4UEYA

Structure of the periplasmic domain phoq double mutant (w104c-a128c)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
140
structure length
140
Chain Sequence
TFRLLRGESNLFYTLAKWENNKISVELPENLDMQSPTMTLIYDETGKLLWTQRNIPCLIKSIQPEWLKTNGFHEIETNVDCTSTLLSEDHSAQEKLKEVREDDDDAEMTHSVAVNIYPATARMPQLTIVVVDTIPIELKR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOQ PERIPLASMIC DOMAIN DOUBLE MUTANT
publication title Acidic pH and divalent cation sensing by PhoQ are dispensable for systemic salmonellae virulence.
pubmed doi rcsb
source organism Salmonella enterica
molecule tags Signaling protein
total genus 32
structure length 140
sequence length 140
chains with identical sequence B, C
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2014-12-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.140 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ueyA00
3BQ8A 3BQAA 1YAXA 4UEYA
chains in the Genus database with same CATH superfamily
2Y2PA 4LFUA 2Y2LA 4HBTA 1ZHHB 4ZDXA 4PAUA 2J7VA 1E25A 4Y2FA 2EX8A 2ZM8A 2ZQ7A 1MBLA 3I7JA 4XUXA 1MZUA 3ITAA 4WEKA 2PT7A 4FTXA 1DJBA 3A3DA 1LI9A 2VEAA 4HH2A 3Q81A 3A0SA 5A91A 5CECA 4FSFA 5J3WA 2Y91A 1U60A 3KYZA 3TW8A 3T1SA 3SS5A 3GDIA 4NXBA 3GRJA 3UE0A 1IKIA 2EXAA 4BQMA 4R6LA 4I38A 1NYYA 1BLPA 1PWGA 4JGRA 3G32A 1RGYA 4PM6A 2W27A 4OQIA 3PYPA 4JF5A 4WZ4A 1D1JA 4FD8A 1K54C 2VLGA 4E04A 5FI7A 3HBRA 5HWWA 1FSWA 3DTIA 1N9BA 4U3TA 5AQBA 4DJ2A 4Y17A 1YPRA 3A3EA 2J9OA 1GA9A 4KENB 2AVXA 3S4XA 2ZC4B 1FCNA 1NLZA 5FQMA 3E0YA 4IJGA 2UV0E 3MXQA 4NETA 1XGJA 1Y54A 1FILA 4HJ3A 1PIOA 4P85A 4D2OA 1HVBA 1ESIA 5DFYA 5FDHA 1YKDA 5E2HA 3C38A 3CLOA 3T4SA 3H82B 3F1PA 4DDSA 4R70A 1OT9A 3RJUA 3QP2A 3G30A 2XROA 3PAGA 4DE3A 2JKFA 1SZVA 2VA0A 3ICYA 2PD7A 1OTIA 1ES4A 1TS0A 4P6ZS 4QY5A 3LR5A 1NYMA 3HLCA 5FAPA 3C7UA 4I5SA 4E3NA 3DW0A 4EQIA 3GMWA 