4UEQA

Structure of the v74c large subunit mutant of d. fructosovorans nife- hydrogenase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
262
structure length
262
Chain Sequence
AKHRPSVVWLHNAECTGCTEAAIRTIKPYIDALILDTISLDYQETIMAAAGEAAEAALHQALEGKDGYYLVVEGGLPTIDGGQWGMVAGHPMIETTKKAAAKAKGIICIGTCSAYGGVQKAKPNPSQAKGVSEALGVKTINIPGCPPNPINFVGAVVHVLTKGIPDLDENGRPKLFYGELVHDNCPRLPHFEASEFAPSFDSEEAKKGFCLYELGCKGPVTYNNCPKVLFNQVNWPVQAGHPCLGCSEPDFWDTMTPFYEQG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title [NiFe]-hydrogenases revisited: nickel-carboxamido bond formation in a variant with accrued O2-tolerance and a tentative re-interpretation of Ni-SI states.
pubmed doi rcsb
source organism Desulfovibrio fructosivorans jj
molecule tags Oxidoreductase
molecule keywords HYDROGENASE (NIFE) SMALL SUBUNIT HYDA
total genus 81
structure length 262
sequence length 262
chains with identical sequence B, C, D, E, F
ec nomenclature ec 1.12.2.1: Cytochrome-c3 hydrogenase.
pdb deposition date 2014-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01058 Oxidored_q6 NADH ubiquinone oxidoreductase, 20 Kd subunit
A PF14720 NiFe_hyd_SSU_C NiFe/NiFeSe hydrogenase small subunit C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.700 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NADH:ubiquinone oxidoreductase-like, 20kDa subunit 4ueqA01
4.10.480.10 Few Secondary Structures Irregular Cytochrome-c3 Hydrogenase; Chain A, domain 2 Cytochrome-c3 hydrogenase, C-terminal domain 4ueqA02
4KO2S 4UD2A 1H2AS 5JRDS 4UPEA 4UE6A 5JSUA 3H3XA 1UBTS 5A4FS 4IUBS 4KL8S 3CURA 2WPNA 4URHA 4UPVA 2FRVA 4UD6A 4UE3S 5JSKA 4C3OB 1CC1S 5A4MS 5A4IS 3UQYS 4KO4S 1WUHS 1WUKS 3MYRA 4IUCS 1UBJS 1FRVA 4GD3Q 4KN9S 1UBOS 4KO3S 4UCWA 4UCXA 4UE2A 5JSYA 1UBMS 3AYXB 4OMFG 4U9HS 3RGWS 3ZE9A 3ZE6A 3USES 3ZE8A 5ADUS 1WULS 3AYZB 4UQPA 1H2RS 4UCQA 1YQ9A 1WUJS 4CI0B 3ZE7A 1UBRS 1FRFS 1UBKS 4IUDS 4KO1S 4TTTS 4U9IS 4UEQA 1UBHS 1E3DA 1YQWA 1UBLS 5JSHA 4UEWA 1WUIS 1YRQA 3CUSA 5D51S 4UQLA 5JT1A 1UBUS 3ZEAA 3USCS
chains in the Genus database with same CATH superfamily
4WOCA 5TEWA 1CIJA 2R8ZA 1Q57A 3B9QA 1VJ1A 4IBOA 3NIBA 2J87A 5AJZA 3BIXA 4FEYA 3LNCA 3ZHVA 5EJ4A 4OQDA 3W5IA 4ILEA 5AM2A 3W5UA 1JFVA 5DYNA 3GLHA 1J2YA 4G89A 1MJFA 1ZFNA 3RFFA 5C52B 1TI7A 3C48A 4L5IA 1P2SA 2ISQA 4MV8A 1SWWA 3N2LA 4PYMA 5LUBA 4YCNA 4KIGA 2IV7A 1E4EA 4BB0A 5LNK1 4M9QA 5EIHA 1XRSB 1S3FA 3UXEA 1H69A 3HDHA 3AI2A 4QBIA 2QG4A 2PWPA 1MB2A 4YX9A 5IG2A 1WKCA 2C2HA 1W2GA 1KU0A 3PNMA 5JWRA 2RGCA 3KTFA 4L8WB 3NOQA 2NUTA 4IPTA 4KVGA 1DPGA 4ML3A 4DBVO 4EH1A 2QYOA 4KO2S 4W5OA 3H4VA 5KQSA 3TXAA 3IESA 1HDCA 5A0TA 4LDPA 1GG5A 3E3OA 2AG6A 3SKVA 4AWXA 1VIVA 5A7GA 2NVUB 5KOJA 4QGAA 4GU5A 2I8AA 2ZTUA 3H8JA 2JGRA 3O4JA 2Z5LA 4J29A 3SZUA 3T4PA 4DG9A 4PN3A 3S7TA 4ZC1A 1R37A 1FFDA 4UEJA 1Z4IA 2JIZA 2CVQA 1ZD1A 3LX5A 2VJOA 5AIAA 3QTLA 5T64A 3QVVA 1W5BA 1NBME 1E3TA 3JR3A 3A1DA 1NKVA 3OPMA 5FRDA 5C34B 1KDOA 2AFIA 3AESB 4WINA 3MCVA 4ZU1X 2DR2A 2IZ7A 2H63A 3GFQA 4LY0A 4NRDA 4KFUA 2ZYHA 1Y8ZA 5GADl 3H0EA 3PD0A 3RU2A 3IUNA 4CKYA 1F8UA 1YDGA 2YWJA 1HK7A 1M8PA 3MEQA 4PAGA 4MIYA 2NP6A 2E89A 3GGCA 3NFYA 4A2WA 4U8HA 2AI2A 2J9ZB 1Q91A 5EWMB 2X0EA 2GOYA 3OEYA 4MPPA 3R4CA 5HM8A 2CJXA 2XYRA 4CG3A 4G0QA 2JGEA 2G09A 3K70D 4PLWA 2FY8A 3MPUA 3UYLA 1TCBA 4UTPA 1LSJA 5ITZB 3BT7A 3KYJB 2H1WA 1U3TA 2YQ5A 4XVQA 2JCXA 2ZI4A 3K5PA 3U4CA 4GEGA 4HZGA 1E96A 4IKOA 2C99A 3HHEA 5DHTA 3GDGA 3KUCA 4IXDA 5FPYA 3V7UA 4ZCRA 4TWIA 3U4IA 3THXB 1GARA 3FGOA 3TD6A 1JSLA 1L7PA 3FBTA 2F1JA 3F5SA 2VXYA 2FPWA 1AUPA 1L7RA 3HA7A 4WKGA 3WK4A 2AW3A 2DY1A 3ZGZA 2AXEA 4RTNA 4EK9A 1NASA 5H70A 5JMTA 3BJZA 4L3WA 1KIMA 1N9ZA 3QVKA 4Q05A 2XQIA 3VU1A 4YIKA 4F06A 4C7OA 1QG0A 2J5BA 4ZHQF 1XTUA 4ALKA 4HH4A 4QXQA 1Y48E 4PHCA 1R00A 4KLAA 1OAKA 4XRGA 5LOVA 1I13A 2JARA 1GUDA 4JSRA 4P1ZA 1YB1A 1USVA 4ZOEA 3K09A 4ZEVA 3JRWA 1BVYF 1OBFO 1P2FA 3GGPA 5I7HA 3FPHA 5H4HA 4UFPA 2ZW9A 2ZU0C 3K09C 5B4VA 2YVLA 1Z0KA 2VNJA 4OK5A 4NYMQ 2GTHA 4IH9A 3D8BA 5TQ0B 4C0BA 4D8WA 2YVKA 2R3SA 2V6JA 1VKRA 3MAJA 4DJJA 3ZD6A 4IZ6A 3P52A 3NIGB 3TQRA 1PBTA 1TMGE 2VPWA 4RMNA 3SQWA 2YN0A 4JL8A 1Y81A 1P7VA 3H05A 3OIWA 3WJAA 4Q1CA 4M76B 5EI5A 1X39A 3QRWA 1L4KA 3TLEA 1C2YA 1ADFA 2R96A 1NJFA 5TARA 3N0RA 4MSUA 4P2BA 4UU8A 2CL7X 4I50F 1ZC3A 2MT9A 1Z4JA 4YS6A 3CYFA 1VLZA 3PK0A 5L7TA 3L46A 2MYPA 4QGGA 3KEFA 1JHAA 5BWMA 4V0MA 3VJMA 4DZRA 2FDXA 4J16C 2E4UA 3CZ5A 3IERA 4EJMA 3SIPA 3R8FA 2ZZMA 2PE5A 1LDNA 4YRCA 3SC3A 2PCJA 2YINC 3ZD7A 1XN1A 2V96A 2ZWVA 4OI4A 1U9YA 1ZIDA 3BD9A 4RK4A 5TB5A 4ZEMA 1VZ3A 1XDWA 3EGXB 3GFPA 4I7EA 2VC2B 2ZYIA 4HB4A 1K1EA 2H85A 3FOZA 2NXWA 1NBMA 4AJ1A 2PWBA 5KI6A 3BB4A 1NF9A 3CLRC 2HREA 4YCJA 5KVSA 4Y2JA 1KEVA 2C4VA 1IXRC 1ZVQA 4FYPA 5IK2A 2A0KA 1BH6A 1MN6A 2XCLA 5AI5A 1Y33E 1Z13A 4MYDA 1L5OA 4IX9A 2QMHA 1PO7A 3B6KA 4ZVVA 4DM7A 1JFFB 1HYGA 5FPTA 2Q4DA 3OUTA 4OFZA 2P3SA 4GM4A 3U4GA 3HCRA 1BE8A 2X9VA 4W5WA 4YDHB 1CY4A 4N6NA 4UHEA 4P2GA 2VYVA 4DB2A 1O6FA 3UAWA 1VP3A 1GNVA 1T2CA 2XYHA 3ZCSA 3O8CA 1Z5UA 1N33B 1Z7WA 2W11A 2OHVA 2P3LA 2RBEA 3ICCA 3DPIA 1ZK0A 4XD7D 5GMOA 3TNJA 3V33A 5IT4A 2ICAA 3I3OA 3UMCA 4AX8A 1FFEA 2HHJA 2JEZA 3LD9A 5EJAA 2FF7A 