 1EZ3A 4ZS2A 2XZEA 4DO0A 2XAJB 4Z91A 2D5UA 2ZM8A 3P4RA 1US7B 3RC8A 1X9BA 2ACXA 3RX6A 1D1CA 2I59A 2W66A 4TV9E 4DVDA 4YSXA 5CA1E 2DNXA 2HPLA 1MMNA 2X67A 3OKQA 3ZSSA 2N1GA 3B57A 3Q2MA 4O4LE 3WAKA 2XQ3A 3JAEA 4H9OC 2XAHB 3I0QA 2LSJA 3OTOT 4P09A 3RF1A 3HKEE 2W67A 4MLKA 3RRWA 1J1JA 3ZT6A 3D0TA 4PFOA 4DV7T 3ZMSB 2K24A 2WB5A 1BR4A 4F6RC 4YSYA 2WMNA 3QUJA 2VL8A 3RISA 2CXDA 2LM9A 3KV6A 4A56A 4EV6A 1HG5A 2AXDS 2NR4A 4ZZCA 2CWYA 5BR8T 4YJ3E 1U5PA 4YJ2E 3ZC1A 5LG3A 3EDVA 1XZYA 2WWVA 2BKNA 3ZN0B 5AQIB 4LFBT 4TWHA 5LBMA 3EHZA 2KLQA 3ZCIA 4GKJT 1OEDE 2QVAA 2EHOB 5F3JA 2ZLYA 3O1HA 4OK0A 1NENA 2BS3A 4U33A 2Q9QA 4H9QC 2CHNA
chains in the Genus database with same CATH topology
2H3RA 4P0AA 5L3GB 2C5JA 2LENA 5L3DB 5JRCB 2C0SA 1T98A 4G2AA 4ILUA 2EHOC 4OHFA 2PG8A 3AA6B 4TN7B 3CX8B 5LBQB 4I4TE 5LYJE 1QSDA 3LK3B 5JDFA 3CX7B 4PW8A 4EIWA 2SPCA 5IHYA 3F57A 2VKJA 4FI5A 2DHRA 3C4ZA 5BMVE 4PJNA 1O3XA 3ZYKA 1OXZA 2M67A 5JR9A 5LGUB 2CCQA 1HCIA 3PUSA 3LK2B 4GYSA 3ETVA 3RYCE 5LGNB 3SWHA 3MXZA 5KX5E 3DTOA 4OFZA 2Q9QD 2PFVA 4X1KE 4C90A 2WAUA 2ETLA 3KVFA 4IG7A 4HE8A 3HR0A 2E9XD 3CPZA 4B6XA 4ZI2C 2NTXA 3EDUA 4IHJE 2LJLA 4AQFC 5EK2A 2L9QA 2LT3A 3LFMA 2D2SA 4NUUA 1OWAA 2CEAA 5FXZA 4V1Av 5EZYE 2VWAA 1X79A 5KMGP 2XTLA 2V7MA 5LHGB 1BR2A 2XUEA 3PU3A 1CUNA 2MYSA 4ERRA 2VASA 5ETWA 2X9HA 4IE5A 3QC9A 4WBNE 1IJ6A 4GOUA 1YD8G 1SA0E 4FJOA 2Y6XA 3OJAA 2E9XB 2DWKA 3UTKA 3ESLA 5LA6E 2Q9QB 2KNDA 3O1JA 3V5UA 4E7SA 3N2OA 3J7Yq 4P0BA 3ZEFB 3FBLA 4IDZA 3IF8B 3HKBE 4PJJA 2C5IT 3BK9A 3MK7C 5L3EB 4I43B 3IBPA 4ANJA 3IFWA 3CQCB 2XAQB 2Q9QC 3N9NA 3ZYMA 2NW7A 2CE7A 3KBTA 3ZLIA 4JKJA 3S4UA 1SHZC 4PJMA 4CI2B 2IW5B 4AKIA 2UXNB 4X1IE 4QHOA 1D0YA 4JUYA 2DCFA 4ZI3D 3HL6A 3FHNA 3M65A 4ZI2D 3A7SA 2CWOA 4WNKA 2ODVA 4ISTA 4UEMA 3GA8A 2B1EA 5LP6E 3ZJ1A 2YEVC 1MMAA 4AKLA 4DMVA 5L3FB 5JDHA 2EHOD 3KINB 2YU1A 4CXXA 4AKRB 4Z8XA 1G73A 1XD3A 3J9X1 3ONXA 5J2UE 1HTJF 3ZMZB 2EHOA 4O4IE 2DWGA 2E8IA 3RC3A 2NW8A 4H9NC 3W15B 4IE4A 2JRKA 1FIOA 2BDEA 3A5XA 2CXFA 1ZEEA 3ZMTB 3IRTA 3MKDA 1KNZA 2A72A 4CXWA 2VB6A 3RIIA 2PBIA 3ZPOA 4MBQA 3RKOA 3IEEA 2CLYC 3JC6C 3I9WA 1WYCA 3LJCA 3PU8A 5FYMA 5JDQA 4JEUB 3R84B 4EOZB 5J1GA 1UX4A 2X68A 4CZZB 5FY7A 2LEHA 2WWUA 3JC6D 2VKDA 4UF0A 3RH3A 4EZ4A 4E7ZA 1MIWA 4J2CA 3N9QA 2A2FX 4XBFB 1YKHB 4O4JE 2Y48B 2N2NA 5LGTB 2JMHA 1NAFA 5JR9C 2LSIA 3AAIA 3C98B 5L3BB 5L2LA 2XAFB 3C64A 2DLRA 3PDYA 3BQIA 4M1PA 2UXXB 4MFRA 3N2KE 5E0OA 4ZI3C 3N5LA 2E9XC 5HXRA 4TUYE 3ZMVB 5JR9B 3K3NA 1VRBA 2RA1A 3KDSE 5A1LA 3E0ZA 3KW5A 1HG2A 4I55E 4AI6A 3N9LA 4N78D 3RYHE 1MIYA 2BVMA 4AXPA 1YKEB 4EZHA 3ZJ2A 4O2BE 2XAGB 3F2EA 5H6QB 5FXWA 2JMKA 4MALA 4ASKA 5HXCA 3MJXA 4L5GA 1U4QA 1D1AA 2KT9A 4HGAA 3TB3A 3KVBA 3L09A 2GK9A 3ZC0A 4X1YE 2NOXA 2LHNA 5LNKA 3PUAA 4QXCB 4IGUA 3ZCJA 2V1DB 1HFAA 3N9MA 2G0UA 1LVKA 2X9YA 1UCUA 1IAPA 5ADXL 3LBXA 1HX8A 3L3PA 3I1AA 1MMDA 4UVAB 1BR1A 2IC6A 2HH7A 2K48A 3ETUA 3C51A 3H37A 4QX8B 3HKCE 3AA1B 2NWBA 4AKHA 2PJQA 3VKHA 3NZQA 3VKGA 4ZOLE 4YFSA 2KWHA 3Q5WA 1NWMX 4AQGA 2V7IA 3P7IA 1LVFA 4IE6A 3SS1A 2X9WA 1HF8A 2CXLA 4ADZA 3OBVE 5AFUL 1MIVA 2XQYA 2CM0A 5M4YA 5FXXA 3PTRB 5DQVA 3ZC1A 2D0TA 2X9XA 4GK0E 4H63H 5GONE 5JDGA 2W00A 4OYJA 3UT5E 5HXHA 3GMIA 2LHRA 2IC9A 3NRYA 3CQXC 4IE0A 2K5BB 3KFWX 5J2TE 3CWZB 2JQQA 3K3QC 4EAHA 3AAAB 4TX5A 2W61A 4GYRA 4XZCA 2X0LB 4CI3B 