4H6JB 3ZGAB 2Y59A 1C3BA 1CJFA 1H5XA 3SW1A 4HOIA 5JYPA 2ZLYA 4Q8IA 1LT0A 2VGJA 1BTLA 2QJ5A 2FFFB 3UDFA 4I3AA 4LV3A 1ONGA 2VGLM 3K3DA 5CTMA 4ESPA 3KSGA 4GB7A 1PWDA 3NI9A 3LCEA 4H6JA 4GHIA 1IOUA 4HIAA 4X55A 2W3EA 3FPWA 3VE3A 4Q0IA 3IHAA 4CJNA 1L3LA 5FASA 2BLSA 2HP9A 3EOIA 1ZG4A 5DKLA 3HUNA 3MQQA 2EFUA 2VKSA 3LIFA 3ZG5A 4MBHA 1KE4A 3S7PA 1SDEA 1OTEA 4X25A 4S2LA 4NXFA 4OPZA 2RCXA 3BLSA 3ZNTA 3KSFA 1W63M 1PW1A 1IFQA 1I2SA 1P9WA 5IT5A 2Y2NA 2EX9A 2WAFA 1S4RA 3A0RA 5M18A 3WRTA 5CHUA 4CLCD 2A49A 3FC7A 1K55A 1NZOA 4KQQA 5HPIA 1QMEA 4G3WA 1CQAA 4FH4A 5HARA 2XA7M 1BZAA 4MN7A 2Z6CA 3FWLA 3F1OA 3IXGA 1XJ2A 4PHTA 1PWCA 3F1NA 2UWXA 4NXGA 3D4FA 4WELA 4PPRA 1SKFA 4KZ5A 4LENA 1LSWA 4N9LA 3B33A 1HLUP 1M6KA 3LO7A 1UWNX 3IXDA 3CUEA 5CXWA 2EWWA 4BD0A 2R9WA 5EFWA 4EBPA 3DTKA 3VFFA 3BM6A 2QMIA 4CLCE 4MDZA 4LV2A 1G5UA 2VGKA 1K4FA 1O7EA 1MWTA 4P6ZM 5L10A 1SCWA 5FQ9A 3HLEA 5GHYA 5EVIA 4GJ4A 4X1LA 4GZBA 3O88A 5HDSA 4Y15A 1XXMA 1NRJA 4GKUA 4GN2A 3N4IA 4UQIS 2MJ6A 2HJEA 2H10A 1NZUA 2VZWA 4JPMA 3RFBA 4WEJA 1ES5A 2KX6A 2EFXA 5CTNA 2V1ZA 5F6AA 3U4LP 3T4LA 1MPLA 3EQUA 2O0YA 1I5QA 1WYBA 2PR5A 1LL5A 1YLZA 3DTMA 3LR0A 5IU1A 3QP1A 3PBSA 1H8MA 4OPQA 1KVMA 2WKPA 5CERA 1ONHA 3PBQA 2XLNA 3IXBA 3HLGA 2WZXA 1KE3A 5EV0A 3GTCA 3ZG9B 3NDEA 2H0TA 4E6XA 4C3QA 4Y3IA 4MBFA 4ZJ3A 1P97A 4GNUA 1DP6A 3OOVA 3NBLA 4MCWA 1MWSA 3NOUC 5JYOA 2C5WB 3VOLA 3MS6A 5HWTA 3BQAA 5EVEA 1ZKJA 1VETA 1J9MA 1YMSA 2VV8A 4RX2A 2L1MA 4S2IA 3HLDA 1VHMA 2O9BA 3UE1A 3BYDA 5FDSA 1K57A 4WMCA 5CGSA 2ZC5B 2QWSA 3ZQ5A 4UEYA 3A3FA 4P6BA 3LFVA 1M40A 4BBVA 4MBKA 4YFMA 1GHPA 4O7DA 3MMHA 1PI4A 1TDLA 4PM9A 5FL3A 2OSUA 3QNCA 3B3XA 2Z2LB 4B88A 3A3IA 2ZL1B 4XT2B 1PRQA 1V9YA 3PR6A 3HUMA 2XFTA 3ZCZA 3Q1FA 1W7FA 4OQ0A 5L09A 4HY8A 1ESUA 5A93A 3TE8A 4S2JA 3PHYA 2J9PA 3N7WA 2ZBBA 2ZL1A 4EERA 1TVFA 4XT2A 1S67L 3Q7ZA 3NDGA 2HF6A 2XSSA 2EX2A 2VV6A 