4UEMA

Uch-l5 in complex with the rpn13 deubad domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
309
structure length
281
Chain Sequence
b'EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKRFNLMAIVSDRKMIYEQKIAELQRQLAESMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 86
structure length 281
sequence length 309
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uemA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uemA01
3A7SA 1UCHA 4JKJA 4DM9A 3RIIA 4UELA 4IG7A 3RISA 3IHRA 3IFWA 3IRTA 3KW5A 1XD3A 2ETLA 4UEMA 3KVFA 1CMXA 2LENA 3TB3A 4I6NA
chains in the Genus database with same CATH superfamily
2C5JA 2YKSA 3CKDA 2XAGB 2XQ7A 1ZOYA 2LHNA 2CWOA 4KP3C 3UTKA 5CJ5A 3S4UA 2LKHA 5L4EA 3PDYA 2WQYA 2D5UA 5LA6E 1WLXA 5HXEA 2L3LA 5HEHA 4UIGA 4AIUA 3IRTA 3SS1A 1MIWA 3ZYKA 2NR4A 4B3TT 2QRXA 4ZI7E 1XZYA 2BBJA 3UFEA 3ANWA 2M6BA 3GN5B 4DMVA 1IZNB 2V7JA 2CHOA 5JR9A 2HPJA 3W15B 2V8SV 2JMKA 2I59A 4TUYE 1UGOA 3ONJA 2M6IA 4L5GA 3KDSE 2WU2A 2VKDA 1SHZC 3JAFA 3NBXX 4PJJA 3RI5A 3KFWX 4OYKA 1QUUA 3EABA 3KV4A 3NVOA 4IIJE 3LBXA 5LBQB 2OV9A 3JC6D 2Q9QD 2LHRA 5JQGE 4QH4A 4UR9A 2XAFB 2LSJA 5JTGA 4IE6A 4DBQA 3E22E 3K3QC 3R84B 5LYJE 1N34T 2CM0A 3AE3A 4B6XA 4KHPT 4DVDA 3FZHB 2RP4A 2MTQA 4EOZB 5JDMA 1N32T 2FJBA 3ANWB 5ABHA 3CX6B 2NW7A 3ZYMA 4X1KE 2QYWA 3C4WA 2XQ9A 3NKZA 5DJQC 1HNXT 3RPUA 1MMNA 3SRZA 3ZC1A 4HWCA 5JR9B 3CQCB 4TWHA 4YLHA 2ZM6T 3BQIA 2XSAA 4O4JE 3RHWA 4CN4A 4IDZA 2YK0A 3EAMA 3MZKB 5HXCA 1G73A 1WYCA 4XAXB 3AEDA 3N9NA 1T98A 4CQIA 4IE5A 3RIAA 1HFAA 3LBXB 1D1AA 2XAJB 5HEUA 3ZJ2A 4N78D 2CBJA 3AEFA 4UV9B 5HCJA 2LRKA 4H9QC 1W09A 3TLVA 1S94A 4JUYA 4DR2T 5HWXA 3SOLA 4DV6T 2UXXB 4DR5T 3PV0F 3C4ZA 4I0UA 5AQMB 2BBHA 1XNRT 4U72A 2CE7A 3CQXC 4TZ4C 4YTNA 4WNKA 3GMIA 1OWAA 2JQHA 5ABGA 3RKOA 5C8YE 2VQFT 2DWKA 3SFDA 5AQVB 1XWMA 1ZHCA 3UU6A 1XMQT 4CI1B 2E5VA 4UVCB 5AQIB 1X9BA 3AE6A 2E9XA 4B3RT 3ZJ1A 4GK5E 3PUZF 1YW0A 1OEDA 3CQGB 5LJMA 3PUVF 2VK9A 3EHZA 2H7VC 2XTLA 3ETUA 3PUAA 3ZT6A 2XJ7A 3OVUA 5JDFA 2UUAT 2WMNA 5LNKA 1WCRA 3PUYF 4LFAT 3LK42 4PFPA 2NOXA 2MOZA 1XNQT 1ZV4X 2YDQA 4DV7T 2X51A 2C5KT 5IUXA 3VR8A 4JI6T 4K0KT 1SA0E 1WFDA 3U3IA 4QXCB 4U33A 5GONE 3A7MA 2V7KA 3MJXA 4DUZT 5ABEA 2Z6EA 5HXRA 4UV8B 3V5SA 3I0OA 2J1DG 3RISA 3FZLB 2EHOC 3RIUA 3ZKRA 5HEGA 4X5TA 1MIVA 3LSVA 2RA1A 4AQYT 5HEJA 5ABFA 4YT0A 2J47A 4DBRA 3HKEE 4TX5A 3Q5EA 3FXDB 4WBOA 3AE4A 1E2AA 2XPKA 1E7PA 1XDOA 3ZCJA 4QHOA 4O4HE 5FY0A 2E9XB 3ZMTB 3PUXF 1KEYA 2V7IA 3ZSTA 1OEDB 4ZI2C 3ETVA 1T7SA 5FXZA 3RQWA 2W62A 2JQKA 3AE1A 2YEVC 4HKAA 5FNVE 4AQFA 5H6QB 4YTPA 4TNWA 2ZM8A 2FJEA 3LG7A 4H9SE 3ZMSB 4U31A 2LJLA 2KMFA 3H3AA 3EVYA 4IE4A 1JNZA 2LKGA 5FYMA 2DHRA 2D9DA 2WBLA 2B76A 1FMVA 3FZKB 2WWVA 3HL6A 3VRAA 4YJ2E 4OFZA 4AKIA 3EUHA 2LENA 2DNXA 4A98A 3X1DA 4U2YA 3CIRA 4CN1A 2WDQA 3OJAA 4EXTA 4Z90A 5L3FB 3AE8A 3OPCA 5JH7E 4Z91A 4YSXA 5LGNB 3ZC0A 5AQFB 2NTXA 2ES0A 1J5WA 4AQGA 3Q5DA 4X20E 3OYXA 3KINB 4JEHB 1JNRA 3ZN1B 5ABFB 3H37A 2UU9T 2BS2A 3F57A 3N9PA 3ONLC 4X1IE 4AKGA 4H63V 3N2KE 5LCYA 2W66A 4QX8B 5IYZE 1U5PA 5JDGA 2LRLA 3ZEFB 1ZP0A 4MBQA 2X9XA 4GIWA 3UUXB 3FZFB 3AE7A 4PK6A 5LHIB 4XBFB 2OA5A 2CXDA 2H7OA 2W00A 2WCAA 4JI5T 2LT3A 3Q9DA 2VQET 1FJGT 5AQOB 3RYCE 2MYSA 4JI2T 2IAKA 3UQ7A 2FUPA 4ADZA 2W67A 3HR0A 2KSRA 4Q25A 3PUQA 3CX8B 3TLTA 1G8XA 3FBZA 4PAGA 2Q9QA 3RRWA 4LMLA 2XQ4A 3ZLIA 3HA4A 2WDRA 4QXBB 4EYYR 3VHLA 1YQ4A 3ABVA 3RC3A 1W0AA 2NP9A 4HFIA 1US7B 2ODVA 2XQ3A 3VKGA 3AEBA 4P0AA 4I50E 4JYAT 4HWFA 3TKLB 2YINA 3UULA 2JRKA 4H9PC 2YDRA 5JR9C 1HR0T 5FXWA 4JI0T 2HH7A 3UU4A 3LFMA 1LKXA 4XZCA 4EV6A 5LBMA 1EZ3A 3BK9A 4P1NA 3TLWA 2X0YA 3TLSA 5L3GB 1NWMX 4UVAB 5AQJB 3RC8A 2KLQA 2NW8A 3WAKA 4CZZB 2M67A 1XD3A 4DR7T 3VU7H 5CGMA 4ZS3A 4X66T 2CA5A 3HKCE 1CUNA 2ZM2A 3VKHA 2WB5A 4PNIA 4PJLA 3FHNA 4ZI3D 4E7ZA 4J2CA 4PJNA 2NWBA 5HEOA 2PBIA 1W9RA 3N2GE 1IBMT 1J5ET 3OKQA 1MMDA 3C51A 2C0SA 2K5BB 2Q9QB 4NXNT 5J2UE 3AA0B 4HFVA 2F4VT 1WYBA 2VASA 3P4WA 3IFWA 4KX6A 5IWAT 2W2UA 1NAFA 1YD8G 3OYZA 5L4HA 4DV1T 2AE9A 5EK4A 5JDQA 4AKLA 3I9YA 4YFSA 2BG9E 4HGAA 2XQ5A 4QH5A 3M65A 4OX9T 3P8CD 5AQSB 4LF4T 2H88A 3T8OA 2KNDA 3I9WA 4NPPA 4V1Av 3LJCA 4QWNB 2UXDT 2KINB 2N1GA 3NRYA 4IHJE 3CVRA 4DV0T 2V6XA 2X0HA 2W4XA 4MFRA 1LRZA 2UXNB 2YU2A 1I94T 3Q2MA 3KVAA 3E0ZA 2XQAA 3UUMA 2X9WA 2UUBT 4F6RC 3NWIA 5CFBA 4JLEA 3IEEA 2DL1A 2XASB 3KBUA 1D0ZA 3Q5WA 3EI0A 4DR1T 3IA3A 2VKOA 