4UEMA

Uch-l5 in complex with the rpn13 deubad domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
309
structure length
281
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKRFNLMAIVSDRKMIYEQKIAELQRQLAESMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 86
structure length 281
sequence length 309
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uemA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uemA01
4UEMA 3IHRA 3RIIA 1CMXA 4IG7A 4UELA 2LENA 3RISA 3IFWA 3KW5A 4I6NA 2ETLA 1XD3A 3A7SA 3TB3A 4DM9A 3IRTA 1UCHA 4JKJA 3KVFA
chains in the Genus database with same CATH superfamily
4QWNB 4TUYE 5JVDE 2LKGA 2YU2A 3AEEA 1YQ3A 3RYHE 4ZI3D 2MAWA 1N36T 3N5LA 3VKHA 1UURA 3ZEFB 2NTYA 4AKRB 5HEJA 4QH4A 4ADZA 5AFUL 5FY1A 3M65A 1WR6A 3P4RA 3CQGB 4AISA 2UXDT 3HKCE 4EZ4A 5LGNB 2JQ9A 4GYRA 5L4EA 1XD3A 3NZPA 3E0ZA 1BR4A 4KMCA 3KVFA 3AE1A 3AA0B 4AKIA 5ABFA 4ILBA 4UF0A 4LF4T 2KWHA 4IE6A 4ZI2C 5HCMA 3TLUA 2C0SA 1ZKEA 1H7CA 4EYUA 4CXYA 4H9NC 4I55E 2WSSV 3TLWA 2JMHA 4PW8A 2QGSA 1L0VA 3SWHA 2CE7A 2BKOA 5AQLB 3I0QA 3AE8A 2E9XD 4KHPT 2KINB 2CWOA 4Z8XA 3DTOA 2HN1A 5DABA 3SFDA 3RIUC 3ZYLA 3PUVF 2JMKA 3AEBA 4Q25A 2LM9A 4CXXA 2MPKA 2CHOA 3AA6B 2MTQA 4DO0A 2Q9QA 4O8SA 1X9BA 3UUXB 4EAHA 3A7SA 2ODVA 1W0AA 4OHFA 4H63V 5AQFB 1MIWA 3ZMVB 5JR9C 3L09A 3RKOA 3FBZA 2X66A 4C91A 2AXDS 3BK9A 4DV0T 4MFRA 2YDSA 4ISSA 4QXHB 2K24A 5L3EB 4F6RC 1S94A 4QH1A 4PJNA 3AAAB 2RPAA 3U78A 3AA7B 3RISA 3KDSE 3ZYMA 1IBKT 3QNUA 5J0ZA 3SOLA 4MLKA 4AQGA 2WP9A 2FJBA 2BS3A 2A2FX 3ZC0A 3U3IA 3P4QA 2VL0A 3P4PA 4LF9T 4UVBB 3NZQA 2WMOA 1HR0T 3AEDA 3ZN0B 2CLYC 2JRKA 4ILCA 3Q5DA 5LMUT 1N34T 4LF5T 2UXNB 1XMQT 1OEDB 4WBNE 2E2AA 2VKOA 4AQFC 2WDRA 2WBLA 4V1Av 3FZKB 5LYJE 4EEDA 4UXNB 2H3RA 3UTKA 2BG9E 4YJ2E 3LK2B 4DUYT 4X64T 2E8IA 5L2LA 1UK5A 5C3JA 2M67A 3C4WA 3S4UA 5JH7E 2K9AA 3CIRA 3ZSTA 2K3WA 2OLTA 4LF7T 4JLEA 2N9DA 2LSGA 5HCJA 2NW8A 4GK5E 2WDQA 1E7PA 3VKGA 2M6BA 3QK6A 2X9XA 1YKEB 1WYBA 1WFDA 4KBMB 2ZLYA 3RIUA 2CMRA 3FZFB 5LMNT 4H9PC 4H9QC 1DU2A 3G06A 3UFEA 1T98A 3PUSA 2XJ7A 3UQ4A 3UUNA 3KVBA 2X0LB 1YD8G 5CJ5A 4AXPA 4O4HE 2B1EA 4DR4T 5AQVB 5FNVE 4YHHT 5EZYE 3LDQB 3OKQA 5JR9A 4AKLA 2UXCT 1HFAA 3JCFA 4UVCB 3ZYKA 2OA5A 4PJMA 2FJEA 4BJNA 4UEMA 4X20E 2JIWA 3KV9A 5DQVA 4ZHQE 3JAEA 4DIDB 2UXBT 5L3GB 3K3OA 4AQYT 5AQMB 4GOUA 1W9RA 4HWHA 3CQCB 3ONXA 1HNWT 1MNEA 5LG4A 4UR9A 1BR2A 4G63A 4CQIA 1HTJF 2VKHA 2P9BA 4ZOLE 1ZV4X 3BQLA 3P4SA 2I59A 4X1YE 3AB3B 3RRCA 1MMAA 3Q5XA 1N33T 2LRKA 4U2YA 5F3JA 4ZEYA 3AXJA 4AI6A 1LVKA 3Q5WA 2EHOC 1IBLT 4WBOA 3AE3A 3AVSA 3I1AA 1BR0A 4TWFA 2V26A 5LHIB 3NKZA 3F31A 3RIAA 2BBHA 5JDFA 2WQYA 4DV6T 3I9WA 5FYMA 1T72A 1M7KA 4E7SA 5JRCB 4LFBT 3RYFE 4YJ3E 3PUWF 4DVDA 3MXZA 1E1HB 5KX5E 3EDVA 3PUQA 2Q9QD 2IC9A 1J1JA 1WR0A 5LCYA 4A98A 3JC6C 2UXXB 4DR5T 5LB7B 1HS7A 3HA4A 3ZMTB 3N2OA 3UQ7A 3X1DA 3Q9DA 3RPUA 3T1HT 2J4GA 3ONJA 3HKEE 4QX8B 2WZHA 3AEGA 1QLBA 3GMIA 2WAUA 3A7MA 4NUUA 3ZCIA 4YTMA 5E0OA 3EHZA 3RIIA 4KP3C 5ABHA 2CM0A 3RI5A 2BVMA 1HG2A 5ABEA 1YXRA 3ANWB 1S35A 2DHRA 2XTLA 4O2BE 2BVLA 3RGLA 5CFBA 2KWIB 3Q2MA 4I4TE 5FXWA 3CX6B 1CMXA 3KVAA 2VK9A 2VWAA 2LLYA 2HN2A 3E08A 4PJJA 1I94T 3UT5E 3UU5A 3IRTA 4IDZA 3ESLA 4PNIA 4LF8T 2XM1A 5A1LA 2JPFA 3ANWA 4TWHA 2WY2A 4J2CA 4UVAB 2X68A 3T1YT 3I9YA 2YINA 4KI0F 2VURA 4BAYB 3I0OA 2H7VC 3N9LA 3RF1A 3GN5A 2XSBA 4ZXLA 3A5XA 1T8BA 2EHOA 4HWIB 5HEOA 4WNKA 1XZYA 3PV0F 4X5TA 4ASKA 2WS3A 3O1HA 4U33A 2VKDA 5JQGE 2XQ4A 1LKXA 4H63H 5HEUA 2XQ7A 2W0GA 5ABFB 4UF0B 3KINB 5AQRB 4HFBA 2CRBA 2UUAT 2C5KT 2XSAA 2PTFA 1LRZA 2ETLA 1NWMX 2DWGA 4U72A 4B3MT 1SE7A 2YEVC 4NXNT 3RKGA 2LSJA 3FB2A 2V5CA 2XAJB 3JAFA 4YSXA 4HFDA 5AQUB 1IJ5A 3ZJ1A 2X0YA 5LHHB 2CCQA 3OBVE 4XAXB 4P0BA 4L0RA 1WLXA 2DWKA 2HH7A 2XUEA 2Q9QB 3K3QC 3ZSSA 2X0HA 2CXFA 4IT4A 3KFWX 1HNXT 1LVFA 1U4QA 3AE5A 1YQ4A 4YT0A 4JI0T 4I0UA 3ZCJA 3FZLB 2YU1A 4C90A 3VRBA 3CX7B 2LM2A 1OEDE 3PU8A 5HWYA 3CWZB 2QA7A 4OFZA 4AKGA 3PUYF 2D0UA 1IZNB 2VASA 3O1IA 4B3TT 4ZI3C 2KT9A 2IUBA 3R6NA 2Z6EA 2IMLA 3ONLC 1VCTA 3L3PA 1D0XA 3IA3A 2NR4A 3K8PC 4CZZB 5LXTE 2NWBA 3KV4A 1MNDA 3PTRB 3TLVA 5LJNA 2XZEA 5FMNA 1UGOA 2J62A 3AECA 5CGMA 2BKPA 5FY7A 3P50A 5CA1E 3PJAJ 4CI3B 3L8RA 2LOSA 3CPZA 4B3RT 1QSDA 3LBXA 4HFEA 2RA1A 3MK7C 3J9X1 3ZKRA 2V6XA 1CHUA 4E7ZA 3CKDA 2MBGA 2NW9A 2D5UA 4I6NA 4N78D 2V7IA 4OYJA 1QUUA 4MBQA 2XQ8A 2E9XC 3N9OA 3FBLA 4ZI7E 4H9SE 4DBRA 4H9OC 