4ZTKA 4IEDA 5F1GA 4UA6A 5DJTA 4JLFA 2PDRA 4UA9A 5TBMA 4I39A 4QD4A 1YSQA 1F9IA 2KOIA 3V3RA 4C75A 5M1AA 4L9FA 3ZG0A 1E4DA 4QJGA 1LSXA 4G3VA 1OT6A 1ERMA 1YLJA 1IKGA 1HZOA 1MY8A 3B47A 1FIKA 2BTFP 1FCMA 1ZG6A 1JTDA 4ARZB 5AQ7A 4R3JA 3HLWA 4RVAA 2WADA 3BEBA 1PI5A 3V67A 1XP4A 3TOIA 2WGIA 2JHEA 3BQ8A 3FKWA 4N1XA 4LCMA 4Q0JA 3ISGA 3NULA 4O0PA 5GLCA 2WAEA 1GCEA 3MF0A 3ZYTA 5CEBA 4WN5A 1YAXA 3BW6A 3EGDC 3W4QA 1LL8A 1Q2QA 5CGWA 2Q9MA 1SDNA 2Z6DA 3WRZA 2ZC6B 4HHDA 1MXOA 3H9WA 5HL6A 2XFSA 5AVFA 2EXBA 4WZ5A 3EEHA 4NK3A 5C5KA 4D60A 2HV1A 4EU0A 1N9OA 2VV7A 2V8FA 5L2FA 3VP1A 3IXHA 5CGXA 3P7NA 1FSYA 2QZ6A 1OJGA 3GVBA 3IX4A 1XKZA 3NJAA 3UPOA 2DCFA 2B95A 3ZG8B 3SH8A 5F68A 2Q9NA 4IVKA 1OTDA 5EECA 2PU4A 2H28A 3BLMA 4OONA 3IF6C 3CITA 5F83A 1RP5A 4E6WA 3FZCA 1ES3A 2E8IA 3DBAA 2EA9A 3MFXA 1DRMA 4JXWA 1YLPA 2ZOHA 5D3OA 2X01A 1H8ZA 3LY4A 4HBUA 1D06A 1KGFA 3LYXA 3RH8B 4EWFA 3CG5A 3DWZA 3MZEA 5FATA 3UY6A 1CF0A 4JBFA 4LCLA 4OP8A 2JKGA 1Y28A 4GW9A 1F98A 1CEFA 5HW3A 3S7QA 1K4EA 3SZTA 4WF0A 4GDBA 2OV5A 3S7NA 2Y2JA 1N9LA 3BRMA 3JPUA 1Y4OA 1LHYA 3CMZA 3OCNA 1L2SA 3PTEA 4KZ9A 1PYYA 1W8QA 1H0MA 3IH9A 4DN0A 1YQSA 2ZM0A 3HVFA 4ZAMA 5CRFA 2WKQA 1OPXA 2V1BA 4DE0A 3EEAA 1PZPA 2Q0OA 2JKTI 5EE8A 1FR1A 4Y0UA 4JXGA 2BG1A 2VK3A 3L7HA 1GSWA 3VFHA 1STZA 2GX5A 5M19A 1MC0A 3E2KA 1E3UD 3LR3A 3BWLA 4UHUA 3IF6B 1SHVA 1T1CA 2V8CA 3T12B 4B4XA 5GLAA 4NXEA 2IWBA 2V2FF 2QJ7A 3H82A 3VOZA 1YLTA 1DY6A 5FI6A 1ERQA 1OMEA 3GQZA 3IS2B 5DTKA 1VM1A 4UA7A 2H0YA 2Y2KA 1NY0A 5MC7A 1P0ZA 3SOIA 1KGEA 4DXBA 4EETB 2X71A 3CZDA 4JF4A 1UWPX 2R78A 3IS2A 5E2FA 4BL2A 4NKPA 3DWKA 4KZ6A 1CK3A 3TG9A 5EVID 3WS1A 3ZFZA 1BT5A 4PM5A 4KZAA 3S22A 2PAVP 4JGQA 1MWUA 2J3WA 2Y2QA 3G4PA 2B18A 4JGPA 3G2ZA 3E4PA 5CHJA 4EBLA 3FG8A 1K54A 1GSVA 1O07A 1K56D 2ZOIA 3G2YA 4U0TA 1KDWA 5A8BA 1KE0A 4YINA 1BLSA 2W3FA 2XK1A 1S1YA 5EVLA 2PYPA 1P9RA 