4UEMA

Uch-l5 in complex with the rpn13 deubad domain
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
Knots found
sequence length
309
structure length
281
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKRFNLMAIVSDRKMIYEQKIAELQRQLAESMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPLVEKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of Uch-L5 Activation and Inhibition by Deubad Domains in Rpn13 and Ino80G.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords UBIQUITIN CARBOXYL-TERMINAL HYDROLASE ISOZYME L5
total genus 86
structure length 281
sequence length 309
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uemA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 4uemA01
1XD3A 3IHRA 3IFWA 3TB3A 4UEMA 4IG7A 2LENA 4JKJA 3RIIA 3IRTA 3KW5A 4I6NA 3RISA 3KVFA 4DM9A 1CMXA 1UCHA 2ETLA 3A7SA 4UELA
chains in the Genus database with same CATH superfamily
5AQLB 4ZOLE 3UUNA 3ZT7A 2KXPB 5HCMA 1HNXT 5AQVB 4AKGA 3AE7A 4NXNT 2E9XA 5L3CB 2UXCT 1QUUA 3LK2B 3PURA 3PE0A 2VB6A 1JNRA 4DV3T 3B5MA 3AAEB 1OWAA 2FJBA 3P7IA 3ETVA 1MIWA 3RYIE 4P0AA 3O1HA 2H89A 3ZMZB 2L3LA 4DV1T 2K5BB 2WDQA 3ZKRA 2ACXA 4HWDA 2WAUA 4I6NA 5BMVE 1HX1B 2QVAA 3P8CD 4QX8B 4JI6T 1HNWT 4HWCA 5JDHA 1UURA 2C5JA 3WI3A 2BVMA 3KINB 2N2NA 4HFVA 2VVNA 1G73A 2K3WA 3M65A 1CHUA 2MAWA 3Q5DA 3OTOT 4LF7T 2LENA 5AQSB 1WFDA 4HFDA 3I0QA 3SFDA 4DR4T 3SFEA 4UXNB 5ETWA 4LFBT 3PUGA 3NKZA 2V6XA 5TAOA 2YN6A 3ANWB 3AA6B 4L9IA 5AQRB 2CM0A 4JV5T 3JAEA 3AEDA 5AQIB 3PUYF 3TLUA 5KX5E 5FXWA 5LGUB 3RC8A 1CMXA 2VASA 2X9YA 3ESLA 3IHRA 3UFEA 2UUAT 1VRBA 2XQ9A 2B76A 1S94A 3KVBA 4QWNB 3ZCIA 4CZZB 4CN6A 4A56A 3PTRB 4DV2T 4PJNA 2Y6XA 3FXDB 4PW8A 1I6ZA 3CPZA 1IAPA 4PJJA 3QC9A 4EYYR 3E0ZA 4U74A 2YU1A 3I9YA 3UU3A 3RIUC 4EIWA 5FMNA 1W09A 2V7IA 2CWOA 3M3ZB 1D1CA 4OHFA 1GQEA 4GIWA 2Q9QA 4TX5A 3B13A 3EDVA 3ZN0B 5HEGA 5LG3A 4X1KE 3FZMB 4ILCA 4DBRA 2UUBT 4EB6E 1NENA 1MMDA 2XQ7A 3LFMA 5LA6E 2E5LT 2W63A 4DR7T 5FL0A 3K8PC 4X66T 3AE9A 1HG2A 2BG9C 4YSZA 5DQWA 4HE8A 3D0TA 3V5UA 5JTGA 1J5ET 2C5IT 3FZLB 3N9NA 3O1IA 5LGNB 5J2TE 1HF8A 3TLVA 4JI8T 5FYMA 1W0BA 4DR1T 5C8YE 3JAFA 2F4VT 1UUSA 1D0YA 3GA8A 4QXBB 4DMWA 3RIIA 2B1EA 1LVKA 3AECA 2UXBT 2JQHA 5CB4E 1N32T 3CIRA 2FUPA 2BVLA 4A5XA 2MTQA 4CI1B 4ZS3A 5AQHB 3JC6C 3UU5A 4GK0E 4QH4A 2WZIA 2JJ9A 1IBLT 3CX6B 3LDQB 3HA4A 4YXDA 2UU9T 4UELA 2XY8B 4UV9B 4WZXA 3RYHE 5JDLA 3LBXB 3AEGA 3J9X1 2LRLA 3ABVA 4HWIB 3RIUA 4AKHA 2XQ4A 1HG5A 3UUBA 4YTNA 4LF5T 3HKBE 2Q9QC 2BS4A 1WCRA 1EZ3A 2CBIA 3EABA 4F8HA 5ABFB 1OEDE 2KWIB 3QOFA 1LKXA 5DABA 4K0KT 5JRCA 2CPTA 4EEBA 2WMOA 3C4ZA 2LJLA 4QKNA 3KVAA 2NP9A 5JRCB 5JREA 2DCFA 4TN7B 3UTKA 2OV9A 2LE8A 1S35A 5E0OA 1FMWA 3MZKB 3RQUA 2LSYA 4DR6T 2X0HA 4JI5T 2W67A 2NW8A 1M62A 2WZHA 5HXEA 5L4HA 3I0OA 4LMLA 1XNRT 2XSAA 4XAXB 4P1NA 4CI2B 2CLYB 3RC3A 4NXMT 3AE5A 4KX6A 2NWBA 1ZV4X 2IAKA 1KEYA 4HWFA 5LJNA 2XZEA 3G06A 1X9BA 2J1DG 3JCFA 3PU3A 3ZCJA 3KVFA 1OEDA 4WNKA 1KNRA 4DV0T 2QGSA 3PUWF 1YKEB 2J62A 2M6BA 3MJXA 3PDYA 4HFCA 1WRDA 2WMNA 3E22E 2VURA 2A3DA 3KV9A 4IDNA 4JEUB 4O4HE 4EEDA 2VQET 4DV5T 2W00A 2X9HA 3N9PA 3VR8A 4B6XA 2JMHA 4YJ3E 1YW0A 4DR3T 2AXDS 3ONJA 4HWHA 1W9RA 4DUYT 1MIYA 4AKIA 5FNVE 4XZCA 2NOXA 4I43B 5EK4A 2YU2A 1WR0A 1ZEEA 1KNZA 3W15B 3CVRA 2KNDA 4H9PC 4U2ZA 5H6RB 4WYVA 3ZPOA 4G63A 4BJNA 4ZI3D 3OYXA 3ZLIA 2J47A 4A98A 5AQJB 3P4RA 1Y64B 3KDSE 3DJBA 3RPUA 4YHJA 4Z91A 4DVDA 4EZHA 2D0TA 5LHIB 4KHZF 3RLFF 5GONE 2YOEA 2UXNB 2K48A 2VL0A 4O2AE 3R6NA 1MIVA 1E7PA 2ZM8A 2XAQB 2E2AA 4ZS2A 3CK6A 1NWMX 1OEDC 4DR5T 2ODVA 1KFYA 1Z0PA 3BQLA 3H3AA 5FXZA 3ZYLA 4YHHT 1W0AA 3ZMUB 5JR9B 4JEHB 2H3RA 2WSSV 2CHNA 2EHOD 4N78D 3UULA 4KI0F 3QB5K 4JLEA 3IA3A 3N5LA 2LOSA 2VKHA 2I6HA 2ZLYA 4UEMA 3Q5EA 2E9XD 3F2EA 4JYAT 3VKHA 2X51A 1XNQT 5CFBA 4QH1A 5H6QB 2XQ6A 3I9WA 1XZYA 2BG9A 4CXWA 5JDMA 5L3DB 3CMLA 4TWDA 2L8KA 4MALA 4X1IE 3VRBA 2CHOA 2E5VA 4FI5A 3Q9DA 4HFEA 4QH5A 2LHNA 1IZNB 2CA5A 3ONXA 3P4PA 4O2BE 4QXCB 2HN2A 2YDRA 4JUYA 4UF0B 4PJMA 5HEUA 3N9LA 5HXRA 5KDMC 5AQMB 2BDEA 4HN9A 3HL6A 3VKGA 3FZFB 4PK4A 4V1Av 2Z6EA 4X64T 4B3TT 2IIUA 1SHZC 1G8XA 4EYUA 2V7JA 3C51A 3N2OA 5LCYA 5AQFB 3P50A 3AVSA 2OLTA 2UXXB 3CKDA 4COFA 2HPJA 4GKKT 2H7VC 3RRCA 5IYZE 5L3EB 3AE2A 3K3OA 2PJQA 2X0LB 2WWUA 3NBXX 3O1JA 4FJOA 4GOUA 4KP3C 3ZMTB 2Y8DA 3HR0A 4DMVA 2BKOA 2FBWA 3HKDE 3Q2MA 4HGAA 1BR4A 2WCAA 1T8BA 2D9DA 3HI2A 2JRKA 3IF8B 3KV4A 3L09A 4PK6A 4C90A 