2CMRA 5JQGE 2J1DG 2V7JA 3EUHA 4TV8E 4L9IA 4DM9A 4CQIA 2JJ9A 1ZKEA 3GN5A 4O8SA 4DMWA 3N9PA 3UUMA 3Q9DA 3V5SA 3N9OA 5HWYA 3UULA 3PUGA 1S35A 2C5KT 3PE0A 4YLHA 4ZHQE 5LJMA 1B7TA 1S94A 4H9PC 4HKAA 3CVRA 3HKDE 4PK5A 3VHLA 5EK3A 5L3CB 3ZYLA 3IHRA 3SRZA 3KVAA 1IJ5A 3AAEB 2ODUA 2VK9A 1WRDA 2WM9A 3DP7A 3PURA 2YU2A 4H9SE 4HFVA 3FXEB 2V26A 4UVBB 4PFPA 3LG7A 1LRZA 1Y64B 2W62A 4PK6A 4IIJE 3HA4A 5H6RB 4EYUA 3F31A 3P8CD 3GN5B 2LSYA 3AVRA 3RPUA 3U3IA 1IZNB 4H9RC 4KBMB 3UUNA 1BR0A 3Q5XA 3TKLB 5LHHB 2WMOA 5JDLA 3AB3B 3BQKA 3WAJA 2ZM2A 3O1IA 3OYXA 4ISSA 4UV9B 5HAXA 2L3LA 3E22E 3KBUA 4DBRA 3E08A 2P9BA 2KZ7B 4DBQA 2NP9A 2BZBA 1E1HB 2XASB 4HTEA 2CA5A 2LSKA 4JLEA 4MHCA 5CB4E 4CXYA 2RP4A 2L8KA 4BJNA 3KV9A 1KK7A 2V7KA 4UXNB 2DI4A 1MNEA 3FXDB 5FMNA 5HWXA 2WSSV 1ZV4X 3NBXX 2ES0A 5HYAA 1WR6A 3K8PC 3UFEA 3CX6B 2NTYA 1D0ZA 1UX5A 4UV8B 4PK4A 4H63V 4YHJA 4AQFA 5LHIB 3DJBA 2HPJA 2MOZA 3CMLA 4IE7A 3EVYA 1HS7A 3KV4A 4G63A 3MZKB 4HN9A 2LOPA 3N2GE 2V7LA 3UUXB 5DQWA 4ZS3A 1QUUA 4JEHB 3ZN1B 5FY1A 1Z0PA 3C4XA 4U72A 2JPFA 5JDNA 3NRXA 4TZ4C 4NUVA 4BAYB 1ZHCA 4OYKA 2KWIB 3MACA 2KXPB 3C4WA 4L0RA 1VOMA 3CKDA 3U78A 2H7OA 3QK6A 4QWNB 1CMXA 3FBZA 1FEWA 3ANWB 5TAOA 4KP3C 3GWHA 3LK42 4EXTA 4O4HE 2W0GA 2VKOA 2X51A 3RYFE 4KUMB 5FY0A 4GK5E 2WBLA 1WYBA 2H7VC 4UELA 4HEAA 4I50E 5LXTE 2K9AA 2QGSA 1H7CA 4UIGA 2W63A 4UF0B 4C91A 3B13A 2KINB 4PNIA 4WW0A 5F8PA 3T8OA 4I6NA 3BQLA 2E9XA 5JREA 4BA9A 1MMGA 2ZM0A 3ZMUB 3HI2A 4EYYR 2X66A 3C50A 1FMVA 2D0UA 4AKGA 5C8YE 2CLYB 4KMCA 3I0OA 5DABA 1V9DA 5DJQC 5LCYA 4QXHB 3MA9A 2YK0A 5JDMA 2YINA 4X20E 2BVLA 5FP3A 4BJMA 1FMWA 5LJNA 4WBOA 2IAKA 4PAGA 5CA0E 4UVCB 5EK4A 3VU7H 1YW0A 4U74A 5JVDE 3H3AA 4PJLA 5FNVE 2MBGA 2LE8A 5FXVA 4DNDA 3ANWA 5IYZE 1UCHA 2NW9A 2Z6EA 2OA5A 3NZPA 4ZI7E 3FB2A 3OYZA 3O9XA 3K3OA 4XAXB 3O4XE 1WLXA 3RYIE 3AA7B 2QA7A 3KV5A 4QX7B 4K0UA 3RRCA 1MNDA 2MTQA 5LOVE 5HXEA 3SOLA 2ZMAA 3I9YA 3AVSA 3PUQA 5KDMC 4GIWA 2Y8DA 4EB6E 4O2AE 5HXSA 2XHEB 5JH7E 1G8XA 2KMFA 3R6NA 1LKXA 1D1BA 1AJ3A 3AA0B 1D0XA 3WI3A 3LBXB 2VKHA 4QXBB 5LG4A 2N9DA 2A3DA 2LSGA 3CQGB 4QKNA 2LOSA 4CI1B 1EZ3A 4ZS2A 4DO0A 2XAJB 2D5UA 2ZM8A 1US7B 3RC8A 2ACXA 3RX6A 1D1CA 2I59A 4DVDA 4TV9E 5CA1E 2DNXA 2HPLA 1MMNA 2X67A 3OKQA 2N1GA 3B57A 3Q2MA 4O4LE 3WAKA 4H9OC 2XAHB 3I0QA 2LSJA 4P09A 3HKEE 4MLKA 3RRWA 3D0TA 4PFOA 3ZMSB 2K24A 4F6RC 1BR4A 2WMNA 3QUJA 2VL8A 3RISA 2CXDA 2LM9A 3KV6A 4A56A 5JRCA 1HG5A 2CWYA 4YJ3E 1U5PA 4YJ2E 3EDVA 3ZN0B 5LBMA 2KLQA 3ZCIA 2EHOB 5F3JA 2ZLYA 3O1HA 4OK0A 2Q9QA 4H9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKJ A;  3TB3 A;  3A7S A;  3IRT A;  3RIS A;  1CMX A;  3KW5 A;  3RII A;  4UEM A;  4DM9 A;  1UCH A;  2LEN A;  3IFW A;  1XD3 A;  2ETL A;  4I6N A;  3IHR A;  3KVF A;  4UEL A;  4IG7 A; 
#chains in the Genus database with same CATH topology
 3AEA A;  1I94 T;  2H3R A;  5LMN T;  3UFG A;  4P0A A;  5L3G B;  3RIA A;  2C5J A;  1SUM B;  2LEN A;  4JI8 T;  5L3D B;  1IBL T;  3H3M A;  3K1S A;  3QB5 K;  2C0S A;  1T98 A;  3A7M A;  3PV0 F;  4G2A A;  4X65 T;  1KFY A;  4ILU A;  4EGW A;  4HFD A;  2EHO C;  4OHF A;  2JQ9 A;  2PG8 A;  1KNP A;  3AA6 B;  1JNR A;  4TN7 B;  2M6I A;  3CX8 B;  5LBQ B;  4YXD A;  1ZOY A;  2BKP A;  4I4T E;  5LYJ E;  4DR3 T;  2LLY A;  1KNR A;  1QSD A;  3LK3 B;  3CX7 B;  2J4G A;  3AE9 A;  2IIU A;  4HFH A;  