1NAFA 2V7MA 4EOZB 4JI4T 2L3LA 3KV5A 4PK6A 5L4HA 5J2UE 3RQWA 3PJAA 4HFHA 2W61A 3UUBA 1KNRA 2LJLA 1Z8UA 3AVRA 2BKNA 3IF8B 2BG9C 3QB5A 3M3ZB 5J2TE 5FVLA 4NUVA 2YKSA 4HFCA 5LHGB 1JNRA 4JI6T 2V5DA 3N9NA 1G8XA 2PBIA 4NPPA 4B6XA 2X9YA 1IAPA 1FJGT 3F2EA 4PFPA 5ABGA 4CN6A 2VVSA 2XQ5A 4X1KE 3OPCA 2V6YA 3E22E 2BS2A 3NRXA 2PFVA 4A56A 5JR9B 2ZM2A 4B3ST 3C51A 5AQOB 2H89A 4YTNA 3UU4A 4JUYA 3FXEB 3ZMUB 2J1DG 2W63A 4IDQA 2LHRA 4EGWA 4GKKT 4PFOA 5IYZE 5EK2A 3CMLA 5JREA 4IE4A 4X62T 4EXTA 4HWCA 2QYWA 3KBUA 3MJXA 3DJBA 5HXEA 4U7YA 5L3CB 5EK4A 3HL6A 3UU3A 2OV9A 3EAMA 2J47A 5JDGA 2XQAA 2C5IT 4WZXA 2BS4A 4QHOA 3PE0A 3K3NA 3UU8A 2YOEA 2XQ9A 2XASB 5JDNA 2CLYB 1ZHCA 2CHNA 3RH3A 1HX8A 4Z91A 5EK3A 4TNWA 5LOVE 3H3MA 4JKJA 1D0ZA 4IHJE 4EIWA 3AXJB 2WWVA 5FKYA 5FL1A 3AE9A 3WI3A 2WU5A 5ETWA 2LT3A 4TX5A 5DJQC 2E9XA 2IAKA 4DNDA 2GK9A 5M4YA 3KW5A 4IL4A 2LHNA 5IUXA 2UU9T 4AKHA 3N9MA 1O3XA 5HXRA 2C5JA 4JI5T 4AQFA 5FP3A 2CBIA 4LFAT 2MOZA 3OYZA 2JQQA 3UUMA 2D2SA 5H6RB 2XPKA 3CK6A 2BG9A 5JDHA 4LFCT 4HWFA 4GYSA 3QB5K 3D0TA 4X65T 3NWIA 3UU6A 4JEHB 5H6QB 4IIJE 2LKHA 2ES0A 1KFYA 3ZJ2A 4O4LE 2L9QA 4HN9A 5IHYA 4ZZBA 2DNXA 4ERRA 4I50E 3BQKA 3R84B 5AQSB 1V9DA 2IW5B 2I0MA 3PU3A 3PUGA 3F57A 3PDYA 2X67A 2D0TA 3TKLB 1MIYA 4DR2T 1XNQT 3VR9A 4EZHA 1XMOT 1JNZA 4MALA 3TLSA 1WYCA 2ZMAA 2LSYA 1ZP0A 2FBWA 4FJOA 2V8SV 2CBJA 1VCSA 5L3FB 1US7B 3SFEA 5HXHA 5HWXA 3HKDE 2KSRA 2A9UA 2WMNA 4DM9A 3AA1B 1G73A 1YW0A 1KK7A 2IC6A 3ZMSB 4IDOA 3C4XA 4HE8A 3GWHA 4DMWA 3EVYA 5J1GA 3QUJA 1N32T 4QH5A 2F4VT 3N9QA 1SUMB 5FXXA 4DBQA 4QKNA 2ZM8A 2WWUA 3RYIE 3RIFA 1XDPA 3RRWA 1I6ZA 1UCUA 4O2AE 4GKJT 1GQEA 1FMVA 4UELA 3LG7A 3GN5B 4F8HA 4WYVA 3IFWA 3NRYA 2VL8A 4JEUB 5LBMA 2KXPB 5HEHA 2DI4A 2W2UA 4COFA 2EHOB 3GA8A 4ISTA 3P8CD 2VKJA 5BMVE 4P0AA 4HTEA 5ADXL 3LJCA 3P7IA 3K1SA 2Q9QC 4KHZF 4OK0A 5C2TA 3KV6A 1HNZT 4ZI2D 2JQKA 4UV9B 3SS1A 1NEKA 4IE5A 4U3CA 3RYCE 2UUCT 1XWMA 2A72A 3CX8B 1KEYA 3B5MA 4DV4T 2WZIA 4O4JE 5AQPB 2W4XA 4PAGA 3MA9A 4HFVA 2BZBA 1IJ6A 5LG3A 3W15B 3H3AA 5BR8T 5AQTB 3RHWA 4TZ4C 1MMGA 5HAXA 1VOMA 3AE7A 3AEAA 3ZT7A 3FHNA 2XAGB 4DV1T 1AJ3A 2CPTA 3RC3A 2NTXA 5C8YE 4ANJA 3TLTA 2LOPA 2ZM0A 3WAJA 1SHZC 2D9DA 5AQNB 3IHRA 4UIGA 4FI5A 3EI0A 5LA6E 3P4WA 4YXDA 2KNDA 4IE0A 5AQGB 4AIUA 2E5VA 3H37A 1E2AA 3VRAA 5JDQA 3B13A 3DP7A 4U7IA 3AEFA 2ZM6T 4X66T 3LK3B 3J7Yq 4L5GA 4P1NA 2HPJA 2NP9A 2V7LA 1OEDC 3C50A 2ODUA 5JTGA 5FVKA 5LNKA 3ZT5A 5AQHB 2LENA 1J5ET 2G0UA 2V7KA 3ZMZB 3ETVA 2CWYA 2DCFA 2UUBT 4CI2B 1D1AA 3LBXB 3O9XA 1FMWA 3WAKA 5LBQB 5KDMC 4IG7A 2QVAA 4CN4A 1MMNA 2DLRA 2IHR1 4OX9T 2WCAA 2YDQA 3O1JA 4U2ZA 4DMVA 4HWDA 3TB3A 5HXCA 1B7TA 2CEAA 5LP6E 1UUSA 4TV8E 2LSIA 1M62A 1EZ3A 4DR6T 3SRZA 1D1CA 2XY8B 5FY0A 4HGAA 3AE2A 1MMDA 4X1IE 5L3DB 5FXVA 2W66A 1D1BA 2CXLA 3N9PA 1HG5A 5LGUB 2MYSA 3UULA 1ZEEA 4OYKA 3QC9A 2WDVA 3VHLA 1W0BA 2A3DA 4L9IA 4IREA 4Z90A 2WM9A 1HCIA 1BR1A 1CUNA 2K5BB 3C64A 3HI2A 3BQIA 2L8KA 4JI2T 4U74A 2XM2A 5JDLA 4CI1B 3Q5EA 4KX6A 2XAHB 4TNVA 2V6YB 1T7SA 4JV5T 2E5LT 2V1DB 3EDUA 2M6IA 4QXCB 3V5UA 5KXJA 2HPLA 2LE8A 5F5WA 3VR8A 3LFMA 1Y01A 4ZS3A 3IEEA 2XAFB 1WRDA 4DR1T 2JJ9A 1R8IA 1U5PA 4NIQA 3LSVA 4PK4A 1FIOA 4YFSA 3PUAA 4EEBA 5IWAT 3KBTA 1UX5A 1OEDA 5FL0A 5L47A 3EABA 4UV8B 2IDOB 5TAOA 4YSZA 5DQWA 2VB6A 4LF6T 4TWDA 4P09A 3MACA 3PUZF 3RQUA 4YTPA 3AAEB 1OWAA 3NVOA 2VQFT 3L39A 4G2AA 3OVUA 4IDPA 4YHJA 3C4ZA 3N2GE 5AQIB 1YKHB 2CA5A 1UCHA 2EHOD 4A97A 1FEWA 1MIVA 4YSYA 2PG8A 2E9XB 4DV7T 3AE4A 4CN1A 3HKBE 3ETUA 3FZHB 3ZT6A 2ACXA 4QX7B 2DL1A 2W00A 1KNZA 3OJAA 3A8YC 1NENA 3MZKB 4HEAA 2BDEA 4MHCA 1SA0E 1UX4A 2BG9B 1ZOYA 2Y8DA 2XQYA 3CVRA 2PJQA 3JC6D 2X51A 2AE9A 3OTOT 4GK0E 4PK5A 5AQKB 2BBJA 4YY3T 3FXDB 3V5SA 2W62A 1J5WA 2B76A 3AE6A 4BA9A 2KMFA 4BJMA 4HFIA 2YK0A 2N1GA 1HF8A 2NW7A 2CXDA 1OXZA 4U31A 2XHEB 4K0UA 2W67A 4I43B 4DV2T 3NBXX 2FJAA 3C98B 4ZZCA 4WW0A 2K48A 2SPCA 3AAIA 2KLQA 4ZS2A 3ZN1B 2N2NA 2NOXA 5CB4E 3T8OA 3ZLIA 2LEHA 3ZC1A 2H7OA 2YN6A 4YLHA 4K0KT 4DV3T 1W09A 3O4XE 3UFGA 4JYAT 2RP4A 5AQQB 2QRXA 2VVNA 1XNRT 2V7JA 2LRLA 4JBWF 5L3BB 3N2KE 4TN7B 4ILUA 4IDNA 2XQ3A 2JQHA 2VQET 4ILAA 3QOFA 1Z0PA 3IBPA 3RC8A 4EYYR 2X9WA 3OYXA 4JI8T 4CXWA 1X79A 4HKAA 3FZMB 4TV9E 5LGTB 4QXBB 1HX1B 3CQXC 2FUPA 4M1PA 4LMJA 1VRBA 5JRCA 4IE7A 1WCRA 2LSKA 2FJDA 2YDRA 3HR0A 4PJLA 3JADA 2Y6XA 4A5XA 1KNPA 5LJMA 4KUMB 1Y64B 4H9RC 5HEGA 4XBFB 3PURA 5HXSA 2WU2A 4DR3T 2IIUA 2I6HA 3MKDA 5HYAA 4EV6A 3ZPOA 1KF6A 2Y48B 4JI3T 5FXZA 4O4IE 2XQ6A 1D0YA 4IL9A 5JDMA 3EUHA 2KZ7B 4LMLA 5AQJB 3ABVA 4JI7T 4IGUA 2ACZA 4LMKA 3LK42 1IBMT 5CA0E 3VU7H 4GIWA 5GONE 4NXMT 3RLFF 5F8PA 4DR7T 4EB6E 4DUZT 4XZCA 3B57A 2XAQB 2WB5A 4JI1T 3RX6A 2HHHT 2H88A 5KMGP 3PUXF 2R6GF 1XDOA 4DV5T 2X9HA