2RI6A 4KIFA 1K4KA 4GVXA 3SQXA 2WVHA 2QEQA 3OH8A 4K8OA 2NN3C 1EUCA 4NBTA 4Z3KA 2JLWA 1ZSVA 3DV9A 4H15A 3S27A 2RHHA 3SI7A 4I1VA 1LPNA 2PQ0A 3NM6B 2ZAIA 2VJNA 3G1TA 4O2AF 1V8BA 5ALXA 4Q4AB 2VBIA 3SJUA 4DSOA 3QENA 5ALQA 3DL7A 5B30A 3HADA 3KUUA 3QP9A 3SN6A 2O8EA 1OE0A 5JZBA 1TAHA 1BXKA 3QXXA 2FQ1A 1K3TA 1NRWA 3KSDO 4N0QA 3HP7A 3S2UA 1KAGA 3NHMA 4WCFA 3W1WA 4TWZA 1TKRA 2JAUA 1NLUA 1OI7A 3L4BC 1DP4A 3TM4A 5JAIA 1P61B 2O7RA 5AICA 1MOPA 3FX2A 3B3GA 4MZXA 4P31A 1LBTA 2WRZA 2ZTLA 4EGCB 1XVIA 1FDSA 4Q6WA 1KHTA 3EX7C 4H35A 5DX0A 1Z06A 1ZD4A 1X1RA 3LWZA 4OXKA 2RHRA 5EVJA 2WG2A 4YPFA 4E1BA 2HCJB 2QS9A 4JYZA 2HMTA 4UM8B 1LX6A 3WKDA 1ZH6A 3NU1A 1FNNA 2X4DA 2ZOSA 1WMSA 3IKVA 3ND7A 3P94A 3PUVA 4GOOD 1WHTB 4IJVA 4ZO8A 1UFRA 4RDXA 5KQGA 5B2FA 2VNKA 4YRAA 4CV0A 1BX1A 3K9CA 5FBKA 5JSKA 3LUPA 4I50B 4GP6A 3VZDA 3RVKA 1YWGO 2H9YA 5I8WA 3AMVA 2VJQA 1Z0FA 1ZBDA 3FYHA 5ADUS 3T3DA 1WX1A 4NNOA 1G7RA 1PEDA 4PG8A 4K2AA 2J3IA 3JYPA 4FZ3A 4IWYA 2V3WA 4PX9A 3UYKA 2PKXA 4HQ6A 1EWKA 4KAFA 4MPJA 4D9BA 4ALIA 3W3AA 3DUFA 4EW1A 4N0DA 4IHAA 2WB2A 1Y1SA 1QP4A 2PSSA 2QZPA 4Q4HA 4HSGA 2NT4A 2RGDA 4LQLA 2CDNA 4TYWA 1T5HX 4DCPA 4BTLA 3MJSA 3EF1A 2RG1A 1A98A 3BL5A 2PGJA 4CCYA 1V4BA 1ZSYA 2H11A 2VJPA 5FNVA 2FOXA 1IVSA 1YONA 2XLCA 2PSJA 2GH1A 4BDSA 3F3KA 4HGZA 3G9TA 4UHCA 4Q9JA 5SYAA 1TO1E 1TF7A 1XCOA 1IN8A 3DKRA 1F20A 2Q3MA 3W05A 3LGSA 4NCNA 1WPGA 4QUKA 1E8DA 1SCAA 3FPCA 5I7FA 4U3JB 1ULSA 5EZQA 3ZWKA 3BULA 4DUZB 1MLDA 2XB9A 1NX9A 1P7PA 4OF4A 4BO3A 1MT0A 1QPBA 3IVAA 4R98A 4CQMA 4AW9A 4DW8A 3USCS 1Y1KE 1A7KA 3KL2A 2NADA 1M2JA 2PGLA 3NC0C 4GFDA 3WDSA 3ONDA 4KL8S 4AG6A 1P1IA 3VVCA 3LIIA 4MQMA 4GPBA 2IBTA 4KPFC 1M74A 4WJKB 4KQEA 1ENPA 4PC1A 2A5LA 3U5TA 1SC9A 1XROA 3EQZA 3PLRA 1Y1LA 3AU9A 5CTAA 2D5AA 1SUDA 4JKYA 4I5DA 3VBEA 4B44A 4BNJA 1N77A 3CLTC 1NVTA 4I1UA 4Q3EA 1MIHA 1GRQA 1Z7EA 3E1SA 3ZC3A 2YCBA 3PBKA 2F2TA 3IOMA 1MEJA 1Q1GA 4R41A 4C22A 1TK3A 5KQPA 1OBVA 5CG1A 2Z0MA 2WM8A 1UMDA 2FN7A 4I1SA 4IXTA 1HDOA 4AUNA 1NA5A 2IYNA 4DXHA 2DQYA 1ZS9A 3U48A 1L7NA 4XXHA 4YRQA 3V4LA 4YTEA 1AS2A 4NESA 2BEUB 3KG2A 4EPWA 5FEUA 4KV9A 1CUHA 3RC1A 2ZSDA 1FQKA 3D1VA 3T35A 3FLMA 4KVAA 4OSEA 2Q7OE 3RQIA 1GZ4A 1OAOA 1W96A 1WUHS 4P4TA 3RWBA 1RI5A 5EJFA 5JQGB 4KWTA 3PZRA 2CV0A 1JT2A 2J3JA 1UJCA 2BRUC 4BFZA 4UFOA 4WXPA 2IH2A 2GM5A 3TDNA 1N2XA 1I7QB 4JMLA 1TQHA 4WMLA 3M6FA 1CZRA 1SU7A 2WWFA 1YHNA 1MW9X 4MKRA 3CS3A 3R8XA 1WUYA 1C81A 4TXLA 3IT3A 1XP5A 2P2ZA 1S2GA 2VWGA 2O8VA 1GIAA 2AEMA 2P41A 5CW1A 2AMYA 2OYSA 3X2EA 3MWLA 5JQGF 3HFSA 3HGMA 4E13A 1HG1A 2HMYB 2IYPA 4IDDA 4NE2A 3LX6A 4BEVA 3G2JA 1PLKA 2WPDD 1RWKA 1GFSA 1VJRA 3CUTA 1Y5IA 4FZJA 3R7AA 4PC6A 3V7YA 5IYZB 4LIPD 2ORED 2Q9UA 3ASYA 3FAKA 3KWLA 2WDPA 4QGBA 4TRNA 1FTSA 3CFYA 1GPH1 1Z68A 1FL9A 2DFLA 2VZEA 5DRTA 4KBGA 1G9TA 4CM7A 4TLMB 3IBSA 1HZJA 1JU3A 2G4VA 3NAGA 3WYFA 1E60A 4D8YA 1SC4A 4OXQA 5I7WA 2IIPA 4NJEB 3RS5A 1WDMA 4O63O 4OXYA 2W6JA 4EKYA 4ZTUB 4EP1A 3FG9A 1YBMA 4HDRB 1JDTA 5IT9A 2A9OA 4C78A 1T8WA 1JEYA 1IOLA 3AF5A 2VF5X 1AGRA 4Y9UA 5C37A 1U0SY 4KC0A 3UQYS 2WVJA 4EI9A 4OXRA 4YRJA 1QONA 1PI3A 1T0IA 4LDAA 3Q72A 1E3WA 3LK6A 3IAFA 3AY7A 2BJHA 1KI9A 3QIVA 4UCQA 4Q4JB 2JJ2A 3PYMA 3TM5A 3X2SA 3EDCA 1MT3A 1KC1A 1EEHA 1QOZA 2QR5A 3R3SA 1OFUX 4H6VA 2C2MA 1SCUA 1ZCJA 3HA2A 3M5PA 4JCCA 4TRJA 1DC3A 4X1YA 2ZM5A 4V24A 1ZEMA 2BONA 3I1FA 4D5EA 4GYJA 2G83A 2NU7A 1U7TA 3S6JA 2G9UA 3CZCA 9LDTA 3KHKA 1SUIA 1L7VC 1P74A 3AXSA 4CIYA 4JR0A 4F93B 5EHXA 2P77A 2HHCA 1TF5A 1ZWLA 3JATA 1TGVA 3HRKA 5BUCA 1SCJA 4OHWA 3SIRA 4EI2A 5TPZD 5AXCA 2RHDA 1EP9A 2X13A 4GR5A 5KYVA 3PUXA 1W4RA 2G7MC 3L1VA 4QQ8A 2YIDA 3EZ6A 4Q1EA 1RI4A 1T0JB 1OIWA 3AVUA 3HJTA 2OMKA 1OLOA 2ZUCA 3C87A 4L8GA 4A36A 1EVKA 4BNTA 2ANBA 3R5FA 2M6KA 2CUNA 5AP9A 2W2PA 2V7QA 3MTBA 4TV9B 2LRHA 2R751 1UBCA 4J1QA 3TB6A 1D8TA 4XUCA 5GOZA 3JXEA 5A62A 1XE3A 4DMLA 1Y7TA 5A05A 5ESDA 3NHWA 1PV1A 4DCSA 4RW0A 4IGAA 2OEPA 3AF4A 3A2MA 3E9YA 1ZX1A 3O5AA 1RSZA 1E1KA 3A6EA 3W8FA 5AUOB 5K0TA 3FFWA 2OM2A 3I9KA 3N9IA 3Q7TA 1XLUA 1LW7A 2B25A 2Q4TA 4DV5B 3D2CA 4WH0A 1WB4A 8OHMA 3LHSA 3WRXC 2IPOA 2QUZA 3HKBA 4R2KA 2PWYA 4WESA 1W581 5AM3A 1A1SA 4P92A 1J06A 4M1OA 3WGNA 1VHTA 2R48A 5AVQA 3RT7A 3AWIA 2HPAA 3OQNA 1F2TB 1IY2A 1C4WA 5CXXA 1O6BA 2UZIR 1JDVA 2NM0A 4R2WA 4BNLA 3KP1A 2MTBA 2O2YA 2H1CA 3BX1A 1N3IA 4HBGA 4BBZA 3V1KA 4EHNA 2ZJ5A 2AC7A 2AOTA 4TS9A 3UW3A 2A3RA 1EE2A 5L53A 1FS6A 3VC2A 4Z1OA 4IIVA 2C4UA 5I9IA 4WA8A 1UM8A 3FOAA 4WXMA 4B8ZA 3L9XA 4YMGA 1O0BA 3AHJA 1R3DA 5FKJA 3I09A 4MGKR 2WTBA 3RYFA 1G5QA 4B81A 4OQNA 4E6EA 2GJAA 3R0ZA 1RYHA 3PJRA 3KQSA 2GO1A 2RHBA 3HJCA 5J1TB 1A72A 3ZVNA 4W9MC 5C5DA 3ZH2A 3KZ1E 1X3SA 1EJ6A 2Y71A 3P2OA 2HLPA 3A36A 4GWKA 1C3VA 1QQAA 1HF3A 1RACA 1YASA 2Q7XA 2WNIA 3TR5A 5IFLA 4JLKA 2V7XA 1S2NA 1P80A 3EC7A 4LISA 3RHTA 2MSKA 1RPJA 3CG4A 3HSYA 5C4IA 4Z4FA 3VDRA 2Q4EA 1NXQA 2YXLA 3CEAA 3S68A 4D0LB 2DGDA 2BMEA 2R25B 2WAXA 4RAOA 4RNDB 4WFJA 1E1MA 2WABA 1QGUA 2VHUA 1THGA 4YAGA 3S8YA 1QR6A 4KBYA 2MWMA 3VRHA 3QPCA 4F5YA 4YRSA 3DHVA 2J6BA 5L8VA 1RRPA 1KP2A 2PBRA 2J3EA 3O6VA 1NTRA 2YRXA 4C7KA 5BQ5A 2ZR9A 3VTFA 3V2GA 3W1VA 4Q21A 1VYTA 4R7ZA 2VBGA 1U8FO 1SD2A 2BFMA 3OLWA 1EXDA 3OQBA 8AT1A 3A4IA 4PX2A 3S0JA 1QIFA 3T9BA 1D6SA 1N6IA 2OD7A 