3EVYA 4ZI2C 5FL1A 1IJ5A 2RPAA 3A7MA 3O4XE 5IWAT 2X67A 3OJAA 2IDOB 3AB3B 3UQ4A 4ANJA 5LB7B 4EZ4A 3FB2A 3ZEFB 2LKHA 4ZZCA 2R6GF 4KMCA 3N9QA 5J2UE 4PAGA 3GWHA 4U31A 5HEJA 4B3RT 1MMGA 1UK5A 4JBWF 4OFZA 3N2KE 5F5WA 4EXTA 2WY2A 4IE5A 1IJ6A 4U7YA 2AE9A 2C5KT 3KBTA 2VKJA 3PUAA 4MFRA 3P4SA 1BR1A 3DP7A 1J5WA 1B7TA 1FMVA 1KK7A 3FXEB 4H63H 5JDQA 5L47A 4MLKA 4I0UA 3C50A 1HCIA 1Z8UA 3V5SA 2KINB 4BAYB 4ILBA 1BR2A 1J1JA 2A2FX 2LT3A 4IDQA 4AISA 4YSXA 2W4XA 3IRTA 1CUNA 2QA7A 4IIJE 2XQAA 3F57A 2V7KA 1MNEA 4KUMB 5FY0A 5C2TA 2W2UA 3AEFA 2HN1A 3P4QA 1UCUA 2XQYA 2X9WA 4AQGA 2LM9A 5C3JA 4CXYA 2XM2A 1I94T 1NEKA 1YXRA 3BQKA 2CLYC 2NTYA 3ONLC 5HEOA 5CA1E 2CXLA 3A8YC 3VR9A 2CMRA 3K1SA 4YFSA 5AQUB 4NPPA 3KW5A 3IEEA 4B3ST 2BKPA 4O4LE 4TV9E 4TUYE 4H63V 4IHJE 2V7LA 3ZT6A 4X5TA 4DM9A 2IC9A 2M6IA 2X66A 2FJAA 4I50E 4X65T 2UUCT 4HEAA 2XQ8A 5ABFA 2VK9A 3FZKB 3TLTA 1D0ZA 5M4YA 5J0ZA 2ZM0A 4MHCA 2ODUA 2Y48B 3L8RA 2FJDA 1KF6A 1ZHCA 2BZBA 1MMNA 1D1BA 2VWAA 3KFWX 3RH3A 5L3BB 4CN4A 2DL1A 2YEVC 3PV0F 4Z8XA 2ZM2A 3AVRA 4PJLA 5AQOB 3RF1A 2LKGA 4X62T 4O4IE 2VL8A 2CWYA 4U72A 4EOZB 5EK2A 4JI4T 1UX4A 2HPLA 4ZHQE 3U3IA 1US7B 5EK3A 5L3GB 3U78A 3EAMA 4TV8E 4U33A 4IE6A 4IL4A 3QB5A 5ABGA 3C4WA 5L4EA 2VQFT 3P4WA 5HXCA 3KBUA 5HXSA 4YTPA 4ZEYA 2PFVA 3NRYA 4HKAA 3CQGB 5CA0E 2LLYA 4JI7T 3HKCE 3MA9A 4P0BA 2BG9B 2XAJB 3TLWA 2IW5B 1M7KA 4YJ2E 4PNIA 3H37A 1Y01A 3QUJA 3RIFA 2K9AA 3GN5B 3OVUA 4LMJA 4LFAT 2MBGA 4ISTA 2WQYA 3AE6A 2V6YA 1U5PA 5FXVA 2D2SA 5FVLA 4IE4A 3RISA 5FKYA 2SPCA 5LGTB 3PJAJ 1E2AA 2IHR1 3ZN1B 4ZXLA 3NRXA 1XD3A 5JR9A 3B57A 4HFIA 2V8SV 1OXZA 3FHNA 4IDZA 4O8SA 2KWHA 3ZSSA 4JI1T 1AJ3A 3CQXC 2L9QA 2XQ5A 1ZP0A 2BS3A 2CRBA 4KHPT 3O9XA 3PUXF 1MNDA 2DWGA 3FBLA 3H3MA 3LG7A 1R8IA 3A5XA 4I4TE 3S4UA 2W61A 3UU4A 3VU7H 5KXJA 1IBMT 2KMFA 3AA0B 4GYRA 2CE7A 1BR0A 1DU2A 3JADA 4EGWA 3RKOA 4HTEA 4YY3T 3SOLA 3AE1A 2K24A 3K3QC 3MACA 3MK7C 5AFUL 1HS7A 4C91A 1HFAA 2E9XB 3AEBA 5LBMA 1QSDA 3HKEE 1V9DA 3UU8A 5CGMA 3SWHA 4ZI2D 3RRWA 2FJEA 3TB3A 4DNDA 3UUMA 3AXJB 5ABHA 3RYCE 3QNUA 4A97A 1SE7A 4ASKA 1HX8A 4CI3B 4YT0A 3RQWA 4TNVA 1T72A 2V1DB 2P9BA 1YD8G 4TWFA 2DI4A 4DIDB 5IUXA 5JQGE 3BK9A 5LMUT 3T1HT 1N36T 5AQGB 2WDRA 3C98B 1HTJF 2LOPA 3RYFE 2YINA 5LG4A 5DJQC 3AXJA 2G0UA 2MPKA 3OYZA 3RIAA 5HYAA 5L2LA 4DV4T 3FBZA 4ISSA 3RKGA 4LMKA 2LHRA 2Q9QB 4HFHA 3KV6A 2XHEB 3N9OA 2QYWA 2X68A 3VHLA 4OX9T 4XBFB 1UCHA 5LOVE 4H9NC 4OYKA 4F6RC 3NZPA 5J1GA 5JDGA 2X9XA 3DTOA 5AQQB 1SA0E 2V7MA 5LBQB 2W62A 4Q25A 1O3XA 4MBQA 4JKJA 4PFOA 2DHRA 2VKDA 3AA1B 4UVAB 2D5UA 2PBIA 4X20E 4ZI7E 1N33T 3BQIA 3RX6A 2XTLA 3AEAA 4TZ4C 3I1AA 4AIUA 5AQKB 2GK9A 4DR2T 3ETUA 2DNXA 2JQKA 2VVSA 4DUZT 4YLHA 3EI0A 2BKNA 2LSKA 2W66A 3EDUA 4P09A 4JI2T 2V5DA 2H7OA 3CX7B 3UUXB 5ADXL 4IDPA 3WAJA 3OPCA 2V6YB 2KLQA 3PUZF 4NIQA 3ZC1A 2IC6A 1ZOYA 4NUVA 1LRZA 4LF9T 4ZZBA 2N1GA 5LYJE 4ILAA 2KT9A 2JQ9A 4U7IA 3WAKA 3F31A 4AQFA 4CQIA 4DO0A 1VCSA 4JI3T 4UVCB 2DLRA 4QXHB 1UGOA 4OK0A 2EHOB 4ZI3C 3VRAA 3CWZB 4H9OC 2WBLA 3C64A 4WW0A 3LK3B 1OEDB 2LSIA 3FZHB 3ZMSB 2E8IA 5LHGB 2MOZA 4B3MT 4LF4T 3J7Yq 5JH7E 3ZYKA 2ETLA 3OBVE 1SUMB 2XSBA 3ZMVB 3CQCB 4LFCT 2XPKA 1E1HB 5HAXA 4YSYA 4QHOA 1XDPA 3Q5WA 1FEWA 3LSVA 2XAFB 5IHYA 4HFBA 4CXXA 4LF8T 5LHHB 4H9QC 3CX8B 4WBOA 5HWXA 5LP6E 2A9UA 2CEAA 2CBJA 2WWVA 2JMKA 1D1AA 2XM1A 5F8PA 1NAFA 1YQ4A 1FJGT 2D0UA 1LVFA 2XAHB 2YDSA 2KSRA 3UU6A 1WYCA 2WU5A 5LXTE 2XAGB 5JVDE 2WDVA 1WYBA 2JPFA 4H9SE 1XMOT 4UV8B 1JNZA 4U2YA 2NR4A 5HWYA 2ZMAA 2MYSA 4LF6T 1X79A 3AE4A 5JR9C 4O4JE 2UXDT 2HHHT 3ZYMA 3ZSTA 4AQFC 3IBPA 1WLXA 4PK5A 2LSJA 5CJ5A 3ZJ2A 4IL9A 3AAIA 3L3PA 3NZQA 3AEEA 2YDQA 3LBXA 3GN5A 1VCTA 4AKLA 2JQQA 2W0GA 4AXPA 3N9MA 2XASB 1MMAA 3X1DA 4GYSA 4EV6A 4AI6A 1T98A 2BS2A 3SS1A 3TKLB 4DV6T 4IREA 4Z90A 2IMLA 3NWIA 1U4QA 4OYJA 5FXXA 1HR0T 4BJMA 4E7ZA 5FVKA 4TWHA 1YQ3A 2Q9QD 2XUEA 3R84B 1QLBA 2JIWA 1T7SA 2WP9A 2EHOA 5EZYE 3EUHA 3Q5XA 5FY1A 4GK5E 5HEHA 3IFWA 3PUSA 4ERRA 4UIGA 5AQTB 4ILUA 3UQ7A 3PUVF 4DBQA 2RP4A 5L3FB 2BG9E 4IE7A 2VKOA 3MXZA 4UR9A 2LRKA 3SRZA 5JDNA 2RA1A 4CN1A 4WBNE 3JC6D 5LJMA 2CCQA 3PJAA 4IG7A 2C0SA 5AQNB 5ABEA 1IBKT 5AQPB 3PUQA 3ZT5A 2BBHA 3AE8A 1XWMA 3KV5A 2V5CA 3E08A 3C4XA 2ACZA 1VOMA 5FY7A 3ZJ1A 4TNWA 5FP3A 3N2GE 3LJCA 4IDOA 1WR6A 4QX7B 2BBJA 3AE3A 1XMQT 4BA9A 4E7SA 2N9DA 4KBMB 1HNZT 2XQ3A 2NW9A 3AAAB 3EHZA 4PFPA 3A7SA 4AQYT 3QK6A 4NUUA 2E9XC 2QRXA 4L0RA 4YTMA 4GKJT 4G2AA 2NW7A 4J2CA 2WM9A 2J4GA 2NTXA 5DQVA 3ZC0A 4ADZA 2M67A 2WU2A 3ANWA 2LM2A 3K3NA 4L5GA 2EHOC 4UF0A 5A1LA 5F3JA 5LNKA 1XDOA 2CXDA 3T1YT 4JI0T 4DV7T 4IE0A 4UVBB 2OA5A 2DWKA 2V26A 4X1YE 3RGLA 4EAHA 3UFGA 2LSGA 3NVOA 4H9RC 2CXFA 5HXHA 2I59A 5HCJA 3TLSA 5BR8T 3T8OA 2ZM6T 1ZKEA 5LMNT 2PTFA 1N34T 2XJ7A 1YKHB 2HH7A 2YKSA 1FIOA 4K0UA 5KMGP 1UX5A 4U3CA 2X0YA 4IT4A 5JDFA 3UT5E 4AKRB 4M1PA 1L0VA 3L39A 1KNPA 3MKDA 2WS3A 4I55E 2IUBA 4IGUA 2PG8A 3RI5A 1H7CA 2ES0A 3PU8A 3AA7B 2WB5A 3OKQA 1D0XA 2H88A 2A72A 2LEHA 3GMIA 3LK42 2YK0A 3RHWA 2KZ7B 2I0MA