chains in the Genus database with same CATH topology
1B7TA 2CEAA 4QWNB 5LP6E 1E1HB 4TV8E 2LSIA 3KBUA 3MJXA 5KX5E 4TUYE 3DJBA 5JVDE 5HXEA 3EDVA 1EZ3A 3PUQA 2YU2A 5L3CB 2Q9QD 3SRZA 1D1CA 5EK4A 2IC9A 5FY0A 3HL6A 4HGAA 3RYHE 4ZI3D 1MMDA 5LCYA 3JC6C 2UXXB 3N5LA 3VKHA 5JDGA 3ZEFB 2C5IT 2NTYA 4AKRB 1HS7A 3HA4A 4X1IE 5L3DB 3ZMTB 3N2OA 4ADZA 5AFUL 5FY1A 4QHOA 5FXVA 3PE0A 3K3NA 1D1BA 3M65A 2CXLA 1WR6A 3N9PA 1HG5A 3Q9DA 5LGUB 2MYSA 3RPUA 3CQGB 3UULA 3HKCE 4EZ4A 1ZEEA 3HKEE 3QC9A 4OYKA 4QX8B 2XASB 5JDNA 5LGNB 2CLYB 4GYRA 1ZHCA 3VHLA 2A3DA 3RH3A 1XD3A 4L9IA 1HX8A 5EK3A 3GMIA 3NZPA 2WAUA 5LOVE 3E0ZA 4NUUA 4JKJA 1BR4A 4KMCA 3KVFA 1D0ZA 2WM9A 3AA0B 4IHJE 4EIWA 1HCIA 4AKIA 1BR1A 1CUNA 2K5BB 3C64A 4UF0A 3ZCIA 3HI2A 3BQIA 5E0OA 2KWHA 2L8KA 4IE6A 4U74A 4ZI2C 3RIIA 4KP3C 5JDLA 2C0SA 2CM0A 3WI3A 4CI1B 2BVMA 1HG2A 1ZKEA 5ETWA 1H7CA 2LT3A 4TX5A 5DJQC 4EYUA 2E9XA 2IAKA 4DNDA 4CXYA 2GK9A 2XAHB 4H9NC 3ANWB 5M4YA 3KW5A 4I55E 2WSSV 1S35A 2JMHA 4PW8A 2LHNA 2DHRA 2XTLA 2V1DB 3EDUA 4O2BE 2QGSA 2BVLA 4QXCB 4AKHA 2KWIB 3N9MA 3SWHA 3V5UA 1O3XA 3Q2MA 5HXRA 2C5JA 4I4TE 5FXWA 2CE7A 3CX6B 1CMXA 2HPLA 3KVAA 4AQFA 3I0QA 5FP3A 2VK9A 2VWAA 2LE8A 2E9XD 3LFMA 3E08A 4ZS3A 3IEEA 2KINB 4PJJA 3UT5E 2MOZA 2CWOA 4Z8XA 2XAFB 3DTOA 3OYZA 1WRDA 2JQQA 4IDZA 5DABA 2D2SA 3ESLA 2JJ9A 4PNIA 1U5PA 5H6RB 3UUMA 3ZYLA 5A1LA 5JDHA 2JPFA 2JMKA 3ANWA 4PK4A 1FIOA 2LM9A 4YFSA 4J2CA 4CXXA 3PUAA 3KBTA 4GYSA 1UX5A 3AA6B 3D0TA 4UVAB 2X68A 4JEHB 2MTQA 5H6QB 3I9YA 4IIJE 2YINA 4UV8B 4DO0A 2ES0A 2Q9QA 4O8SA 4BAYB 3ZJ2A 4O4LE 3UUXB 3I0OA 5TAOA 2L9QA 5DQWA 4HN9A 2VB6A 4EAHA 2H7VC 3N9LA 5IHYA 3GN5A 3A7SA 2ODVA 2DNXA 4ERRA 3A5XA 4P09A 3MACA 4OHFA 2EHOA 4H63V 1MIWA 4I50E 4WNKA 3ZMVB 3BQKA 3R84B 3AAEB 5JR9C 1V9DA 2IW5B 3L09A 3RKOA 4ASKA 3FBZA 3PU3A 3O1HA 1OWAA 2X66A 4C91A 2VKDA 5JQGE 3PUGA 3F57A 3PDYA 2X67A 2D0TA 1LKXA 3TKLB 1MIYA 3BK9A 4G2AA 4EZHA 4H63H 4YHJA 3C4ZA 3N2GE 4MALA 2W0GA 1YKHB 1WYCA 4MFRA 2ZMAA 4UF0B 2LSYA 2CA5A 1UCHA 2EHOD 4FJOA 4ISSA 4QXHB 1FEWA 2K24A 3KINB 1MIVA 5L3EB 4F6RC 1S94A 2PG8A 2E9XB 5L3FB 1US7B 4PJNA 3HKBE 5HXHA 2C5KT 3AAAB 5HWXA 3HKDE 3ETUA 3U78A 3AA7B 3RISA 3KDSE 3ZYMA 2WMNA 1LRZA 2ETLA 2ACXA 3SOLA 4MLKA 4QX7B 4DM9A 1NWMX 3AA1B 1G73A 1YW0A 4AQGA 1KK7A 2IC6A 3ZMSB 2DWGA 2W00A 4U72A 1KNZA 3C4XA 2A2FX 4HE8A 3GWHA 3ZC0A 4DMWA 3OJAA 3EVYA 3U3IA 5J1GA 2YEVC 3QUJA 3MZKB 4HEAA 2BDEA 4MHCA 4UVBB 2LSJA 3FB2A 3NZQA 2WMOA 3N9QA 1SA0E 1UX4A 2XAJB 3ZN0B 2CLYC 2JRKA 2Y8DA 5FXXA 2XQYA 4DBQA 4QKNA 2ZM8A 3CVRA 2WWUA 2PJQA 3JC6D 1IJ5A 2UXNB 2X51A 3RYIE 3ZJ1A 4GK0E 3RRWA 4PK5A 4WBNE 2VKOA 5LHHB 3FXDB 2CCQA 3V5SA 1UCUA 2W62A 4O2AE 3OBVE 4XAXB 4AQFC 4L0RA 1WLXA 2DWKA 2HH7A 4P0BA 2XUEA 2Q9QB 2WBLA 3K3QC 4V1Av 2CXFA 4BA9A 1FMVA 3KFWX 4UELA 5LYJE 2KMFA 3LG7A 4UXNB 4BJMA 3GN5B 1LVFA 2H3RA 3UTKA 1U4QA 3IFWA 3LK2B 3NRYA 2VL8A 4JEUB 5LBMA 2KXPB 4YJ2E 2E8IA 2YK0A 2DI4A 1HF8A 2N1GA 5L2LA 3ZCJA 2EHOB 2YU1A 4C90A 2NW7A 3GA8A 4ISTA 3CX7B 3P8CD 2M67A 2VKJA 3C4WA 5BMVE 4P0AA 3PU8A 5HWYA 3S4UA 4HTEA 5ADXL 5JH7E 2K9AA 3LJCA 3CWZB 2QA7A 3P7IA 2CXDA 4OFZA 4AKGA 1OXZA 2XHEB 4K0UA 2Q9QC 4OK0A 2D0UA 4I43B 1IZNB 2VASA 3NBXX 3KV6A 3C98B 3O1IA 4ZI3C 4JLEA 2KT9A 2N9DA 4ZI2D 4WW0A 2K48A 2LSGA 2Z6EA 4UV9B 2SPCA 3R6NA 2NW8A 3AAIA 2KLQA 4ZS2A 4IE5A 3SS1A 3ZN1B 2N2NA 4GK5E 3RYCE 2NOXA 5CB4E 3T8OA 3ZLIA 2A72A 2LEHA 3L3PA 3VKGA 3ZC1A 3CX8B 1D0XA 2H7OA 3K8PC 3QK6A 2X9XA 4CZZB 1YKEB 1WYBA 4YLHA 5LXTE 4KBMB 2NWBA 2ZLYA 2CMRA 3O4XE 3KV4A 1MNDA 4O4JE 3PTRB 2RP4A 4H9PC 4H9QC 2V7JA 5LJNA 5FMNA 3UFEA 1T98A 3N2KE 3PUSA 5L3BB 4TN7B 4ILUA 4PAGA 3KVBA 3UUNA 2X0LB 5FY7A 5CA1E 3MA9A 1YD8G 1Z0PA 4HFVA 2BZBA 3IBPA 4CI3B 1IJ6A 2LOSA 3H3AA 3W15B 4AXPA 4O4HE 2B1EA 3CPZA 4EYYR 3RC8A 4TZ4C 2X9WA 3OYXA 5FNVE 1MMGA 5EZYE 5HAXA 1VOMA 4CXWA 1X79A 4HKAA 1QSDA 3LBXA 3OKQA 2RA1A 4TV9E 3MK7C 5JR9A 3FHNA 3J9X1 4AKLA 5LGTB 1HFAA 4QXBB 2XAGB 4E7ZA 3CQXC 4UVCB 3CKDA 2MBGA 2NW9A 2D5UA 4M1PA 1AJ3A 4I6NA 1VRBA 3ZYKA 4N78D 2OA5A 3RC3A 4PJMA 2NTXA 2V7IA 5C8YE 4OYJA 4ANJA 4IE7A 5JRCA 1QUUA 2LOPA 2LSKA 2ZM0A 3HR0A 