4PW8 A;  2SPC A;  2XQ8 A;  5IHY A;  4EIW A;  3F57 A;  2VKJ A;  4FI5 A;  4DR7 T;  2DHR A;  3C4Z A;  5BMV E;  1N32 T;  4PJN A;  5AQU B;  1O3X A;  3LSV A;  3ZYK A;  1OXZ A;  2M67 A;  5JR9 A;  5LGU B;  2CCQ A;  1HCI A;  3P50 A;  3PUS A;  3LK2 B;  4GYS A;  4YT0 A;  3ETV A;  3RYC E;  5LGN B;  1T8B A;  1N33 T;  3SWH A;  3TLV A;  3MXZ A;  5KX5 E;  2D9D A;  2XM1 A;  3DTO A;  4OFZ A;  1FJG T;  3AE4 A;  2VL0 A;  1YQ4 A;  4LF4 T;  2Q9Q D;  2PFV A;  4X1K E;  4C90 A;  4B3T T;  2WAU A;  2ETL A;  3KVF A;  4DM9 A;  3ZST A;  4IG7 A;  4HE8 A;  3HR0 A;  4COF A;  5HCJ A;  2E9X D;  3CPZ A;  5JTG A;  2IUB A;  4B6X A;  4ZI2 C;  2NTX A;  3QOF A;  3EDU A;  4AQY T;  4IHJ E;  2DL1 A;  2FUP A;  2WDV A;  2LJL A;  4IDO A;  4AQF C;  5HEU A;  5EK2 A;  2L9Q A;  2LT3 A;  3LFM A;  1YXR A;  2D2S A;  3NWI A;  3PUZ F;  1OWA A;  2CEA A;  4NUU A;  4V1A v;  5EZY E;  2VWA A;  5FXZ A;  1X79 A;  5KMG P;  2XTL A;  2V7M A;  5LHG B;  1BR2 A;  2XUE A;  3PU3 A;  1CUN A;  2J62 A;  2MYS A;  4U7I A;  4U2Z A;  4ERR A;  2WQY A;  2I0M A;  2VAS A;  4DUZ T;  5ETW A;  1UUR A;  2X9H A;  4IE5 A;  3PUV F;  2R6G F;  3QC9 A;  3ONL C;  4ILB A;  4WBN E;  1IJ6 A;  4I0U A;  4GOU A;  1YD8 G;  3AEF A;  4EEB A;  2VQF T;  1SA0 E;  4FJO A;  2Y6X A;  3OJA A;  2E9X B;  5ABF B;  5AQG B;  3FZH B;  2DWK A;  5AQP B;  4IRE A;  2XSA A;  3ESL A;  2BBJ A;  3JCF A;  3PJA J;  5FVK A;  5LA6 E;  3UTK A;  2VVN A;  2Q9Q B;  2KND A;  3O1J A;  3V5U A;  4E7S A;  3N2O A;  3J7Y q;  2UUA T;  4P0B A;  3ZEF B;  3FBL A;  4IDZ A;  3IF8 B;  3HKB E;  4PJJ A;  3QNU A;  3RQU A;  2C5I T;  3BK9 A;  3MK7 C;  3FZK B;  4QX8 B;  4A97 A;  5AQJ B;  2CBI A;  5L3E B;  4I43 B;  3IBP A;  4ANJ A;  3IFW A;  3CQC B;  4JI6 T;  2XAQ B;  4B3M T;  2Q9Q C;  2BG9 B;  3SFE A;  2CPT A;  1JNZ A;  1GQE A;  3IA3 A;  2NW7 A;  3N9N A;  2CE7 A;  3KBT A;  5FKY A;  2WZI A;  5FVL A;  5HEH A;  3ZLI A;  4I6N A;  2XM2 A;  4JI7 T;  4JI0 T;  4JKJ A;  3B5M A;  3S4U A;  1SHZ C;  4PJM A;  4CI2 B;  4IDP A;  2IW5 B;  4AKI A;  2UXN B;  1KF6 A;  4X1I E;  4QHO A;  1D0Y A;  4JUY A;  2DCF A;  5HEJ A;  3AEG A;  3HL6 A;  4ZI3 D;  3FHN A;  3M65 A;  4ZI2 D;  2OV9 A;  3A7S A;  2CWO A;  4WNK A;  2ODV A;  2I6H A;  4IST A;  4UEM A;  3GA8 A;  2B1E A;  5LP6 E;  3ZJ1 A;  4YSZ A;  3RGL A;  2YEV C;  1MMA A;  4AKL A;  4DMV A;  5L3F B;  3UQ7 A;  1HNX T;  5JDH A;  2UU9 T;  2EHO D;  3KIN B;  2YU1 A;  1N36 T;  1IBM T;  3JAF A;  4AKR B;  1W0B A;  4LMK A;  4Z8X A;  1G73 A;  4CXX A;  4YY3 T;  1XMQ T;  1XD3 A;  3J9X 1;  2HHH T;  2B76 A;  4CN6 A;  3A8Y C;  3ONX A;  5JRC A;  2V6Y B;  1HTJ F;  4LF8 T;  3ZMZ B;  4YTN A;  5J2U E;  4JI1 T;  1NEK A;  2EHO A;  2LKH A;  4O4I E;  2DWG A;  2E8I A;  2IML A;  3RC3 A;  4DR5 T;  2NW8 A;  4H9N C;  3W15 B;  4IE4 A;  3RIU A;  4YTP A;  2WY2 A;  2JRK A;  1FIO A;  2BDE A;  3A5X A;  4A5X A;  2CXF A;  1ZEE A;  3ZMT B;  3IRT A;  1N34 T;  3L8R A;  3MKD A;  1XNR T;  2YDS A;  4DV5 T;  1KNZ A;  2A72 A;  2XQA A;  2VB6 A;  1YQ3 A;  4CXW A;  1M7K A;  3FZM B;  3RII A;  2PBI A;  5CGM A;  2CRB A;  3ZPO A;  4MBQ A;  3RKO A;  3IEE A;  2CLY C;  3JC6 C;  3I9W A;  1WYC A;  3LJC A;  3PU8 A;  4QH4 A;  4U7Y A;  5FYM A;  3AE8 A;  3NVO A;  5JDQ A;  2X0Y A;  2WU5 A;  5C3J A;  4JEU B;  1L0V A;  3R84 B;  4EOZ B;  4B3S T;  4CN1 A;  2W4X A;  2ZM6 