3OC2A 3W4PA 4CLCC 3LICA 3N6IA 4LLOB 4BMWA 5L8MA 1JWZA 2PRFA 1IELA 1YM1A 4Y13A 1LLBA 1K38A 4AFIA 3M2KA 2LB5A 1IEMA 2JKRI 1PFLA 5FAOA 1K6SA 4GD6A 4UAAA 3AGEA 4X53A 3KX0X 4S2NC 3UB5P 4OOMA 3MSHA 2WKEA 2J8YA 3JVUA 1TF1A 3VOYA 1FQGA 4NEED 2O99A 5AQAA 1ACFA 2Y4AA 2ZMFA 3SS4A 2HP5A 3HUOA 3D72A 1OJ5A 1JWPA 3MFDA 5HAPA 2JN7A 4HP9A 2GDNA 2A24B 4L9EA 1NWZA 4KZ8A 2P74A 5FA7A 4X69A 4BL3A 3HJIA 2K31A 4WMCD 1XGIA 1W5DA 1Q2PA 2A2LA 4R1GA 1CEGA 1T18A 4S2PA 4K08A 3IHBA 5AVEA 2CC1A 3A3JA 4HI4A 3EQVA 4JXVA 4DXCA 1DJAA 1XJ6A 4HP4A 3UB6A 3BFEA 3MJQA 4GS9B 3VSLA 3MQ0A 2A24A 2XDMA 4C6YA 3U2AA 4F3LB 4LV0A 4B9OA 2IWDA 4PKYG 4KQRA 1VEUB 3VP0A 3BY8A 4IUKA 1RGZA 4HNBA 3CJMA 4I3IA 2V9AA 2BASA 3D3OA 4CLCB 4OVDA 4RYEA 3KSIA 1NLYA 4GS9A 5FEGA 5DVAA 4F3LA 3NECA 3GECA 3VE4A 5KMWA 4YOFA 1VEUA 2WKRA 4F94A 3K3CA 5G18A 5FSRA 2Y79A 2QHKA 3P09A 5TGFA 4QHCA 2GZAA 3GR2A 5E2EA 5FI2A 5EM0A 3ZVTA 1IYPA 1YSPA 1F5MA 4IUHA 4FH2A 5J8XA 4B93A 4R0QA 4PM8A 2ZMAA 2PHYA 4CPKA 4KZ3A 5K5BA 1YMXA 2XF3A 3G34A 1ODVA 2V20A 1WA9A 2HJ9C 4R4SA 4LRYC 3HJKA 4EEUA 4GD8A 4NG2A 4ID4A 4KUOA 2Y2HA 3BFFA 3PBOA 3T4QA 4DKIA 1JNUA 2L4RA 3E2LA 2ZM2A 2G7UA 1ZTUA 3BECA 1CI9A 2GJ3A 1BUEA 4EUVA 1KOUA 3OPRA 4LRXC 4II7A 4WLAA 1H8YA 2B02A 4S2MA 3T1QB 4N9KA 2M7UA 4HH3A 1G28A 4QWOA 3IH8A 3PBNA 5FQQA 3MZDA 2ACGA 1XJ4A 3T4JA 2NUTC 2Z2MB 4WZ5C 5EM1A 2YKFA 5FAQA 3LEQA 5GHXA 3IWOA 5DF9A 1S4SA 2W3GA 5DJUA 2PD8A 4HQAA 4IBRA 3WS4A 4BBUA 3CAXA 5HZHA 1PNEA 2JC7A 2HP6A 4RQ9A 5EUAA 2KLIA 1BYWA 5HX9A 3UB9A 2D01A 3LIEA 5LBRA 1S0WA 2CMNA 1FR6A 1DP8A 5HPFA 3T4KA 1QMFA 4UQIM 2ZQ8A 1LL9A 2V0WA 5KSCA 1H3QA 1RCJA 1S1ZA 4IVIA 1TEMA 3V50A 3WWXA 3OBFA 2WUQA 3G35A 4OPRA 2G2UA 3NCKA 2P7JA 4CQHA 3LY3A 5CX7A 2C6WB 2ZC7A 3M2JA 4QB8A 1FOFA 3OLOA 2XQZA 3Q7VB 3T1RA 3IT9A 4QY6A 2DRWA 2ZMVA 2HPBA 4M3KA 3UPPA 4MEZA 1NXYA 1WE4A 2K7SA 3HLBA 2A3UA 3EWKA 5BOHA 1W79A 