4BJNA 3WAJA 1SHZC 4PJLA 3IHRA 4UEMA 4MBQA 4X20E 4UIGA 2Y6XA 2E9XC 5LJMA 3N9OA 4KUMB 3KV9A 5DQVA 4ZHQE 3FBLA 4FI5A 4ZI7E 5LA6E 5L3GB 3K3OA 2KNDA 4H9SE 4IE0A 4DBRA 4H9OC 1NAFA 1Y64B 2V7MA 4H9RC 4EOZB 4GOUA 2L3LA 3H37A 4XBFB 3KV5A 3PURA 4PK6A 5HXSA 5J2UE 3CQCB 3MKDA 3B13A 5JDQA 3DP7A 2W61A 3ONXA 5HYAA 2LJLA 1MNEA 3ZPOA 3AVRA 5LG4A 2Y48B 1BR2A 5FXZA 3LK3B 4O4IE 4G63A 4CQIA 3IF8B 3J7Yq 1HTJF 4L5GA 2VKHA 2P9BA 5J2TE 1D0YA 2HPJA 4NUVA 4ZOLE 1ZV4X 3BQLA 2NP9A 2V7LA 5LHGB 3C50A 2I59A 4X1YE 2ODUA 3AB3B 3RRCA 1MMAA 5LNKA 3Q5XA 3N9NA 5JDMA 1G8XA 2PBIA 5F3JA 2LENA 3EUHA 4AI6A 1LVKA 4B6XA 2X9YA 2KZ7B 2G0UA 2V7KA 3ZMZB 4IGUA 1IAPA 3ETVA 3F2EA 3LK42 2CWYA 3Q5WA 4PFPA 2EHOC 5CA0E 2DCFA 4WBOA 3AVSA 4CI2B 4X1KE 3I1AA 3VU7H 1BR0A 1D1AA 4GIWA 5GONE 3E22E 2V26A 5LHIB 3NRXA 2PFVA 3LBXB 3F31A 5F8PA 4A56A 5JDFA 5JR9B 3O9XA 1FMWA 2ZM2A 3WAKA 4EB6E 3C51A 5LBQB 5KDMC 4JUYA 3I9WA 3FXEB 5FYMA 3ZMUB 4IG7A 2J1DG 4XZCA 3B57A 2W63A 2XAQB 3RX6A 1MMNA 2DLRA 4E7SA 2LHRA 5JRCB 3IRTA 3O1JA 5KMGP 4PFOA 5IYZE 4DMVA 3RYFE 3TB3A 4YJ3E 5EK2A 3CMLA 5HXCA 5JREA 4IE4A 2X9HA 4DVDA 4EXTA 3MXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UEM A;  3IHR A;  3RII A;  1CMX A;  4IG7 A;  4UEL A;  2LEN A;  3RIS A;  3IFW A;  3KW5 A;  4I6N A;  2ETL A;  1XD3 A;  3A7S A;  3TB3 A;  4DM9 A;  3IRT A;  1UCH A;  4JKJ A;  3KVF A; 
#chains in the Genus database with same CATH topology
 4QWN B;  4TUY E;  5JVD E;  2LKG A;  2YU2 A;  3AEE A;  1YQ3 A;  3RYH E;  4ZI3 D;  2MAW A;  1N36 T;  3N5L A;  3VKH A;  1UUR A;  3ZEF B;  2NTY A;  4AKR B;  5HEJ A;  4QH4 A;  4ADZ A;  5AFU L;  5FY1 A;  3M65 A;  1WR6 A;  3P4R A;  3CQG B;  4AIS A;  2UXD T;  3HKC E;  4EZ4 A;  5LGN B;  2JQ9 A;  4GYR A;  5L4E A;  1XD3 A;  3NZP A;  3E0Z A;  1BR4 A;  4KMC A;  3KVF A;  3AE1 A;  3AA0 B;  4AKI A;  5ABF A;  4ILB A;  4UF0 A;  4LF4 T;  2KWH A;  4IE6 A;  4ZI2 C;  5HCM A;  3TLU A;  2C0S A;  1ZKE A;  1H7C A;  4EYU A;  4CXY A;  4H9N C;  4I55 E;  2WSS V;  3TLW A;  2JMH A;  4PW8 A;  2QGS A;  1L0V A;  3SWH A;  2CE7 A;  2BKO A;  5AQL B;  3I0Q A;  3AE8 A;  2E9X D;  4KHP T;  2KIN B;  2CWO A;  4Z8X A;  3DTO A;  2HN1 A;  5DAB A;  3SFD A;  3RIU C;  3ZYL A;  3PUV F;  2JMK A;  3AEB A;  4Q25 A;  2LM9 A;  4CXX A;  2MPK A;  2CHO A;  3AA6 B;  2MTQ A;  4DO0 A;  2Q9Q A;  4O8S A;  1X9B A;  3UUX B;  4EAH A;  3A7S A;  2ODV A;  1W0A A;  4OHF A;  4H63 V;  5AQF B;  1MIW A;  3ZMV B;  5JR9 C;  3L09 A;  3RKO A;  3FBZ A;  2X66 A;  4C91 A;  2AXD S;  3BK9 A;  4DV0 T;  4MFR A;  2YDS A;  4ISS A;  4QXH B;  2K24 A;  5L3E B;  4F6R C;  1S94 A;  4QH1 A;  4PJN A;  3AAA B;  2RPA A;  3U78 A;  3AA7 B;  3RIS A;  3KDS E;  3ZYM A;  1IBK T;  3QNU A;  5J0Z A;  3SOL A;  4MLK A;  4AQG A;  2WP9 A;  2FJB A;  2BS3 A;  2A2F X;  3ZC0 A;  3U3I A;  3P4Q A;  2VL0 A;  3P4P A;  4LF9 T;  4UVB B;  3NZQ A;  2WMO A;  1HR0 T;  3AED A;  3ZN0 B;  2CLY C;  2JRK A;  4ILC A;  3Q5D A;  5LMU T;  1N34 T;  4LF5 T;  2UXN B;  1XMQ T;  1OED B;  4WBN E;  2E2A A;  2VKO A;  4AQF C;  2WDR A;  2WBL A;  4V1A v;  3FZK B;  5LYJ E;  4EED A;  4UXN B;  2H3R A;  3UTK A;  2BG9 E;  4YJ2 E;  3LK2 B;  4DUY T;  4X64 T;  2E8I A;  5L2L A;  1UK5 A;  5C3J A;  2M67 A;  3C4W A;  3S4U A;  5JH7 E;  2K9A A;  3CIR A;  3ZST A;  2K3W A;  2OLT A;  4LF7 T;  4JLE A;  2N9D A;  2LSG A;  5HCJ A;  2NW8 A;  4GK5 E;  2WDQ A;  1E7P A;  3VKG A;  2M6B A;  3QK6 A;  2X9X A;  1YKE B;  1WYB A;  1WFD A;  4KBM B;  2ZLY A;  3RIU A;  2CMR A;  3FZF B;  5LMN T;  4H9P C;  4H9Q C;  1DU2 A;  3G06 A;  3UFE A;  1T98 A;  3PUS A;  2XJ7 A;  3UQ4 A;  3UUN A;  3KVB A;  2X0L B;  1YD8 G;  5CJ5 A;  4AXP A;  4O4H E;  2B1E A;  4DR4 T;  5AQV B;  5FNV E;  4YHH T;  5EZY E;  3LDQ B;  3OKQ A;  5JR9 A;  4AKL A;  2UXC T;  1HFA A;  3JCF A;  4UVC B;  3ZYK A;  2OA5 A;  4PJM A;  2FJE A;  4BJN A;  4UEM A;  4X20 E;  2JIW A;  3KV9 A;  5DQV A;  4ZHQ E;  3JAE A;  4DID B;  2UXB T;  5L3G B;  3K3O A;  4AQY T;  5AQM B;  4GOU A;  1W9R A;  4HWH A;  3CQC B;  3ONX A;  1HNW T;  1MNE A;  5LG4 A;  4UR9 A;  1BR2 A;  4G63 A;  4CQI A;  1HTJ F;  2VKH A;  2P9B A;  4ZOL E;  1ZV4 X;  3BQL A;  3P4S A;  2I59 A;  4X1Y E;  3AB3 B;  3RRC A;  1MMA A;  3Q5X A;  1N33 T;  2LRK A;  4U2Y A;  5F3J A;  4ZEY A;  3AXJ A;  4AI6 A;  1LVK A;  3Q5W A;  2EHO C;  1IBL T;  4WBO A;  3AE3 A;  3AVS A;  3I1A A;  1BR0 A;  4TWF A;  2V26 A;  5LHI B;  