4OHFA 4X62T 1M7KA 1O3XA 2W61A 2XUEA 4E7SA 2A2FX 1HCIA 3AE5A 4DV3T 3PE0A 5C2TA 4JI4T 3GWHA 1WR0A 3F2EA 3L3PA 4JI7T 2LSYA 4A5XA 3RIIA 4JEUB 1YXRA 1IJ6A 5H6RB 3UFGA 5AQKB 2R6GF 4HWDA 1W0BA 4AI6A 4ILBA 3O1JA 4WZXA 2C5IT 3I1AA 2E9XC 4EYUA 2IW5B 4DO0A 2QA7A 2CXLA 4CN6A 1OEDC 4DM9A 4G63A 3OBVE 3IHRA 1U4QA 4KHZF 5JVDE 1KNRA 2XZEA 2I6HA 1HX1B 4QH1A 2XM1A 2BS4A 3F31A 4U2ZA 4I6NA 2CLYC 4AKRB 4YY3T 2YU1A 4U7YA 4BA9A 4IT4A 3ONXA 3AEEA 3FZMB 1CHUA 2LM2A 4LFCT 2IUBA 4UF0A 5LHGB 2BG9C 2H3RA 1HG2A 2PG8A 4HEAA 3RIUC 4EB6E 2ODUA 3AA7B 2A9UA 5AQQB 4JV5T 1KK7A 4IL4A 1T8BA 2K48A 4UVBB 4ANJA 1QLBA 2WZIA 3SWHA 5KXJA 2OLTA 2ZLYA 2BKPA 3ZCIA 1WR6A 3FBLA 2KZ7B 4HWIB 4WBNE 5HXSA 3IBPA 2LM9A 2E8IA 4H9RC 2CPTA 2KWIB 4KBMB 3KV5A 2FJAA 4LF7T 4GK0E 4ILAA 4DV5T 2NW9A 3N9OA 2HN2A 2N2NA 2WM9A 5IHYA 1LVKA 2V5CA 3CMLA 5JDLA 2EHOA 5J1GA 3BQKA 3QK6A 4DR4T 2Y8DA 4BAYB 4IE0A 2HN1A 2IDOB 4HN9A 3FB2A 2CHNA 2DWGA 4ISSA 4UF0B 4IDPA 4HFEA 3O9XA 4O2BE 5AQTB 3B13A 4WW0A 2E2AA 5AQNB 5LP6E 4DV4T 2WY2A 1ZEEA 3C4XA 2IC9A 2FJDA 1KFYA 2WZHA 2L9QA 3AVRA 3AVSA 4CXWA 1D0YA 5L2LA 3K3OA 5LHHB 4HE8A 1N33T 4YTMA 5LXTE 1V9DA 2CCQA 1Z0PA 3QUJA 2ACXA 3LDQB 1HNZT 1IBLT 1CMXA 4YHJA 2AXDS 1BR0A 4X64T 2X9HA 3L39A 4DV2T 5FKYA 3TB3A 4TN7B 4O4LE 5DQWA 3CWZB 5HWYA 2BZBA 4G2AA 3UT5E 3MA9A 2VURA 2XM2A 3PJAA 2CXFA 2I0MA 3MK7C 1UX4A 1UK5A 4KI0F 1FIOA 1VCTA 3UUBA 2UUCT 3KV6A 4O2AE 2JIWA 4LF8T 2HPLA 2EHOB 2XHEB 1FEWA 3VR9A 3KBTA 5FP3A 3JC6C 3CK6A 5BR8T 3H3MA 2EHOD 5CB4E 1H7CA 2Q9QC 2LEHA 2VL8A 4QXHB 5FMNA 3AAEB 3AAAB 4LF9T 3LK3B 2JQQA 5EZYE 2XY8B 4PW8A 3P4QA 4ILUA 2ZMAA 1S35A 5L47A 2BDEA 4NXMT 5LGUB 4CXXA 3DP7A 1OXZA 3B5MA 4PJMA 4ZXLA 5HAXA 2G0UA 2RPAA 4F8HA 2V7MA 2LOSA 2XSBA 4HFBA 2A3DA 2IC6A 1FMWA 3AXJA 3FXEB 4MHCA 4YHHT 1YKEB 1UCUA 3UU5A 4ZZBA 4ZI2D 5AQLB 5LOVE 1HS7A 4HFHA 3KW5A 3RX6A 3AE9A 5ADXL 4U74A 3V5UA 4FJOA 3QB5A 3MACA 3KVBA 2KXPB 2XQ8A 1M62A 4TWFA 4BJMA 1N36T 3O1HA 4ZZCA 5FL1A 4ZHQE 2WU5A 4UXNB 3P4PA 5ETWA 3ZYLA 2CWYA 2LSGA 2W0GA 3N9LA 3PTRB 4YJ3E 2J62A 4GYRA 4YXDA 1VRBA 3UUNA 1OEDE 2KWHA 4IGUA 2LE8A 3LK2B 3PUGA 2ETLA 3RYIE 5CA1E 3RGLA 4B3ST 2D0TA 2XQ6A 3ZMVB 3O4XE 4AXPA 2CMRA 5JRCA 1VCSA 3NZQA 2E5LT 2QVAA 4IREA 2DLRA 2K24A 2D2SA 3ZSSA 3QB5K 4C91A 2LLYA 1I6ZA 3KVFA 2DCFA 3AXJB 3C50A 4Z8XA 2CEAA 3RQUA 2N9DA 5FVLA 2JMHA 2FBWA 4EGWA 4M1PA 4P0BA 4IE7A 1GQEA 3T1HT 4EEBA 3AE2A 2WAUA 1X79A 5LG3A 2WWUA 5CA0E 2HHHT 4ISTA 4X1YE 5HCMA 1KNZA 4DNDA 4A56A 4LMKA 2LSKA 5L3BB 1D1BA 4HFCA 4AISA 5TAOA 3AAIA 4HWHA 1ZKEA 4ASKA 4I55E 4IDOA 1D0XA 4ZS2A 3N9QA 4L9IA 1D1CA 2Y6XA 3P4RA 4I43B 4LMJA 1E1HB 1HTJF 4DMWA 2GK9A 1XMOT 4I4TE 5FXVA 2P9BA 3J9X1 2X9YA 2X68A 3AEAA 2PTFA 1SUMB 1WRDA 4HTEA 2VB6A 1L0VA 5BMVE 5JRCB 2MPKA 2D0UA 2XQYA 4LFBT 4U7IA 1AJ3A 3ZT7A 2BS3A 4K0UA 5F8PA 3N5LA 4X65T 5AQRB 4YSZA 4ERRA 2SPCA 5AQGB 4IDQA 5M4YA 4TV9E 3ZPOA 2PFVA 3ZMZB 4JKJA 2YDSA 3RYFE 1VOMA 2JPFA 3DTOA 2MBGA 4DIDB 1IBKT 3UU8A 1QSDA 3P7IA 1SE7A 3U78A 3K1SA 1MNDA 3NRXA 4NUUA 1UURA 1UUSA 3WI3A 3K8PC 5HXHA 5AFUL 1KF6A 4FI5A 2DI4A 2H89A 1DU2A 2B1EA 4AKHA 5LMUT 5FY7A 4JI1T 4DR6T 4H9OC 4LF6T 2BKNA 3I0QA 2UXBT 3PU3A 4COFA 1BR4A 3RH3A 4GOUA 3MXZA 3Q5XA 1MMAA 1MMGA 2VVNA 3NZPA 5L3EB 4ZOLE 1BR2A 5FVKA 3VRBA 3JAEA 4NIQA 2JQ9A 4EAHA 3JADA 3RLFF 4PK4A 3AB3B 3C98B 5EK2A 2V7LA 1YQ3A 2ACZA 2K3WA 1Y64B 2X0LB 5AQHB 3M3ZB 3RKGA 1B7TA 3QC9A 4EZHA 4KUMB 3UQ4A 2V6YA 5F3JA 2L8KA 4JI3T 4UELA 2V1DB 4BJNA 3P4SA 1T72A 3K3NA 3SFEA 5HYAA 1UX5A 4TV8E 3GA8A 3OTOT 4QX7B 2BVLA 5E0OA 2WSSV 3L09A 2W63A 2BG9A 3RYHE 4JBWF 2WMOA 5LGTB 2A72A 2CRBA 1J1JA 2JJ9A 3C64A 4PFOA 4CXYA 4H9NC 5L3DB 3JCFA 2LSIA 4IL9A 2V26A 4QKNA 3PJAJ 5KMGP 1YKHB 3G06A 3EDVA 4U3CA 4H63H 1HF8A 2XAHB 4AQFC 1KNPA 3HKDE 1HG5A 3B57A 5JREA 4LF5T 2VWAA 5EK3A 5C3JA 4P09A 3A5XA 4EIWA 2X66A 3PU8A 4OK0A 2WS3A 5J2TE 3IF8B 4MLKA 3RIFA 3HKBE 2YOEA 4B3MT 3CX7B 5DQVA 4MALA 1MIYA 1R8IA 4WYVA 2E9XD 4OYJA 5AQPB 4TWDA 3J7Yq 4YSYA 3TLUA 4EZ4A 4TNVA 3BQLA 5AQUB 5FXXA 1LVFA 2CLYB 2V6YB 3QOFA 5JDHA 5KX5E 4L0RA 5DABA 4PK5A 3ZMUB 3ZN0B 2LOPA 3D0TA 5A1LA 3UU3A 4GKJT 4CI3B 2IMLA 3QNUA 1BR1A 3RF1A 3RRCA 4DUYT 3DJBA 4UEMA 2WDVA 2IHR1 3PUSA 4EEDA 1MNEA 5KDMC 2J4GA 5LMNT 3A7SA 2BG9B 1IJ5A 1HNWT 5LG4A 2XAQB 4GKKT 3ZT5A 4GYSA 2UXCT 2BKOA 3PURA 4C90A 3AECA 3AA1B 4ILCA 3KV9A 4ZI3C 3WAJA 3O1IA 3L8RA 5JDNA 3N2OA 4KMCA 2IIUA 3MKDA 3PUWF 1XDPA 3E08A 2V5DA 2PJQA 4DR3T 1Y01A 2BVMA 3N9MA 5L3CB 2QGSA 2X67A 3GN5A 2YN6A 3HI2A 2MAWA 4HFDA 5F5WA 3R6NA 4JI8T 1IAPA 3ESLA 1HX8A 5FY1A 2NTYA 4O8SA 2VKJA 2ZM0A 5FL0A 3AA6B 2VVSA 4O4IE 5J0ZA 3P50A 2VL0A 3AEGA 5LB7B 1UCHA 2KT9A 1Z8UA 2Y48B 3T1YT 3EDUA 2CBIA 4IG7A 3CPZA 2VKHA 3A8YC 2WP9A 1NENA 4A97A 1NEKA 5LJNA 4NUVA 4IDNA 4ZEYA 4CI2B 2K9AA