4EUZA 4ARZA 1SKOB 1F2KA 4KZ7A 4LRZE 3OCLA 1TDGA 5DF7A 4OH0A 3ZHHA 4R38A 3V3SA 4WL9A 4GCZA 5F82A 4EESA 3FYZA 3KO6A 3OPLA 4LGWA 5DFXA 3UNWA 3FPVA 5TJJA 5HD5A 1S66L 3MBZA 3H7WB 3KSHA 1SKOA 3UDIA 1L0EA 3LIDA 2R9XA 2I72A 4BBTA 2PU2A 4IHQA 3CPTB 1FCOA 4OPYA 3IX8A 4Y5FA 3Q07A 3T1XA 4EEPA 3C8CA 3G31A 5HL1A 2PBDP 3H7WA 2HGVA 3K2NA 1JWVA 3MKEA 2Y55A 2VGLS 3C30A 3DAVA 1OTAA 3D9YA 2ZQDA 3SH9A 3VMAA 4BWIA 3WS0A 4JXSA 1CI8A 5DKKA 3AGDA 3QP4A 3FV7A 3MXSA 1G6OA 3ZNYA 1MWRA 4S2OA 1T1BA 2FH5A 2XD5A 4KQDA 3VP4A 4MNRA 3LUQA 3E4OA 2XH9A 3R4KA 5A92A 4Y7PA 2LB9A 3OZHA 3EGXC 4IBXA 1EW0A 1XA1A 2EX6A 4GOGA 3UO9A 4ETZA 3V5MA 5KSHA 1NRFA 2OLVA 1AXBA 3LI8A 1Z6FA 2JKTM 3PXPA 4WUJA 1EI5A 5G4ZA 1YLYA 1GHMA 3ITBA 2PBYA 2VJWA 1W8YA 1LI0A 1XFQA 2W3HA 5F1FA 3V39A 4N92A 2XA7S 2M7VA 1D7EA 3F1PB 2RL3A 1ES2A 1EWZA 5GHZA 2ZQAA 4DRTA 4JGOA 3LEZA 4BJPA 4QU3A 3O87A 4K0WA 2OWHA 4Y0TA 1TS6A 2HDQA 4L0LA 1K55C 4BLMA 4MMNA 2ZD8A 2Y2GA 1ALQA 1GHIA 4WM9A 3C5AA 2ZJ9A 4S2KA 2JE5A 1TS8A 4HEFA 1Z09A 2OLUA 1IYQA 5DTSA 4Z9QA 1KDSA 3ZDJA 2XD1A 5EOEA 3UN7A 5I94A 2W1TB 4PM7A 2ZC3B 3HL9A 2WYXA 1JVJA 4MLLA 4KZBA 4MN5A 3ZG7B 3IF6A 3CUEC 4PMAA 4GHIB 4ME4A 3WS2A 3TRCA 1HD8A 1VQQA 4KG2A 5KIZA 1V9ZA 5IS1A 3S7OA 3IWQA 2W1TA 1K25A 2V0UA 2OAQ1 4HESA 1A0KA 3LI9A 5EVIC 4Q0HA 4P0MA 1IYSA 4OLDA 2GNXA 2P9VB 2ZQ9A 4DE2A 4EV4A 3DTEA 5J7EA 1XA7A 1X0OA 1IYOA 2J80A 5EPHA 2QYBA 2WKIA 4GDNA 4L9GA 3VSKA 3NC8A 4B4ZA 1G68A 3UMEA 4OLGA 4OKPA 2P9VA 3G6OA 3NOPC 2JKRM 2WGVA 2HDUA 3CI6A 3OPPA 4EBNA 4XUZA 2H5SA 5E2GA 4E3MA 2OAP1 1BLHA 3F1OB 4DF6A 2PYRA 2WKHA 3UE3A 1E3UA 3TSGA 1OTBA 5DTTA 2O9CA 3BFGA 3VP2A 4I3JA 4LV1A 5GLBA 4KG6A 3F1NB 4X68A 3P98A 4ETXA 2W3DA 1LSVA 2IWCA 2XRNA 1I2WA 3VP3A 3C2WA 2V1AA 4ZBEA 3BFCA 1UGUA 3HLFA 5J4EA 5CEDA 4DMZA 3NIAA 3N8RA 1PW8A 1W63Q 2L0WA 3CHWP 1K57C 4E3IA 1DP9A 5FQIA 2YKHA 5HDDA 2X02A 4QPRA 2O9AA 2WZZA 