3EXHB 1IM2A 2HLHA 2QRKA 4FX2A 4DM3A 3B8EA 4E2FA 2Z6QA 4EM6A 1WXQA 1NE2A 1J20A 3QU2A 1LF5A 4WE3A 1R2QA 5EJ6A 1J24A 1G8JA 1Y3BE 1W1UA 4UHDA 4GEKA 4V39A 4YP6A 1MO2A 2QTZA 2Q45A 3ASVA 3B1KA 2NXEA 3T95A 4BFCA 5EWLB 3AEKA 2WWHA 2I65A 4KYTA 1SFRA 3SFVA 3HB7A 4C43A 3NZEA 4MYCA 3AW9A 4HBZA 4N8DA 4Z49A 1DBVO 1DV1A 1RWVA 3HFRA 2RGGA 2HUNA 2V9PA 5A0VA 1JQAA 4ZAXA 4P38A 1DC5A 2ZJFA 2P0YA 4BZWA 5FTWA 3WL4A 3WAJA 1GADO 5IAOA 2B4QA 3MLEA 3PNOA 2Z5VA 5K6TA 2VI5A 4NNJA 4FSXA 1ZP6A 2VAWA 3GAFA 4C29A 4BNUA 3DEYX 5FNZA 1BX0A 3C4VA 1W73A 2AUMA 3I2KA 1ODSA 3ZI7A 4BE9A 2VHZA 1AMOA 4BB5A 1H6BA 1PD0A 1CUUA 4DLAA 4P34A 4BLUA 1XZ8A 4POAA 4HS4A 2B7CA 1E98A 1KBZA 4O4LA 3SOZA 5A3SA 4X65B 4K9SA 5AI4A 4WOJA 4M7OA 3TTXA 5FH9A 2HMAA 2WLSA 1QU2A 2WSMA 2XYGA 1NRJB 2ST1A 3D1JA 1H66A 1KU6A 2OV4A 3DXZA 3FSEA 3OPYI 4OJMX 3RYIB 1W4AA 5CG2A 1ZN9A 1JKMA 1QHIA 2JIPA 5H3HA 5C8YF 1W9HA 2H3EA 4XOIA 1PJQA 3ZHZA 3HYTA 1W87A 5G1NA 5H02A 2X1HA 4BNKA 3R7SA 4JVSB 1G4HA 3V8BA 4AY2A 1UP4A 3E3MA 2CK3D 1Y3DE 4MX8A 4DLVA 4ZQCB 2WJAA 4UD6A 4NQZA 1RWNA 1CFJA 2Y27A 1W0JD 2O23A 3KTOA 2CT8A 1FSPA 2EBHX 3DDHA 3AT1A 4Y7DA 1YVEI 1GPNA 4HNSA 2XYPA 3MAGA 4MHSA 4YFVA 2OQ2A 3U7HB 4ID3A 4C0KA 3F49S 1SUBA 3TLGB 3BF8A 2BF4A 1E3EA 1XIVA 3OT5A 4V2IA 5ILOA 2NO5A 3N7AA 1H0KA 4GOMD 4C0LA 2XKKA 1ZAYA 1HWYA 3UK6A 1I24A 4GSYA 3SCZA 2P5YA 1KAHA 4LN1A 3MRTA 1A5AB 3TFOA 2ZP1A 2PXAA 1ZK3A 3K94A 4LRXA 1NR1A 4C3VA 5IJ9B 2QD1A 4ZKEA 4ASUA 4G56A 1AKNA 1IN5A 1L5FA 1X9HA 2BTQB 2NTJA 3T3PB 5A03A 4Z4CA 1YQDA 5K3DA 1KZ1A 4EEKA 2P27A 4ERNA 4G0WA 1RPTA 2XT0A 3C5VA 5T57A 2I29A 3HL4A 3LBAA 3KBOA 4RZUA 3DDOA 3I37X 2QN1A 1YZTA 4OFWA 5D3MB 3FROA 2RONA 5B6PA 1R10A 3Q3GE 3H0KA 3OZBA 5KINB 2AFRA 4RMGA 2FUCA 3UAXA 3CNQS 5IHXA 4HUTA 1NSTA 3VC7A 2FQXA 4WAUA 1DKMA 1C50A 4QBFA 1M83A 3DE3X 4B4UA 1A9ZA 1E18A 4OAPA 3DE7X 5JRJA 2VTEA 3V46A 1WB5A 3C1OA 1KYWA 1K7XB 4YVFA 1D2NA 3VISA 4DQLA 1KJQA 1OJ7A 2PSDA 2ZYTX 3ELYA 3JX9A 4CL3A 5CH3A 3LZ6A 1LTKA 3AR4A 2QTHA 2B34A 3OETA 1P9WA 5D3MA 5A71A 2WIDA 1EWVA 3EN0A 3U61B 4H08A 1M7GA 4PHGA 2HN9A 4TS1A 1PTKA 4GIBA 3IKTA 4PZ0A 2XZOA 5MFPA 3QG5A 5CA1F 6GPBA 4CHGA 3A1VA 3OTIA 2ZJ7A 3AM4A 4QTYA 4R1SA 2GO7A 3UMSA 3OJLA 1TYCA 4NDZA 1DIOB 1XU9A 3RU7A 1XQXA 2G76A 1NJGA 2OCGA 5E4TA 1G5FA 4K5QA 5EJMA 3EPKA 4AZVA 1ITZA 4DEVA 1Z7BA 3GP5A 4KLRA 4FT2A 2W2QA 2RI1A 3V7WA 1YCDA 5DJ5A 2NIPA 3JWPA 3DZDA 4J7XA 4OH7A 1OX6A 2GBLC 4JBWA 3L8HA 4TTAA 3ZU5A 1S4MA 3N76A 5IHPA 2PJRA 2V7EA 1SULA 1VGVA 4TVSA 2CB0A 3VYWA 4RZXA 10MHA 1UBLS 4XX0B 3GMSA 1WCIB 2OCXA 1QTNA 4KACA 3GYGA 2FZWA 2ZRBA 3C70A 2DKFA 2ASVA 2Y67A 3LJKA 3WFZA 2O8DB 2GILA 2NZYA 4HNRA 3KC2A 3IEVA 5IXYA 3D3QA 3HE3A 1QTIA 1QIGA 1YMUA 1W5FA 4O8CA 4W8OA 3RO7A 1VIYA 4RACA 3B8HA 2XT6A 2XGGA 4EA6A 2GGSA 3G2MA 1XZGA 3LYUA 3V9AA 2EX1A 1UJ6A 5KYYB 2AYZA 4M0PA 5IMSA 2OG2A 2J0VA 1XLVA 5KDOA 4D81A 4ABYA 3QLUC 2QPLA 4CT5A 4QU8A 4EG0A 4MGYR 4CR7A 4DIBA 2RC6A 3NDPA 1A8SA 4NEHB 3FKSA 5CJJA 2XVMA 1H2YA 2G8NA 2FEOA 5E1MA 4N3AA 4D9EA 5BSKA 2M6RA 1KMNA 2JHGA 5EMNA 4CF4A 1PSWA 4EB3A 3PC8C 4XE5A 1T9AA 5EYPB 1CE8B 5CVVA 5HFNA 2A7QA 3GP3A 1QHGA 4XUEA 3VSEA 5JNRA 5K01A 2PA3A 2ZWIA 3OFSA 3OPYA 2OECA 4PINA 2NV6A 5FR2A 4ALNA 5J63A 3Q2KA 1IK4A 4YUWA 3EGWA 5LYJF 4F60A 4R8LA 3RTEA 5JW6A 3MRSA 4GP9A 3EGVA 5FUWA 2II6A 1Q22A 3A58B 4A2PA 1VE5A 1SGWA 2Y6VA 4IHJA 1M7BA 4P3OA 3Q5GA 1Z0IA 1HQYE 3L0YA 3D7MA 1WCWA 3WRVA 4V03A 5TSDA 1M72A 4J8PA 3UC9A 1DO2A 3JPWA 1U81A 3JZFA 2FWMX 2F55A 1E6LA 2F17A 3PP8A 4NK5A 5A02A 2PUVA 4W5RA 1LPOA 3KE8A 2GPAA 3QH4A 4URYR 5KOHA 2C57A 2P9EA 3TL3A 1XKLA 2LCIA 1F4PA 1B3RA 1I51A 1U9ZA 4MP8A 2GK4A 1GZ3A 1WY7A 5JZ9A 1K3UB 3AF1A 1UC9A 1QK4A 1D7AA 4JGBA 2DU8A 3N0VA 1HZZC 4QXOA 4AYWA 3O8LA 4XB2A 1TLFA 2HHLA 2JZCA 3EUAA 1KH1A 4P83A 5CEJA 1V8DA 4FKZA 4J0HA 4LXTA 1KAQA 5FP0A 2RGXA 4ND4A 1AQUA 2AOXA 3FCUB 3JQAB 4R40A 3AHCA 3EZNA 1TFRA 1GGJA 3FOWA 3G9QA 1X14A 4LXHA 3DMNA 2HXYA 3EF3A 4Q37A 1GCAA 4JJ7A 1D7OA 4ZJUA 2WJJA 4GXRA 1XNHA 1N0HA 1RKUA 4I4TB 4BATA 2PEZA 5LCXA 3KJGA 1OVMA 1GG2A 1Q7TA 1U2GC 2IUEA 3SX2A 4A0HA 3IXLA 3AVQA 3JWEA 1P19A 1UPAA 3L7AA 3KM0A 1EX9A 3IQGX 4K03A 1U0TA 1TM2A 2H2WA 4XYEA 4L76A 4A5OA 1Z9BA 1JLLA 1A27A 2JHPA 3KO8A 1W88A 1YI1A 4EPYA 5L3QA 3HABA 2JG3A 2OTCA 3UK2A 1UJBA 2BCJQ 2VUUA 3OEEA 4D4KA 3AIKA 4TMTA 4Y2VA 2OL4A 3SQMA 4Y1RB 3OZSA 4KKXB 2TYSB 5HGJA 3R3HA 2Z04A 2H8GA 3RNLA 4HEJA 4C0JA 3HUEA 3GB9A 1BGWA 3L40A 1Z08A 3D0RA 4G8BA 5FOQA 4QPPA 1ZH4A 3GXBA 1C3OB 1D2AA 3I76A 1V1RA 2FW6A 4WT7A 3SBEA 3AI1A 3DLIA 3SOPA 2P8JA 1Z6TA 3SXUA 4EYSA 2PMKA 4CM9D 6ABPA 4AMGA 2QV7A 2AOWA 4BMSA 1IFXA 4F2DA 3DPSA 5IM4F 1WV1A 4LSWA 3B5EA 5FV4A 4HWSA 4C6HA 1GVHA 1Q11A 1EU1A 2I1VB 3EZGA 3CCBA 4WJZA 4CCSA 1DARA 1QYXA 3K2QA 2GZHA 1Y6ZA 4FFSA 3HM9A 2O1WA 1G1MA 3CVWA 3U44A 5JTUA 3DOEA 2BEUA 4PHTA 4RIEA 1TL7C 1DUIA 1QCCA 1CUZA 5GONF 1KI6B 3K0SA 4U9UA 2BBOA 5IUKC 1ZJ5A 1IL0A 2C1EA 2OBBA 3IOYA 4NFSA 1EEXB 1WCYA 4MQEA 3K73O 5C8YA 1ZD8A 2XNHA 3D4BA 4BQSA 4CWAA 3PGMA 4NP6A 1G2OA 3OEHD 4N7BA 5LL6P 3LA6A 4NU8X 1BXGB 4AB1A 1ZJWA 3SF8A 2ZYWX 5FI1B 3RRZA 2WA2A 2EX4A 3AFNA 1PE0A 1T3ZA 3PHIA 2ZDQA 5LA6B 3BGOS 4WASA 5JSUA 4GX5A 1ULTA 4HNGA 5DTJA 1RWXA 4OU4A 4X61A 1V1JA 5T6MA 1FNMA 2OCKA 2ODEA 1B6SA 3D6FA 4PIVA 3V6LA 4C6SA 