chains in the Genus database with same CATH topology
2C5JA 2CLYC 4AKRB 2ZM8A 3CKDA 5TAOA 3AAIA 2XAGB 3LG7A 2YU1A 4H9SE 1ZKEA 3ZMSB 4ASKA 4BA9A 2LHNA 4I55E 2LJLA 3ONXA 2CWOA 2KMFA 3H3AA 3EVYA 4KP3C 3UTKA 4IE4A 1D0XA 4ZS2A 5FYMA 2DHRA 3S4UA 2WBLA 3N9QA 1FMVA 4L9IA 1D1CA 3HL6A 2Y6XA 4UF0A 4YJ2E 3PDYA 5LHGB 4I43B 1E1HB 1HTJF 2H3RA 3EUHA 4OFZA 2DNXA 4AKIA 2LENA 2D5UA 4DMWA 5LA6E 1HG2A 2GK9A 2PG8A 4HEAA 1WLXA 3OJAA 4EXTA 5HXEA 4I4TE 2L3LA 5FXVA 4EB6E 4UIGA 5L3FB 5JH7E 2ODUA 3AA7B 3IRTA 2P9BA 3J9X1 2X9YA 2X68A 5LGNB 3ZC0A 3SS1A 1KK7A 1MIWA 1WRDA 2NTXA 2ES0A 3ZYKA 4HTEA 2VB6A 5BMVE 2K48A 4AQGA 4UVBB 4ZI7E 3UFEA 4ANJA 3ANWA 4X20E 3OYXA 3GN5B 4DMVA 1IZNB 5JRCB 3KINB 2V7JA 4JEHB 3ZN1B 2D0UA 3H37A 2XQYA 3SWHA 3F57A 1AJ3A 3N9PA 5JR9A 2HPJA 4X1IE 2ZLYA 4K0UA 4AKGA 3W15B 5F8PA 3N5LA 4H63V 3N2KE 3ZCIA 1WR6A 5LCYA 2JMKA 4ERRA 2SPCA 2I59A 4QX8B 3FBLA 2KZ7B 4TUYE 5IYZE 4WBNE 1U5PA 5HXSA 5M4YA 3IBPA 4TV9E 3ZPOA 5JDGA 2LM9A 2PFVA 2E8IA 3ZMZB 4H9RC 4JKJA 3ZEFB 4MBQA 2KWIB 3RYFE 1VOMA 2X9XA 4GIWA 4KBMB 3UUXB 2JPFA 3DTOA 3KV5A 2MBGA 4L5GA 4GK0E 1QSDA 3KDSE 3P7IA 2VKDA 4PK6A 3U78A 1SHZC 2NW9A 5LHIB 5JREA 4XBFB 3N9OA 2OA5A 3NBXX 2CXDA 2N2NA 2H7OA 2WM9A 2W00A 1MNDA 5IHYA 1LVKA 4PJJA 3NRXA 4NUUA 3KFWX 3WI3A 2LT3A 3CMLA 3Q9DA 4OYKA 1QUUA 3K8PC 3KV4A 3RYCE 4IIJE 5HXHA 3LBXA 5JDLA 2MYSA 5AFUL 5LBQB 4FI5A 2DI4A 2IAKA 3JC6D 2EHOA 4ADZA 3HR0A 5J1GA 3BQKA 3QK6A 2B1EA 2Q9QD 4AKHA 2Y8DA 3PUQA 5FY7A 3CX8B 4BAYB 2LHRA 4H9OC 4IE0A 5JQGE 1G8XA 4HN9A 3FB2A 3I0QA 2XAFB 3FBZA 2LSJA 4PAGA 2DWGA 3PU3A 2Q9QA 4IE6A 3RRWA 4DBQA 1BR4A 4ISSA 4UF0B 3RH3A 3E22E 3K3QC 4GOUA 3R84B 3ZLIA 3HA4A 5LYJE 3MXZA 4QXBB 3O9XA 3Q5XA 4O2BE 1MMAA 4EYYR 3VHLA 3B13A 4WW0A 1MMGA 3NZPA 2CM0A 3RC3A 5L3EB 5LP6E 2NP9A 4ZOLE 1BR2A 4B6XA 1US7B 2ODVA 3VKGA 4DVDA 1ZEEA 4P0AA 4I50E 2RP4A 2MTQA 4EOZB 5JDMA 3TKLB 4EAHA 2YINA 3C4XA 2IC9A 3UULA 3ANWB 4PK4A 2JRKA 3CX6B 3AVSA 2L9QA 2NW7A 3AVRA 4H9PC 1D0YA 3AB3B 3C98B 3ZYMA 4CXWA 5EK2A 4X1KE 5L2LA 3K3OA 5LHHB 4HE8A 2V7LA 3C4WA 5JR9C 5DJQC 5LXTE 1Y64B 2X0LB 1V9DA 2CCQA 3RPUA 1MMNA 1Z0PA 3QUJA 5FXWA 3SRZA 3ZC1A 5JR9B 2ACXA 2HH7A 3LFMA 1LKXA 1CMXA 4YHJA 4XZCA 1BR0A 2X9HA 3CQCB 4YLHA 1B7TA 3QC9A 5LBMA 3BQIA 4EZHA 4KUMB 3TB3A 4TN7B 1EZ3A 5F3JA 4O4LE 3BK9A 5DQWA 3CWZB 2L8KA 4O4JE 5HWYA 5L3GB 2BZBA 4UELA 2V1DB 4BJNA 1NWMX 4G2AA 4IDZA 4UVAB 3UT5E 3MA9A 2YK0A 3MZKB 3RC8A 2KLQA 2NW8A 3WAKA 3K3NA 4CZZB 2CXFA 2M67A 5HYAA 1UX5A 1XD3A 3MK7C 5HXCA 4TV8E 3VU7H 3GA8A 4QX7B 2BVLA 5E0OA 4ZS3A 2CA5A 2WSSV 1G73A 1UX4A 1WYCA 2W63A 3L09A 3HKCE 3RYHE 1CUNA 2ZM2A 1FIOA 2WMOA 4XAXB 2A72A 5LGTB 3VKHA 2JJ9A 3KV6A 4O2AE 4PNIA 3N9NA 1T98A 4PJLA 4CQIA 3C64A 4PFOA 4CXYA 4IE5A 3FHNA 4H9NC 4ZI3D 5L3DB 2LSIA 4E7ZA 2V26A 1HFAA 3LBXB 4J2CA 2HPLA 4PJNA 4QKNA 2NWBA 1D1AA 2XAJB 2EHOB 5KMGP 3ZJ2A 2XHEB 1FEWA 2PBIA 1YKHB 3N2GE 4N78D 3KBTA 5FP3A 3JC6C 3EDVA 4UV9B 3OKQA 4H63H 4I6NA 2EHOD 1MMDA 5CB4E 1HF8A 1H7CA 2Q9QC 3C51A 2LEHA 2XAHB 4AQFC 2C0SA 3HKDE 4H9QC 2K5BB 1HG5A 2VL8A 3B57A 4QXHB 2Q9QB 1S94A 4JUYA 5HWXA 3SOLA 5FMNA 5J2UE 3AAEB 3AA0B 4HFVA 1WYBA 2VASA 3AAAB 2UXXB 3IFWA 3C4ZA 2JQQA 3LK3B 2VWAA 1NAFA 1YD8G 5EK3A 5EZYE 3OYZA 4PW8A 4ILUA 2ZMAA 4U72A 2CE7A 1S35A 3CQXC 4P09A 3A5XA 5EK4A 4AKLA 3I9YA 4EIWA 5JDQA 2BDEA 2X66A 3PU8A 4OK0A 4YFSA 5J2TE 4TZ4C 3IF8B 4MLKA 4HGAA 3HKBE 5LGUB 4CXXA 4WNKA 3GMIA 3DP7A 1OWAA 3CX7B 1OXZA 3M65A 5DQVA 4PJMA 5HAXA 2G0UA 3RKOA 5C8YE 2DWKA 4MALA 1MIYA 2V7MA 1ZHCA 2LOSA 3P8CD 4CI1B 2E9XD 2A3DA 2IC6A 1FMWA 4OYJA 4UVCB 3FXEB 3T8OA 4MHCA 2KNDA 1YKEB 1UCUA 3I9WA 3J7Yq 2E9XA 4ZI2D 4V1Av 3ZJ1A 4GK5E 3LJCA 1YW0A 4EZ4A 4QWNB 3BQLA 2KINB 3CQGB 5FXXA 5LJMA 1LVFA 2CLYB 5KX5E 5JDHA 2N1GA 4L0RA 3NRYA 4PK5A 5DABA 2VK9A 3ZMUB 3ZN0B 4IHJE 3CVRA 5LOVE 2LOPA 2H7VC 2XTLA 3D0TA 3ETUA 3PUAA 5A1LA 1HS7A 3KW5A 4CI3B 3RX6A 1BR1A 3RRCA 5ADXL 4U74A 3DJBA 4UEMA 4MFRA 1LRZA 5JDFA 2UXNB 2YU2A 2WMNA 3PUSA 3V5UA 5LNKA 1MNEA 3Q2MA 4FJOA 3MACA 5KDMC 3KVAA 3KVBA 3LK42 2KXPB 4PFPA 3A7SA 3E0ZA 1IJ5A 2NOXA 3UUMA 2MOZA 2X9WA 5LG4A 1ZV4X 2X51A 