3NHQA 5EVIB 3MXRA 3QP8A 4XXRA 3N8LA 3TJZC 2WK0A 2NUPC 3PAEA 4MN6A 2XR0A 4KUKA 4N1HA 3QP6A 3JYIA 3T50A 3R7WB 1K0KA 2I9VA 2INWA 5U47A 3S1YA 2DNSA 4OOLA 3ULFA 1XX2A 2Y2MA 2KDKA 5EOOA 1GA0A 3BJNA 4M4XA 1L0DA 4KG5A 3UPNA 3NY4A 5FQKA 2K2NA 1J3WA 1K56A 2J3TC 5AJGA 3A0VA 3R7WA 3IF5A 3UE6A 5DF8A 3T4TA 2J3TD 1EROA 2ZQCA 2VX8A 4GLQA 3MKFA 3LGOA 4YWZA 4EW7A 2B5RA 3W8KA 1KGGA 3IBJA 3MZFA 4CLCA 1WYCA 4Y0OA 5F69A 4DJ3A 3WS5A 4ZJ1A 3CWFA 3RXXA 4EXOA 1VETB 3AGFA 2WGWB 4X1MA 3C4PA 4S2NA 1XFNA 4FCFA 3HCYA 1XJ3A 5I5LA 5HFOA 4DE1A 4X6TA 3HREA 3C4OA 4KZ4A 2W0NA 4O01A 3KYQA 2IA2A 3E98A 4FUWA 2WGWA 4JF6A 5A90A 1BLCA 3W2ZA 1YLWA 4O8GA 2QPNA 5G4YA 4JKTA 4WYYA 5TFQA 1KVLA 1NJ4A 4HJ4A 4E3JA 2XEPA 4K0XA 3UB7A 4E3OA 3QNBA 3UMDA 2P04A 3N8SA 4OOYA 2P08A 3B42A 5FQJA 4E3LA 1JTGA 3P01A 2M1CA 2PR6A 4OQHA 4ZRRA 3RTYA 4BENA 3IQAA 3SS3A 1N9NA 4X56A 1ZC2A 5TBMB 2FZ0A 4KQOA 4WBGA 5HD3A 2E8JA 3GSGA 3IBRA 3MQOA 1MKMA 4R3BA 5HAIA 4R3AA 3JVVA 1XPBA 4EQ1A 2Y8HA 5KZHA 4OQGA 3MR0A 2OOLA 4R4RA 4A5RA 3BFDA 4H8RA 1HTZA 3IX3A 3LR4A 2EWVA 3NOTC 5FEFA 1BULA 2D02A 4HJ6A 3O3VA 4ZJ2A 3IWIA 4R23A 4P87A 2HDRA 3PBTA 3W4OA 5HSQA 3UDXA 3LIBA 4E3KA 4DDYA 4YNRA 4BD1A 5HWVA 5E43A 3C7VA 4FOFA 3KYEA 4LPZA 2FFYA 3GV9A 3OPHA 1GSXA 3Q7VA 4G3KA 2XGNA 2Y2IA 1VB6A 4U0XA 1K6RA 3RXWA 3O86A 4K91A 3FKVA 4Z1WA 5TR7A 3M6HA 3PBRA 3QP5A 1MKIA 1T19A 2Y2OA 5F5YA 4RA7A 3VV4A 3T4OA 3Q82A 1YT4A 4OP5A 5GL9A 4PKYA 2HDSA 1AWIA 1L0FA 3LIAA 2DMWA 3ZVWA 3SH7A 1N4OA 1S6RA 5IHVA 2OWJA 3O5YA 5L07A 5HAQA 3BY9A 5HDCA 1L0GA 2W1RA 2QKPA 3L9KA 1G6AA 1TS7A 3UB8A 1DJCA 3QHYA 5GLDA 2JCHA 2HZ5A 1T1AA 1TD5A 2JBFA 5AQ9A 3CPTA 3M6BA 1PZOA 2G2WA 5CHMA 4RX3A 1BSGA 3E4QA
chains in the Genus database with same CATH topology