1AV6A 5BSFA 1L9KA 3SDBA 2PMWB 4MUGA 4QYIA 4CM4B 4L7VA 2UYCA 4TX1A 4BNZA 5I7OA 3LOUA 3IS3A 3V8EA 3UAGA 2UZ4A 4ALJA 2HQBA 3P5SA 2I2DA 3BGVA 2J9RA 4TMZA 1VSQA 1OX5A 4B4VA 3FY4A 2O2IA 4E70A 5B1EA 5LOVF 2A1TR 1RIIA 2WFMA 1KR2A 4R5MA 3ZNQA 3CLVA 4JI8B 4NY1A 2FWJA 1D1QA 2I22A 2QAGC 2F8TA 1G5TA 1DHRA 1H9AA 2W4IA 1RIFA 3ANXA 4DCNA 1E9SA 3NKVA 2R1UA 4RMIA 2FWIA 4N1AA 1U6JA 1W6UA 3ABQB 3RDPA 1R0CA 2O57A 3A04A 3A28A 4TSRA 1T2FA 3KUKA 4MV9A 5K4AA 7ADHA 1IHPA 3Q8KA 2JCSA 2ZUUA 4HWPA 1ZBQA 1W94A 1DQRA 2GBFA 3H1AA 4OKNA 3NANA 4YAWA 3ANYB 4RETA 1YCGA 3G1UA 4NC9A 3TIFA 2FLVA 3OJXA 5DRYA 3G8YA 3RUHA 1V0JA 1UQRA 5FL7D 1ZXXA 1MFPA 1JDPA 1P39A 3JRXA 4LSGA 3LDFA 5AVVA 5G40A 3LBNA 1O03A 4OP1A 1U1EA 1U0JA 3QKWA 4QNNA 3WP1B 3VJLA 3PR3A 3E7WA 4PIPA 4QEDA 1LF0A 2J9XB 1E2IA 3PXDA 2O3TA 1TIPA 3AR3A 3H5IA 4ESEA 3UEOA 3ZQKA 1MAVA 1ZVJA 1RRGA 2B8NA 2QUJA 2ZREA 5CLHA 2HF2A 2GN8A 5TDHA 2BWJA 4N49A 4DAEA 5INTA 5JXWA 4ZCSA 5IJWA 1U8YA 3RJZA 2VDQB 4RK7A 1T8SA 4OLAA 2QMEA 5AVWA 1HMYA 4XQ9A 5FOVA 2XDQB 1LK0A 1AGXA 3WIEA 4WX2B 5LKAA 1GUYA 3OU7A 3NVKI 4N0PA 1N2GA 2VSYA 3H1TA 3NPAA 1KI4A 2XHZA 3I72A 3IV6A 5BR4A 3PT5A 3GEHA 4G5GA 4TROA 1J4AA 3QF7A 4ZYZA 3VC1A 1QDEA 3HU1A 3PL1A 4O02B 1NHWA 3KLMX 4HFMA 4WTOA 3OAAA 4GZ6A 5ABPA 1WLSA 4WXYB 2Z9CA 3BG5A 3HFGA 1T34A 4KAJA 2B4RO 4W1PA 4IDHA 1N5IA 3IR6A 3JTMA 1ZL0A 3T5DA 3UANA 3U7QB 2VT7A 4YAIA 2AKAB 5IJAA 5DP2A 2WYHA 1MPXA 1NJ8A 3GNLA 4UXHA 1D5CA 2ZPUA 3E9QA 3RIYA 4LZAA 4N41A 4J6EA 4IIGA 3DW1X 3FPLA 3ZW7A 1GAQA 2CBXA 3LUAA 3MTQA 3NORA 4MKIA 3WO0A 3FJOA 3QGMA 3IP7A 4Z2AA 2V45A 3ZE6A 4CLDA 2XF8A 4MV7A 5IH7A 1LTQA 2FUNB 4UDNA 2C3OA 1Q84A 1T5DX 3R3VA 4S1WA 3FMVA 4CDMA 2A9RA 4P0TA 1ZJ4A 1A9SA 1TK9A 1CQJB 2X4LA 3ELWA 2P62A 3WFIA 3FUWA 3JRNA 5EWMA 2A2ZA 3DEJA 4ZXFA 5FB3A 2ARKA 3UWPA 2OD2A 3FZYA 4GECA 4HWKA 1JEAA 1KEKA 3S2SA 2VT3A 4AULA 5EP1A 4DDHA 2M1ZA 2GA9A 4NYJR 2OKCA 2QOEA 1TAQA 1PS8A 2Z8ZA 4KDCA 2XITA 3KKZA 4P4GA 5A9SA 5B7GA 4KQCA 4KR3A 4AIRA 3QBEA 4KNVA 1J8MF 2ZI7A 1PL6A 3QF4A 5K8JB 3CTMA 3L07A 2BTEA 1QQ5A 4M8SA 4REQB 4WFIA 3U7GA 3MS4A 3NHRA 2R6ZA 4BV3A 1WA5A 4MB2A 3O8RA 1TCCA 1WABA 1EESA 4FUQA 2ZTSA 4RDIA 1E62A 3WZMA 1DLIA 2QLLA 3BEDA 4NOMA 3KYDB 1Z2OX 4FLFA 4RMJA 3M89A 5FHRA 2GYWA 2QYSA 1VCHA 3ESRA 3FNGA 5I3ZA 3ZDCA 1TU0A 1XCMA 5LFAA 5D7BA 1K0FA 2KSQA 4GO1A 3QVSA 3VKGA 2VDRB 3NWOA 1CDDA 2IQIA 1HSOA 1LFAA 1C9JA 2Q5HA 1K8RA 1A8HA 1KVQA 2W6ZA 3A0RB 3E5HA 4UMDA 5CT4A 1W6RA 2WKSA 5LP6C 3I9NA 4C0SA 1Y3CE 3ADPA 5FA8A 1JGTA 4JI2B 4P7GA 3IPRA 3NOVA 2BZGA 1KQ3A 1IHYA 4WXEA 2WA1A 1T9GS 4ETMA 4JGGA 1U0FA 1ZUWA 4MYHA 2BJWA 3WB2A 1N92A 2KMLA 4WACA 1FDOA 2HPZA 3O90A 3VZRA 4M7WA 4E94A 2W00A 4G09A 1AA6A 3CJTA 4YCBA 4NATA 2HX1A 4JUCA 2BHNA 2GN4A 5AW1A 4JYAB 1QVZA 1TK2A 1PN3A 3IAM6 2WYVA 4M54A 4UZSA 3G2KA 3OQIB 5A5GA 2GJSA 3H8SA 4R54A 4ID9A 3TFQA 2HJGA 3UN1A 2J9FB 3RAJA 2ZIUB 4IVNA 3UCXA 4ZI7A 1SC1A 2R8YA 5IYZF 1QMGA 2AL7A 4V3CA 5H0IA 2NXJA 4H6XA 4OLHA 4B45A 2QT9A 1Z2EA 1N7IA 2B6HA 3B70A 3W3AD 2IW1A 2XPCA 2B4TO 4R68A 1SBIA 3CKKA 4BMDA 3ZY3A 1N8NA 4EMBA 1BMFD 4QG7A 2PMFA 4IYJA 1DGQA 2JATA 5G0UA 2V4MA 1IY9A 2O7SA 1TJPB 1ZU4A 2F1OA 2I7CA 3MWDB 2P4SA 3GCWA 3UFXB 5F7JA 4FC7A 1THZA 3WP0A 5MF6A 4CMIB 2WU3A 3FGPA 3QKUA 2C8LA 4QC2A 3P4XA 3QE0A 1WXWA 5BSVA 2PMEA 3B78A 3K1AA 3LXMA 2DH5A 2LWIA 3HB0A 4IMIB 1TPZA 2I78A 4HRYA 4K6FA 1I7SB 1FQJA 3ZIAD 2ACKA 2GZ3A 5IJ0A 1T36B 1OGJA 1R6TA 4KFRA 521PA 4BKQA 4C6TB 1U9IC 1FSZA 1W1IA 4IJKA 4NFHA 4WLEA 1IJBA 3G82C 2EKPA 1TZBA 2ODNA 3OP1A 5DTEA 3OX1A 4WZBE 1XWIA 2J45A 2PZ8A 5AK5A 3P0HA 3E82A 3ZWWA 3JD4A 3UMFA 3BAFA 4KH0A 3T9FA 2PY6A 3ONFA 1R4AA 1L0BA 4DIMA 1J21A 4ZD6A 2GCOA 3AHIA 1XAIA 2JFYA 1KOJA 4QJ4A 1J00A 1H0SA 3GFRA 1QX3A 3KR2A 4R0NA 2GK6A 4UMEA 4KITB 4B84A 4B3MB 4DT1A 4ENPA 1ZWKA 3HY6A 3WLKX 4E5VA 1E4VA 2P5TB 1Z6AA 5CLIA 1BX3A 1Q7GA 1RFLA 4PXAA 1EP1B 1Z3IX 2RAFA 1XJCA 2PH3A 4Q34A 3D6JA 4Q03A 5K3FA 3TQQA 5FWXA 3NTOA 1QZZA 2ZRAA 2IYYA 3E05A 3FHCB 1YZHA 1FDTA 3JYQA 3Q8XB 4FGUA 1CQIB 1QLHA 1SU4A 4G36A 4C87A 3Q0IA 1P4JA 4BMOB 2WG1A 4B2YA 3DHWC 3MT7A 5IKPA 1M2OB 2HK7A 2LZ0A 2JBHA 2RHTA 3DBHB 4QDZA 3RSSA 4DY4A 4M1MA 2F3RA 5DGHA 4YJHA 2O5VA 1BEUB 3E61A 2F1IA 3NWEA 4EW6A 2A0FA 1IVNA 3O91A 1JBQA 1D4ZA 1FVXA 3KFLA 4I08A 4J2HA 2B37A 1FX0B 1BEEA 1OW3B 3OFND 4NPAA 1HNXB 2KBEA 3EZXA 3J81k 2GWRA 2H1FA 2AG0A 1L7QA 2VA9A 3GNTA 3I8OA 1PNVA 1VECA 4IH1A 5IBCA 1SHKA 2PLNA 3PHBE 2VQ3A 4KYUA 2FZCA 3VUFA 2P11A 1T43A 3ORYA 2DUMA 2JKYA 3DE6X 3DL2A 3OZGA 3R3XA 4YWHA 3DE1X 1UJMA 2JHFA 4DWJA 1JJAA 2B92A 2CLFB 1PQWA 2Z8XA 5CT9A 3RC9A 1NRXA 1H3FA 4WZBA 2AJBA 4KXMA 5ICMA 4JI7B 3IT0A 3UK0A 1HURA 3SSAA 3GJXC 1GL7A 2W2KB 1WR8A 2NYAA 2XJ4A 1ZM7A 5E4FA 4LI3X 3V4SA 3ZTYA 4LV5B 4BWYA 4YMTA 5CT6A 3JS5A 2QTVB 5BWCA 2CC2A 1U7OA 2B3DA 1WETA 5JU6A 5K03A 3R5HA 1UKAA 3ICOA 3ZE2B 3DGEC 1OB5A 3G0BA 4PBSA 3IIIA 4AJJA 2IGTA 2V6IA 3HZOA 4QVKA 2QUKA 2JFWA 4ZT2A 3HVKA 1MMFB 1SBNE 2DFKB 2IY8A 2GXQA 3A8TA 3LYHA 4BWGA 2F62A 3H75A 3HP4A 2GRJA 3JALB 4FOOA 3RYCA 5HBGA 1A0OA 1BMFA 2EGUA 3VNAA 4CCYB 4B6QA 3AG6A 2QK4A 1U98A 2W8ZA 3D8RA 2CXPA 1GKKA 3RTDA 2QLBA 3QVTA 2CXOA 1TRHA 4CN9A 3JQGB 3KJZA 1GPKA 3VSDA 2LGJA 1FFCA 3O8OA 3D8SA 4HMPA 1DWOA 3IA2A 3MGKA 4I81A 4OEHA 1KFCB 2O2DA 3TXXA 