chains in the Genus database with same CATH topology
4ZOLE 3UUNA 4AKGA 2KXPB 2E9XA 5L3CB 1QUUA 3LK2B 3PURA 3PE0A 2VB6A 3AAEB 1OWAA 3P7IA 3ETVA 1MIWA 3RYIE 3O1HA 3ZMZB 2L3LA 2K5BB 2ACXA 4I6NA 2WAUA 5BMVE 4QX8B 3P8CD 5JDHA 2C5JA 3WI3A 2BVMA 3KINB 2N2NA 4HFVA 1G73A 3M65A 2LENA 3I0QA 4UXNB 5ETWA 3PUGA 5TAOA 3ANWB 3AA6B 4L9IA 2CM0A 5KX5E 1CMXA 5FXWA 5LGUB 3RC8A 2VASA 2X9YA 3ESLA 3IHRA 3UFEA 1VRBA 1S94A 3KVBA 4QWNB 3ZCIA 4CZZB 4A56A 3PTRB 4PJNA 2Y6XA 3FXDB 4PW8A 3CPZA 1IAPA 4PJJA 3QC9A 4EYYR 3E0ZA 4U74A 2YU1A 3I9YA 4EIWA 5FMNA 2V7IA 2CWOA 1D1CA 4OHFA 4GIWA 2Q9QA 4TX5A 3B13A 3EDVA 3ZN0B 4X1KE 4DBRA 4EB6E 1MMDA 3LFMA 5LA6E 2W63A 3K8PC 1HG2A 5DQWA 4HE8A 3D0TA 3V5UA 2C5IT 5J2TE 3N9NA 3O1IA 5LGNB 1HF8A 5FYMA 5C8YE 1D0YA 3GA8A 4QXBB 4DMWA 3RIIA 2B1EA 1LVKA 5CB4E 2BVLA 2MTQA 4CI1B 4ZS3A 3JC6C 4GK0E 2JJ9A 3CX6B 3HA4A 4UELA 4UV9B 3RYHE 5JDLA 3LBXB 3J9X1 4AKHA 1HG5A 3HKBE 2Q9QC 1EZ3A 2KWIB 1LKXA 5DABA 5JRCA 2WMOA 3C4ZA 2LJLA 4QKNA 3KVAA 2NP9A 5JREA 2DCFA 4TN7B 3UTKA 2LE8A 1S35A 5E0OA 1FMWA 3MZKB 2LSYA 2NW8A 5HXEA 3I0OA 4XAXB 4CI2B 2CLYB 3RC3A 2NWBA 1ZV4X 2IAKA 5LJNA 2J1DG 3PU3A 3ZCJA 3KVFA 4WNKA 2QGSA 1YKEB 3PDYA 3MJXA 4JEUB 1WRDA 2WMNA 3E22E 3KV9A 2A3DA 4O4HE 2W00A 2X9HA 3N9PA 4B6XA 2JMHA 4YJ3E 1YW0A 1MIYA 4AKIA 5FNVE 4XZCA 2NOXA 4I43B 5EK4A 2YU2A 1ZEEA 1KNZA 3W15B 3CVRA 2KNDA 4H9PC 5H6RB 3ZPOA 4ZI3D 4G63A 4BJNA 3OYXA 3ZLIA 1Y64B 3KDSE 3DJBA 3RPUA 4YHJA 4DVDA 4EZHA 2D0TA 5LHIB 5GONE 2UXNB 2K48A 4O2AE 3R6NA 1MIVA 2ZM8A 2XAQB 4ZS2A 1NWMX 2ODVA 1Z0PA 3BQLA 3H3AA 5FXZA 3ZYLA 5JR9B 3ZMUB 4JEHB 2H3RA 2WSSV 2EHOD 4N78D 3UULA 4JLEA 3N5LA 2LOSA 2VKHA 2ZLYA 4UEMA 2E9XD 3F2EA 3VKHA 2X51A 5H6QB 4CXWA 5JDMA 3I9WA 5JRCB 3A7SA 5L3DB 3CMLA 2L8KA 4MALA 4X1IE 4FI5A 3Q9DA 2LHNA 1IZNB 2CA5A 3ONXA 4O2BE 4UF0B 4QXCB 4JUYA 4PJMA 5KDMC 3N9LA 5HXRA 2BDEA 4HN9A 3HL6A 3VKGA 4PK4A 4V1Av 2Z6EA 1SHZC 1G8XA 4EYUA 2V7JA 3C51A 3N2OA 5LCYA 3AVSA 2UXXB 3CKDA 2HPJA 2H7VC 3RRCA 5IYZE 5L3EB 3K3OA 2PJQA 2X0LB 2WWUA 3NBXX 3O1JA 4FJOA 4GOUA 4KP3C 3ZMTB 2Y8DA 3HR0A 4DMVA 3HKDE 3Q2MA 4HGAA 4P0AA 4XBFB 1BR4A 3HI2A 3IF8B 4C90A 2JRKA 3L09A 3KV4A 4PK6A 4ZI2C 3EVYA 1IJ5A 3O4XE 2X67A 3OJAA 3AB3B 3ZEFB 4ANJA 4EZ4A 3FB2A 4KMCA 3N9QA 5J2UE 4PAGA 3GWHA 1MMGA 4EXTA 4OFZA 3N2KE 4IE5A 1IJ6A 2C5KT 3KBTA 2VKJA 3PUAA 4MFRA 1BR1A 3DP7A 4H63H 1B7TA 1FMVA 1KK7A 3FXEB 5JDQA 4MLKA 4BAYB 3C50A 1HCIA 3V5SA 2KINB 1BR2A 2A2FX 3IRTA 2LT3A 1CUNA 2QA7A 4IIJE 3F57A 2V7KA 1MNEA 4KUMB 5FY0A 1UCUA 2XQYA 2X9WA 4AQGA 2LM9A 4CXYA 3BQKA 2CLYC 2NTYA 5CA1E 2CXLA 2CMRA 4YFSA 3KW5A 3IEEA 4O4LE 4TV9E 4TUYE 4H63V 4IHJE 2V7LA 4DM9A 2IC9A 2X66A 4I50E 4HEAA 2VK9A 1D0ZA 5M4YA 2ZM0A 4MHCA 2ODUA 2Y48B 1ZHCA 2BZBA 2VWAA 1MMNA 1D1BA 3KFWX 3RH3A 5L3BB 2YEVC 4Z8XA 2ZM2A 3AVRA 4PJLA 4O4IE 2VL8A 2CWYA 4U72A 4EOZB 5EK2A 1UX4A 2HPLA 4ZHQE 3U3IA 1US7B 5EK3A 5L3GB 3U78A 4TV8E 4IE6A 3C4WA 5HXCA 3KBUA 5HXSA 2PFVA 3NRYA 4HKAA 3CQGB 5CA0E 3HKCE 3MA9A 4P0BA 2XAJB 4YJ2E 2IW5B 4PNIA 3H37A 3QUJA 2K9AA 3GN5B 2MBGA 4ISTA 5FXVA 1U5PA 2D2SA 4IE4A 3RISA 2SPCA 5LGTB 3ZN1B 3NRXA 1XD3A 5JR9A 3B57A 3FHNA 1OXZA 4IDZA 4O8SA 2KWHA 1AJ3A 3CQXC 2L9QA 3O9XA 1MNDA 2DWGA 3FBLA 3LG7A 3VU7H 3A5XA 4I4TE 3S4UA 2W61A 2KMFA 3AA0B 4GYRA 2CE7A 1BR0A 3RKOA 4HTEA 3SOLA 5AFUL 2K24A 3K3QC 3MACA 3MK7C 1HS7A 4C91A 1HFAA 2E9XB 5LBMA 1QSDA 3HKEE 1V9DA 3SWHA 4ZI2D 3RRWA 3TB3A 4DNDA 3UUMA 3RYCE 4ASKA 4CI3B 1HX8A 2P9BA 2V1DB 1YD8G 5JQGE 2DI4A 3IFWA 3BK9A 3C98B 1HTJF 2LOPA 3RYFE 2YINA 5LG4A 5DJQC 3OYZA 2G0UA 5HYAA 5L2LA 3FBZA 4ISSA 2LHRA 2Q9QB 3VHLA 3KV6A 2XHEB 3N9OA 2X68A 1UCHA 5LOVE 4H9NC 4OYKA 4F6RC 3NZPA 5J1GA 5JDGA 2X9XA 3DTOA 1SA0E 2V7MA 5LBQB 2W62A 4JKJA 1O3XA 4MBQA 4PFOA 2DHRA 2VKDA 3AA1B 4UVAB 2D5UA 2PBIA 4X20E 4ZI7E 3BQIA 3RX6A 2XTLA 4TZ4C 3I1AA 2GK9A 3ETUA 2DNXA 4YLHA 2LSKA 5ADXL 3EDUA 4P09A 2H7OA 3CX7B 3UUXB 3WAJA 2KLQA 3ZC1A 2IC6A 4NUVA 