4BJMA 2XAQB 2C5KT 4F6RC 4GYSA 3O1HA 4ZHQE 3PURA 3IEEA 4JLEA 1SA0E 2XASB 4UXNB 3U3IA 3KBUA 4C90A 1D0ZA 3AA1B 3Q5WA 3KV9A 4QXCB 4ZI3C 5ETWA 3ZYLA 2CWYA 2LSGA 3WAJA 2VKOA 5GONE 3O1IA 2W0GA 4OHFA 3N9LA 3PTRB 4YJ3E 2V7KA 5JDNA 4GYRA 3N2OA 3MJXA 1O3XA 2W61A 2XUEA 2Z6EA 5HXRA 4UV8B 1VRBA 4KMCA 3V5SA 4E7SA 3UUNA 3I0OA 2A2FX 2J1DG 1HCIA 3MKDA 3RISA 2KWHA 4IGUA 2EHOC 2LE8A 3E08A 3LK2B 2PJQA 3PUGA 2ETLA 3RYIE 5CA1E 3PE0A 1MIVA 2D0TA 2BVMA 3N9MA 3GWHA 5L3CB 3ZMVB 2QGSA 3F2EA 2X67A 3O4XE 3GN5A 4AXPA 2CMRA 2RA1A 3L3PA 3HI2A 5JRCA 2LSYA 3NZQA 4DBRA 3R6NA 3HKEE 3RIIA 4JEUB 1IAPA 1IJ6A 5H6RB 3ESLA 2DLRA 4TX5A 1HX8A 2K24A 2D2SA 5FY1A 4C91A 2NTYA 3FXDB 4O8SA 4WBOA 2VKJA 4AI6A 2ZM0A 3AA6B 3O1JA 3KVFA 4O4IE 2DCFA 3C50A 4Z8XA 3ZCJA 2C5IT 3I1AA 4QHOA 2CEAA 2E9XC 4EYUA 4O4HE 2IW5B 5FY0A 4DO0A 2N9DA 1UCHA 2QA7A 2CXLA 2E9XB 2KT9A 3ZMTB 2Y48B 2V7IA 4DM9A 4G63A 2JMHA 3EDUA 3OBVE 3CPZA 4IG7A 4M1PA 3IHRA 4P0BA 1U4QA 4IE7A 4ZI2C 3ETVA 5FXZA 2VKHA 2W62A 2WAUA 1X79A 2WWUA 5JVDE 5CA0E 5LJNA 4NUVA 2YEVC 3F31A 4HKAA 5FNVE 4ISTA 4X1YE 1KNZA 4DNDA 4A56A 4AQFA 2LSKA 5L3BB 4CI2B 1D1BA 2K9AA 5H6QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A7S A;  1UCH A;  4JKJ A;  4DM9 A;  3RII A;  4UEL A;  4IG7 A;  3RIS A;  3IHR A;  3IFW A;  3IRT A;  3KW5 A;  1XD3 A;  2ETL A;  4UEM A;  3KVF A;  1CMX A;  2LEN A;  3TB3 A;  4I6N A; 
#chains in the Genus database with same CATH topology
 2C5J A;  2YKS A;  3CKD A;  2XAG B;  2XQ7 A;  1ZOY A;  2LHN A;  2CWO A;  4KP3 C;  3UTK A;  5CJ5 A;  3S4U A;  2LKH A;  5L4E A;  3PDY A;  2WQY A;  2D5U A;  5LA6 E;  1WLX A;  5HXE A;  2L3L A;  5HEH A;  4UIG A;  4AIU A;  3IRT A;  3SS1 A;  1MIW A;  3ZYK A;  2NR4 A;  4B3T T;  2QRX A;  4ZI7 E;  1XZY A;  2BBJ A;  3UFE A;  3ANW A;  2M6B A;  3GN5 B;  4DMV A;  1IZN B;  2V7J A;  2CHO A;  5JR9 A;  2HPJ A;  3W15 B;  2V8S V;  2JMK A;  2I59 A;  4TUY E;  1UGO A;  3ONJ A;  2M6I A;  4L5G A;  3KDS E;  2WU2 A;  2VKD A;  1SHZ C;  3JAF A;  3NBX X;  4PJJ A;  3RI5 A;  3KFW X;  4OYK A;  1QUU A;  3EAB A;  3KV4 A;  3NVO A;  4IIJ E;  3LBX A;  5LBQ B;  2OV9 A;  3JC6 D;  2Q9Q D;  2LHR A;  5JQG E;  4QH4 A;  4UR9 A;  2XAF B;  2LSJ A;  5JTG A;  4IE6 A;  4DBQ A;  3E22 E;  3K3Q C;  3R84 B;  5LYJ E;  1N34 T;  2CM0 A;  3AE3 A;  4B6X A;  4KHP T;  4DVD A;  3FZH B;  2RP4 A;  2MTQ A;  4EOZ B;  5JDM A;  1N32 T;  2FJB A;  3ANW B;  5ABH A;  3CX6 B;  2NW7 A;  3ZYM A;  4X1K E;  2QYW A;  3C4W A;  2XQ9 A;  3NKZ A;  5DJQ C;  1HNX T;  3RPU A;  1MMN A;  3SRZ A;  3ZC1 A;  4HWC A;  5JR9 B;  3CQC B;  4TWH A;  4YLH A;  2ZM6 T;  3BQI A;  2XSA A;  4O4J E;  3RHW A;  4CN4 A;  4IDZ A;  2YK0 A;  3EAM A;  3MZK B;  5HXC A;  1G73 A;  1WYC A;  4XAX B;  3AED A;  3N9N A;  1T98 A;  4CQI A;  4IE5 A;  3RIA A;  1HFA A;  3LBX B;  1D1A A;  2XAJ B;  5HEU A;  3ZJ2 A;  4N78 D;  2CBJ A;  3AEF A;  4UV9 B;  5HCJ A;  2LRK A;  4H9Q C;  1W09 A;  3TLV A;  1S94 A;  4JUY A;  4DR2 T;  5HWX A;  3SOL A;  4DV6 T;  2UXX B;  4DR5 T;  3PV0 F;  3C4Z A;  4I0U A;  5AQM B;  2BBH A;  1XNR T;  4U72 A;  2CE7 A;  3CQX C;  4TZ4 C;  4YTN A;  4WNK A;  3GMI A;  1OWA A;  2JQH A;  5ABG A;  3RKO A;  5C8Y E;  2VQF T;  2DWK A;  3SFD A;  5AQV B;  1XWM A;  1ZHC A;  3UU6 A;  1XMQ T;  4CI1 B;  2E5V A;  4UVC B;  5AQI B;  1X9B A;  3AE6 A;  2E9X A;  4B3R T;  3ZJ1 A;  4GK5 E;  3PUZ F;  1YW0 A;  1OED A;  3CQG B;  5LJM A;  3PUV F;  2VK9 A;  3EHZ A;  2H7V C;  2XTL A;  3ETU A;  3PUA A;  3ZT6 A;  2XJ7 A;  3OVU A;  5JDF A;  2UUA T;  2WMN A;  5LNK A;  1WCR A;  3PUY F;  4LFA T;  3LK4 2;  4PFP A;  2NOX A;  2MOZ A;  1XNQ T;  1ZV4 X;  2YDQ A;  4DV7 T;  2X51 A;  2C5K T;  5IUX A;  3VR8 A;  4JI6 T;  4K0K T;  1SA0 E;  1WFD A;  3U3I A;  4QXC B;  4U33 A;  5GON E;  3A7M A;  2V7K A;  3MJX A;  4DUZ T;  5ABE A;  2Z6E A;  5HXR A;  4UV8 B;  3V5S A;  3I0O A;  2J1D G;  3RIS A;  3FZL B;  2EHO C;  3RIU A;  3ZKR A;  5HEG A;  4X5T A;  1MIV A;  3LSV A;  2RA1 A;  4AQY T;  5HEJ A;  5ABF A;  4YT0 A;  2J47 A;  4DBR A;  3HKE E;  4TX5 A;  3Q5E A;  3FXD B;  4WBO A;  3AE4 A;  1E2A A;  2XPK A;  1E7P A;  1XDO A;  3ZCJ A;  4QHO A;  4O4H E;  5FY0 A;  2E9X B;  3ZMT B;  3PUX F;  1KEY A;  2V7I A;  3ZST A;  1OED B;  4ZI2 C;  3ETV A;  1T7S A;  5FXZ A;  3RQW A;  2W62 A;  2JQK A;  3AE1 A;  2YEV C;  4HKA A;  5FNV E;  4AQF A;  5H6Q B;  4YTP A;  4TNW A;  2ZM8 A;  2FJE A;  3LG7 A;  4H9S E;  