2AMVA 1DXQA 4XH9B 3LPNA 2HI0A 2FFRA 1UDBA 3DDCA 1FSSA 4URWR 1OTYA 4ZDKA 1ISRA 1D1TA 3IJ5A 5K0GA 2DJ5A 2IKSA 2JKVA 3HYRA 2C7BA 3I83A 3K0EA 3FYUC 3QELB 3R75A 1QIKA 2C92A 1BOOA 4OQ4A 1NOJA 2EBUA 3RAPR 4AC9A 5JJCA 3BZBA 3NJ8A 4F9TA 1FS5A 1HC7A 4RDHA 3QBVA 4XRRA 3K6JA 2FPMA 2FX5A 2OSBA 4BDTA 1HO3A 2GM3A 3ZBPA 1EB9A 1F0KA 1GP2A 4F3KA 4ZYXA 4EMTA 3SY8A 1F9AA 5L9AA 3O8OB 1G98A 3EJWA 4HH0A 5KCMA 5JBQA 1R6BX 3SEQA 1SKBA 1REQA 3N2KB 1TT7A 3CO5A 4JASB 1ZIOA 4U7DA 2AN3A 4B6JA 2FK7A 3IX7A 1Z4QA 3PR2B 4O0LA 4OQXA 4M21A 5DNAA 4EAQA 3WIUA 3HM2A 2M1XA 2PR2A 3AUAA 4BX9A 1DB3A 3EG9A 3P9IA 2Y99A 4KRXA 4EGFA 4OA5A 3A2KA 2HA3A 4KB5A 2XNDA 1W19A 1OY1A 1E99A 2QQFA 3NBAA 2IZ0A 3PGKA 4S3MA 1KIAA 2B2NA 1V7PC 2DBYA 3OZFA 3PNYA 1PNQA 4S0XA 2DSTA 2F8LA 2R5WA 2ILTA 4MGEA 3PPIA 5F77A 1T10A 5TQ2B 2X2EA 1SBZA 3DJYA 4Q9AA 4ARZB 4BU0A 3DL0A 3IV7A 3O2JA 5KYUB 4BKUA 4ZZIA 4YT8A 1RYFA 1XQ6A 4NZYA 4FXOA 2CMHA 2PL3A 5BNWA 1CZKA 1M34B 2XNJA 1IH8A 1NZFA 2G3YA 3H87A 3AVPA 2EJWA 3QXHA 3DAOA 1JLSA 4BLOA 2P2DA 2WMDA 2B1JA 2FYTA 3W2TA 1FSGA 4M8IA 1YJBA 4DARA 2Q21A 5LZ2A 3DDWA 1HLGA 4YREA 3RAFC 3NMUF 2XQKA 3O1JC 4RHXA 2IU6A 3M4YA 5BR8B 3QJYA 3OQJA 5CVEA 3K2IA 1JHYA 2CLLB 1EVYA 3VZSA 1ZA1A 3RFVA 3GW8A 2BEWB 1AM4D 5HJEA 3NLLA 3KHTA 5KYUA 1JF8A 1E9CA 2FSSA 4MIOA 4DLTA 4N48A 1SC6A 4QDUA 5EINA 3REQA 1RC1A 2NSHA 3IIEA 2WYUA 3A4YA 5BSHA 1Z74A 3BFXA 4PY2A 2PEYA 1A5BB 4BEJA 3FYDA 1FUEA 4URXR 5JFOA 4HZUB 4G0UA 4IFTA 5H16A 2IVZA 2DBZA 4MR9A 2IYLD 1WCV1 3KPJA 1A7UA 1TM3E 4JHXA 3JV7A 3MK31 2XRFA 3D4LA 2PKYX 1A9RA 2DFPA 3HA5A 4QBKA 2FPGA 3UJCA 4NJOA 1KMMA 1M5RA 3R0VA 3ESXA 2H5IA 1HTWA 1NF8A 4CODB 1Q3TA 1GYRA 3T38A 2BM0A 3BFPA 1ZQ9A 3DP9A 3H7AA 2HHHB 1LS6A 1UKYA 3UWOA 1I80A 1Z07A 2MINB 1JH9A 1T4BA 1EUDA 2WPNA 3WDLA 1W1WA 2FRVA 1XELA 3HBLA 3N59A 1H22A 4B87A 3GLIA 2VP3A 4PPFA 1T3GA 3T7AA 1XEXB 2W37A 4M55A 1A4UA 2VJBA 1DXOA 2WU1A 5AXAA 2QHXA 5B1HA 5TX7A 3TQFA 2PZMA 1RCTE 2CV2A 3L6OO 1YRWA 2JVIA 3OOYA 4XYBA 2DHEA 4M1YA 4PQRA 4RGVA 3AEUA 3BQ9A 4PO3X 2FG7C 1U7WA 1VP9A 1UINA 2OILA 2BL4A 3HDQA 4PEVA 5KTMA 3HZZA 2AD1A 2MSWA 1CW2B 4ISBA 2CF5A 3P9ZA 1EQAA 4OA8A 2QX8A 4NMHA 4MRRA 2HWKA 3JQFC 4ZEOA 3DC7A 1QG6A 5HRUA 2PUCA 4UD2A 1LWNA 3PUHA 3W6OA 3JQQA 3AUYA 3IDFA 3N7UA 4NJMB 4QPDA 2DPYA 5FOSA 3E1GA 4V1CI 3P9KA 3HBJA 1EWYA 1VE7A 4I9GA 3TNYA 1S3IA 4X20B 3CNOA 1L8XA 3IAUA 1YR2A 3KB1A 4RSMA 4UPVA 2ONJA 4DNPA 1IRXA 1CC1S 2R5FA 1TC1A 3ABSB 4QBTA 2ZVPX 3VNSA 7GPBA 1TTTA 5FL7A 1K6IA 1YMVA 2F4NA 2I2XB 3WISA 4U6NA 2IS6A 1SHZA 1WTCA 2VP2A 3L0SA 3P9CA 2OG1A 4ND2A 4U7HA 1WOMA 3CRRA 1FP2A 1TIKA 3DMFA 4YRLA 3BEOA 5G0WA 3RQSA 3JYHA 3UH1A 3X1JA 4CV1A 1DINA 2AN4A 3H2GA 4ZOLF 5FWDA 2OCIA 4QVIA 3WJ2A 5JBIA 2IHJA 1M73E 2EW1A 3KJFA 4ZGWA 3GX1A 1C30B 3SYKA 1VL5A 3SEZA 1D1PA 2R1VA 4MI9A 2ZB2A 2D5LA 5TMBA 3OZTA 4PZEA 3C3EA 3LBIA 2G63A 2QENA 1KO8A 1OYWA 3CF0A 1RFGE 5C8VA 1KZ9A 2HU8A 3KQUA 2QXTA 2BGWA 1T2UA 2O2XA 3GJ8A 3GPDG 4ZO7A 1NXSA 4L3OA 1G6KA 1BU5A 1UODA 4NARA 4DC1A 1NVGA 4CRWB 2P1RA 3DV0A 3KB6A 3C74A 4G8DA 3HVRA 4F71A 2LCFA 2R0QC 2Q6KA 1YACA 3GDOA 3BGDA 2FPKA 3KPVA 1CF2O 3VKUA 1KRWA 2EZ9A 4UASA 4QM7A 2HMWA 4PQEA 1WG8A 1J25A 2A9QA 1RXSA 5EGSA 5KZMB 1MGOA 4PANA 3N53A 1GTVA 5JO9A 1KAMA 4I1OA 4LE0A 4RTPA 2PT7A 4HKTA 1QP8A 3IEXA 4Y2RA 3MXTA 4MS1B 3O1HB 1L5HB 4RLSA 2G9NA 1B7GO 3H2HA 3FLBA 4WK0B 2RE8A 4D0NA 2IVFA 4Q02A 1KJ9A 2DT8A 2P9BA 3G5LA 1XRMA 5CK4A 4I3HA 3RV3A 2QQGA 5KNBA 1B8UA 4FC6A 1AKVA 4YEDA 1NPYA 3OF2A 3LBHA 4NBLA 1Q1AA 1HY3A 2Y05A 4LHSA 4Q39A 1CY7A 1WMAA 1M6VA 4NQRA 1XZFA 4KNYA 1L3IA 4YRZA 3PQ2A 1C1YA 5FJJA 2C58A 2PQ6A 1QIEA 2A88A 2QSZA 1H9CA 4CLRA 3EIUA 1OD6A 1TKBA 4GF5A 5DTMA 2YMPA 1M8JA 4Q01A 1OYVA 4E32A 2Z57A 3GH3A 2O8NA 1YJCA 2WTMA 3OJWA 4I2NA 5DDIP 4BVEA 3ES9A 3PWSA 4H9GA 3U7EB 5J4KA 3WLLA 1Y7IA 2OR3A 5L4LA 2ACVA 2EFGA 4JX8A 2QORA 4W5JA 3O03A 4M8LA 3TNLA 4XGRA 4D9MA 3JQ8B 4QJ5A 4B5LA 2O59A 1RQPA 4X1KB 3F47A 1YB4A 5DTRA 4HXFB 3U5ZB 2VOJA 3EWNA 1JG1A 3T9EA 5AXDA 3I6YA 4AO8A 3WR5A 2VOEA 2AG5A 2JGAA 2WSYB 2XA2A 2ZI5A 3INNA 1NR5A 1GSOA 4JX9A 1W48A 1CHNA 5DHFA 3QEAZ 7AT1A 1KVSA 1OREA 4IDQA 3NPMA 3E8XA 3C6QA 1O4VA 5IBPA 4YJ2A 1KAEA 1ENOA 1FDIA 1YS7A 2NNWB 2ODBA 1BWSA 3O82A 5AK3A 5BSUA 3VI3B 2IYQA 3TLJA 2CLEB 4ND7A 4EGSA 1PF7E 2ZSUA 4QOSA 4ZTBA 2FXVA 4PZYA 4EG4A 3D9QX 1CR6A 1KS9A 4MWOA 4X8OA 2PX0A 2QTMA 1R5NA 3LQ4A 1ONOA 1XJ5A 3IO3A 4HPJB 1Z8FA 3G9ZA 3T1HB 1YJAA 2L82A 1P1RA 1XVLA 3F5QA 2PH1A 2XTAA 2I2CA 2RB5A 1U7XA 2H51A 4LDNA 4QYWA 5SY6A 4KOEC 1P2BA 1QXSA 3F5MA 1PR0A 5EC8A 4Y9DA 4JOSA 2H1VA 4YJ2B 2IYSA 2H7VA 1B8NA 3IUSA 3QPBA 1SK8A 4HXEB 1LDEA 2XIJA 1R6DA 3FUVA 4L95C 3VSCA 4PPGA 3RVQA 4NAUA 3THXA 3HK2A 2W6ID 4C03A 4KRFA 2BVNA 1VOTA 3IP9A 1OC4A 5FA6A 1A4IA 3V5NA 3WVNA 1LBEA 4TGLA 4CI0B 2H4HA 3JAWB 5E6SA 4CIXA 1MDBA 1GPUA 2Y0PA 5U4QA 2X2FA 1P0IA 1GCIA 3HCPA 4UNPA 2I80A 3UT5B 1VSUA 5EQJB 3WLRA 1SUCA 3M1LA 2YV1A 3Q9UA 5SZHB 4BECA 1ZXBA 2AOTB 1MHTA 2D00A 2P1DA 3T99A 3I5MA 1N4AA 5C1OA 3LPAA 4MVJD 4PO1A 1PR6A 1X94A 3G2PA 3BE8A 1G291 2J3KA 4FNGA 3PX7A 3RAGA 3TKYA 2AGVA 1V26A 4QELA 1Z38A 2NQ2C 2GRAA 1UF9A 3BD6A 3LPLA 3QLVC 4XZ3A 5EMKA 4TN1A 2B1QA 3CGGA 3AIOA 4JV5B 1JWLA 5AVRA 5ED4A 3P32A 4Z54A 4Q15A 1C0IA 2IOHA 4MW0A 5B5SA 2G5TA 3UIEA 