1LRZA 2N1GA 5LYJE 2KT9A 4AQFA 3WAKA 3F31A 4CQIA 4DO0A 4UVCB 2DLRA 4QXHB 4OK0A 2EHOB 4ZI3C 3CWZB 4H9OC 2WBLA 3C64A 4WW0A 3LK3B 3ZMSB 2LSIA 5LHGB 2E8IA 2MOZA 3J7Yq 5JH7E 3ZYKA 2ETLA 3OBVE 3ZMVB 3CQCB 1E1HB 5HAXA 4QHOA 3Q5WA 1FEWA 2XAFB 5IHYA 4CXXA 5LHHB 4H9QC 3CX8B 4WBOA 5HWXA 5LP6E 2CEAA 2JMKA 1D1AA 5F8PA 1NAFA 2D0UA 1LVFA 2XAHB 1WYCA 5LXTE 2XAGB 5JVDE 1WYBA 2JPFA 4H9SE 4UV8B 5HWYA 2ZMAA 2MYSA 1X79A 5JR9C 4O4JE 3ZYMA 4AQFC 3IBPA 1WLXA 4PK5A 2LSJA 3ZJ2A 3AAIA 3L3PA 3NZQA 3LBXA 3GN5A 4AKLA 2JQQA 2W0GA 4AXPA 3N9MA 2XASB 1MMAA 4GYSA 4AI6A 1T98A 3SS1A 3TKLB 4OYJA 1U4QA 5FXXA 4BJMA 4E7ZA 2Q9QD 2XUEA 3R84B 2EHOA 5EZYE 3EUHA 3Q5XA 5FY1A 4GK5E 3PUSA 4ERRA 4UIGA 4ILUA 4DBQA 2RP4A 5L3FB 4IE7A 2VKOA 3MXZA 5JDNA 3SRZA 2RA1A 4WBNE 5LJMA 3JC6D 2CCQA 4IG7A 2C0SA 3PUQA 3KV5A 3E08A 3C4XA 1VOMA 5FY7A 3ZJ1A 5FP3A 3N2GE 3LJCA 4QX7B 1WR6A 4BA9A 4E7SA 2N9DA 4KBMB 2NW9A 3AAAB 4PFPA 3QK6A 4NUUA 2E9XC 4L0RA 4G2AA 2NW7A 4J2CA 2WM9A 2NTXA 5DQVA 3ZC0A 4ADZA 2M67A 3ANWA 4L5GA 4UF0A 3K3NA 5F3JA 2EHOC 5A1LA 5LNKA 2CXDA 4IE0A 4UVBB 2OA5A 2DWKA 2V26A 4X1YE 4EAHA 5HXHA 2LSGA 4H9RC 2CXFA 2I59A 3T8OA 1ZKEA 1YKHB 2HH7A 4K0UA 1FIOA 5KMGP 1UX5A 3UT5E 5JDFA 4AKRB 4M1PA 4I55E 3MKDA 4IGUA 2PG8A 1H7CA 2ES0A 3PU8A 3AA7B 3OKQA 1D0XA 3LK42 2A72A 2LEHA 3GMIA 2YK0A 2KZ7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XD3 A;  3IHR A;  3IFW A;  3TB3 A;  4UEM A;  4IG7 A;  2LEN A;  4JKJ A;  3RII A;  3IRT A;  3KW5 A;  4I6N A;  3RIS A;  3KVF A;  4DM9 A;  1CMX A;  1UCH A;  2ETL A;  3A7S A;  4UEL A; 
#chains in the Genus database with same CATH topology
 5AQL B;  4ZOL E;  3UUN A;  3ZT7 A;  2KXP B;  5HCM A;  1HNX T;  5AQV B;  4AKG A;  3AE7 A;  4NXN T;  2E9X A;  5L3C B;  2UXC T;  1QUU A;  3LK2 B;  3PUR A;  3PE0 A;  2VB6 A;  1JNR A;  4DV3 T;  3B5M A;  3AAE B;  1OWA A;  2FJB A;  3P7I A;  3ETV A;  1MIW A;  3RYI E;  4P0A A;  3O1H A;  2H89 A;  3ZMZ B;  2L3L A;  4DV1 T;  2K5B B;  2WDQ A;  3ZKR A;  2ACX A;  4HWD A;  2WAU A;  4I6N A;  5BMV E;  1HX1 B;  2QVA A;  3P8C D;  4QX8 B;  4JI6 T;  1HNW T;  4HWC A;  5JDH A;  1UUR A;  2C5J A;  3WI3 A;  2BVM A;  3KIN B;  2N2N A;  4HFV A;  2VVN A;  1G73 A;  2K3W A;  3M65 A;  1CHU A;  2MAW A;  3Q5D A;  3OTO T;  4LF7 T;  2LEN A;  5AQS B;  1WFD A;  4HFD A;  3I0Q A;  3SFD A;  4DR4 T;  3SFE A;  4UXN B;  5ETW A;  4LFB T;  3PUG A;  3NKZ A;  2V6X A;  5TAO A;  2YN6 A;  3ANW B;  3AA6 B;  4L9I A;  5AQR B;  2CM0 A;  4JV5 T;  3JAE A;  3AED A;  5AQI B;  3PUY F;  3TLU A;  5KX5 E;  5FXW A;  5LGU B;  3RC8 A;  1CMX A;  2VAS A;  2X9Y A;  3ESL A;  3IHR A;  3UFE A;  2UUA T;  1VRB A;  2XQ9 A;  2B76 A;  1S94 A;  3KVB A;  4QWN B;  3ZCI A;  4CZZ B;  4CN6 A;  4A56 A;  3PTR B;  4DV2 T;  4PJN A;  2Y6X A;  3FXD B;  4PW8 A;  1I6Z A;  3CPZ A;  1IAP A;  4PJJ A;  3QC9 A;  4EYY R;  3E0Z A;  4U74 A;  2YU1 A;  3I9Y A;  3UU3 A;  3RIU C;  4EIW A;  5FMN A;  1W09 A;  2V7I A;  2CWO A;  3M3Z B;  1D1C A;  4OHF A;  1GQE A;  4GIW A;  2Q9Q A;  4TX5 A;  3B13 A;  3EDV A;  3ZN0 B;  5HEG A;  5LG3 A;  4X1K E;  3FZM B;  4ILC A;  4DBR A;  2UUB T;  4EB6 E;  1NEN A;  1MMD A;  2XQ7 A;  3LFM A;  5LA6 E;  2E5L T;  2W63 A;  4DR7 T;  5FL0 A;  3K8P C;  4X66 T;  3AE9 A;  1HG2 A;  2BG9 C;  4YSZ A;  5DQW A;  4HE8 A;  3D0T A;  3V5U A;  5JTG A;  1J5E T;  2C5I T;  3FZL B;  3N9N A;  3O1I A;  5LGN B;  5J2T E;  1HF8 A;  3TLV A;  4JI8 T;  5FYM A;  1W0B A;  4DR1 T;  5C8Y E;  3JAF A;  2F4V T;  1UUS A;  1D0Y A;  3GA8 A;  4QXB B;  4DMW A;  3RII A;  2B1E A;  1LVK A;  3AEC A;  2UXB T;  2JQH A;  5CB4 E;  1N32 T;  3CIR A;  2FUP A;  2BVL A;  4A5X A;  2MTQ A;  4CI1 B;  4ZS3 A;  5AQH B;  3JC6 C;  3UU5 A;  4GK0 E;  4QH4 A;  2WZI A;  2JJ9 A;  1IBL T;  3CX6 B;  3LDQ B;  3HA4 A;  4YXD A;  2UU9 T;  4UEL A;  2XY8 B;  4UV9 B;  4WZX A;  3RYH E;  5JDL A;  3LBX B;  3AEG A;  3J9X 1;  2LRL A;  3ABV A;  4HWI B;  3RIU A;  4AKH A;  2XQ4 A;  1HG5 A;  3UUB A;  4YTN A;  4LF5 T;  3HKB E;  2Q9Q C;  2BS4 A;  1WCR A;  1EZ3 A;  2CBI A;  3EAB A;  4F8H A;  5ABF B;  1OED E;  2KWI B;  3QOF A;  1LKX A;  5DAB A;  4K0K T;  5JRC A;  2CPT A;  4EEB A;  2WMO A;  3C4Z A;  2LJL A;  4QKN A;  3KVA A;  2NP9 A;  5JRC B;  5JRE A;  2DCF A;  4TN7 B;  3UTK A;  2OV9 A;  2LE8 A;  1S35 A;  5E0O A;  1FMW A;  3MZK B;  3RQU A;  2LSY A;  4DR6 T;  2X0H A;  4JI5 T;  2W67 A;  2NW8 A;  1M62 A;  2WZH A;  5HXE A;  5L4H A;  3I0O A;  4LML A;  1XNR T;  