3ZMS B;  4U31 A;  2LJL A;  2KMF A;  3H3A A;  3EVY A;  4IE4 A;  1JNZ A;  2LKG A;  5FYM A;  2DHR A;  2D9D A;  2WBL A;  2B76 A;  1FMV A;  3FZK B;  2WWV A;  3HL6 A;  3VRA A;  4YJ2 E;  4OFZ A;  4AKI A;  3EUH A;  2LEN A;  2DNX A;  4A98 A;  3X1D A;  4U2Y A;  3CIR A;  4CN1 A;  2WDQ A;  3OJA A;  4EXT A;  4Z90 A;  5L3F B;  3AE8 A;  3OPC A;  5JH7 E;  4Z91 A;  4YSX A;  5LGN B;  3ZC0 A;  5AQF B;  2NTX A;  2ES0 A;  1J5W A;  4AQG A;  3Q5D A;  4X20 E;  3OYX A;  3KIN B;  4JEH B;  1JNR A;  3ZN1 B;  5ABF B;  3H37 A;  2UU9 T;  2BS2 A;  3F57 A;  3N9P A;  3ONL C;  4X1I E;  4AKG A;  4H63 V;  3N2K E;  5LCY A;  2W66 A;  4QX8 B;  5IYZ E;  1U5P A;  5JDG A;  2LRL A;  3ZEF B;  1ZP0 A;  4MBQ A;  2X9X A;  4GIW A;  3UUX B;  3FZF B;  3AE7 A;  4PK6 A;  5LHI B;  4XBF B;  2OA5 A;  2CXD A;  2H7O A;  2W00 A;  2WCA A;  4JI5 T;  2LT3 A;  3Q9D A;  2VQE T;  1FJG T;  5AQO B;  3RYC E;  2MYS A;  4JI2 T;  2IAK A;  3UQ7 A;  2FUP A;  4ADZ A;  2W67 A;  3HR0 A;  2KSR A;  4Q25 A;  3PUQ A;  3CX8 B;  3TLT A;  1G8X A;  3FBZ A;  4PAG A;  2Q9Q A;  3RRW A;  4LML A;  2XQ4 A;  3ZLI A;  3HA4 A;  2WDR A;  4QXB B;  4EYY R;  3VHL A;  1YQ4 A;  3ABV A;  3RC3 A;  1W0A A;  2NP9 A;  4HFI A;  1US7 B;  2ODV A;  2XQ3 A;  3VKG A;  3AEB A;  4P0A A;  4I50 E;  4JYA T;  4HWF A;  3TKL B;  2YIN A;  3UUL A;  2JRK A;  4H9P C;  2YDR A;  5JR9 C;  1HR0 T;  5FXW A;  4JI0 T;  2HH7 A;  3UU4 A;  3LFM A;  1LKX A;  4XZC A;  4EV6 A;  5LBM A;  1EZ3 A;  3BK9 A;  4P1N A;  3TLW A;  2X0Y A;  3TLS A;  5L3G B;  1NWM X;  4UVA B;  5AQJ B;  3RC8 A;  2KLQ A;  2NW8 A;  3WAK A;  4CZZ B;  2M67 A;  1XD3 A;  4DR7 T;  3VU7 H;  5CGM A;  4ZS3 A;  4X66 T;  2CA5 A;  3HKC E;  1CUN A;  2ZM2 A;  3VKH A;  2WB5 A;  4PNI A;  4PJL A;  3FHN A;  4ZI3 D;  4E7Z A;  4J2C A;  4PJN A;  2NWB A;  5HEO A;  2PBI A;  1W9R A;  3N2G E;  1IBM T;  1J5E T;  3OKQ A;  1MMD A;  3C51 A;  2C0S A;  2K5B B;  2Q9Q B;  4NXN T;  5J2U E;  3AA0 B;  4HFV A;  2F4V T;  1WYB A;  2VAS A;  3P4W A;  3IFW A;  4KX6 A;  5IWA T;  2W2U A;  1NAF A;  1YD8 G;  3OYZ A;  5L4H A;  4DV1 T;  2AE9 A;  5EK4 A;  5JDQ A;  4AKL A;  3I9Y A;  4YFS A;  2BG9 E;  4HGA A;  2XQ5 A;  4QH5 A;  3M65 A;  4OX9 T;  3P8C D;  5AQS B;  4LF4 T;  2H88 A;  3T8O A;  2KND A;  3I9W A;  4NPP A;  4V1A v;  3LJC A;  4QWN B;  2UXD T;  2KIN B;  2N1G A;  3NRY A;  4IHJ E;  3CVR A;  4DV0 T;  2V6X A;  2X0H A;  2W4X A;  4MFR A;  1LRZ A;  2UXN B;  2YU2 A;  1I94 T;  3Q2M A;  3KVA A;  3E0Z A;  2XQA A;  3UUM A;  2X9W A;  2UUB T;  4F6R C;  3NWI A;  5CFB A;  4JLE A;  3IEE A;  2DL1 A;  2XAS B;  3KBU A;  1D0Z A;  3Q5W A;  3EI0 A;  4DR1 T;  3IA3 A;  2VKO A;  4OHF A;  4X62 T;  1M7K A;  1O3X A;  2W61 A;  2XUE A;  4E7S A;  2A2F X;  1HCI A;  3AE5 A;  4DV3 T;  3PE0 A;  5C2T A;  4JI4 T;  3GWH A;  1WR0 A;  3F2E A;  3L3P A;  4JI7 T;  2LSY A;  4A5X A;  3RII A;  4JEU B;  1YXR A;  1IJ6 A;  5H6R B;  3UFG A;  5AQK B;  2R6G F;  4HWD A;  1W0B A;  4AI6 A;  4ILB A;  3O1J A;  4WZX A;  2C5I T;  3I1A A;  2E9X C;  4EYU A;  2IW5 B;  4DO0 A;  2QA7 A;  2CXL A;  4CN6 A;  1OED C;  4DM9 A;  4G63 A;  3OBV E;  3IHR A;  1U4Q A;  4KHZ F;  5JVD E;  1KNR A;  2XZE A;  2I6H A;  1HX1 B;  4QH1 A;  2XM1 A;  2BS4 A;  3F31 A;  4U2Z A;  4I6N A;  2CLY C;  4AKR B;  4YY3 T;  2YU1 A;  4U7Y A;  4BA9 A;  4IT4 A;  3ONX A;  3AEE A;  3FZM B;  1CHU A;  2LM2 A;  4LFC T;  2IUB A;  4UF0 A;  5LHG B;  2BG9 C;  2H3R A;  1HG2 A;  2PG8 A;  4HEA A;  3RIU C;  4EB6 E;  2ODU A;  3AA7 B;  2A9U A;  5AQQ B;  4JV5 T;  1KK7 A;  4IL4 A;  1T8B A;  2K48 A;  4UVB B;  4ANJ A;  1QLB A;  2WZI A;  3SWH A;  5KXJ A;  2OLT A;  2ZLY A;  2BKP A;  3ZCI A;  1WR6 A;  3FBL A;  2KZ7 B;  4HWI B;  4WBN E;  5HXS A;  3IBP A;  2LM9 A;  2E8I A;  4H9R C;  2CPT A;  2KWI B;  4KBM B;  3KV5 A;  2FJA A;  4LF7 T;  4GK0 E;  4ILA A;  4DV5 T;  2NW9 A;  3N9O A;  2HN2 A;  2N2N A;  2WM9 A;  5IHY A;  1LVK A;  2V5C A;  3CML A;  5JDL A;  2EHO A;  5J1G A;  3BQK A;  3QK6 A;  4DR4 T;  2Y8D A;  4BAY B;  4IE0 A;  2HN1 A;  2IDO B;  4HN9 A;  3FB2 A;  2CHN A;  2DWG A;  4ISS A;  4UF0 B;  4IDP A;  4HFE A;  3O9X A;  4O2B E;  5AQT B;  3B13 A;  4WW0 A;  2E2A A;  5AQN B;  5LP6 E;  4DV4 T;  2WY2 A;  1ZEE A;  3C4X A;  2IC9 A;  2FJD A;  1KFY A;  2WZH A;  2L9Q A;  3AVR A;  3AVS A;  4CXW A;  1D0Y A;  5L2L A;  3K3O A;  5LHH B;  4HE8 A;  1N33 T;  4YTM A;  5LXT E;  1V9D A;  2CCQ A;  1Z0P A;  