1XZAA 1B8OA 2ZUTA 1IDOA 3EQ8A 4MCHA 2Z1MA 3URKA 3RTCA 2PVPA 2WD8A 3FDIA 1BDHA 5CFZA 3H4IA 5FX2A 2HSEA 5KIAA 4AM8A 1NXPA 2WTEA 1CVRA 3GLVA 1D9XA 1F6BA 2IX9A 3SJZA 3ZOKA 4D2IA 3AJAA 2X9LA 3B6MA 2QN6A 1EHYA 2X5JO 3FPFA 4PONA 3ZV5A 2NV0A 2AKEA 1CR0A 2GCPA 2QM7A 3DXFA 1YQEA 3AESA 3I6BA 5THKA 4AY3A 3GMTA 4RHTA 3QLVA 2Q5EA 3JZMA 1QPZA 4B2IA 1DG1G 4AXBA 4E33A 2ODWA 1TQ4A 2HCTA 4KPUB 3DOJA 5F2OA 4EJSB 1IHDA 1XZQA 3OCYA 1NR7A 4OH1A 2RGRA 2PT5A 3AERA 5GZ1A 3KZCA 1WCXA 3MINB 4FTWA 2A14A 5A5FA 5EQFA 3DM9B 1T5TA 3OZAA 3H18A 1ND5A 1F60A 2HWXA 2N1MA 3I9OA 4OB7A 2YYYA 1DBPA 3GEBA 3DDUA 3L0BA 3SZRA 4ED9A 3MJTA 3BJMA 4HO1X 4J0EA 2OPHA 3SK0A 2JFQA 3ETJA 3DWIA 3PUJA 1X0XA 3FB4A 3WYCA 1KDPA 4Q18A 1G9SA 4AF8A 5EMMA 4EO7A 5AVXA 3O0DA 4NPHA 3ZZ1A 5IJ9A 3M2TA 5KCZA 2A84A 2UYOA 2V7UA 3T5TA 2Z1NA 4D02A 2EKDA 2FMFA 3L84A 5BN1A 3HN7A 2ONZA 3DFMA 5DSTA 2V65A 5JCXA 2BSQA 4KPUA 2W83A 4EJSA 1XJ0A 3KYBA 4QDJA 5AH0A 2WFLA 3CBQA 3WAKA 1T5BA 4KQGA 4QODA 1X6VA 4QU9A 5F51A 3ANNA 4GPAA 4RY9A 3W90A 2AX4A 3KT0A 1L5SA 2WZBA 1O0SA 2AV6A 3EC1A 3KDPA 4BUJA 1DJQA 4D3SA 1OWNA 2Z56A 5BR1A 1JQEA 3BWDD 3HB5X 3MWFA 2AZMA 2G77B 2HK9A 3BUSA 1J5PA 2AHRA 1I3KA 2AQHA 2GVDC 4MA4A 4NZPA 4R3WA 3EY4A 4MRVA 3M1YA 5K20A 1Y5LA 2PXCA 2R00C 3I5UA 3U3MA 2VDVE 2CGEA 2G08A 2QRQA 4HYEA 1NWHA 4M8KA 2J32A 3WTCA 5DWVA 2BC9A 1YB2A 2VQSA 3CQ9A 4Y2UA 4IJWA 2VTKA 1CY2A 4R7GA 3SR3A 4BS9A 4ZMSA 1BDMA 4Q7EA 4M53A 1KDRA 2VYNA 4DNOA 1GRNA 1GLGA 1H9BA 3DE4X 3OTQA 1U0EA 4YR7A 4J1NA 3ZIUA 4D4MA 4DEXA 1ISMA 3RUPA 5HIIA 7REQB 3W1EA 1I0IA 3P9SA 3V7FA 1G20B 4FDTA 4UM5A 2QUBA 5T4FA 3WL5A 1SG6A 1KYZA 2JB9A 3RVJA 4K6CA 2HRBA 5JEDA 3DT9A 5DYTA 1VB3A 1I3MA 3ZZUA 4EENA 4XASA 1V2GA 3BWBA 3LO8A 3TTUA 2SKDA 2FZEA 1A9OA 1JE1A 2GB4A 2XCQA 1GQSA 1R0KA 4HNAB 2HU2A 1K88A 5E1BA 5DZSA 1WPXA 3CLRD 4N3GA 5KNDA 1ZK1A 1AN9A 2BPOA 1L4EA 5IK2D 4BB6A 1XMOB 1WXGA 3V8RA 1OZFA 4Z7NB 3R9XA 2VNHA 4HATA 2GCOB 1LLQA 4O6VA 1EHIA 3FGZA 3WKAA 2NAPA 1DAGA 1S0UA 1CUBA 3I12A 5F12A 1R8SA 1U2GA 4CMCA 1FJGB 2ZRGA 5IM5A 2LW7A 3AFMA 3O8NA 4HGOA 3FJ1A 5HPYB 1AGYA 4FFBB 1LY1A 1ZCBA 1R6UA 4NX2A 4YWJA 4IMJB 3DCNA 2Q2VA 5KSOA 8GPBA 2JAPA 1Q74A 4JJ6A 1V6AA 4XTCS 3GLQA 3RVBA 2W2TA 4XJSA 3PNQA 1ODFA 1GILA 3OPNA 2CXQA 4LQCA 2XMBA 4CMAA 2QRPA 5K05A 3Q8MA 2CVHA 2EKQA 2R1TB 2FW7A 2W4MA 3H6KA 3HVUA 3NONA 4G24A 5LYJA 1N9GB 1X7ZA 4OX9Y 1PP4A 2O0JA 3D6VA 1X7GA 3KLPX 4M6WB 2IYRA 4OGFA 4M38A 4S12A 1PZHA 3FWNA 4J3JA 1L4YA 1YD7A 4AK9A 2CNOA 1H05A 2G17A 4RDCA 1YUNA 1ECGA 3M9LA 4P3KA 3QNUA 2VQEB 1KVRA 1SUPA 2R87A 2W90A 4FFBA 2HF9A 4MJXA 2WIFA 4WWHA 3PRHA 4XJVA 3LY9A 3VQTA 4AP9A 4EVIA 4AQYB 3P9RA 2B4YA 2IBMA 3QOWA 4TRRA 1Q7BA 3L7NA 4MROA 3I32A 1PJCA 3IXMA 4L8YA 5AHOA 2X42A 3THYA 4ICIA 1E7YA 3M82A 1JDBC 1X15A 2V0CA 2WVGA 4UFNA 4TL9A 3RLIA 2QTAA 3R3YA 5J4YA 3AI7A 1CQXA 4GOLD 3RVLA 3RPEA 3VTAA 1G2IA 3GT7A 4WJLA 1QNFA 4MVJE 1S2IA 2AFVA 2OCYC 4FIZA 4XPIB 3M9XA 4FFVA 2FRXA 5WRFA 2HXSA 3ZTWA 3V42A 1YVUA 2JGLA 4X9XA 4AP5A 5I7VA 3KYCA 1WP9A 4AKSA 1N5RA 3N2EA 4PZCA 1M0TA 4JDPA 4DOMA 2ESRA 4JXKA 3LX8A 1H1TA 3I2FA 3OQ1A 1NQUA 4GH5A 2WEKA 1MA0A 2DHRA 1OT5A 2MSCB 3OTWA 4IILA 1C1XA 3ER6A 1W47A 2V8BA 5A7FA 2X14A 1PHPA 3QUQA 1VKOA 2J41A 2PL5A 3NQ41 1NVMB 3ME5A 1SBTA 5D5QA 3J7AC 5BW8A 1DFHA 4B85A 4CIDA 1BIFA 3OIGA 1GSAA 1E59A 5B2EA 5JLAA 1HV8A 3LRTA 3DLPX 4KQ9A 1HTBA 1EFUA 4O4HB 2DUNA 4HQRA 1P9OA 4QM6A 3E3NA 4ZVPA 4DC9A 4DCOA 1T1EA 3W7BA 4G8JA 3H99A 2VT2A 3VVMA 3GBPA 1YR1A 3OHPA 2CD7A 2ZT5A 4S2UA 4DMCA 1IBMB 5DYWA 4ARIA 2R00A 3OJFA 4U0JA 1I6KA 2X9QA 4O4HF 2FVXA 3NHBA 1CZUA 1GRRA 1SU6A 5AUQA 4MS4A 3NHSA 3FIUA 4ZVQA 1PVDA 4RD1A 1DDGA 2YFYA 1AGNA 3WIOA 3UJHA 3ESDA 4NULA 4X5OA 2IUSA 1BMDA 3L43A 1ZSNA 3N2GA 3KRTA 2JHCA 5JPIA 4DTCA 3UY4A 4M0FA 2XWQA 3ON5A 4BRZA 5DBEX 3GVXA 3F1KA 3T41A 2JNWA 1EXVA 1PZNA 3WAGA 1IULA 1QFXA 1U3WA 4G1FA 5CR9A 4JA2A 1E89A 4TRMA 4ZMBA 3IQDB 2IRWA 1NAHA 1ZLXA 1MJGA 3SXUB 3AL2A 3S2ZA 1RLJA 3V1UA 1NW5A 1WB9A 5LD2C 4C6RA 3EC2A 2RC5A 2L19A 3E9NA 3JZIA 4AG3A 1P44A 1XUOA 1U28A 4IIUA 1XTSA 5JH7A 3FHTA 1ZAKA 5DU2A 1DIGA 3L7IA 3TQCA 4AT1A 1SCNE 2CNWD 3MYYA 1FRVA 3AX6A 3QVWA 4G84A 4MVJF 2RMKA 4BRUA 3J80A 3LCJA 4COKA 1YC5A 4E07A 1U5CA 1N5DA 1DXYA 1EUZA 3ZNOA 5HOEA 1T6YA 1AZWA 5KUTA 1R0XA 3AIIA 3B6IA 1ODKA 1N32B 4ZVSA 3PJDA 4JLAA 3WBBA 4MQLA 4GZ5A 3LF2A 1PT6A 2AR7A 1EXWA 1NI5A 1I4TD 2PD3A 2GN1A 2ZWPA 4Q4JA 4HWRA 4I6EA 3CW9A 5FTMA 1ACJA 3NC1C 1VXOA 4BB9A 3MERA 1A50B 3CSUA 4PQYA 3WGMA 4HNHA 4N9QA 1IZ7A 3B9PA 4PZ9A 1RRKA 2IXFA 4WXRA 1GNRA 4GD3Q 1VHDA 1HXHA 2RKOA 2VYQA 5CAEA 1W5AA 3COZA 2IYEA 1KOLA 4CG0A 3QOFA 1QAQA 3Q40A 1O95A 2H2IA 1APBA 2GZSA 4HEQA 4LTMA 3WK5A 3W7AA 5LXTB 1VA4A 4RVOA 1YF3A 3IR7A 4BFXA 4ITVA 3TI7A 2C3PA 3HVJA 5LR6A 1FTQA 1L5VA 3OZIA 1MC8A 1IZ8A 1YRBA 2JEYA 4RJLA 4EUNA 5E7IA 4KGDA 2I4OA 1BNCA 4FS3A 2XKJE 3VZPA 4MWBA 4TLEA 1CERA 2V4UA 3EA5A 1YQTA 2MR5A 3GH1A 3S70A 2O2JA 2VF7A 4S35A 2W42A 4UZEA 1VKNA 1YV9A 3W8EA 4TYMA 4OUDB 2FPOA 4QHSA 5CVTA 5JR3A 1AKRA 5BYAA 2AZ4A 3EIXA 5FUVA 4C9BA 2A5YB 1DTWA 2XE8A 1A2BA 2X3FA 2C07A 1TZJA 2CVOA 2Z09A 1NIJA 3I01M 3MELA 3ORFA 3G2HA 3OUUA 4K9NA 4EG7A 4RTMA 4CKBB 1N1GA 1UDAA 3BD8A 4IFBA 3F73A 1T15A 4GBED 3M5DA 1ZMRA 2ZQZA 3BN3A 1YRQA 1UBUS 4HHEA 1CYEA 1QB8A 