3NKZ A;  3F31 A;  3RIA A;  2BBH A;  5JDF A;  2WQY A;  4DV6 T;  3I9W A;  5FYM A;  1T72 A;  1M7K A;  4E7S A;  5JRC B;  4LFB T;  3RYF E;  4YJ3 E;  3PUW F;  4DVD A;  3MXZ A;  1E1H B;  5KX5 E;  3EDV A;  3PUQ A;  2Q9Q D;  2IC9 A;  1J1J A;  1WR0 A;  5LCY A;  4A98 A;  3JC6 C;  2UXX B;  4DR5 T;  5LB7 B;  1HS7 A;  3HA4 A;  3ZMT B;  3N2O A;  3UQ7 A;  3X1D A;  3Q9D A;  3RPU A;  3T1H T;  2J4G A;  3ONJ A;  3HKE E;  4QX8 B;  2WZH A;  3AEG A;  1QLB A;  3GMI A;  2WAU A;  3A7M A;  4NUU A;  3ZCI A;  4YTM A;  5E0O A;  3EHZ A;  3RII A;  4KP3 C;  5ABH A;  2CM0 A;  3RI5 A;  2BVM A;  1HG2 A;  5ABE A;  1YXR A;  3ANW B;  1S35 A;  2DHR A;  2XTL A;  4O2B E;  2BVL A;  3RGL A;  5CFB A;  2KWI B;  3Q2M A;  4I4T E;  5FXW A;  3CX6 B;  1CMX A;  3KVA A;  2VK9 A;  2VWA A;  2LLY A;  2HN2 A;  3E08 A;  4PJJ A;  1I94 T;  3UT5 E;  3UU5 A;  3IRT A;  4IDZ A;  3ESL A;  4PNI A;  4LF8 T;  2XM1 A;  5A1L A;  2JPF A;  3ANW A;  4TWH A;  2WY2 A;  4J2C A;  4UVA B;  2X68 A;  3T1Y T;  3I9Y A;  2YIN A;  4KI0 F;  2VUR A;  4BAY B;  3I0O A;  2H7V C;  3N9L A;  3RF1 A;  3GN5 A;  2XSB A;  4ZXL A;  3A5X A;  1T8B A;  2EHO A;  4HWI B;  5HEO A;  4WNK A;  1XZY A;  3PV0 F;  4X5T A;  4ASK A;  2WS3 A;  3O1H A;  4U33 A;  2VKD A;  5JQG E;  2XQ4 A;  1LKX A;  4H63 H;  5HEU A;  2XQ7 A;  2W0G A;  5ABF B;  4UF0 B;  3KIN B;  5AQR B;  4HFB A;  2CRB A;  2UUA T;  2C5K T;  2XSA A;  2PTF A;  1LRZ A;  2ETL A;  1NWM X;  2DWG A;  4U72 A;  4B3M T;  1SE7 A;  2YEV C;  4NXN T;  3RKG A;  2LSJ A;  3FB2 A;  2V5C A;  2XAJ B;  3JAF A;  4YSX A;  4HFD A;  5AQU B;  1IJ5 A;  3ZJ1 A;  2X0Y A;  5LHH B;  2CCQ A;  3OBV E;  4XAX B;  4P0B A;  4L0R A;  1WLX A;  2DWK A;  2HH7 A;  2XUE A;  2Q9Q B;  3K3Q C;  3ZSS A;  2X0H A;  2CXF A;  4IT4 A;  3KFW X;  1HNX T;  1LVF A;  1U4Q A;  3AE5 A;  1YQ4 A;  4YT0 A;  4JI0 T;  4I0U A;  3ZCJ A;  3FZL B;  2YU1 A;  4C90 A;  3VRB A;  3CX7 B;  2LM2 A;  1OED E;  3PU8 A;  5HWY A;  3CWZ B;  2QA7 A;  4OFZ A;  4AKG A;  3PUY F;  2D0U A;  1IZN B;  2VAS A;  3O1I A;  4B3T T;  4ZI3 C;  2KT9 A;  2IUB A;  3R6N A;  2Z6E A;  2IML A;  3ONL C;  1VCT A;  3L3P A;  1D0X A;  3IA3 A;  2NR4 A;  3K8P C;  4CZZ B;  5LXT E;  2NWB A;  3KV4 A;  1MND A;  3PTR B;  3TLV A;  5LJN A;  2XZE A;  5FMN A;  1UGO A;  2J62 A;  3AEC A;  5CGM A;  2BKP A;  5FY7 A;  3P50 A;  5CA1 E;  3PJA J;  4CI3 B;  3L8R A;  2LOS A;  3CPZ A;  4B3R T;  1QSD A;  3LBX A;  4HFE A;  2RA1 A;  3MK7 C;  3J9X 1;  3ZKR A;  2V6X A;  1CHU A;  4E7Z A;  3CKD A;  2MBG A;  2NW9 A;  2D5U A;  4I6N A;  4N78 D;  2V7I A;  4OYJ A;  1QUU A;  4MBQ A;  2XQ8 A;  2E9X C;  3N9O A;  3FBL A;  4ZI7 E;  4H9S E;  4DBR A;  4H9O C;  1NAF A;  2V7M A;  4EOZ B;  4JI4 T;  2L3L A;  3KV5 A;  4PK6 A;  5L4H A;  5J2U E;  3RQW A;  3PJA A;  4HFH A;  2W61 A;  3UUB A;  1KNR A;  2LJL A;  1Z8U A;  3AVR A;  2BKN A;  3IF8 B;  2BG9 C;  3QB5 A;  3M3Z B;  5J2T E;  5FVL A;  4NUV A;  2YKS A;  4HFC A;  5LHG B;  1JNR A;  4JI6 T;  2V5D A;  3N9N A;  1G8X A;  2PBI A;  4NPP A;  4B6X A;  2X9Y A;  1IAP A;  1FJG T;  3F2E A;  4PFP A;  5ABG A;  4CN6 A;  2VVS A;  2XQ5 A;  4X1K E;  3OPC A;  2V6Y A;  3E22 E;  2BS2 A;  3NRX A;  2PFV A;  4A56 A;  5JR9 B;  2ZM2 A;  4B3S T;  3C51 A;  5AQO B;  2H89 A;  4YTN A;  3UU4 A;  4JUY A;  3FXE B;  3ZMU B;  2J1D G;  2W63 A;  4IDQ A;  2LHR A;  4EGW A;  4GKK T;  4PFO A;  5IYZ E;  5EK2 A;  3CML A;  5JRE A;  4IE4 A;  4X62 T;  4EXT A;  4HWC A;  2QYW A;  3KBU A;  3MJX A;  3DJB A;  5HXE A;  4U7Y A;  5L3C B;  5EK4 A;  3HL6 A;  3UU3 A;  2OV9 A;  3EAM A;  2J47 A;  5JDG A;  2XQA A;  2C5I T;  4WZX A;  2BS4 A;  4QHO A;  3PE0 A;  3K3N A;  3UU8 A;  2YOE A;  2XQ9 A;  2XAS B;  5JDN A;  2CLY B;  1ZHC A;  2CHN A;  3RH3 A;  1HX8 A;  4Z91 A;  5EK3 A;  4TNW A;  5LOV E;  3H3M A;  4JKJ A;  1D0Z A;  4IHJ E;  4EIW A;  3AXJ B;  2WWV A;  5FKY A;  5FL1 A;  3AE9 A;  3WI3 A;  2WU5 A;  5ETW A;  2LT3 A;  4TX5 A;  5DJQ C;  2E9X A;  2IAK A;  4DND A;  2GK9 A;  5M4Y A;  3KW5 A;  4IL4 A;  2LHN A;  5IUX A;  2UU9 T;  4AKH A;  3N9M A;  1O3X A;  5HXR A;  2C5J A;  4JI5 T;  4AQF A;  5FP3 A;  2CBI A;  4LFA T;  2MOZ A;  3OYZ A;  2JQQ A;  3UUM A;  2D2S A;  5H6R B;  2XPK A;  3CK6 A;  2BG9 A;  5JDH A;  4LFC T;  4HWF A;  4GYS A;  3QB5 K;  3D0T A;  4X65 T;  3NWI A;  3UU6 A;  4JEH B;  5H6Q B;  4IIJ E;  2LKH A;  2ES0 A;  1KFY A;  3ZJ2 A;  4O4L E;  2L9Q A;  4HN9 A;  5IHY A;  