3QUJ A;  2ACX A;  3LDQ B;  1HNZ T;  1IBL T;  1CMX A;  4YHJ A;  2AXD S;  1BR0 A;  4X64 T;  2X9H A;  3L39 A;  4DV2 T;  5FKY A;  3TB3 A;  4TN7 B;  4O4L E;  5DQW A;  3CWZ B;  5HWY A;  2BZB A;  4G2A A;  3UT5 E;  3MA9 A;  2VUR A;  2XM2 A;  3PJA A;  2CXF A;  2I0M A;  3MK7 C;  1UX4 A;  1UK5 A;  4KI0 F;  1FIO A;  1VCT A;  3UUB A;  2UUC T;  3KV6 A;  4O2A E;  2JIW A;  4LF8 T;  2HPL A;  2EHO B;  2XHE B;  1FEW A;  3VR9 A;  3KBT A;  5FP3 A;  3JC6 C;  3CK6 A;  5BR8 T;  3H3M A;  2EHO D;  5CB4 E;  1H7C A;  2Q9Q C;  2LEH A;  2VL8 A;  4QXH B;  5FMN A;  3AAE B;  3AAA B;  4LF9 T;  3LK3 B;  2JQQ A;  5EZY E;  2XY8 B;  4PW8 A;  3P4Q A;  4ILU A;  2ZMA A;  1S35 A;  5L47 A;  2BDE A;  4NXM T;  5LGU B;  4CXX A;  3DP7 A;  1OXZ A;  3B5M A;  4PJM A;  4ZXL A;  5HAX A;  2G0U A;  2RPA A;  4F8H A;  2V7M A;  2LOS A;  2XSB A;  4HFB A;  2A3D A;  2IC6 A;  1FMW A;  3AXJ A;  3FXE B;  4MHC A;  4YHH T;  1YKE B;  1UCU A;  3UU5 A;  4ZZB A;  4ZI2 D;  5AQL B;  5LOV E;  1HS7 A;  4HFH A;  3KW5 A;  3RX6 A;  3AE9 A;  5ADX L;  4U74 A;  3V5U A;  4FJO A;  3QB5 A;  3MAC A;  3KVB A;  2KXP B;  2XQ8 A;  1M62 A;  4TWF A;  4BJM A;  1N36 T;  3O1H A;  4ZZC A;  5FL1 A;  4ZHQ E;  2WU5 A;  4UXN B;  3P4P A;  5ETW A;  3ZYL A;  2CWY A;  2LSG A;  2W0G A;  3N9L A;  3PTR B;  4YJ3 E;  2J62 A;  4GYR A;  4YXD A;  1VRB A;  3UUN A;  1OED E;  2KWH A;  4IGU A;  2LE8 A;  3LK2 B;  3PUG A;  2ETL A;  3RYI E;  5CA1 E;  3RGL A;  4B3S T;  2D0T A;  2XQ6 A;  3ZMV B;  3O4X E;  4AXP A;  2CMR A;  5JRC A;  1VCS A;  3NZQ A;  2E5L T;  2QVA A;  4IRE A;  2DLR A;  2K24 A;  2D2S A;  3ZSS A;  3QB5 K;  4C91 A;  2LLY A;  1I6Z A;  3KVF A;  2DCF A;  3AXJ B;  3C50 A;  4Z8X A;  2CEA A;  3RQU A;  2N9D A;  5FVL A;  2JMH A;  2FBW A;  4EGW A;  4M1P A;  4P0B A;  4IE7 A;  1GQE A;  3T1H T;  4EEB A;  3AE2 A;  2WAU A;  1X79 A;  5LG3 A;  2WWU A;  5CA0 E;  2HHH T;  4IST A;  4X1Y E;  5HCM A;  1KNZ A;  4DND A;  4A56 A;  4LMK A;  2LSK A;  5L3B B;  1D1B A;  4HFC A;  4AIS A;  5TAO A;  3AAI A;  4HWH A;  1ZKE A;  4ASK A;  4I55 E;  4IDO A;  1D0X A;  4ZS2 A;  3N9Q A;  4L9I A;  1D1C A;  2Y6X A;  3P4R A;  4I43 B;  4LMJ A;  1E1H B;  1HTJ F;  4DMW A;  2GK9 A;  1XMO T;  4I4T E;  5FXV A;  2P9B A;  3J9X 1;  2X9Y A;  2X68 A;  3AEA A;  2PTF A;  1SUM B;  1WRD A;  4HTE A;  2VB6 A;  1L0V A;  5BMV E;  5JRC B;  2MPK A;  2D0U A;  2XQY A;  4LFB T;  4U7I A;  1AJ3 A;  3ZT7 A;  2BS3 A;  4K0U A;  5F8P A;  3N5L A;  4X65 T;  5AQR B;  4YSZ A;  4ERR A;  2SPC A;  5AQG B;  4IDQ A;  5M4Y A;  4TV9 E;  3ZPO A;  2PFV A;  3ZMZ B;  4JKJ A;  2YDS A;  3RYF E;  1VOM A;  2JPF A;  3DTO A;  2MBG A;  4DID B;  1IBK T;  3UU8 A;  1QSD A;  3P7I A;  1SE7 A;  3U78 A;  3K1S A;  1MND A;  3NRX A;  4NUU A;  1UUR A;  1UUS A;  3WI3 A;  3K8P C;  5HXH A;  5AFU L;  1KF6 A;  4FI5 A;  2DI4 A;  2H89 A;  1DU2 A;  2B1E A;  4AKH A;  5LMU T;  5FY7 A;  4JI1 T;  4DR6 T;  4H9O C;  4LF6 T;  2BKN A;  3I0Q A;  2UXB T;  3PU3 A;  4COF A;  1BR4 A;  3RH3 A;  4GOU A;  3MXZ A;  3Q5X A;  1MMA A;  1MMG A;  2VVN A;  3NZP A;  5L3E B;  4ZOL E;  1BR2 A;  5FVK A;  3VRB A;  3JAE A;  4NIQ A;  2JQ9 A;  4EAH A;  3JAD A;  3RLF F;  4PK4 A;  3AB3 B;  3C98 B;  5EK2 A;  2V7L A;  1YQ3 A;  2ACZ A;  2K3W A;  1Y64 B;  2X0L B;  5AQH B;  3M3Z B;  3RKG A;  1B7T A;  3QC9 A;  4EZH A;  4KUM B;  3UQ4 A;  2V6Y A;  5F3J A;  2L8K A;  4JI3 T;  4UEL A;  2V1D B;  4BJN A;  3P4S A;  1T72 A;  3K3N A;  3SFE A;  5HYA A;  1UX5 A;  4TV8 E;  3GA8 A;  3OTO T;  4QX7 B;  2BVL A;  5E0O A;  2WSS V;  3L09 A;  2W63 A;  2BG9 A;  3RYH E;  4JBW F;  2WMO A;  5LGT B;  2A72 A;  2CRB A;  1J1J A;  2JJ9 A;  3C64 A;  4PFO A;  4CXY A;  4H9N C;  5L3D B;  3JCF A;  2LSI A;  4IL9 A;  2V26 A;  4QKN A;  3PJA J;  5KMG P;  1YKH B;  3G06 A;  3EDV A;  4U3C A;  4H63 H;  1HF8 A;  2XAH B;  4AQF C;  1KNP A;  3HKD E;  1HG5 A;  3B57 A;  5JRE A;  4LF5 T;  2VWA A;  5EK3 A;  5C3J A;  4P09 A;  3A5X A;  4EIW A;  2X66 A;  3PU8 A;  4OK0 A;  2WS3 A;  5J2T E;  3IF8 B;  4MLK A;  3RIF A;  3HKB E;  2YOE A;  4B3M T;  3CX7 B;  5DQV A;  4MAL A;  1MIY A;  1R8I A;  4WYV A;  2E9X D;  4OYJ A;  5AQP B;  4TWD A;  3J7Y q;  4YSY A;  3TLU A;  4EZ4 A;  4TNV A;  3BQL A;  5AQU B;  5FXX A;  1LVF A;  2CLY B;  2V6Y B;  3QOF A;  5JDH A;  5KX5 E;  4L0R A;  5DAB A;  4PK5 A;  3ZMU B;  3ZN0 B;  2LOP A;  3D0T A;  5A1L A;  3UU3 A;  4GKJ T;  4CI3 B;  2IML A;  3QNU