4LWZA 4CGYA 5FFFA 5B37A 5CH8A 1XZPA 4FQ8A 3RKSA 4ONEA 5ISMA 3KKPA 4AIIA 4ZCIA 5JNTA 5K3SA 1QFZA 4MO9A 5KU7A 2QNIA 4EA7A 2R97A 1XBTA 1OLXA 2YS6A 3L8EA 1BGVA 1K7YA 3L7CA 2LPMA 2XOXA 5BVGB 1QHSA 3CONA 3RAEC 4U6QA 4ZOLA 3K15A 2PKEA 3LVQE 3MGCA 4C1BA 1E7SA 3RF6A 1FYXA 4NJEA 1Y6JA 4LVNA 1HQCA 2W6QA 2DUUA 1TLLA 4MEJA 2WKQA 4O5OA 4XOUA 3VR3D 2NUTB 1Z5PA 1G8HA 1SAYA 4G2TA 1XZHA 4TYQA 5JS7A 1GGHA 3A26A 4I4NA 4RM3A 5F7OA 2GZDA 2FG6C 3KEMA 4RADA 3HO8A 3ZD8A 1XNQB 1E2JA 4NMWA 2IIVA 1CS0B 3WRYC 5A3VA 1IJEA 1G7SA 1JQBA 5FL3A 1WB6A 2XXAA 2CUTA 3CX8A 5BVGA 5GVSA 5KJFA 4EZEA 1U28C 1R1DA 5TLSA 2GQ0A 1KBOA 2Q3LA 4X1YB 4RTQA 2OQVA 2GFQA 5J58A 2H4XA 5JSYA 1Z7GA 3CEPB 1PZXA 1X1BA 1XXHA 4DN6A 3T1TA 1QH0A 2QPOA 1N8SA 3UWSA 4X94A 5HWSA 1WXEA 2B8EA 3MWEA 3OSUA 2HA6A 3CRMA 4MUFA 3ZQUA 2WIKA 1A88A 1KPGA 2R85A 4K28A 5C1DA 5IH3A 5SY9A 1QUEA 1IG0A 1DWQA 4XIFA 3INYA 3LC2O 2NWQA 5IAJA 3AH8A 2X4GA 4YNBA 3CJRA 5A9TA 1IN4A 1VE6A 2XD4A 3WO1A 4FS8A 5LJLA 2W71A 3PU6A 2EXXA 5KOIA 4Y0AA 3OM0A 5EAIA 3LPMA 4H1UA 2XUOA 1FFHA 1WBJB 3MBKA 3ZY6A 4AMBA 2Z6UA 3R5JA 5AHKA 2JFBA 2CZCA 1NLMA 1YC2A 2I67A 4OFBA 5DM4A 2QYHA 2H92A 2WW8A 3WTBA 4GVLA 4R0VA 5CX4A 1WAMA 3ZYCA 3ZV6A 4IXNA 1X77A 3O3OB 1P6QA 1N0IA 6ADHA 3LQKA 2OGSA 2AC2A 4CEHB 4BO0A 4ZFNA 1FTNA 1O3YA 3M5WA 2NZWA 4I9UA 5ALRA 1YBVA 421PA 2QKYA 5D6NA 3VU0A 3U4MA 4QDOA 1LPSA 3KHUA 1Q3KA 2WSSD 4M22A 1J0EA 1G6Q1 3DL4A 4J1TC 1CY6A 2A9JA 3A4NA 4WXHA 2CL0X 1QH9A 1JSXA 3PQFA 3PX2A 3UMRA 1XMPA 1Z26A 2BFNA 4O3MA 2GZRA 5TGTA 5L3SB 4KR7A 1EZZA 2HF7A 5FO1A 4F56A 4PFSA 1E20A 1V5IA 1QH8B 2EJTA 4RKEA 5PNTA 1QZ3A 1K0UA 4AJIA 2XEDA 3QVLA 3ZWBA 4EHAA 4OXNA 1MZPA 3O7MA 5DM0A 1YZQA 1J97A 2RHJA 4HDRA 4WZ6A 1U2ZA 1RT9A 4XEHA 5LPNA 2PNJA 2I1WA 3KSMA 4MB0A 2IZ6A 5HSGA 1GQ2A 4Y2SA 3S2EA 3U1BA 1NUTA 1FPQA 2YWFA 3AF0A 3OZ7A 4GBMA 2E1PA 2WWGA 4IM7A 4KI0A 4YLYA 1G55A 3KVRA 4FBLA 1KY2A 1MQ8B 4CEIB 1XA4A 1JB1A 3FBGA 3PSHA 4K81B 1WE2A 2VYVD 3HYLA 3K9WA 3L6BA 5JYDA 2GVZC 3B9RA 3O31A 3KOUA 3OECA 3DEIA 2XSZA 5GJWC 4JC4A 4A2QA 1H65A 3R7FA 4YIHA 3WICA 3V55A 3RADC 2OFWA 3AYXB 3SICE 4ESVA 2ZIXB 4MCAA 3PQ7A 3G6WA 3T54A 1JAHA 4IF4A 1SVOA 2Q2WA 2QROA 3BXEA 1C29B 3BMQB 1S02A 2SCUA 3NEAA 4AJOA 4B4DA 4BVAA 1TOAA 3B52X 2OSVA 2EL7A 2W6NA 4IFIA 2OV6A 5ES4B 3NGMA 5JO0A 5DI3B 4RLQA 4FPXA 4ZAZA 2R1ZA 1QHHA 4CEIA 3QBJA 3G8BA 1RWWA 4TL7A 1EP3B 5CK5A 4DJ5X 1DG9A 3TBHA 3GLKA 5L95A 1Q1ZA 2J9YB 3WB0A 3AEYA 4NS1A 3LLUA 5ARBA 2JD2A 4TTSA 3WZLA 1JJFA 3HNRA 1Q1BA 2BEVB 2BJVA 2J3DA 4JT2A 1YDHA 1ZY2A 1EB8A 1SVSA 3IUJA 3L2OB 4TTPA 5REQA 2GEFA 3MVEA 2X0DA 5E9JA 1A9TA 3BMQA 3S99A 1PWZA 1JEOA 3JQAD 3LNTA 3V97A 4U5QA 3WLIA 4Z86A 4BE7B 4JZYA 4DA0A 4DPKA 3P0JA 1CV2A 2C2YA 2JH3A 3DWEX 4AKEA 3TOVA 1EMDA 4EJFA 3GGDA 1ORRA 1TEVA 3K1ZA 5F2NA 4PW0A 1IU9A 1C9YA 3CR3C 4F6LA 2YV2A 3ECSA 1MH9A 4B8WA 1LDYA 3AUXA 3QMPA 5EERA 3JD0A 2E4AA 4KG7A 1J33A 5FO0A 1F2TA 4Z5XA 3I6ZA 3I6MA 5KTNA 4YR9A 1FNSA 2B2CA 3EXHC 4Q00A 3SLKA 4FYJA 4DL9A 1XHFA 2XDWA 4PG7A 1W0CA 4BVKA 3T9AA 1ZD3A 2OORA 3LBFA 3EB9A 1RVV1 1GG9A 1KEZA 2BLNA 4XYMA 5HCNA 2HRCA 2HSWA 2X41A 5YASA 1QKIA 2H48A 3ESAA 3GJQA 3L6UA 2YICA 3WK6A 1XA0A 4DG5A 721PA 2CSXA 1UFQA 4XFJA 2IUFA 5LMUB 4GAEA 2PJDA 2GSDA 3OO0A 3BGIA 4EBBA 1KOGA 2I6SA 2PRZA 1GGNA 3WYGA 4B4WA 1KNXA 2ZIWB 4FU0A 1DC7A 1NLZA 1CP2A 1VJCA 4Q4AA 3KFVA 2FMIA 1BFUA 1OZAA 1VRCA 3GQVA 3GMIA 3TIVA 1I5EA 4B3FX 5IC4A 3TL6A 3U3OA 4UNIA 5CDUA 1U6IA 2JAWA 4LDRA 4NK4A 4J9VA 3QXSA 3D8HA 5IABA 4ON9A 4WEOA 2C9CA 2CVZA 3QJ5A 2ZSFA 5CVCA 2CLDX 3USES 3X1YA 4UOZA 3ITEA 3QG1A 1H23A 4DCMA 5ALDA 1XV5A 4CM6A 1YQ9A 1Y98A 1OFTA 1OZ0A 1IHOA 2FOIA 5DI9A 3SVLA 4X66B 3ZWPA 2BMWA 2AG1A 4KRGA 3KEGA 4GOJA 3D6TB 3CLUC 3T5CA 3OO1A 2W2XA 3FTQA 1U1DA 4EABA 4CT4B 3CLSC 2IITA 2HV8A 4G2NA 1XB2A 4J75A 4HVLA 4EVQA 2IGBA 3IFSA 4KDFA 4AS2A 1WQ4A 5CLQA 2C2BA 3IHLA 4POOA 4WNAB 5A0FA 1YOBA 2SKCA 1G41A 1WVGA 2DVMA 4RCZA 1U1GA 4TXNA 3RIEA 2P7IA 2PSHA 2FSGA 3AHDA 3UFXA 3OY7A 3P9XA 1J0XO 1K4YA 1ZRHA 1DEHA 3BBLA 1EP2B 4U2CA 4RO0A 2Z9BA 4UHJA 1PLJA 3FCCA 4FGZA 1G1AA 3CRVA 2J4CA 3USZA 3ZDBA 5BQPA 1J7JA 1M2HA 3RVSA 4ENRA 2HCRA 4Y1GA 1FUIA 4DYVA 3KU4A 4ECAA 5ALMA 1C9MA 2PRYA 1WXXA 4BV8A 5ITVA 2E4ZA 2Y6UA 1IWBB 3I9LA 3QTTA 3I9MA 3ZHQA 2B7BA 4YCCA 1HSZA 4JBXA 3LLMA 1TQ8A 3VU9A 2EFDB 5DNUA 3UV3A 3PQCA 3G59A 4WBNA 2OGUA 2NTNA 2GJKA 5KNBD 4WY8A 2Z8YA 2VEOA 1ZC4A 1BE0A 4Q7JB 1ML4A 4FCCA 2PO7A 1Y3IA 2QN2A 2HB6A 3B1ZA 3ZX4A 4CEJA 4FHGA 4CNQA 2Q2OA 2EQAA 3MMZA 4PLHA 5JCJD 1CUXA 3AP2A 2QX6A 2LKDA 3I8SA 2FI1A 1E1CA 3PGVA 4JU8A 1HDZA 1E5TA 2E4WA 4M87A 4S1VA 4ZPXA 1GPBA 2B0CA 3FSRA 3OZVA 5IDWA 3E9DA 1FMLA 4RIHA 1QVAA 2W2LA 3C16C 1KL7A 3VOTA 3DMTC 2BGIA 2GLTA 5B6JA 5TVKA 2YFHA 1XDSA 4PLGA 3RYIA 4NV3A 2QVBA 4E4YA 1V11B 1U65A 4HTFB 4K9MA 5JS8A 1CF9A 4S1OA 2B1IA 1ZRSA 2IZOA 2EHJA 2VATA 3TDKA 2D59A 3NNDA 4KNWA 3RU3A 1REQB 1RP1A 1TZ2A 2Q1UA 3Q8WA 4LX8A 3TZ6A 1I7NA 3IQWA 3BF7A 2ZPTX 3IGFA 1W29A 4P7KA 5NULA 1Y8QA 5MHTA 4COOA 4PVCA 4DLYA 3N8KA 3G2QA 5BURA 1GGFA 2Z43A 4MV6A 4P9NA 3G0OA 3IAXA 3LOQA 4MR7B 4ARBA 1MO6A 1P9RA 1KWGA 2CNDA 1NY6A 1ADCA 2YWCA 3LY7A 1T2NA 4A4DA 4PPQA 1Y4DE 3B1WA 1R5BA 3O3MB 3HBNA 2WT9A 4Y6SA 2EP5A 5EQDA 4R2HA 3TBFA 5JZSA 5LZ5A 3ZDZB 1XU7A 4BGEA 1WUKS 4XWGA 