4ZZB A;  2DNX A;  4ERR A;  4I50 E;  3BQK A;  3R84 B;  5AQS B;  1V9D A;  2IW5 B;  2I0M A;  3PU3 A;  3PUG A;  3F57 A;  3PDY A;  2X67 A;  2D0T A;  3TKL B;  1MIY A;  4DR2 T;  1XNQ T;  3VR9 A;  4EZH A;  1XMO T;  1JNZ A;  4MAL A;  3TLS A;  1WYC A;  2ZMA A;  2LSY A;  1ZP0 A;  2FBW A;  4FJO A;  2V8S V;  2CBJ A;  1VCS A;  5L3F B;  1US7 B;  3SFE A;  5HXH A;  5HWX A;  3HKD E;  2KSR A;  2A9U A;  2WMN A;  4DM9 A;  3AA1 B;  1G73 A;  1YW0 A;  1KK7 A;  2IC6 A;  3ZMS B;  4IDO A;  3C4X A;  4HE8 A;  3GWH A;  4DMW A;  3EVY A;  5J1G A;  3QUJ A;  1N32 T;  4QH5 A;  2F4V T;  3N9Q A;  1SUM B;  5FXX A;  4DBQ A;  4QKN A;  2ZM8 A;  2WWU A;  3RYI E;  3RIF A;  1XDP A;  3RRW A;  1I6Z A;  1UCU A;  4O2A E;  4GKJ T;  1GQE A;  1FMV A;  4UEL A;  3LG7 A;  3GN5 B;  4F8H A;  4WYV A;  3IFW A;  3NRY A;  2VL8 A;  4JEU B;  5LBM A;  2KXP B;  5HEH A;  2DI4 A;  2W2U A;  4COF A;  2EHO B;  3GA8 A;  4IST A;  3P8C D;  2VKJ A;  5BMV E;  4P0A A;  4HTE A;  5ADX L;  3LJC A;  3P7I A;  3K1S A;  2Q9Q C;  4KHZ F;  4OK0 A;  5C2T A;  3KV6 A;  1HNZ T;  4ZI2 D;  2JQK A;  4UV9 B;  3SS1 A;  1NEK A;  4IE5 A;  4U3C A;  3RYC E;  2UUC T;  1XWM A;  2A72 A;  3CX8 B;  1KEY A;  3B5M A;  4DV4 T;  2WZI A;  4O4J E;  5AQP B;  2W4X A;  4PAG A;  3MA9 A;  4HFV A;  2BZB A;  1IJ6 A;  5LG3 A;  3W15 B;  3H3A A;  5BR8 T;  5AQT B;  3RHW A;  4TZ4 C;  1MMG A;  5HAX A;  1VOM A;  3AE7 A;  3AEA A;  3ZT7 A;  3FHN A;  2XAG B;  4DV1 T;  1AJ3 A;  2CPT A;  3RC3 A;  2NTX A;  5C8Y E;  4ANJ A;  3TLT A;  2LOP A;  2ZM0 A;  3WAJ A;  1SHZ C;  2D9D A;  5AQN B;  3IHR A;  4UIG A;  4FI5 A;  3EI0 A;  5LA6 E;  3P4W A;  4YXD A;  2KND A;  4IE0 A;  5AQG B;  4AIU A;  2E5V A;  3H37 A;  1E2A A;  3VRA A;  5JDQ A;  3B13 A;  3DP7 A;  4U7I A;  3AEF A;  2ZM6 T;  4X66 T;  3LK3 B;  3J7Y q;  4L5G A;  4P1N A;  2HPJ A;  2NP9 A;  2V7L A;  1OED C;  3C50 A;  2ODU A;  5JTG A;  5FVK A;  5LNK A;  3ZT5 A;  5AQH B;  2LEN A;  1J5E T;  2G0U A;  2V7K A;  3ZMZ B;  3ETV A;  2CWY A;  2DCF A;  2UUB T;  4CI2 B;  1D1A A;  3LBX B;  3O9X A;  1FMW A;  3WAK A;  5LBQ B;  5KDM C;  4IG7 A;  2QVA A;  4CN4 A;  1MMN A;  2DLR A;  2IHR 1;  4OX9 T;  2WCA A;  2YDQ A;  3O1J A;  4U2Z A;  4DMV A;  4HWD A;  3TB3 A;  5HXC A;  1B7T A;  2CEA A;  5LP6 E;  1UUS A;  4TV8 E;  2LSI A;  1M62 A;  1EZ3 A;  4DR6 T;  3SRZ A;  1D1C A;  2XY8 B;  5FY0 A;  4HGA A;  3AE2 A;  1MMD A;  4X1I E;  5L3D B;  5FXV A;  2W66 A;  1D1B A;  2CXL A;  3N9P A;  1HG5 A;  5LGU B;  2MYS A;  3UUL A;  1ZEE A;  4OYK A;  3QC9 A;  2WDV A;  3VHL A;  1W0B A;  2A3D A;  4L9I A;  4IRE A;  4Z90 A;  2WM9 A;  1HCI A;  1BR1 A;  1CUN A;  2K5B B;  3C64 A;  3HI2 A;  3BQI A;  2L8K A;  4JI2 T;  4U74 A;  2XM2 A;  5JDL A;  4CI1 B;  3Q5E A;  4KX6 A;  2XAH B;  4TNV A;  2V6Y B;  1T7S A;  4JV5 T;  2E5L T;  2V1D B;  3EDU A;  2M6I A;  4QXC B;  3V5U A;  5KXJ A;  2HPL A;  2LE8 A;  5F5W A;  3VR8 A;  3LFM A;  1Y01 A;  4ZS3 A;  3IEE A;  2XAF B;  1WRD A;  4DR1 T;  2JJ9 A;  1R8I A;  1U5P A;  4NIQ A;  3LSV A;  4PK4 A;  1FIO A;  4YFS A;  3PUA A;  4EEB A;  5IWA T;  3KBT A;  1UX5 A;  1OED A;  5FL0 A;  5L47 A;  3EAB A;  4UV8 B;  2IDO B;  5TAO A;  4YSZ A;  5DQW A;  2VB6 A;  4LF6 T;  4TWD A;  4P09 A;  3MAC A;  3PUZ F;  3RQU A;  4YTP A;  3AAE B;  1OWA A;  3NVO A;  2VQF T;  3L39 A;  4G2A A;  3OVU A;  4IDP A;  4YHJ A;  3C4Z A;  3N2G E;  5AQI B;  1YKH B;  2CA5 A;  1UCH A;  2EHO D;  4A97 A;  1FEW A;  1MIV A;  4YSY A;  2PG8 A;  2E9X B;  4DV7 T;  3AE4 A;  4CN1 A;  3HKB E;  3ETU A;  3FZH B;  3ZT6 A;  2ACX A;  4QX7 B;  2DL1 A;  2W00 A;  1KNZ A;  3OJA A;  3A8Y C;  1NEN A;  3MZK B;  4HEA A;  2BDE A;  4MHC A;  1SA0 E;  1UX4 A;  2BG9 B;  1ZOY A;  2Y8D A;  2XQY A;  3CVR A;  2PJQ A;  3JC6 D;  2X51 A;  2AE9 A;  3OTO T;  4GK0 E;  4PK5 A;  5AQK B;  2BBJ A;  4YY3 T;  3FXD B;  3V5S A;  2W62 A;  1J5W A;  2B76 A;  3AE6 A;  4BA9 A;  2KMF A;  4BJM A;  4HFI A;  2YK0 A;  2N1G A;  1HF8 A;  2NW7 A;  2CXD A;  1OXZ A;  4U31 A;  2XHE B;  4K0U A;  2W67 A;  4I43 B;  4DV2 T;  3NBX X;  2FJA A;  3C98 B;  4ZZC A;  4WW0 A;  2K48 A;  2SPC A;  3AAI A;  2KLQ A;  4ZS2 A;  3ZN1 B;  2N2N A;  2NOX A;  5CB4 E;  3T8O A;  3ZLI A;  2LEH A;  3ZC1 A;  2H7O A;  2YN6 A;  4YLH A;  4K0K T;  4DV3 T;  1W09 A;  3O4X E;  3UFG A;  4JYA T;  2RP4 A;  5AQQ B;  2QRX A;  2VVN A;  1XNR T;  2V7J A;  2LRL A;  4JBW F;  5L3B B;  3N2K E;  4TN7 B;  4ILU A;  