T;  5J1G A;  1UX4 A;  2X68 A;  2XQ5 A;  5FY7 A;  4CZZ B;  2LEH A;  2WWU A;  3UU4 A;  3ZKR A;  2V5C A;  3JC6 D;  3EAB A;  2VKD A;  3EI0 A;  2W2U A;  4UF0 A;  4NPP A;  3AEB A;  3RH3 A;  2J47 A;  1MIW A;  4J2C A;  3N9Q A;  5F5W A;  4EZ4 A;  2A2F X;  4E7Z A;  1YKH B;  4O4J E;  2Y48 B;  2N2N A;  4TNW A;  5L4E A;  5LGT B;  4XBF B;  2WU2 A;  2VUR A;  4TNV A;  2JMH A;  3UU6 A;  1NAF A;  5JR9 C;  2LSI A;  3AAI A;  3C98 B;  4HWF A;  5L3B B;  5AQF B;  2XAF B;  5L2L A;  3C64 A;  4LFC T;  1HNW T;  2DLR A;  3PDY A;  3AXJ A;  3BQI A;  4M1P A;  2YDR A;  2UXX B;  4MFR A;  1ZP0 A;  3N2K E;  5E0O A;  5AQH B;  4ZI3 C;  2V6Y A;  2HN1 A;  3N5L A;  3PUW F;  2E9X C;  2UXD T;  2KSR A;  5HXR A;  4TUY E;  2WZH A;  3ZMV B;  5JR9 B;  3K3N A;  3VKH A;  1VRB A;  4AIU A;  2RA1 A;  3KDS E;  5A1L A;  3E0Z A;  3KW5 A;  1HG2 A;  4I55 E;  4DR6 T;  4AI6 A;  1XDO A;  3N9L A;  1HR0 T;  4N78 D;  3RYH E;  1MIY A;  2BVM A;  4AXP A;  1CHU A;  1YKE B;  4DV2 T;  3P4P A;  4EZH A;  1J5E T;  4JI5 T;  3ZJ2 A;  2UUC T;  4O2B E;  2XAG B;  3F2E A;  5H6Q B;  5FXW A;  4U31 A;  2XQ7 A;  4DV0 T;  2JMK A;  1XDP A;  2BG9 C;  4MAL A;  2UXC T;  4ASK A;  5HXC A;  3MJX A;  4L5G A;  3T1Y T;  1U4Q A;  1D1A A;  2K3W A;  2KT9 A;  4HGA A;  3KVB A;  1W09 A;  3L09 A;  2GK9 A;  3ZC0 A;  3TB3 A;  4X1Y E;  2NOX A;  2LHN A;  3RKG A;  5LNK A;  3PUA A;  4QXC B;  4IGU A;  3UU8 A;  3ZCJ A;  2V1D B;  1HFA A;  1KEY A;  3N9M A;  4QH5 A;  2G0U A;  1LVK A;  1WFD A;  2X9Y A;  1UCU A;  1IAP A;  2WP9 A;  5AQK B;  3LBX A;  5ADX L;  4YHH T;  1HX8 A;  2LRL A;  3L3P A;  3I1A A;  1MMD A;  4TWF A;  4UVA B;  1BR1 A;  2IC6 A;  2HH7 A;  2E2A A;  2K48 A;  3C51 A;  3ETU A;  3H37 A;  3HKC E;  4HFI A;  2V6X A;  3AA1 B;  4Q25 A;  4LF5 T;  4B3R T;  2UXB T;  2NWB A;  4WYV A;  1UK5 A;  2PJQ A;  5C2T A;  3NZQ A;  4AKH A;  3TLW A;  4ZOL E;  4YFS A;  2KWH A;  3Q5W A;  1XMO T;  1NWM X;  1E2A A;  4AQG A;  2V7I A;  3P7I A;  1LVF A;  4IE6 A;  3SS1 A;  3X1D A;  4ZEY A;  2X9W A;  1HF8 A;  4DID B;  3EAM A;  2CXL A;  3T1H T;  4ADZ A;  3OBV E;  1VCS A;  5AFU L;  4X64 T;  4JI4 T;  1MIV A;  2XQY A;  2CM0 A;  5M4Y A;  5FXX A;  3PTR B;  5DQV A;  4IDN A;  1J5W A;  2D0T A;  2X9X A;  2XSB A;  2WDQ A;  2XY8 B;  4GK0 E;  1UUS A;  2W00 A;  4H63 H;  5GON E;  4OYJ A;  3UT5 E;  5HXH A;  5JDG A;  4X66 T;  3GMI A;  2LHR A;  4DV3 T;  2IC9 A;  5HCM A;  3NRY A;  3CQX C;  4IE0 A;  5LB7 B;  4F8H A;  2K5B B;  1SE7 A;  3KFW X;  4P1N A;  5J2T E;  4GKK T;  2BS2 A;  3CWZ B;  2VQE T;  2JQQ A;  2PTF A;  3K3Q C;  4EAH A;  2FJD A;  3AAA B;  4TX5 A;  2W61 A;  4HWH A;  4LML A;  4GYR A;  4XZC A;  2X0L B;  4CI3 B;  2CMR A;  5JQG E;  2X0H A;  2J1D G;  2V7J A;  3EUH A;  4TV8 E;  3RQW A;  4L9I A;  5LMU T;  1Z8U A;  3G06 A;  3P4W A;  3QB5 A;  2IHR 1;  2JJ9 A;  3AE2 A;  1T72 A;  4HFE A;  3RHW A;  4CQI A;  4DV4 T;  1ZKE A;  3GN5 A;  4O8S A;  4DMW A;  3RIU C;  4OX9 T;  2AE9 A;  3N9P A;  5AQO B;  3UUM A;  4LF7 T;  3UU3 A;  3Q9D A;  3V5S A;  3N9O A;  5FL1 A;  3CIR A;  5HWY A;  4DV1 T;  2F4V T;  3UUL A;  4DR1 T;  4ZZB A;  3PUG A;  1S35 A;  2C5K T;  3PE0 A;  4YLH A;  2FJB A;  4ZHQ E;  5LJM A;  2A9U A;  3PUX F;  1B7T A;  1R8I A;  2JQK A;  3FZL B;  5FL0 A;  3UU5 A;  5CJ5 A;  1S94 A;  4H9P C;  4HKA A;  3CVR A;  2LKG A;  3VR8 A;  1E7P A;  