A;  1BR1 A;  3RF1 A;  3RRC A;  4DUY T;  3DJB A;  4UEM A;  2WDV A;  2IHR 1;  3PUS A;  4EED A;  1MNE A;  5KDM C;  2J4G A;  5LMN T;  3A7S A;  2BG9 B;  1IJ5 A;  1HNW T;  5LG4 A;  2XAQ B;  4GKK T;  3ZT5 A;  4GYS A;  2UXC T;  2BKO A;  3PUR A;  4C90 A;  3AEC A;  3AA1 B;  4ILC A;  3KV9 A;  4ZI3 C;  3WAJ A;  3O1I A;  3L8R A;  5JDN A;  3N2O A;  4KMC A;  2IIU A;  3MKD A;  3PUW F;  1XDP A;  3E08 A;  2V5D A;  2PJQ A;  4DR3 T;  1Y01 A;  2BVM A;  3N9M A;  5L3C B;  2QGS A;  2X67 A;  3GN5 A;  2YN6 A;  3HI2 A;  2MAW A;  4HFD A;  5F5W A;  3R6N A;  4JI8 T;  1IAP A;  3ESL A;  1HX8 A;  5FY1 A;  2NTY A;  4O8S A;  2VKJ A;  2ZM0 A;  5FL0 A;  3AA6 B;  2VVS A;  4O4I E;  5J0Z A;  3P50 A;  2VL0 A;  3AEG A;  5LB7 B;  1UCH A;  2KT9 A;  1Z8U A;  2Y48 B;  3T1Y T;  3EDU A;  2CBI A;  4IG7 A;  3CPZ A;  2VKH A;  3A8Y C;  2WP9 A;  1NEN A;  4A97 A;  1NEK A;  5LJN A;  4NUV A;  4IDN A;  4ZEY A;  4CI2 B;  2K9A A; 
#chains in the Genus database with same CATH homology
 2C5J A;  2CLY C;  4AKR B;  2ZM8 A;  3CKD A;  5TAO A;  3AAI A;  2XAG B;  3LG7 A;  2YU1 A;  4H9S E;  1ZKE A;  3ZMS B;  4ASK A;  4BA9 A;  2LHN A;  4I55 E;  2LJL A;  3ONX A;  2CWO A;  2KMF A;  3H3A A;  3EVY A;  4KP3 C;  3UTK A;  4IE4 A;  1D0X A;  4ZS2 A;  5FYM A;  2DHR A;  3S4U A;  2WBL A;  3N9Q A;  1FMV A;  4L9I A;  1D1C A;  3HL6 A;  2Y6X A;  4UF0 A;  4YJ2 E;  3PDY A;  5LHG B;  4I43 B;  1E1H B;  1HTJ F;  2H3R A;  3EUH A;  4OFZ A;  2DNX A;  4AKI A;  2LEN A;  2D5U A;  4DMW A;  5LA6 E;  1HG2 A;  2GK9 A;  2PG8 A;  4HEA A;  1WLX A;  3OJA A;  4EXT A;  5HXE A;  4I4T E;  2L3L A;  5FXV A;  4EB6 E;  4UIG A;  5L3F B;  5JH7 E;  2ODU A;  3AA7 B;  3IRT A;  2P9B A;  3J9X 1;  2X9Y A;  2X68 A;  5LGN B;  3ZC0 A;  3SS1 A;  1KK7 A;  1MIW A;  1WRD A;  2NTX A;  2ES0 A;  3ZYK A;  4HTE A;  2VB6 A;  5BMV E;  2K48 A;  4AQG A;  4UVB B;  4ZI7 E;  3UFE A;  4ANJ A;  3ANW A;  4X20 E;  3OYX A;  3GN5 B;  4DMV A;  1IZN B;  5JRC B;  3KIN B;  2V7J A;  4JEH B;  3ZN1 B;  2D0U A;  3H37 A;  2XQY A;  3SWH A;  3F57 A;  1AJ3 A;  3N9P A;  5JR9 A;  2HPJ A;  4X1I E;  2ZLY A;  4K0U A;  4AKG A;  3W15 B;  5F8P A;  3N5L A;  4H63 V;  3N2K E;  3ZCI A;  1WR6 A;  5LCY A;  2JMK A;  4ERR A;  2SPC A;  2I59 A;  4QX8 B;  3FBL A;  2KZ7 B;  4TUY E;  5IYZ E;  4WBN E;  1U5P A;  5HXS A;  5M4Y A;  3IBP A;  4TV9 E;  3ZPO A;  5JDG A;  2LM9 A;  2PFV A;  2E8I A;  3ZMZ B;  4H9R C;  4JKJ A;  3ZEF B;  4MBQ A;  2KWI B;  3RYF E;  1VOM A;  2X9X A;  4GIW A;  4KBM B;  3UUX B;  2JPF A;  3DTO A;  3KV5 A;  2MBG A;  4L5G A;  4GK0 E;  1QSD A;  3KDS E;  3P7I A;  2VKD A;  4PK6 A;  3U78 A;  1SHZ C;  2NW9 A;  5LHI B;  5JRE A;  4XBF B;  3N9O A;  2OA5 A;  3NBX X;  2CXD A;  2N2N A;  2H7O A;  2WM9 A;  2W00 A;  1MND A;  5IHY A;  1LVK A;  4PJJ A;  3NRX A;  4NUU A;  3KFW X;  3WI3 A;  2LT3 A;  3CML A;  3Q9D A;  4OYK A;  1QUU A;  3K8P C;  3KV4 A;  3RYC E;  4IIJ E;  5HXH A;  3LBX A;  5JDL A;  2MYS A;  5AFU L;  5LBQ B;  4FI5 A;  2DI4 A;  2IAK A;  3JC6 D;  2EHO A;  4ADZ A;  3HR0 A;  5J1G A;  3BQK A;  3QK6 A;  2B1E A;  2Q9Q D;  4AKH A;  2Y8D A;  3PUQ A;  5FY7 A;  3CX8 B;  4BAY B;  2LHR A;  4H9O C;  4IE0 A;  5JQG E;  1G8X A;  4HN9 A;  3FB2 A;  3I0Q A;  2XAF B;  3FBZ A;  2LSJ A;  4PAG A;  2DWG A;  3PU3 A;  2Q9Q A;  4IE6 A;  3RRW A;  4DBQ A;  1BR4 A;  4ISS A;  4UF0 B;  3RH3 A;  3E22 E;  3K3Q C;  4GOU A;  3R84 B;  3ZLI A;  3HA4 A;  5LYJ E;  3MXZ A;  4QXB B;  3O9X A;  3Q5X A;  4O2B E;  1MMA A;  4EYY R;  3VHL A;  3B13 A;  4WW0 A;  1MMG A;  3NZP A;  2CM0 A;  3RC3 A;  5L3E B;  5LP6 E;  2NP9 A;  4ZOL E;  1BR2 A;  4B6X A;  1US7 B;  2ODV A;  3VKG A;  4DVD A;  1ZEE A;  4P0A A;  4I50 E;  2RP4 A;  2MTQ A;  4EOZ B;  5JDM A;  3TKL B;  4EAH A;  2YIN A;  3C4X A;  2IC9 A;  3UUL A;  3ANW B;  4PK4 A;  2JRK A;  3CX6 B;  3AVS A;  2L9Q A;  2NW7 A;  3AVR A;  4H9P C;  1D0Y A;  3AB3 B;  3C98 B;  3ZYM A;  4CXW A;  5EK2 A;  4X1K E;  5L2L A;  3K3O A;  5LHH B;  4HE8 A;  2V7L A;  3C4W A;  5JR9 C;  5DJQ C;  5LXT E;  1Y64 B;  2X0L B;  1V9D A;  2CCQ A;  3RPU A;  1MMN A;  1Z0P A;  3QUJ A;  5FXW A;  3SRZ A;  3ZC1 A;  5JR9 B;  2ACX A;  2HH7 A;  3LFM A;  1LKX A;  1CMX A;  4YHJ A;  4XZC A;  1BR0 A;  2X9H A;  3CQC B;  4YLH A;  1B7T A;  3QC9 A;  5LBM A;  3BQI A;  4EZH A;  4KUM B;  3TB3 A;  4TN7 B;  1EZ3 A;  5F3J A;  4O4L E;  3BK9 A;  5DQW A;  3CWZ B;  2L8K A;  4O4J E;  5HWY