2XSA A;  4XAX B;  4P1N A;  4CI2 B;  2CLY B;  3RC3 A;  4NXM T;  3AE5 A;  4KX6 A;  2NWB A;  1ZV4 X;  2IAK A;  1KEY A;  4HWF A;  5LJN A;  2XZE A;  3G06 A;  1X9B A;  2J1D G;  3JCF A;  3PU3 A;  3ZCJ A;  3KVF A;  1OED A;  4WNK A;  1KNR A;  4DV0 T;  2QGS A;  3PUW F;  1YKE B;  2J62 A;  2M6B A;  3MJX A;  3PDY A;  4HFC A;  1WRD A;  2WMN A;  3E22 E;  2VUR A;  2A3D A;  3KV9 A;  4IDN A;  4JEU B;  4O4H E;  4EED A;  2VQE T;  4DV5 T;  2W00 A;  2X9H A;  3N9P A;  3VR8 A;  4B6X A;  2JMH A;  4YJ3 E;  1YW0 A;  4DR3 T;  2AXD S;  3ONJ A;  4HWH A;  1W9R A;  4DUY T;  1MIY A;  4AKI A;  5FNV E;  4XZC A;  2NOX A;  4I43 B;  5EK4 A;  2YU2 A;  1WR0 A;  1ZEE A;  1KNZ A;  3W15 B;  3CVR A;  2KND A;  4H9P C;  4U2Z A;  5H6R B;  4WYV A;  3ZPO A;  4G63 A;  4BJN A;  4ZI3 D;  3OYX A;  3ZLI A;  2J47 A;  4A98 A;  5AQJ B;  3P4R A;  1Y64 B;  3KDS E;  3DJB A;  3RPU A;  4YHJ A;  4Z91 A;  4DVD A;  4EZH A;  2D0T A;  5LHI B;  4KHZ F;  3RLF F;  5GON E;  2YOE A;  2UXN B;  2K48 A;  2VL0 A;  4O2A E;  3R6N A;  1MIV A;  1E7P A;  2ZM8 A;  2XAQ B;  2E2A A;  4ZS2 A;  3CK6 A;  1NWM X;  1OED C;  4DR5 T;  2ODV A;  1KFY A;  1Z0P A;  3BQL A;  3H3A A;  5FXZ A;  3ZYL A;  4YHH T;  1W0A A;  3ZMU B;  5JR9 B;  4JEH B;  2H3R A;  2WSS V;  2CHN A;  2EHO D;  4N78 D;  3UUL A;  4KI0 F;  3QB5 K;  4JLE A;  3IA3 A;  3N5L A;  2LOS A;  2VKH A;  2I6H A;  2ZLY A;  4UEM A;  3Q5E A;  2E9X D;  3F2E A;  4JYA T;  3VKH A;  2X51 A;  1XNQ T;  5CFB A;  4QH1 A;  5H6Q B;  2XQ6 A;  3I9W A;  1XZY A;  2BG9 A;  4CXW A;  5JDM A;  5L3D B;  3CML A;  4TWD A;  2L8K A;  4MAL A;  4X1I E;  3VRB A;  2CHO A;  2E5V A;  4FI5 A;  3Q9D A;  4HFE A;  4QH5 A;  2LHN A;  1IZN B;  2CA5 A;  3ONX A;  3P4P A;  4O2B E;  4QXC B;  2HN2 A;  2YDR A;  4JUY A;  4UF0 B;  4PJM A;  5HEU A;  3N9L A;  5HXR A;  5KDM C;  5AQM B;  2BDE A;  4HN9 A;  3HL6 A;  3VKG A;  3FZF B;  4PK4 A;  4V1A v;  2Z6E A;  4X64 T;  4B3T T;  2IIU A;  1SHZ C;  1G8X A;  4EYU A;  2V7J A;  3C51 A;  3N2O A;  5LCY A;  5AQF B;  3P50 A;  3AVS A;  2OLT A;  2UXX B;  3CKD A;  4COF A;  2HPJ A;  4GKK T;  2H7V C;  3RRC A;  5IYZ E;  5L3E B;  3AE2 A;  3K3O A;  2PJQ A;  2X0L B;  2WWU A;  3NBX X;  3O1J A;  4FJO A;  4GOU A;  4KP3 C;  3ZMT B;  2Y8D A;  3HR0 A;  4DMV A;  2BKO A;  2FBW A;  3HKD E;  3Q2M A;  4HGA A;  1BR4 A;  2WCA A;  1T8B A;  2D9D A;  3HI2 A;  2JRK A;  3IF8 B;  3KV4 A;  3L09 A;  4PK6 A;  4C90 A;  3EVY A;  4ZI2 C;  5FL1 A;  1IJ5 A;  2RPA A;  3A7M A;  3O4X E;  5IWA T;  2X67 A;  3OJA A;  2IDO B;  3AB3 B;  3UQ4 A;  4ANJ A;  5LB7 B;  4EZ4 A;  3FB2 A;  3ZEF B;  2LKH A;  4ZZC A;  2R6G F;  4KMC A;  3N9Q A;  5J2U E;  4PAG A;  3GWH A;  4U31 A;  5HEJ A;  4B3R T;  1MMG A;  1UK5 A;  4JBW F;  4OFZ A;  3N2K E;  5F5W A;  4EXT A;  2WY2 A;  4IE5 A;  1IJ6 A;  4U7Y A;  2AE9 A;  2C5K T;  3KBT A;  2VKJ A;  3PUA A;  4MFR A;  3P4S A;  1BR1 A;  3DP7 A;  1J5W A;  1B7T A;  1FMV A;  1KK7 A;  3FXE B;  4H63 H;  5JDQ A;  5L47 A;  4MLK A;  4I0U A;  3C50 A;  1HCI A;  1Z8U A;  3V5S A;  2KIN B;  4BAY B;  4ILB A;  1BR2 A;  1J1J A;  2A2F X;  2LT3 A;  4IDQ A;  4AIS A;  4YSX A;  2W4X A;  3IRT A;  1CUN A;  2QA7 A;  4IIJ E;  2XQA A;  3F57 A;  2V7K A;  1MNE A;  4KUM B;  5FY0 A;  5C2T A;  2W2U A;  3AEF A;  2HN1 A;  3P4Q A;  1UCU A;  2XQY A;  2X9W A;  4AQG A;  2LM9 A;  5C3J A;  4CXY A;  2XM2 A;  1I94 T;  1NEK A;  1YXR A;  3BQK A;  2CLY C;  2NTY A;  3ONL C;  5HEO A;  5CA1 E;  2CXL A;  3A8Y C;  3VR9 A;  2CMR A;  3K1S A;  4YFS A;  5AQU B;  4NPP A;  3KW5 A;  3IEE A;  4B3S T;  2BKP A;  4O4L E;  4TV9 E;  4TUY E;  4H63 V;  4IHJ E;  2V7L A;  3ZT6 A;  4X5T A;  4DM9 A;  2IC9 A;  2M6I A;  2X66 A;  2FJA A;  4I50 E;  4X65 T;  2UUC T;  4HEA A;  2XQ8 A;  5ABF A;  2VK9 A;  3FZK B;  3TLT A;  1D0Z A;  5M4Y A;  5J0Z A;  2ZM0 A;  4MHC A;  2ODU A;  2Y48 B;  3L8R A;  2FJD A;  1KF6 A;  1ZHC A;  2BZB A;  1MMN A;  1D1B A;  2VWA A;  3KFW X;  3RH3 A;  5L3B B;  4CN4 A;  2DL1 A;  2YEV C;  3PV0 F;  4Z8X A;  2ZM2 A;  3AVR A;  4PJL A;  5AQO B;  3RF1 A;  2LKG A;  4X62 T;  4O4I E;  2VL8 A;  2CWY A;  4U72 A;  4EOZ B;  5EK2 A;  4JI4 T;  1UX4 A;  2HPL A;  4ZHQ E;  3U3I A;  1US7 B;  5EK3 A;  5L3G B;  3U78 A;  3EAM A;  4TV8 E;  4U33 A;  4IE6 A;  4IL4 A;  3QB5 A;  5ABG A;  3C4W A;  5L4E A;  2VQF T;  3P4W A;  5HXC A;  3KBU A;  5HXS A;  4YTP A;  4ZEY A;  2PFV A;  3NRY A;  4HKA A;  3CQG B;  5CA0 E;  2LLY A;  4JI7 T;  3HKC E;  3MA9 A;  