3HKD E;  4PK5 A;  3VHL A;  5EK3 A;  3PUY F;  3ZYL A;  3IHR A;  5L3C B;  3AE1 A;  3SRZ A;  3TLS A;  5ABE A;  3KVA A;  2VVS A;  1IJ5 A;  3AAE B;  4JV5 T;  2ODU A;  3ZT5 A;  2VK9 A;  4IT4 A;  2FBW A;  1WRD A;  3OVU A;  2WM9 A;  4JBW F;  5AQR B;  3DP7 A;  3PUR A;  2YU2 A;  4H9S E;  4HFV A;  2BKO A;  3FXE B;  2V26 A;  4UVB B;  5HEO A;  2BS4 A;  4PFP A;  4CN4 A;  3LG7 A;  1XNQ T;  1LRZ A;  4DR2 T;  5AQT B;  1Y64 B;  1M62 A;  2E5V A;  2HN2 A;  2W62 A;  4IIJ E;  4PK6 A;  3HA4 A;  5H6R B;  4EYU A;  3F31 A;  3P8C D;  2E5L T;  3GN5 B;  2LSY A;  3AVR A;  3RPU A;  3U3I A;  1IZN B;  4H9R C;  2QYW A;  1QLB A;  4KBM B;  2YN6 A;  3UUN A;  1BR0 A;  3Q5X A;  4LMJ A;  3TKL B;  5ABF A;  3ZT7 A;  4KX6 A;  5LHH B;  2WMO A;  5JDL A;  4NXN T;  3AB3 B;  3BQK A;  3WAJ A;  5AQV B;  2ZM2 A;  3O1I A;  3OYX A;  4ISS A;  4UV9 B;  5HAX A;  4LF6 T;  2L3L A;  3E22 E;  3KBU A;  4DBR A;  3E08 A;  2FJE A;  2KZ7 B;  2P9B A;  4DBQ A;  2BBH A;  3P4S A;  5AQQ B;  2NP9 A;  2BZB A;  1E1H B;  2XAS B;  4HTE A;  4ILC A;  3TLU A;  2CA5 A;  2LSK A;  3AED A;  4QH1 A;  3RIF A;  4JLE A;  4MHC A;  5CB4 E;  4CXY A;  2RP4 A;  5CFB A;  2L8K A;  4BJN A;  3KV9 A;  2CHO A;  1KK7 A;  2V7K A;  3UUB A;  4UXN B;  2DI4 A;  1MNE A;  3FXD B;  5FMN A;  2BG9 A;  1HNZ T;  5HWX A;  2WSS V;  5AQL B;  1ZV4 X;  4JI2 T;  2ACZ A;  2ES0 A;  3NBX X;  1WR6 A;  5HYA A;  3K8P C;  3M3Z B;  3VRB A;  1OED B;  3UFE A;  4UR9 A;  3CX6 B;  2NTY A;  3AEE A;  1D0Z A;  1UX5 A;  4UV8 B;  4PK4 A;  4H63 V;  4IL4 A;  4X5T A;  4YHJ A;  4AQF A;  4HWI B;  5LHI B;  2QRX A;  3DJB A;  4KI0 F;  2HPJ A;  2MOZ A;  3CML A;  4IE7 A;  3EVY A;  1T7S A;  3JAD A;  4WZX A;  3KV4 A;  4G63 A;  3MZK B;  1IBK T;  4HN9 A;  1HS7 A;  5AQS B;  1WR0 A;  2CBJ A;  5JDF A;  2LOP A;  1DU2 A;  3N2G E;  3AXJ B;  2V7L A;  3UUX B;  2BG9 E;  3L39 A;  5DQW A;  1UGO A;  1OED C;  4ZS3 A;  1QUU A;  4JEH B;  3ZN1 B;  3ZYM A;  5FY1 A;  4TWD A;  1Z0P A;  3C4X A;  3OPC A;  2JPF A;  4U72 A;  5JDN A;  3NRX A;  4TZ4 C;  2XPK A;  4NUV A;  4BAY B;  1ZHC A;  3TLT A;  4AIS A;  4OYK A;  2JQH A;  2KWI B;  3MAC A;  4HWD A;  2KXP B;  3C4W A;  4L0R A;  2OLT A;  1VOM A;  3CKD A;  3U78 A;  2H7O A;  3QK6 A;  4QWN B;  1CMX A;  3CK6 A;  4NIQ A;  3FBZ A;  3SFD A;  4Z90 A;  2XJ7 A;  1FEW A;  3ANW B;  4U3C A;  3Q5D A;  5TAO A;  4KP3 C;  3AE3 A;  4LFA T;  2LM2 A;  3GWH A;  3AE7 A;  3LK4 2;  2V8S V;  4O4H E;  4EXT A;  5ABH A;  2W0G A;  2VKO A;  2X51 A;  3RYF E;  1OED A;  4DUY T;  2IDO B;  4HFC A;  1VCT A;  4KUM B;  3VRA A;  2YKS A;  4EED A;  1I6Z A;  5FY0 A;  4GK5 E;  5AQM B;  3FZF B;  2WBL A;  1WYB A;  2H7V C;  3AE6 A;  4UEL A;  5IWA T;  4JI3 T;  4HEA A;  4I50 E;  5LXT E;  2K9A A;  2QGS A;  1H7C A;  4UIG A;  2W63 A;  4UF0 B;  4C91 A;  3B13 A;  2H88 A;  5L4H A;  4IL9 A;  2KIN B;  3ONJ A;  4PNI A;  4WW0 A;  5F8P A;  3T8O A;  5KXJ A;  4NXM T;  3BQL A;  2E9X A;  1XWM A;  5JRE A;  4JYA T;  4BA9 A;  3VKG A;  1MMG A;  1Y01 A;  2ZM0 A;  2LRK A;  2WCA A;  3HI2 A;  3ZMU B;  4HWC A;  4KHP T;  4EYY R;  2X66 A;  3LDQ B;  2XQ9 A;  3C50 A;  1FMV A;  2YOE A;  2D0U A;  4KHZ F;  5C8Y E;  2CLY B;  4KMC A;  2UUB T;  2FJA A;  3I0O A;  5DAB A;  4AKG A;  1V9D A;  5DJQ C;  5LCY A;  2XQ4 A;  3MA9 A;  2YK0 A;  4QXH B;  5JDM A;  3Q5E A;  2YIN A;  4X20 E;  2BVL A;  