A;  5L3G B;  2BZB A;  4UEL A;  2V1D B;  4BJN A;  1NWM X;  4G2A A;  4IDZ A;  4UVA B;  3UT5 E;  3MA9 A;  2YK0 A;  3MZK B;  3RC8 A;  2KLQ A;  2NW8 A;  3WAK A;  3K3N A;  4CZZ B;  2CXF A;  2M67 A;  5HYA A;  1UX5 A;  1XD3 A;  3MK7 C;  5HXC A;  4TV8 E;  3VU7 H;  3GA8 A;  4QX7 B;  2BVL A;  5E0O A;  4ZS3 A;  2CA5 A;  2WSS V;  1G73 A;  1UX4 A;  1WYC A;  2W63 A;  3L09 A;  3HKC E;  3RYH E;  1CUN A;  2ZM2 A;  1FIO A;  2WMO A;  4XAX B;  2A72 A;  5LGT B;  3VKH A;  2JJ9 A;  3KV6 A;  4O2A E;  4PNI A;  3N9N A;  1T98 A;  4PJL A;  4CQI A;  3C64 A;  4PFO A;  4CXY A;  4IE5 A;  3FHN A;  4H9N C;  4ZI3 D;  5L3D B;  2LSI A;  4E7Z A;  2V26 A;  1HFA A;  3LBX B;  4J2C A;  2HPL A;  4PJN A;  4QKN A;  2NWB A;  1D1A A;  2XAJ B;  2EHO B;  5KMG P;  3ZJ2 A;  2XHE B;  1FEW A;  2PBI A;  1YKH B;  3N2G E;  4N78 D;  3KBT A;  5FP3 A;  3JC6 C;  3EDV A;  4UV9 B;  3OKQ A;  4H63 H;  4I6N A;  2EHO D;  1MMD A;  5CB4 E;  1HF8 A;  1H7C A;  2Q9Q C;  3C51 A;  2LEH A;  2XAH B;  4AQF C;  2C0S A;  3HKD E;  4H9Q C;  2K5B B;  1HG5 A;  2VL8 A;  3B57 A;  4QXH B;  2Q9Q B;  1S94 A;  4JUY A;  5HWX A;  3SOL A;  5FMN A;  5J2U E;  3AAE B;  3AA0 B;  4HFV A;  1WYB A;  2VAS A;  3AAA B;  2UXX B;  3IFW A;  3C4Z A;  2JQQ A;  3LK3 B;  2VWA A;  1NAF A;  1YD8 G;  5EK3 A;  5EZY E;  3OYZ A;  4PW8 A;  4ILU A;  2ZMA A;  4U72 A;  2CE7 A;  1S35 A;  3CQX C;  4P09 A;  3A5X A;  5EK4 A;  4AKL A;  3I9Y A;  4EIW A;  5JDQ A;  2BDE A;  2X66 A;  3PU8 A;  4OK0 A;  4YFS A;  5J2T E;  4TZ4 C;  3IF8 B;  4MLK A;  4HGA A;  3HKB E;  5LGU B;  4CXX A;  4WNK A;  3GMI A;  3DP7 A;  1OWA A;  3CX7 B;  1OXZ A;  3M65 A;  5DQV A;  4PJM A;  5HAX A;  2G0U A;  3RKO A;  5C8Y E;  2DWK A;  4MAL A;  1MIY A;  2V7M A;  1ZHC A;  2LOS A;  3P8C D;  4CI1 B;  2E9X D;  2A3D A;  2IC6 A;  1FMW A;  4OYJ A;  4UVC B;  3FXE B;  3T8O A;  4MHC A;  2KND A;  1YKE B;  1UCU A;  3I9W A;  3J7Y q;  2E9X A;  4ZI2 D;  4V1A v;  3ZJ1 A;  4GK5 E;  3LJC A;  1YW0 A;  4EZ4 A;  4QWN B;  3BQL A;  2KIN B;  3CQG B;  5FXX A;  5LJM A;  1LVF A;  2CLY B;  5KX5 E;  5JDH A;  2N1G A;  4L0R A;  3NRY A;  4PK5 A;  5DAB A;  2VK9 A;  3ZMU B;  3ZN0 B;  4IHJ E;  3CVR A;  5LOV E;  2LOP A;  2H7V C;  2XTL A;  3D0T A;  3ETU A;  3PUA A;  5A1L A;  1HS7 A;  3KW5 A;  4CI3 B;  3RX6 A;  1BR1 A;  3RRC A;  5ADX L;  4U74 A;  3DJB A;  4UEM A;  4MFR A;  1LRZ A;  5JDF A;  2UXN B;  2YU2 A;  2WMN A;  3PUS A;  3V5U A;  5LNK A;  1MNE A;  3Q2M A;  4FJO A;  3MAC A;  5KDM C;  3KVA A;  3KVB A;  3LK4 2;  2KXP B;  4PFP A;  3A7S A;  3E0Z A;  1IJ5 A;  2NOX A;  3UUM A;  2MOZ A;  2X9W A;  5LG4 A;  1ZV4 X;  2X51 A;  4BJM A;  2XAQ B;  2C5K T;  4F6R C;  4GYS A;  3O1H A;  4ZHQ E;  3PUR A;  3IEE A;  4JLE A;  1SA0 E;  2XAS B;  4UXN B;  3U3I A;  3KBU A;  4C90 A;  1D0Z A;  3AA1 B;  3Q5W A;  3KV9 A;  4QXC B;  4ZI3 C;  5ETW A;  3ZYL A;  2CWY A;  2LSG A;  3WAJ A;  2VKO A;  5GON E;  3O1I A;  2W0G A;  4OHF A;  3N9L A;  3PTR B;  4YJ3 E;  2V7K A;  5JDN A;  4GYR A;  3N2O A;  3MJX A;  1O3X A;  2W61 A;  2XUE A;  2Z6E A;  5HXR A;  4UV8 B;  1VRB A;  4KMC A;  3V5S A;  4E7S A;  3UUN A;  3I0O A;  2A2F X;  2J1D G;  1HCI A;  3MKD A;  3RIS A;  2KWH A;  4IGU A;  2EHO C;  2LE8 A;  3E08 A;  3LK2 B;  2PJQ A;  3PUG A;  2ETL A;  3RYI E;  5CA1 E;  3PE0 A;  1MIV A;  2D0T A;  2BVM A;  3N9M A;  3GWH A;  5L3C B;  3ZMV B;  2QGS A;  3F2E A;  2X67 A;  3O4X E;  3GN5 A;  4AXP A;  2CMR A;  2RA1 A;  3L3P A;  3HI2 A;  5JRC A;  2LSY A;  3NZQ A;  4DBR A;  3R6N A;  3HKE E;  3RII A;  4JEU B;  1IAP A;  1IJ6 A;  5H6R B;  3ESL A;  2DLR A;  4TX5 A;  1HX8 A;  2K24 A;  2D2S A;  5FY1 A;  4C91 A;  2NTY A;  3FXD B;  4O8S A;  4WBO A;  2VKJ A;  4AI6 A;  2ZM0 A;  3AA6 B;  3O1J A;  3KVF A;  4O4I E;  2DCF A;  3C50 A;  4Z8X A;  3ZCJ A;  2C5I T;  3I1A A;  4QHO A;  2CEA A;  2E9X C;  4EYU A;  4O4H E;  2IW5 B;  5FY0 A;  4DO0 A;  2N9D A;  1UCH A;  2QA7 A;  2CXL A;  2E9X B;  2KT9 A;  3ZMT B;  2Y48 B;  2V7I A;  4DM9 A;  4G63 A;  2JMH A;  3EDU A;  3OBV E;  3CPZ A;  4IG7 A;  4M1P A;  3IHR A;  4P0B A;  1U4Q A;  4IE7 A;  4ZI2 C;  3ETV A;  5FXZ A;  2VKH A;  2W62 A;  2WAU A;  1X79 A;  2WWU A;  5JVD E;  5CA0 E;  5LJN A;  4NUV A;  2YEV C;  3F31 A;  4HKA A;  5FNV E;  4IST A;  4X1Y E;  1KNZ A;  4DND A;  4A56 A;  4AQF A;  2LSK A;  5L3B B;  4CI2 B;  1D1B A;  2K9A A;  5H6Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...