4P0B A;  2BG9 B;  2XAJ B;  3TLW A;  2IW5 B;  1M7K A;  4YJ2 E;  4PNI A;  3H37 A;  1Y01 A;  3QUJ A;  3RIF A;  2K9A A;  3GN5 B;  3OVU A;  4LMJ A;  4LFA T;  2MBG A;  4IST A;  2WQY A;  3AE6 A;  2V6Y A;  1U5P A;  5FXV A;  2D2S A;  5FVL A;  4IE4 A;  3RIS A;  5FKY A;  2SPC A;  5LGT B;  3PJA J;  1E2A A;  2IHR 1;  3ZN1 B;  4ZXL A;  3NRX A;  1XD3 A;  5JR9 A;  3B57 A;  4HFI A;  2V8S V;  1OXZ A;  3FHN A;  4IDZ A;  4O8S A;  2KWH A;  3ZSS A;  4JI1 T;  1AJ3 A;  3CQX C;  2L9Q A;  2XQ5 A;  1ZP0 A;  2BS3 A;  2CRB A;  4KHP T;  3O9X A;  3PUX F;  1MND A;  2DWG A;  3FBL A;  3H3M A;  3LG7 A;  1R8I A;  3A5X A;  4I4T E;  3S4U A;  2W61 A;  3UU4 A;  3VU7 H;  5KXJ A;  1IBM T;  2KMF A;  3AA0 B;  4GYR A;  2CE7 A;  1BR0 A;  1DU2 A;  3JAD A;  4EGW A;  3RKO A;  4HTE A;  4YY3 T;  3SOL A;  3AE1 A;  2K24 A;  3K3Q C;  3MAC A;  3MK7 C;  5AFU L;  1HS7 A;  4C91 A;  1HFA A;  2E9X B;  3AEB A;  5LBM A;  1QSD A;  3HKE E;  1V9D A;  3UU8 A;  5CGM A;  3SWH A;  4ZI2 D;  3RRW A;  2FJE A;  3TB3 A;  4DND A;  3UUM A;  3AXJ B;  5ABH A;  3RYC E;  3QNU A;  4A97 A;  1SE7 A;  4ASK A;  1HX8 A;  4CI3 B;  4YT0 A;  3RQW A;  4TNV A;  1T72 A;  2V1D B;  2P9B A;  1YD8 G;  4TWF A;  2DI4 A;  4DID B;  5IUX A;  5JQG E;  3BK9 A;  5LMU T;  3T1H T;  1N36 T;  5AQG B;  2WDR A;  3C98 B;  1HTJ F;  2LOP A;  3RYF E;  2YIN A;  5LG4 A;  5DJQ C;  3AXJ A;  2G0U A;  2MPK A;  3OYZ A;  3RIA A;  5HYA A;  5L2L A;  4DV4 T;  3FBZ A;  4ISS A;  3RKG A;  4LMK A;  2LHR A;  2Q9Q B;  4HFH A;  3KV6 A;  2XHE B;  3N9O A;  2QYW A;  2X68 A;  3VHL A;  4OX9 T;  4XBF B;  1UCH A;  5LOV E;  4H9N C;  4OYK A;  4F6R C;  3NZP A;  5J1G A;  5JDG A;  2X9X A;  3DTO A;  5AQQ B;  1SA0 E;  2V7M A;  5LBQ B;  2W62 A;  4Q25 A;  1O3X A;  4MBQ A;  4JKJ A;  4PFO A;  2DHR A;  2VKD A;  3AA1 B;  4UVA B;  2D5U A;  2PBI A;  4X20 E;  4ZI7 E;  1N33 T;  3BQI A;  3RX6 A;  2XTL A;  3AEA A;  4TZ4 C;  3I1A A;  4AIU A;  5AQK B;  2GK9 A;  4DR2 T;  3ETU A;  2DNX A;  2JQK A;  2VVS A;  4DUZ T;  4YLH A;  3EI0 A;  2BKN A;  2LSK A;  2W66 A;  3EDU A;  4P09 A;  4JI2 T;  2V5D A;  2H7O A;  3CX7 B;  3UUX B;  5ADX L;  4IDP A;  3WAJ A;  3OPC A;  2V6Y B;  2KLQ A;  3PUZ F;  4NIQ A;  3ZC1 A;  2IC6 A;  1ZOY A;  4NUV A;  1LRZ A;  4LF9 T;  4ZZB A;  2N1G A;  5LYJ E;  4ILA A;  2KT9 A;  2JQ9 A;  4U7I A;  3WAK A;  3F31 A;  4AQF A;  4CQI A;  4DO0 A;  1VCS A;  4JI3 T;  4UVC B;  2DLR A;  4QXH B;  1UGO A;  4OK0 A;  2EHO B;  4ZI3 C;  3VRA A;  3CWZ B;  4H9O C;  2WBL A;  3C64 A;  4WW0 A;  3LK3 B;  1OED B;  2LSI A;  3FZH B;  3ZMS B;  2E8I A;  5LHG B;  2MOZ A;  4B3M T;  4LF4 T;  3J7Y q;  5JH7 E;  3ZYK A;  2ETL A;  3OBV E;  1SUM B;  2XSB A;  3ZMV B;  3CQC B;  4LFC T;  2XPK A;  1E1H B;  5HAX A;  4YSY A;  4QHO A;  1XDP A;  3Q5W A;  1FEW A;  3LSV A;  2XAF B;  5IHY A;  4HFB A;  4CXX A;  4LF8 T;  5LHH B;  4H9Q C;  3CX8 B;  4WBO A;  5HWX A;  5LP6 E;  2A9U A;  2CEA A;  2CBJ A;  2WWV A;  2JMK A;  1D1A A;  2XM1 A;  5F8P A;  1NAF A;  1YQ4 A;  1FJG T;  2D0U A;  1LVF A;  2XAH B;  2YDS A;  2KSR A;  3UU6 A;  1WYC A;  2WU5 A;  5LXT E;  2XAG B;  5JVD E;  2WDV A;  1WYB A;  2JPF A;  4H9S E;  1XMO T;  4UV8 B;  1JNZ A;  4U2Y A;  2NR4 A;  5HWY A;  2ZMA A;  2MYS A;  4LF6 T;  1X79 A;  3AE4 A;  5JR9 C;  4O4J E;  2UXD T;  2HHH T;  3ZYM A;  3ZST A;  4AQF C;  3IBP A;  1WLX A;  4PK5 A;  2LSJ A;  5CJ5 A;  3ZJ2 A;  4IL9 A;  3AAI A;  3L3P A;  3NZQ A;  3AEE A;  2YDQ A;  3LBX A;  3GN5 A;  1VCT A;  4AKL A;  2JQQ A;  2W0G A;  4AXP A;  3N9M A;  2XAS B;  1MMA A;  3X1D A;  4GYS A;  4EV6 A;  4AI6 A;  1T98 A;  2BS2 A;  3SS1 A;  3TKL B;  4DV6 T;  4IRE A;  4Z90 A;  2IML A;  3NWI A;  1U4Q A;  4OYJ A;  5FXX A;  1HR0 T;  4BJM A;  4E7Z A;  5FVK A;  4TWH A;  1YQ3 A;  2Q9Q D;  2XUE A;  3R84 B;  1QLB A;  2JIW A;  1T7S A;  2WP9 A;  2EHO A;  5EZY E;  3EUH A;  3Q5X A;  5FY1 A;  4GK5 E;  5HEH A;  3IFW A;  3PUS A;  4ERR A;  4UIG A;  5AQT B;  4ILU A;  3UQ7 A;  3PUV F;  4DBQ A;  2RP4 A;  5L3F B;  2BG9 E;  4IE7 A;  2VKO A;  3MXZ A;  4UR9 A;  2LRK A;  3SRZ A;  5JDN A;  2RA1 A;  4CN1 A;  4WBN E;  3JC6 D;  5LJM A;  2CCQ A;  3PJA A;  4IG7 A;  2C0S A;  5AQN B;  5ABE A;  1IBK T;  5AQP B;  3PUQ A;  3ZT5 A;  2BBH A;  3AE8 A;  1XWM A;  3KV5 A;  2V5C A;  3E08 A;  3C4X A;  2ACZ A;  1VOM A;  5FY7 A;  3ZJ1 A;  4TNW A;  5FP3 A;  3N2G E;  3LJC A;  4IDO A;  1WR6 A;  4QX7 B;  2BBJ A;  3AE3 A;  1XMQ T;  4BA9 A;  4E7S A;  2N9D A;  