5FP3 A;  4BJM A;  1FMW A;  5LJN A;  4WBO A;  2IAK A;  4PAG A;  4U2Y A;  4UVC B;  5CA0 E;  4YTM A;  4K0K T;  5JRC B;  5AQN B;  5EK4 A;  1W0A A;  3VU7 H;  1YW0 A;  4U74 A;  5JVD E;  3H3A A;  5L47 A;  4X62 T;  4PJL A;  3RI5 A;  4IDQ A;  2H89 A;  5FNV E;  2MBG A;  4DR4 T;  2LE8 A;  5FXV A;  4DND A;  3ANW A;  5IYZ E;  1UCH A;  2NW9 A;  2Z6E A;  2OA5 A;  4DV6 T;  3NZP A;  4ZI7 E;  3FB2 A;  3OYZ A;  3O9X A;  3K3O A;  4XAX B;  3VR9 A;  3O4X E;  1WLX A;  4HFB A;  3AA7 B;  3RYI E;  5IUX A;  2QA7 A;  3ABV A;  3KV5 A;  2RPA A;  4K0U A;  4QX7 B;  3RRC A;  1MND A;  2MTQ A;  3UQ4 A;  5LOV E;  5HXE A;  3SOL A;  2ZMA A;  3AE5 A;  3AVS A;  2V5D A;  3I9Y A;  5HEG A;  5J0Z A;  3PUQ A;  5ABG A;  3P4Q A;  2M6B A;  2MAW A;  5KDM C;  4GIW A;  2Y8D A;  4EB6 E;  4O2A E;  5HXS A;  2XHE B;  2WS3 A;  5JH7 E;  1G8X A;  1W9R A;  1HX1 B;  2MPK A;  2XQ6 A;  2KMF A;  3R6N A;  3AEC A;  1LKX A;  4ILA A;  2WDR A;  1D1B A;  2JIW A;  1AJ3 A;  3AA0 B;  1D0X A;  3WI3 A;  3LBX B;  3RLF F;  4A98 A;  2YDQ A;  2VKH A;  4QXB B;  5LG4 A;  4LF9 T;  2N9D A;  1WCR A;  2A3D A;  2LSG A;  3NKZ A;  3CQG B;  4QKN A;  2LOS A;  4CI1 B;  3PJA A;  4ZXL A;  1EZ3 A;  4ZS2 A;  2XZE A;  4DO0 A;  2XAJ B;  4Z91 A;  2D5U A;  2ZM8 A;  3P4R A;  1US7 B;  3RC8 A;  1X9B A;  2ACX A;  3RX6 A;  1D1C A;  2I59 A;  2W66 A;  4TV9 E;  4DVD A;  4YSX A;  5CA1 E;  2DNX A;  2HPL A;  1MMN A;  2X67 A;  3OKQ A;  3ZSS A;  2N1G A;  3B57 A;  3Q2M A;  4O4L E;  3WAK A;  2XQ3 A;  3JAE A;  4H9O C;  2XAH B;  3I0Q A;  2LSJ A;  3OTO T;  4P09 A;  3RF1 A;  3HKE E;  2W67 A;  4MLK A;  3RRW A;  1J1J A;  3ZT6 A;  3D0T A;  4PFO A;  4DV7 T;  3ZMS B;  2K24 A;  2WB5 A;  1BR4 A;  4F6R C;  4YSY A;  2WMN A;  3QUJ A;  2VL8 A;  3RIS A;  2CXD A;  2LM9 A;  3KV6 A;  4A56 A;  4EV6 A;  1HG5 A;  2AXD S;  2NR4 A;  4ZZC A;  2CWY A;  5BR8 T;  4YJ3 E;  1U5P A;  4YJ2 E;  3ZC1 A;  5LG3 A;  3EDV A;  1XZY A;  2WWV A;  2BKN A;  3ZN0 B;  5AQI B;  4LFB T;  4TWH A;  5LBM A;  3EHZ A;  2KLQ A;  3ZCI A;  4GKJ T;  1OED E;  2QVA A;  2EHO B;  5F3J A;  2ZLY A;  3O1H A;  4OK0 A;  1NEN A;  2BS3 A;  4U33 A;  2Q9Q A;  4H9Q C;  2CHN A; 
#chains in the Genus database with same CATH homology
 2H3R A;  4P0A A;  5L3G B;  2C5J A;  2LEN A;  5L3D B;  5JRC B;  2C0S A;  1T98 A;  4G2A A;  4ILU A;  2EHO C;  4OHF A;  2PG8 A;  3AA6 B;  4TN7 B;  3CX8 B;  5LBQ B;  4I4T E;  5LYJ E;  1QSD A;  3LK3 B;  5JDF A;  3CX7 B;  4PW8 A;  4EIW A;  2SPC A;  5IHY A;  3F57 A;  2VKJ A;  4FI5 A;  2DHR A;  3C4Z A;  5BMV E;  4PJN A;  1O3X A;  3ZYK A;  1OXZ A;  2M67 A;  5JR9 A;  5LGU B;  2CCQ A;  1HCI A;  3PUS A;  3LK2 B;  4GYS A;  3ETV A;  3RYC E;  5LGN B;  3SWH A;  3MXZ A;  5KX5 E;  3DTO A;  4OFZ A;  2Q9Q D;  2PFV A;  4X1K E;  4C90 A;  2WAU A;  2ETL A;  3KVF A;  4IG7 A;  4HE8 A;  3HR0 A;  2E9X D;  3CPZ A;  4B6X A;  4ZI2 C;  2NTX A;  3EDU A;  4IHJ E;  2LJL A;  4AQF C;  5EK2 A;  2L9Q A;  2LT3 A;  3LFM A;  2D2S A;  4NUU A;  1OWA A;  2CEA A;  5FXZ A;  4V1A v;  5EZY E;  2VWA A;  1X79 A;  5KMG P;  2XTL A;  2V7M A;  5LHG B;  1BR2 A;  2XUE A;  3PU3 A;  1CUN A;  2MYS A;  4ERR A;  2VAS A;  5ETW A;  2X9H A;  4IE5 A;  3QC9 A;  4WBN E;  1IJ6 A;  4GOU A;  1YD8 G;  1SA0 E;  4FJO A;  2Y6X A;  3OJA A;  2E9X B;  2DWK A;  3UTK A;  3ESL A;  5LA6 E;  2Q9Q B;  2KND A;  3O1J