4IDN A;  2XQ3 A;  2JQH A;  2VQE T;  4ILA A;  3QOF A;  1Z0P A;  3IBP A;  3RC8 A;  4EYY R;  2X9W A;  3OYX A;  4JI8 T;  4CXW A;  1X79 A;  4HKA A;  3FZM B;  4TV9 E;  5LGT B;  4QXB B;  1HX1 B;  3CQX C;  2FUP A;  4M1P A;  4LMJ A;  1VRB A;  5JRC A;  4IE7 A;  1WCR A;  2LSK A;  2FJD A;  2YDR A;  3HR0 A;  4PJL A;  3JAD A;  2Y6X A;  4A5X A;  1KNP A;  5LJM A;  4KUM B;  1Y64 B;  4H9R C;  5HEG A;  4XBF B;  3PUR A;  5HXS A;  2WU2 A;  4DR3 T;  2IIU A;  2I6H A;  3MKD A;  5HYA A;  4EV6 A;  3ZPO A;  1KF6 A;  2Y48 B;  4JI3 T;  5FXZ A;  4O4I E;  2XQ6 A;  1D0Y A;  4IL9 A;  5JDM A;  3EUH A;  2KZ7 B;  4LML A;  5AQJ B;  3ABV A;  4JI7 T;  4IGU A;  2ACZ A;  4LMK A;  3LK4 2;  1IBM T;  5CA0 E;  3VU7 H;  4GIW A;  5GON E;  4NXM T;  3RLF F;  5F8P A;  4DR7 T;  4EB6 E;  4DUZ T;  4XZC A;  3B57 A;  2XAQ B;  2WB5 A;  4JI1 T;  3RX6 A;  2HHH T;  2H88 A;  5KMG P;  3PUX F;  2R6G F;  1XDO A;  4DV5 T;  2X9H A; 
#chains in the Genus database with same CATH homology
 1B7T A;  2CEA A;  4QWN B;  5LP6 E;  1E1H B;  4TV8 E;  2LSI A;  3KBU A;  3MJX A;  5KX5 E;  4TUY E;  3DJB A;  5JVD E;  5HXE A;  3EDV A;  1EZ3 A;  3PUQ A;  2YU2 A;  5L3C B;  2Q9Q D;  3SRZ A;  1D1C A;  5EK4 A;  2IC9 A;  5FY0 A;  3HL6 A;  4HGA A;  3RYH E;  4ZI3 D;  1MMD A;  5LCY A;  3JC6 C;  2UXX B;  3N5L A;  3VKH A;  5JDG A;  3ZEF B;  2C5I T;  2NTY A;  4AKR B;  1HS7 A;  3HA4 A;  4X1I E;  5L3D B;  3ZMT B;  3N2O A;  4ADZ A;  5AFU L;  5FY1 A;  4QHO A;  5FXV A;  3PE0 A;  3K3N A;  1D1B A;  3M65 A;  2CXL A;  1WR6 A;  3N9P A;  1HG5 A;  3Q9D A;  5LGU B;  2MYS A;  3RPU A;  3CQG B;  3UUL A;  3HKC E;  4EZ4 A;  1ZEE A;  3HKE E;  3QC9 A;  4OYK A;  4QX8 B;  2XAS B;  5JDN A;  5LGN B;  2CLY B;  4GYR A;  1ZHC A;  3VHL A;  2A3D A;  3RH3 A;  1XD3 A;  4L9I A;  1HX8 A;  5EK3 A;  3GMI A;  3NZP A;  2WAU A;  5LOV E;  3E0Z A;  4NUU A;  4JKJ A;  1BR4 A;  4KMC A;  3KVF A;  1D0Z A;  2WM9 A;  3AA0 B;  4IHJ E;  4EIW A;  1HCI A;  4AKI A;  1BR1 A;  1CUN A;  2K5B B;  3C64 A;  4UF0 A;  3ZCI A;  3HI2 A;  3BQI A;  5E0O A;  2KWH A;  2L8K A;  4IE6 A;  4U74 A;  4ZI2 C;  3RII A;  4KP3 C;  5JDL A;  2C0S A;  2CM0 A;  3WI3 A;  4CI1 B;  2BVM A;  1HG2 A;  1ZKE A;  5ETW A;  1H7C A;  2LT3 A;  4TX5 A;  5DJQ C;  4EYU A;  2E9X A;  2IAK A;  4DND A;  4CXY A;  2GK9 A;  2XAH B;  4H9N C;  3ANW B;  5M4Y A;  3KW5 A;  4I55 E;  2WSS V;  1S35 A;  2JMH A;  4PW8 A;  2LHN A;  2DHR A;  2XTL A;  2V1D B;  3EDU A;  4O2B E;  2QGS A;  2BVL A;  4QXC B;  4AKH A;  2KWI B;  3N9M A;  3SWH A;  3V5U A;  1O3X A;  3Q2M A;  5HXR A;  2C5J A;  4I4T E;  5FXW A;  2CE7 A;  3CX6 B;  1CMX A;  2HPL A;  3KVA A;  4AQF A;  3I0Q A;  5FP3 A;  2VK9 A;  2VWA A;  2LE8 A;  2E9X D;  3LFM A;  3E08 A;  4ZS3 A;  3IEE A;  2KIN B;  4PJJ A;  3UT5 E;  2MOZ A;  2CWO A;  4Z8X A;  2XAF B;  3DTO A;  3OYZ A;  1WRD A;  2JQQ A;  4IDZ A;  5DAB A;  2D2S A;  3ESL A;  2JJ9 A;  4PNI A;  1U5P A;  5H6R B;  3UUM A;  3ZYL A;  5A1L A;  5JDH A;  2JPF A;  2JMK A;  3ANW A;  4PK4 A;  1FIO A;  2LM9 A;  4YFS A;  4J2C A;  4CXX A;  3PUA A;  3KBT A;  4GYS A;  1UX5 A;  3AA6 B;  3D0T A;  4UVA B;  2X68 A;  4JEH B;  2MTQ A;  5H6Q B;  3I9Y A;  4IIJ E;  2YIN A;  4UV8 B;  4DO0 A;  2ES0 A;  2Q9Q A;  4O8S A;  4BAY B;  3ZJ2 A;  4O4L E;  3UUX B;  3I0O A;  5TAO A;  2L9Q A;  5DQW A;  4HN9 A;  2VB6 A;  4EAH A;  2H7V C;  3N9L A;  5IHY A;  3GN5 A;  3A7S A;  2ODV A;  2DNX A;  4ERR A;  3A5X A;  4P09 A;  3MAC A;  4OHF A;  2EHO A;  4H63 V;  1MIW A;  4I50 E;  4WNK A;  3ZMV B;  3BQK A;  3R84 B;  3AAE B;  5JR9 C;  1V9D A;  2IW5 B;  3L09 A;  3RKO A;  4ASK A;  3FBZ A;  3PU3 A;  3O1H A;  1OWA A;  2X66 A;  4C91 A;  2VKD A;  5JQG E;  3PUG A;  3F57 A;  3PDY A;  2X67 A;  2D0T A;  1LKX A;  3TKL B;  1MIY A;  3BK9 A;  4G2A A;  4EZH A;  4H63 H;  4YHJ A;  3C4Z A;  3N2G E;  4MAL A;  2W0G A;  1YKH B;  1WYC A;  4MFR A;  2ZMA A;  4UF0 B;  2LSY A;  2CA5 A;  1UCH A;  2EHO D;  4FJO A;  4ISS A;  4QXH B;  1FEW A;  2K24 A;  3KIN B;  1MIV A;  5L3E B;  4F6R C;  1S94 A;  2PG8 A;  2E9X B;  5L3F B;  1US7 B;  4PJN A;  3HKB E;  5HXH A;  2C5K T;  3AAA B;  5HWX A;  3HKD E;  3ETU A;  3U78 A;  3AA7 B;  3RIS A;  3KDS E;  3ZYM A;  2WMN A;  1LRZ A;  2ETL A;  2ACX A;  3SOL A;  4MLK A;  4QX7 B;  4DM9 A;  1NWM X;  3AA1 B;  1G73 A;  1YW0 A;  4AQG A;  1KK7 A;  2IC6 A;  3ZMS B;  2DWG A;  2W00 A;  4U72 A;  1KNZ A;  3C4X A;  2A2F