3OQOA 1USKA 3GI1A 4BEBA 1CHDA 4NR0A 4YQFA 2EERA 3PIRA 2PHZA 2EJBA 1XRNA 3C1TA 4JQSA 3NBFA 4M98A 3DUFB 4OBWA 1TQ2A 3NYWA 1BRTA 4H3SA 4BMVA 1IN7A 1MOSA 4FFWA 2DTEA 5JANA 1HNZB 2MSDB 3OWHA 1JL3A 2ODTX 2E37A 1D0VA 1UUFA 2Z9DA 3IA7A 3ASUA 4LHYA 3SZOA 1YXMA 4UU7A 2ZSIA 1GU1A 1ZH0A 1J5EB 2IYZA 3RSFA 2DLNA 2IDJA 2CW5A 4LGCA 2VUSA 1TCVA 2ILVA 1V39A 2JFNA 1E1QA 1RHMA 4QLAA 3TB4A 4ZT4A 1O97C 4Q9LA 1NJ1A 4AX4A 4BO7A 3K9LA 3L7JA 1RJFA 3ZLBA 3P20A 5EKTA 3QITA 4AWAA 4D5GA 1F7UA 4PZAA 1P6XA 1L1QA 3RUEA 5JADA 3PEYA 2YHIB 4K6MA 4F0JA 4DSAA 4EX6A 6PFKA 1JR6A 3PEWA 4LGVA 2C3YA 4HQNA 4JQCA 2PH5A 3BHJA 3RUCA 3H13A 3QWFA 4NH4A 4QYSA 3U3KA 1MNAA 2BMAA 1CEXA 1PFUA 3W5AA 2FFAA 1I1HA 2W0MA 3FTNA 3BA1A 5E4JA 2IWRA 3OLCX 3QUCA 1AHPA 1QGYA 1W52X 2PKQP 4O4IF 3TVTA 1U5BB 2WJIA 4U7FA 4YI5A 5EKUA 4HLUC 4LNUA 2NU8B 4WN9A 2MINA 1HQKA 3THOA 5LJIA 3W5DA 5AKIA 2ANCA 2R44A 5HMLA 2GHRA 4H3HB 4JBHA 4ZT7A 2FK8A 3ZHYA 3M6VA 4OB6A 5L40A 1B15A 4HLDA 1GPMA 1YUMA 2YHIA 3KTAB 4E3ZA 2IH4A 3E23A 3AOEA 1E0SA 1LDMA 3B53X 3UAYA 2P6OA 3OZCA 1AS0A 4JP3A 3DAYA 3HGQA 1JS1X 1KPIA 1VMKA 2IUYA 2GZ1A 3PVZA 4CPDA 1U0HC 1E0AA 2ALJA 1MX9A 3AB8A 3CRQA 2CLOB 4OO3A 3AHHA 4K88A 4OYRA 1W9MA 4DLBA 4Y67A 3FA2A 2Z2JA 3L7LA 3NTLA 4GDMA 4HAOA 2GKGA 2XUJA 1CVIA 3B51X 3BGSA 4RJJA 3SQDA 1WRBA 2FCAA 5M04A 4N5LA 5LQCA 1PEAA 2GXUA 2VS1A 2G5CA 1V6CA 2KQUA 3K8QA 3TOXA 3VAZA 3DE5X 1X42A 3EVAA 4LJAA 3W4IA 3PV0A 3D7LA 3AOGA 2VTBB 2ZYVX 4G8CA 1L5LA 4HN9A 4BMZA 4KR2A 4AJEA 4EOGA 4FMCF 2FETA 3LH5A 3HV2A 1UWKA 3IPXA 2DYKA 3KPUA 4BCDA 5JH7B 5DM2A 2OO7A 2J07A 4GWGA 2ZCVA 5FBZA 1DBQA 3IEMA 1RWMA 4UNSA 1D04A 4BNHA 3TLCA 3EVEA 1RI1A 4M1TA 1LH0A 4X90A 3EGEA 1L5GB 3N8NA 1FP4A 5ANRB 5CCEA 2GPBA 1FYFA 1GNQA 2I4LA 2YDYA 3E9RA 4OQFA 3D7SA 4IDGA 3REGA 3ZU2A 1DKOA 1UOOA 1N34B 1PFGA 1PW7A 4GRAA 3FZGA 2H17A 3IYLW 3QKTA 4OHVA 2D1SA 4EGJA 4UM9D 1IONA 1NNEA 3S1AA 5GGYA 1JE0A 3CG0A 1AUXA 2X86A 1M1UA 3FOBA 4IICA 4KXXA 4UEWA 4H7EA 5IDYA 3KL4A 4ND5A 4I2VA 3RC2A 3RRJA 1OWMA 2NQTA 1OLSB 3KJXA 1M34E 2A5JA 4J07A 5CB8A 3STXA 3AWDA 4URFA 3RTBA 1O5OA 1U7DA 2YJ5A 4DY6A 3DTTA 1ZNWA 2P9GA 4FW9A 3IULA 2PSFA 2A0YA 1QYWA 1JZTA 5CJ2A 3WHLA 1ZITA 2IU4A 2GHIA 4I5FA 1YHYA 1S7CA 4NBKA 3WX0A 1OFGA 5DOVA 3JAKB 2G67A 4C5CA 3DV2A 4R1UA 2Z3ZA 3D81A 1KDTA 2GJ4A 2A1IA 2C5HA 1K8QA 1Y7LA 3QV2A 3ZHTA 1ODLA 3FUTA 3PICA 1NBAA 2GAAA 2OLEA 3P5BA 1KRHA 1GRVA 2I4TA 1AKYA 1QS0B 1J49A 3BB3A 4FYHA 1XEWX 3ROTA 5LMZA 2G1UA 3WS7A 3NRBA 3LIPA 2J0QA 3CX4A 4FD3A 4G5OA 3GCZA 3RFCA 1N5KA 2IS4A 2ZRIA 1JV2B 3E2MA 3TLBA 3KCNA 4YXFA 2BKXA 1DMRA 3ZXUB 4ZT5A 1HI9A 4DDKA 2WJGA 4D8TA 1VMAA 1V3QE 1PAUA 1QJCA 2V9CA 4RE5A 2Q2NA 2WHPB 2QE7D 4O5AA 4RWZA 4S1NA 3ELBA 1CF4A 4QO8A 3L3BA 4Q1BA 1F12A 4YRGA 4Z1MA 1FB5A 1NXTA 1WLYA 2RHGB 4AFNA 3L8FA 3IEPA 3CUSA 2HCFA 4FZ5A 3LDAA 3S2GA 1OXXK 1ZESA 5L3QB 1OI2A 4MW6A 4H6PA 3ADCA 2QIPA 4OGKA 3ZGXA 1YGPA 2GARA 4L1KA 1NN0A 4GI7A 1Q14A 4P53A 3ZWOA 1ODJA 3WWDA 2FR0A 4FWBA 5EE5B 1WZEA 2VIIA 3PS9A 3R9KA 3UG6A 2G6TA 2TSYB 3QBTA 3ZXSA 1NPDA 3H86A 1F7VA 5HIKA 4L08A 3DO6A 2W8BB 4QQFA 2E6KA 3ROPA 4JJKA 2O19A 1SD1A 1F0PA 2REQA 3LW7A 1FFGA 4KN8A 4C4YA 4LZOA 2WSIA 3NHKA 1T26A 4PLPA 4YROA 1XEWY 3TN7A 3AIMA 5DBOA 4A3SA 3DVRX 5FJIA 2E5LB 1AK1A 1HQDA 2RGEA 2IEDA 3CMCO 3R3WA 2MMGA 3RRMA 4BAZA 4RULA 4AKIA 2HWUA 1KY4A 1S3GA 3CCFA 3VOBA 3CIFA 1BHSA 4GOXA 2WTXA 1QYIA 3OHMA 2DRIA 4MVYA 5CMLA 2R8XA 3PUZA 4HP8A 2I3GA 3VI4B 4BE4A 5HKKD 2VTDA 2HDNB 5IN4A 5DEIA 2WWVD 3UHJA 5JYEA 1SQFA 1WO8A 2EFCB 3CZPA 4RVFA 5D5PA 1E92A 4LJ5A 4JC5A 1J56A 4O4JB 4M2LA 2YVQA 4AJLA 3P4YA 4FE4A 4Z53A 4QX6A 1EX7A 4MQ5A 3LM8A 4MV0A 3U1VA 4IQ4A 4PG6A 1U8TA 4KWIA 1H6CA 3QW4B 1I01A 3MT0A 4RLFA 3RK0A 2WF6A 5C1PA 1P91A 2FCRA 1EDDA 5DP1A 1QIMA 2M9MA 1W2WB 3ZBQA 2FPSA 3GRFA 3KD2A 1FYVA 1PNRA 3CWZA 3TBKA 5J23A 3OG9A 1GXSB 1TPYA 1MAWA 3L82B 1KMQA 2B8TA 2OD9A 2VCHA 4MRMB 1AUQA 3CY6A 3KX2A 4MJ3A 1FP6A 3KKLA 3HP1A 4ZHQB 4O4JA 3NIDB 3U7IA 2I76A 3OTHA 3C97A 1UFKA 1QIHA 4FZRA 2EWVA 4KXYA 1UXHA 4OOEA 1Q17A 1HE2A 4IY1A 2SHKA 5B58T 4DANA 3EXG1 4NU6A 2BV3A 4NDAA 5E7MA 1LDGA 1KO7A 4D4GA 1DCMA 3E81A 1GYPA 3MINA 4RQUA 1NP6A 5I9SA 5ARDA 4UNQA 4HEA6 4IIEA 3SC2A 3V32A 1ESNA 2RAPA 2XE7A 2AXPA 4AY5A 5JXGA 2WTNA 4BOYA 1TVCA 5TF4A 4ZO4A 1YE3A 3CWCA 4CR6A 1XMQB 4RHCA 4TTIA 2VYND 4Y2PA 5IJXA 2CLSA 1J23A 2XMQA 3P45A 4MV1A 4NCKA 1GQOA 2H06A 2IYAA 1IBKB 4CIAA 3AJEA 1RCUA 3HWWA 3BH0A 4QRHA 3WDMA 4DMRA 5A6VA 1U1IA 2VNSA 5CIQA 1H3NA 1X1SA 1XMSA 1L5KA 4ZVLA 1B93A 1MVLA 2DFTA 4MW2A 3A6FA 1L7XA 3AOEC 3SX4A 3FPEA 5CB4F 1L4BA 4CKCB 5C8DA 4EL5A 4UTNA 4NEQA 1LJUA 2UYGA 3DMPA 1XDBA 1G59A 2TMGA 3BCSA 1TUEA 1UIRA 2GF2A 2IHYA 3SNHA 1O96A 1DJLA 4IIXA 1UMBA 1V95A 2H4WA 3EG5A 3JASA 4GE0A 4IUBS 2AX3A 1P0CA 4J0CA 5LIPA 2G0NA 2UYYA 3OUZA 5LDGA 3IUBA 4C3OB 1O94D 2WKWA 2ZJ6A 5I7UA 2XBLA 1OF1A 5JAMA 4EG3A 1AXRA 2PYZA 1WDKA 2QWXA 1ST2A 3FNHA 1ZI8A 1UPBA 3DZGA 3IVRA 1K63A 3UZUA 4TMWA 3V8VA 2ZRMA 1ENZA 1XU4A 4DSNA 4ZMRA 2LVBA 1K2WA 2OCAA 2QP9X 3H5TA 1O2DA 4FNAA 5K09A 1WDLA 1NJSA 2O7QA 4MMZB 2ID7A 5JYBA 4C05A 1P9LA 1FFYA 2NV2B 2BDUA 3TZEA 3GCXA 2JFVA 3OT1A 4NMXB 4TYPA 3ZNNA 1VKJA 2DBQA 4KQWA 3AR5A 1O97D 2IQ5A 1LXCA 2HDHA 1RWQA 2RGUA 2VDNB 3F90A 3FNIA 4J9UE 3A3NA 3HRIA 3GLSA 3ZWNA