A;  3V5U A;  4E7S A;  3N2O A;  3J7Y q;  4P0B A;  3ZEF B;  3FBL A;  4IDZ A;  3IF8 B;  3HKB E;  4PJJ A;  2C5I T;  3BK9 A;  3MK7 C;  5L3E B;  4I43 B;  3IBP A;  4ANJ A;  3IFW A;  3CQC B;  2XAQ B;  2Q9Q C;  3N9N A;  3ZYM A;  2NW7 A;  2CE7 A;  3KBT A;  3ZLI A;  4JKJ A;  3S4U A;  1SHZ C;  4PJM A;  4CI2 B;  2IW5 B;  4AKI A;  2UXN B;  4X1I E;  4QHO A;  1D0Y A;  4JUY A;  2DCF A;  4ZI3 D;  3HL6 A;  3FHN A;  3M65 A;  4ZI2 D;  3A7S A;  2CWO A;  4WNK A;  2ODV A;  4IST A;  4UEM A;  3GA8 A;  2B1E A;  5LP6 E;  3ZJ1 A;  2YEV C;  1MMA A;  4AKL A;  4DMV A;  5L3F B;  5JDH A;  2EHO D;  3KIN B;  2YU1 A;  4CXX A;  4AKR B;  4Z8X A;  1G73 A;  1XD3 A;  3J9X 1;  3ONX A;  5J2U E;  1HTJ F;  3ZMZ B;  2EHO A;  4O4I E;  2DWG A;  2E8I A;  3RC3 A;  2NW8 A;  4H9N C;  3W15 B;  4IE4 A;  2JRK A;  1FIO A;  2BDE A;  3A5X A;  2CXF A;  1ZEE A;  3ZMT B;  3IRT A;  3MKD A;  1KNZ A;  2A72 A;  4CXW A;  2VB6 A;  3RII A;  2PBI A;  3ZPO A;  4MBQ A;  3RKO A;  3IEE A;  2CLY C;  3JC6 C;  3I9W A;  1WYC A;  3LJC A;  3PU8 A;  5FYM A;  5JDQ A;  4JEU B;  3R84 B;  4EOZ B;  5J1G A;  1UX4 A;  2X68 A;  4CZZ B;  5FY7 A;  2LEH A;  2WWU A;  3JC6 D;  2VKD A;  4UF0 A;  3RH3 A;  4EZ4 A;  4E7Z A;  1MIW A;  4J2C A;  3N9Q A;  2A2F X;  4XBF B;  1YKH B;  4O4J E;  2Y48 B;  2N2N A;  5LGT B;  2JMH A;  1NAF A;  5JR9 C;  2LSI A;  3AAI A;  3C98 B;  5L3B B;  5L2L A;  2XAF B;  3C64 A;  2DLR A;  3PDY A;  3BQI A;  4M1P A;  2UXX B;  4MFR A;  3N2K E;  5E0O A;  4ZI3 C;  3N5L A;  2E9X C;  5HXR A;  4TUY E;  3ZMV B;  5JR9 B;  3K3N A;  1VRB A;  2RA1 A;  3KDS E;  5A1L A;  3E0Z A;  3KW5 A;  1HG2 A;  4I55 E;  4AI6 A;  3N9L A;  4N78 D;  3RYH E;  1MIY A;  2BVM A;  4AXP A;  1YKE B;  4EZH A;  3ZJ2 A;  4O2B E;  2XAG B;  3F2E A;  5H6Q B;  5FXW A;  2JMK A;  4MAL A;  4ASK A;  5HXC A;  3MJX A;  4L5G A;  1U4Q A;  1D1A A;  2KT9 A;  4HGA A;  3TB3 A;  3KVB A;  3L09 A;  2GK9 A;  3ZC0 A;  4X1Y E;  2NOX A;  2LHN A;  5LNK A;  3PUA A;  4QXC B;  4IGU A;  3ZCJ A;  2V1D B;  1HFA A;  3N9M A;  2G0U A;  1LVK A;  2X9Y A;  1UCU A;  1IAP A;  5ADX L;  3LBX A;  1HX8 A;  3L3P A;  3I1A A;  1MMD A;  4UVA B;  1BR1 A;  2IC6 A;  2HH7 A;  2K48 A;  3ETU A;  3C51 A;  3H37 A;  4QX8 B;  3HKC E;  3AA1 B;  2NWB A;  4AKH A;  2PJQ A;  3VKH A;  3NZQ A;  3VKG A;  4ZOL E;  4YFS A;  2KWH A;  3Q5W A;  1NWM X;  4AQG A;  2V7I A;  3P7I A;  1LVF A;  4IE6 A;  3SS1 A;  2X9W A;  1HF8 A;  2CXL A;  4ADZ A;  3OBV E;  5AFU L;  1MIV A;  2XQY A;  2CM0 A;  5M4Y A;  5FXX A;  3PTR B;  5DQV A;  3ZC1 A;  2D0T A;  2X9X A;  4GK0 E;  4H63 H;  5GON E;  5JDG A;  2W00 A;  4OYJ A;  3UT5 E;  5HXH A;  3GMI A;  2LHR A;  2IC9 A;  3NRY A;  3CQX C;  4IE0 A;  2K5B B;  3KFW X;  5J2T E;  3CWZ B;  2JQQ A;  3K3Q C;  4EAH A;  3AAA B;  4TX5 A;  2W61 A;  4GYR A;  4XZC A;  2X0L B;  4CI3 B;  2CMR A;  5JQG E;  2J1D G;  2V7J A;  3EUH A;  4TV8 E;  4L9I A;  4DM9 A;  4CQI A;  2JJ9 A;  1ZKE A;  3GN5 A;  4O8S A;  4DMW A;  3N9P A;  3UUM A;  3Q9D A;  3V5S A;  3N9O A;  5HWY A;  3UUL A;  3PUG A;  1S35 A;  2C5K T;  3PE0 A;  4YLH A;  4ZHQ E;  5LJM A;  1B7T A;  1S94 A;  4H9P C;  4HKA A;  3CVR A;  3HKD E;  4PK5 A;  3VHL A;  5EK3 A;  5L3C B;  3ZYL A;  3IHR A;  3SRZ A;  3KVA A;  1IJ5 A;  3AAE B;  2ODU A;  2VK9 A;  1WRD A;  2WM9 A;  3DP7 A;  3PUR A;  2YU2 A;  4H9S E;  4HFV A;  