4KBM B;  1HNZ T;  2XQ3 A;  2NW9 A;  3AAA B;  3EHZ A;  4PFP A;  3A7S A;  4AQY T;  3QK6 A;  4NUU A;  2E9X C;  2QRX A;  4L0R A;  4YTM A;  4GKJ T;  4G2A A;  2NW7 A;  4J2C A;  2WM9 A;  2J4G A;  2NTX A;  5DQV A;  3ZC0 A;  4ADZ A;  2M67 A;  2WU2 A;  3ANW A;  2LM2 A;  3K3N A;  4L5G A;  2EHO C;  4UF0 A;  5A1L A;  5F3J A;  5LNK A;  1XDO A;  2CXD A;  3T1Y T;  4JI0 T;  4DV7 T;  4IE0 A;  4UVB B;  2OA5 A;  2DWK A;  2V26 A;  4X1Y E;  3RGL A;  4EAH A;  3UFG A;  2LSG A;  3NVO A;  4H9R C;  2CXF A;  5HXH A;  2I59 A;  5HCJ A;  3TLS A;  5BR8 T;  3T8O A;  2ZM6 T;  1ZKE A;  5LMN T;  2PTF A;  1N34 T;  2XJ7 A;  1YKH B;  2HH7 A;  2YKS A;  1FIO A;  4K0U A;  5KMG P;  1UX5 A;  4U3C A;  2X0Y A;  4IT4 A;  5JDF A;  3UT5 E;  4AKR B;  4M1P A;  1L0V A;  3L39 A;  1KNP A;  3MKD A;  2WS3 A;  4I55 E;  2IUB A;  4IGU A;  2PG8 A;  3RI5 A;  1H7C A;  2ES0 A;  3PU8 A;  3AA7 B;  2WB5 A;  3OKQ A;  1D0X A;  2H88 A;  2A72 A;  2LEH A;  3GMI A;  3LK4 2;  2YK0 A;  3RHW A;  2KZ7 B;  2I0M A; 
#chains in the Genus database with same CATH homology
 4ZOL E;  3UUN A;  4AKG A;  2KXP B;  2E9X A;  5L3C B;  1QUU A;  3LK2 B;  3PUR A;  3PE0 A;  2VB6 A;  3AAE B;  1OWA A;  3P7I A;  3ETV A;  1MIW A;  3RYI E;  3O1H A;  3ZMZ B;  2L3L A;  2K5B B;  2ACX A;  4I6N A;  2WAU A;  5BMV E;  4QX8 B;  3P8C D;  5JDH A;  2C5J A;  3WI3 A;  2BVM A;  3KIN B;  2N2N A;  4HFV A;  1G73 A;  3M65 A;  2LEN A;  3I0Q A;  4UXN B;  5ETW A;  3PUG A;  5TAO A;  3ANW B;  3AA6 B;  4L9I A;  2CM0 A;  5KX5 E;  1CMX A;  5FXW A;  5LGU B;  3RC8 A;  2VAS A;  2X9Y A;  3ESL A;  3IHR A;  3UFE A;  1VRB A;  1S94 A;  3KVB A;  4QWN B;  3ZCI A;  4CZZ B;  4A56 A;  3PTR B;  4PJN A;  2Y6X A;  3FXD B;  4PW8 A;  3CPZ A;  1IAP A;  4PJJ A;  3QC9 A;  4EYY R;  3E0Z A;  4U74 A;  2YU1 A;  3I9Y A;  4EIW A;  5FMN A;  2V7I A;  2CWO A;  1D1C A;  4OHF A;  4GIW A;  2Q9Q A;  4TX5 A;  3B13 A;  3EDV A;  3ZN0 B;  4X1K E;  4DBR A;  4EB6 E;  1MMD A;  3LFM A;  5LA6 E;  2W63 A;  3K8P C;  1HG2 A;  5DQW A;  4HE8 A;  3D0T A;  3V5U A;  2C5I T;  5J2T E;  3N9N A;  3O1I A;  5LGN B;  1HF8 A;  5FYM A;  5C8Y E;  1D0Y A;  3GA8 A;  4QXB B;  4DMW A;  3RII A;  2B1E A;  1LVK A;  5CB4 E;  2BVL A;  2MTQ A;  4CI1 B;  4ZS3 A;  3JC6 C;  4GK0 E;  2JJ9 A;  3CX6 B;  3HA4 A;  4UEL A;  4UV9 B;  3RYH E;  5JDL A;  3LBX B;  3J9X 1;  4AKH A;  1HG5 A;  3HKB E;  2Q9Q C;  1EZ3 A;  2KWI B;  1LKX A;  5DAB A;  5JRC A;  2WMO A;  3C4Z A;  2LJL A;  4QKN A;  3KVA A;  2NP9 A;  5JRE A;  2DCF A;  4TN7 B;  3UTK A;  2LE8 A;  1S35 A;  5E0O A;  1FMW A;  3MZK B;  2LSY A;  2NW8 A;  5HXE A;  3I0O A;  4XAX B;  4CI2 B;  2CLY B;  3RC3 A;  2NWB A;  1ZV4 X;  2IAK A;  5LJN A;  2J1D G;  3PU3 A;  3ZCJ A;  3KVF A;  4WNK A;  2QGS A;  1YKE B;  3PDY A;  3MJX A;  4JEU B;  1WRD A;  2WMN A;  3E22 E;  3KV9 A;  2A3D A;  4O4H E;  2W00 A;  2X9H A;  3N9P A;  4B6X A;  2JMH A;  4YJ3 E;  1YW0 A;  1MIY A;  4AKI A;  5FNV E;  4XZC A;  2NOX A;  4I43 B;  5EK4 A;  2YU2 A;  1ZEE A;  1KNZ A;  3W15 B;  3CVR A;  2KND A;  4H9P C;  5H6R B;  3ZPO A;  4ZI3 D;  4G63 A;  4BJN A;  3OYX A;  3ZLI A;  1Y64 B;  3KDS E;  3DJB A;  3RPU A;  4YHJ A;  4DVD A;  4EZH A;  2D0T A;  5LHI B;  5GON E;  2UXN B;  2K48 A;  4O2A E;  3R6N A;  1MIV A;  2ZM8 A;  2XAQ B;  4ZS2 A;  1NWM X;  2ODV A;  1Z0P A;  3BQL A;  3H3A A;  5FXZ A;  3ZYL A;  5JR9 B;  3ZMU B;  4JEH B;  2H3R A;  2WSS V;  2EHO D;  4N78 D;  3UUL A;  4JLE A;  3N5L A;  2LOS A;  2VKH A;  2ZLY A;  4UEM A;  2E9X D;  3F2E A;  3VKH A;  2X51 A;  5H6Q B;  4CXW A;  5JDM A;  3I9W A;  5JRC B;  3A7S A;  5L3D B;  3CML A;  2L8K A;  4MAL A;  4X1I E;  4FI5 A;  3Q9D A;  2LHN A;  1IZN B;  2CA5 A;  3ONX A;  4O2B E;  4UF0 B;  4QXC B;  4JUY A;  4PJM A;  5KDM C;  3N9L A;  5HXR A;  2BDE A;  4HN9 A;  3HL6 A;  3VKG A;  4PK4 A;  4V1A v;  2Z6E A;  1SHZ C;  1G8X A;  4EYU A;  2V7J A;  3C51 A;  3N2O A;  5LCY A;  3AVS A;  2UXX B;  3CKD A;  2HPJ A;  2H7V C;  3RRC A;  5IYZ E;  5L3E B;  3K3O A;  2PJQ A;  2X0L B;  2WWU A;  3NBX X;  3O1J A;  4FJO A;  4GOU A;  4KP3 C;  3ZMT B;  2Y8D A;  3HR0 A;  4DMV A;  3HKD E;  3Q2M A;  4HGA A;  4P0A A;  4XBF B;  1BR4 A;  3HI2 A;  3IF8 B;  4C90 A;  2JRK A;  3L09 A;  3KV4 A;  4PK6 A;  4ZI2 C;  3EVY A;  1IJ5 A;  3O4X E;  2X67 A;  3OJA A;  3AB3 B;  3ZEF B;  4ANJ A;  4EZ4 A;  3FB2 A;  4KMC A;  3N9Q A;  5J2U E;  4PAG A;  3GWH A;  1MMG A;  4EXT A;  4OFZ A;  3N2K E;  4IE5 A;  1IJ6 A;  