X;  4HE8 A;  3GWH A;  3ZC0 A;  4DMW A;  3OJA A;  3EVY A;  3U3I A;  5J1G A;  2YEV C;  3QUJ A;  3MZK B;  4HEA A;  2BDE A;  4MHC A;  4UVB B;  2LSJ A;  3FB2 A;  3NZQ A;  2WMO A;  3N9Q A;  1SA0 E;  1UX4 A;  2XAJ B;  3ZN0 B;  2CLY C;  2JRK A;  2Y8D A;  5FXX A;  2XQY A;  4DBQ A;  4QKN A;  2ZM8 A;  3CVR A;  2WWU A;  2PJQ A;  3JC6 D;  1IJ5 A;  2UXN B;  2X51 A;  3RYI E;  3ZJ1 A;  4GK0 E;  3RRW A;  4PK5 A;  4WBN E;  2VKO A;  5LHH B;  3FXD B;  2CCQ A;  3V5S A;  1UCU A;  2W62 A;  4O2A E;  3OBV E;  4XAX B;  4AQF C;  4L0R A;  1WLX A;  2DWK A;  2HH7 A;  4P0B A;  2XUE A;  2Q9Q B;  2WBL A;  3K3Q C;  4V1A v;  2CXF A;  4BA9 A;  1FMV A;  3KFW X;  4UEL A;  5LYJ E;  2KMF A;  3LG7 A;  4UXN B;  4BJM A;  3GN5 B;  1LVF A;  2H3R A;  3UTK A;  1U4Q A;  3IFW A;  3LK2 B;  3NRY A;  2VL8 A;  4JEU B;  5LBM A;  2KXP B;  4YJ2 E;  2E8I A;  2YK0 A;  2DI4 A;  1HF8 A;  2N1G A;  5L2L A;  3ZCJ A;  2EHO B;  2YU1 A;  4C90 A;  2NW7 A;  3GA8 A;  4IST A;  3CX7 B;  3P8C D;  2M67 A;  2VKJ A;  3C4W A;  5BMV E;  4P0A A;  3PU8 A;  5HWY A;  3S4U A;  4HTE A;  5ADX L;  5JH7 E;  2K9A A;  3LJC A;  3CWZ B;  2QA7 A;  3P7I A;  2CXD A;  4OFZ A;  4AKG A;  1OXZ A;  2XHE B;  4K0U A;  2Q9Q C;  4OK0 A;  2D0U A;  4I43 B;  1IZN B;  2VAS A;  3NBX X;  3KV6 A;  3C98 B;  3O1I A;  4ZI3 C;  4JLE A;  2KT9 A;  2N9D A;  4ZI2 D;  4WW0 A;  2K48 A;  2LSG A;  2Z6E A;  4UV9 B;  2SPC A;  3R6N A;  2NW8 A;  3AAI A;  2KLQ A;  4ZS2 A;  4IE5 A;  3SS1 A;  3ZN1 B;  2N2N A;  4GK5 E;  3RYC E;  2NOX A;  5CB4 E;  3T8O A;  3ZLI A;  2A72 A;  2LEH A;  3L3P A;  3VKG A;  3ZC1 A;  3CX8 B;  1D0X A;  2H7O A;  3K8P C;  3QK6 A;  2X9X A;  4CZZ B;  1YKE B;  1WYB A;  4YLH A;  5LXT E;  4KBM B;  2NWB A;  2ZLY A;  2CMR A;  3O4X E;  3KV4 A;  1MND A;  4O4J E;  3PTR B;  2RP4 A;  4H9P C;  4H9Q C;  2V7J A;  5LJN A;  5FMN A;  3UFE A;  1T98 A;  3N2K E;  3PUS A;  5L3B B;  4TN7 B;  4ILU A;  4PAG A;  3KVB A;  3UUN A;  2X0L B;  5FY7 A;  5CA1 E;  3MA9 A;  1YD8 G;  1Z0P A;  4HFV A;  2BZB A;  3IBP A;  4CI3 B;  1IJ6 A;  2LOS A;  3H3A A;  3W15 B;  4AXP A;  4O4H E;  2B1E A;  3CPZ A;  4EYY R;  3RC8 A;  4TZ4 C;  2X9W A;  3OYX A;  5FNV E;  1MMG A;  5EZY E;  5HAX A;  1VOM A;  4CXW A;  1X79 A;  4HKA A;  1QSD A;  3LBX A;  3OKQ A;  2RA1 A;  4TV9 E;  3MK7 C;  5JR9 A;  3FHN A;  3J9X 1;  4AKL A;  5LGT B;  1HFA A;  4QXB B;  2XAG B;  4E7Z A;  3CQX C;  4UVC B;  3CKD A;  2MBG A;  2NW9 A;  2D5U A;  4M1P A;  1AJ3 A;  4I6N A;  1VRB A;  3ZYK A;  4N78 D;  2OA5 A;  3RC3 A;  4PJM A;  2NTX A;  2V7I A;  5C8Y E;  4OYJ A;  4ANJ A;  4IE7 A;  5JRC A;  1QUU A;  2LOP A;  2LSK A;  2ZM0 A;  3HR0 A;  4BJN A;  3WAJ A;  1SHZ C;  4PJL A;  3IHR A;  4UEM A;  4MBQ A;  4X20 E;  4UIG A;  2Y6X A;  2E9X C;  5LJM A;  3N9O A;  4KUM B;  3KV9 A;  5DQV A;  4ZHQ E;  3FBL A;  4FI5 A;  4ZI7 E;  5LA6 E;  5L3G B;  3K3O A;  2KND A;  4H9S E;  4IE0 A;  4DBR A;  4H9O C;  1NAF A;  1Y64 B;  2V7M A;  4H9R C;  4EOZ B;  4GOU A;  2L3L A;  3H37 A;  4XBF B;  3KV5 A;  3PUR A;  4PK6 A;  5HXS A;  5J2U E;  3CQC B;  3MKD A;  3B13 A;  5JDQ A;  3DP7 A;  2W61 A;  3ONX A;  5HYA A;  2LJL A;  1MNE A;  3ZPO A;  3AVR A;  5LG4 A;  2Y48 B;  1BR2 A;  5FXZ A;  3LK3 B;  4O4I E;  4G63 A;  4CQI A;  3IF8 B;  3J7Y q;  1HTJ F;  4L5G A;  2VKH A;  2P9B A;  5J2T E;  1D0Y A;  2HPJ A;  4NUV A;  4ZOL E;  1ZV4 X;  3BQL A;  2NP9 A;  2V7L A;  5LHG B;  3C50 A;  2I59 A;  4X1Y E;  2ODU A;  3AB3 B;  3RRC A;  1MMA A;  5LNK A;  3Q5X A;  3N9N A;  5JDM A;  1G8X A;  2PBI A;  5F3J A;  2LEN A;  3EUH A;  4AI6 A;  1LVK A;  4B6X A;  2X9Y A;  2KZ7 B;  2G0U A;  2V7K A;  3ZMZ B;  4IGU A;  1IAP A;  3ETV A;  3F2E A;  3LK4 2;  2CWY A;  3Q5W A;  4PFP A;  2EHO C;  5CA0 E;  2DCF A;  4WBO A;  3AVS A;  4CI2 B;  4X1K E;  3I1A A;  3VU7 H;  1BR0 A;  1D1A A;  4GIW A;  5GON E;  3E22 E;  2V26 A;  5LHI B;  3NRX A;  2PFV A;  3LBX B;  3F31 A;  5F8P A;  4A56 A;  5JDF A;  5JR9 B;  3O9X A;  1FMW A;  2ZM2 A;  3WAK A;  4EB6 E;  3C51 A;  5LBQ B;  5KDM C;  4JUY A;  3I9W A;  3FXE B;  5FYM A;  3ZMU B;  4IG7 A;  2J1D G;  4XZC A;  3B57 A;  2W63 A;  2XAQ B;  3RX6 A;  1MMN A;  2DLR A;  4E7S A;  2LHR A;  5JRC B;  3IRT A;  3O1J A;  5KMG P;  4PFO A;  5IYZ E;  4DMV A;  3RYF E;  3TB3 A;  4YJ3 E;  5EK2 A;  3CML A;  5HXC A;  5JRE A;  4IE4 A;  2X9H A;  4DVD A;  4EXT A;  3MXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...