3FXE B;  2V26 A;  4UVB B;  4PFP A;  3LG7 A;  1LRZ A;  1Y64 B;  2W62 A;  4PK6 A;  4IIJ E;  3HA4 A;  5H6R B;  4EYU A;  3F31 A;  3P8C D;  3GN5 B;  2LSY A;  3AVR A;  3RPU A;  3U3I A;  1IZN B;  4H9R C;  4KBM B;  3UUN A;  1BR0 A;  3Q5X A;  3TKL B;  5LHH B;  2WMO A;  5JDL A;  3AB3 B;  3BQK A;  3WAJ A;  2ZM2 A;  3O1I A;  3OYX A;  4ISS A;  4UV9 B;  5HAX A;  2L3L A;  3E22 E;  3KBU A;  4DBR A;  3E08 A;  2P9B A;  2KZ7 B;  4DBQ A;  2NP9 A;  2BZB A;  1E1H B;  2XAS B;  4HTE A;  2CA5 A;  2LSK A;  4JLE A;  4MHC A;  5CB4 E;  4CXY A;  2RP4 A;  2L8K A;  4BJN A;  3KV9 A;  1KK7 A;  2V7K A;  4UXN B;  2DI4 A;  1MNE A;  3FXD B;  5FMN A;  5HWX A;  2WSS V;  1ZV4 X;  3NBX X;  2ES0 A;  5HYA A;  1WR6 A;  3K8P C;  3UFE A;  3CX6 B;  2NTY A;  1D0Z A;  1UX5 A;  4UV8 B;  4PK4 A;  4H63 V;  4YHJ A;  4AQF A;  5LHI B;  3DJB A;  2HPJ A;  2MOZ A;  3CML A;  4IE7 A;  3EVY A;  1HS7 A;  3KV4 A;  4G63 A;  3MZK B;  4HN9 A;  2LOP A;  3N2G E;  2V7L A;  3UUX B;  5DQW A;  4ZS3 A;  1QUU A;  4JEH B;  3ZN1 B;  5FY1 A;  1Z0P A;  3C4X A;  4U72 A;  2JPF A;  5JDN A;  3NRX A;  4TZ4 C;  4NUV A;  4BAY B;  1ZHC A;  4OYK A;  2KWI B;  3MAC A;  2KXP B;  3C4W A;  4L0R A;  1VOM A;  3CKD A;  3U78 A;  2H7O A;  3QK6 A;  4QWN B;  1CMX A;  3FBZ A;  1FEW A;  3ANW B;  5TAO A;  4KP3 C;  3GWH A;  3LK4 2;  4EXT A;  4O4H E;  2W0G A;  2VKO A;  2X51 A;  3RYF E;  4KUM B;  5FY0 A;  4GK5 E;  2WBL A;  1WYB A;  2H7V C;  4UEL A;  4HEA A;  4I50 E;  5LXT E;  2K9A A;  2QGS A;  1H7C A;  4UIG A;  2W63 A;  4UF0 B;  4C91 A;  3B13 A;  2KIN B;  4PNI A;  4WW0 A;  5F8P A;  3T8O A;  4I6N A;  3BQL A;  2E9X A;  5JRE A;  4BA9 A;  1MMG A;  2ZM0 A;  3ZMU B;  3HI2 A;  4EYY R;  2X66 A;  3C50 A;  1FMV A;  2D0U A;  4AKG A;  5C8Y E;  2CLY B;  4KMC A;  3I0O A;  5DAB A;  1V9D A;  5DJQ C;  5LCY A;  4QXH B;  3MA9 A;  2YK0 A;  5JDM A;  2YIN A;  4X20 E;  2BVL A;  5FP3 A;  4BJM A;  1FMW A;  5LJN A;  4WBO A;  2IAK A;  4PAG A;  5CA0 E;  4UVC B;  5EK4 A;  3VU7 H;  1YW0 A;  4U74 A;  5JVD E;  3H3A A;  4PJL A;  5FNV E;  2MBG A;  2LE8 A;  5FXV A;  4DND A;  3ANW A;  5IYZ E;  1UCH A;  2NW9 A;  2Z6E A;  2OA5 A;  3NZP A;  4ZI7 E;  3FB2 A;  3OYZ A;  3O9X A;  3K3O A;  4XAX B;  3O4X E;  1WLX A;  3RYI E;  3AA7 B;  2QA7 A;  3KV5 A;  4QX7 B;  4K0U A;  3RRC A;  1MND A;  2MTQ A;  5LOV E;  5HXE A;  3SOL A;  2ZMA A;  3I9Y A;  3AVS A;  3PUQ A;  5KDM C;  4GIW A;  2Y8D A;  4EB6 E;  4O2A E;  5HXS A;  2XHE B;  5JH7 E;  1G8X A;  2KMF A;  3R6N A;  1LKX A;  1D1B A;  1AJ3 A;  3AA0 B;  1D0X A;  3WI3 A;  3LBX B;  2VKH A;  4QXB B;  5LG4 A;  2N9D A;  2A3D A;  2LSG A;  3CQG B;  4QKN A;  2LOS A;  4CI1 B;  1EZ3 A;  4ZS2 A;  4DO0 A;  2XAJ B;  2D5U A;  2ZM8 A;  1US7 B;  3RC8 A;  2ACX A;  3RX6 A;  1D1C A;  2I59 A;  4DVD A;  4TV9 E;  5CA1 E;  2DNX A;  2HPL A;  1MMN A;  2X67 A;  3OKQ A;  2N1G A;  3B57 A;  3Q2M A;  4O4L E;  3WAK A;  4H9O C;  2XAH B;  3I0Q A;  2LSJ A;  4P09 A;  3HKE E;  4MLK A;  3RRW A;  3D0T A;  4PFO A;  3ZMS B;  2K24 A;  4F6R C;  1BR4 A;  2WMN A;  3QUJ A;  2VL8 A;  3RIS A;  2CXD A;  2LM9 A;  3KV6 A;  4A56 A;  5JRC A;  1HG5 A;  2CWY A;  4YJ3 E;  1U5P A;  4YJ2 E;  3EDV A;  3ZN0 B;  5LBM A;  2KLQ A;  3ZCI A;  2EHO B;  5F3J A;  2ZLY A;  3O1H A;  4OK0 A;  2Q9Q A;  4H9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...