2C5K T;  3KBT A;  2VKJ A;  3PUA A;  4MFR A;  1BR1 A;  3DP7 A;  4H63 H;  1B7T A;  1FMV A;  1KK7 A;  3FXE B;  5JDQ A;  4MLK A;  4BAY B;  3C50 A;  1HCI A;  3V5S A;  2KIN B;  1BR2 A;  2A2F X;  3IRT A;  2LT3 A;  1CUN A;  2QA7 A;  4IIJ E;  3F57 A;  2V7K A;  1MNE A;  4KUM B;  5FY0 A;  1UCU A;  2XQY A;  2X9W A;  4AQG A;  2LM9 A;  4CXY A;  3BQK A;  2CLY C;  2NTY A;  5CA1 E;  2CXL A;  2CMR A;  4YFS A;  3KW5 A;  3IEE A;  4O4L E;  4TV9 E;  4TUY E;  4H63 V;  4IHJ E;  2V7L A;  4DM9 A;  2IC9 A;  2X66 A;  4I50 E;  4HEA A;  2VK9 A;  1D0Z A;  5M4Y A;  2ZM0 A;  4MHC A;  2ODU A;  2Y48 B;  1ZHC A;  2BZB A;  2VWA A;  1MMN A;  1D1B A;  3KFW X;  3RH3 A;  5L3B B;  2YEV C;  4Z8X A;  2ZM2 A;  3AVR A;  4PJL A;  4O4I E;  2VL8 A;  2CWY A;  4U72 A;  4EOZ B;  5EK2 A;  1UX4 A;  2HPL A;  4ZHQ E;  3U3I A;  1US7 B;  5EK3 A;  5L3G B;  3U78 A;  4TV8 E;  4IE6 A;  3C4W A;  5HXC A;  3KBU A;  5HXS A;  2PFV A;  3NRY A;  4HKA A;  3CQG B;  5CA0 E;  3HKC E;  3MA9 A;  4P0B A;  2XAJ B;  4YJ2 E;  2IW5 B;  4PNI A;  3H37 A;  3QUJ A;  2K9A A;  3GN5 B;  2MBG A;  4IST A;  5FXV A;  1U5P A;  2D2S A;  4IE4 A;  3RIS A;  2SPC A;  5LGT B;  3ZN1 B;  3NRX A;  1XD3 A;  5JR9 A;  3B57 A;  3FHN A;  1OXZ A;  4IDZ A;  4O8S A;  2KWH A;  1AJ3 A;  3CQX C;  2L9Q A;  3O9X A;  1MND A;  2DWG A;  3FBL A;  3LG7 A;  3VU7 H;  3A5X A;  4I4T E;  3S4U A;  2W61 A;  2KMF A;  3AA0 B;  4GYR A;  2CE7 A;  1BR0 A;  3RKO A;  4HTE A;  3SOL A;  5AFU L;  2K24 A;  3K3Q C;  3MAC A;  3MK7 C;  1HS7 A;  4C91 A;  1HFA A;  2E9X B;  5LBM A;  1QSD A;  3HKE E;  1V9D A;  3SWH A;  4ZI2 D;  3RRW A;  3TB3 A;  4DND A;  3UUM A;  3RYC E;  4ASK A;  4CI3 B;  1HX8 A;  2P9B A;  2V1D B;  1YD8 G;  5JQG E;  2DI4 A;  3IFW A;  3BK9 A;  3C98 B;  1HTJ F;  2LOP A;  3RYF E;  2YIN A;  5LG4 A;  5DJQ C;  3OYZ A;  2G0U A;  5HYA A;  5L2L A;  3FBZ A;  4ISS A;  2LHR A;  2Q9Q B;  3VHL A;  3KV6 A;  2XHE B;  3N9O A;  2X68 A;  1UCH A;  5LOV E;  4H9N C;  4OYK A;  4F6R C;  3NZP A;  5J1G A;  5JDG A;  2X9X A;  3DTO A;  1SA0 E;  2V7M A;  5LBQ B;  2W62 A;  4JKJ A;  1O3X A;  4MBQ A;  4PFO A;  2DHR A;  2VKD A;  3AA1 B;  4UVA B;  2D5U A;  2PBI A;  4X20 E;  4ZI7 E;  3BQI A;  3RX6 A;  2XTL A;  4TZ4 C;  3I1A A;  2GK9 A;  3ETU A;  2DNX A;  4YLH A;  2LSK A;  5ADX L;  3EDU A;  4P09 A;  2H7O A;  3CX7 B;  3UUX B;  3WAJ A;  2KLQ A;  3ZC1 A;  2IC6 A;  4NUV A;  1LRZ A;  2N1G A;  5LYJ E;  2KT9 A;  4AQF A;  3WAK A;  3F31 A;  4CQI A;  4DO0 A;  4UVC B;  2DLR A;  4QXH B;  4OK0 A;  2EHO B;  4ZI3 C;  3CWZ B;  4H9O C;  2WBL A;  3C64 A;  4WW0 A;  3LK3 B;  3ZMS B;  2LSI A;  5LHG B;  2E8I A;  2MOZ A;  3J7Y q;  5JH7 E;  3ZYK A;  2ETL A;  3OBV E;  3ZMV B;  3CQC B;  1E1H B;  5HAX A;  4QHO A;  3Q5W A;  1FEW A;  2XAF B;  5IHY A;  4CXX A;  5LHH B;  4H9Q C;  3CX8 B;  4WBO A;  5HWX A;  5LP6 E;  2CEA A;  2JMK A;  1D1A A;  5F8P A;  1NAF A;  2D0U A;  1LVF A;  2XAH B;  1WYC A;  5LXT E;  2XAG B;  5JVD E;  1WYB A;  2JPF A;  4H9S E;  4UV8 B;  5HWY A;  2ZMA A;  2MYS A;  1X79 A;  5JR9 C;  4O4J E;  3ZYM A;  4AQF C;  3IBP A;  1WLX A;  4PK5 A;  2LSJ A;  3ZJ2 A;  3AAI A;  3L3P A;  3NZQ A;  3LBX A;  3GN5 A;  4AKL A;  2JQQ A;  2W0G A;  4AXP A;  3N9M A;  2XAS B;  1MMA A;  4GYS A;  4AI6 A;  1T98 A;  3SS1 A;  3TKL B;  4OYJ A;  1U4Q A;  5FXX A;  4BJM A;  4E7Z A;  2Q9Q D;  2XUE A;  3R84 B;  2EHO A;  5EZY E;  3EUH A;  3Q5X A;  5FY1 A;  4GK5 E;  3PUS A;  4ERR A;  4UIG A;  4ILU A;  4DBQ A;  2RP4 A;  5L3F B;  4IE7 A;  2VKO A;  3MXZ A;  5JDN A;  3SRZ A;  2RA1 A;  4WBN E;  5LJM A;  3JC6 D;  2CCQ A;  4IG7 A;  2C0S A;  3PUQ A;  3KV5 A;  3E08 A;  3C4X A;  1VOM A;  5FY7 A;  3ZJ1 A;  5FP3 A;  3N2G E;  3LJC A;  4QX7 B;  1WR6 A;  4BA9 A;  4E7S A;  2N9D A;  4KBM B;  2NW9 A;  3AAA B;  4PFP A;  3QK6 A;  4NUU A;  2E9X C;  4L0R A;  4G2A A;  2NW7 A;  4J2C A;  2WM9 A;  2NTX A;  5DQV A;  3ZC0 A;  4ADZ A;  2M67 A;  3ANW A;  4L5G A;  4UF0 A;  3K3N A;  5F3J A;  2EHO C;  5A1L A;  5LNK A;  2CXD A;  4IE0 A;  4UVB B;  2OA5 A;  2DWK A;  2V26 A;  4X1Y E;  4EAH A;  5HXH A;  2LSG A;  4H9R C;  2CXF A;  2I59 A;  3T8O A;  1ZKE A;  1YKH B;  2HH7 A;  4K0U A;  1FIO A;  5KMG P;  1UX5 A;  3UT5 E;  5JDF A;  4AKR B;  4M1P A;  4I55 E;  3MKD A;  4IGU A;  2PG8 A;  1H7C A;  2ES0 A;  3PU8 A;  3AA7 B;  3OKQ A;  1D0X A;  3LK4 2;  2A72 A;  2LEH A;  3GMI A;  2YK0 A;  2KZ7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...