3EQVA 2ZBBA 3TRCA 1XJ6A 4HP4A 3UB6A 3MJQA 4EERA 1ZHHB 4GS9B 4XT2A 5KIZA 1S67L 4PAUA 3MQ0A 2A24A 4Y2FA 1V9ZA 3U2AA 4F3LB 4B9OA 2HF6A 4PKYG 2XSSA 5IS1A 3S7OA 3BY8A 2VV6A 4IUKA 2W1TA 1MZUA 2V0UA 2OAQ1 4WEKA 2PT7A 3LI9A 4HNBA 4I3IA 4Q0HA 5DJTA 2V9AA 2VEAA 4HH2A 2PDRA 2BASA 2GNXA 3D3OA 4I39A 5TBMA 4CLCB 3A0SA 1YSQA 1F9IA 2KOIA 4FSFA 5J3WA 3KSIA 4L9FA 1NLYA 3KYZA 5J7EA 4GS9A 1LSXA 3TW8A 1X0OA 4G3VA 1OT6A 4F3LA 3GECA 3VE4A 3GDIA 4YOFA 2J80A 4NXBA 2QYBA 2WKRA 3B47A 3K3CA 2Y79A 4R6LA 2QHKA 4I38A 4L9GA 4ARZB 3UMEA 2GZAA 4JGRA 3G6OA 3NOPC 2JKRM 1YSPA 3CI6A 2W27A 3PYPA 1F5MA 4IUHA 2VLGA 3V67A 4B93A 4E04A 5HWWA 2PHYA 2JHEA 3BQ8A 4DJ2A 5K5BA 4Q0JA 2OAP1 4O0PA 1ODVA 3F1OB 1WA9A 2HJ9C 2PYRA 3MF0A 3ZYTA 3UE3A 4LRYC 1OTBA 3HJKA 2O9CA 4WN5A 4I3JA 1YAXA 1NLZA 3BW6A 3F1NB 4EEUA 3E0YA 3EGDC 1LL8A 4IJGA 3MXQA 4KUOA 4ETXA 2W3DA 3PBOA 3T4QA 1JNUA 2L4RA 2Z6DA 2G7UA 4HJ3A 1ZTUA 4HHDA 1LSVA 2XRNA 5DFYA 3H9WA 5HL6A 1YKDA 3C38A 3C2WA 2GJ3A 3CLOA 5AVFA 3T4SA 3H82B 3F1PA 2V1AA 4R70A 3EEHA 1OT9A 5C5KA 4EUVA 1KOUA 2XROA 1UGUA 5J4EA 2HV1A 4DMZA 4EU0A 1N9OA 2VV7A 2L0WA 1W63Q 4LRXC 4II7A 4WLAA 2VA0A 1DP9A 3ICYA 2PD7A 1OTIA 2B02A 1TS0A 3P7NA 2YKHA 5HDDA 4QPRA 4P6ZS 2O9AA 1OJGA 3NHQA 3NJAA 2M7UA 4HH3A 3LR5A 1G28A 4I5SA 3PBNA 3TJZC 2NUPC 4MN6A 1XJ4A 3T4JA 2NUTC 2YKFA 4H6JB 4KUKA 5DF9A 3T50A 3R7WB 1S4SA 2W3GA 3SW1A 5F68A 4HOIA 2I9VA 2PD8A 5DJUA 2INWA 4HQAA 1OTDA 4BBUA 3CAXA 5HZHA 1LT0A 4OOLA 3ULFA 4RQ9A 2H28A 2KDKA 2KLIA 1BYWA 2QJ5A 3BJNA 4I3AA 4M4XA 2VGLM 3UB9A 3K3DA 3KSGA 3CITA 2D01A 3LIEA 5LBRA 2CMNA 2K2NA 1DP8A 5HPFA 4H6JA 3T4KA 4GHIA 1IOUA 3MFXA 3DBAA 2EA9A 1DRMA 2J3TC 5AJGA 4HIAA 4UQIM 2V0WA 3A0VA 3R7WA 1H3QA 2W3EA 2ZOHA 3UE6A 3FPWA 3T4TA 3VE3A 2J3TD 4Q0IA 1S1ZA 1D06A 3OBFA 3LYXA 3RH8B 2VX8A 4GLQA 2P7JA 3EOIA 4YWZA 4EW7A 4CQHA 5DKLA 5CX7A 3MQQA 3IBJA 2VKSA 3LIFA 1Y28A 3OLOA 4GW9A 4CLCA 4ME4A 1F98A 3S7PA 5F69A 1OTEA 2ZMVA 4DJ3A 3CWFA 3S7QA 4WF0A 4NXFA 2K7SA 3S7NA 4EXOA 1N9LA 3EWKA 3KSFA 1W63M 3OCNA 1IFQA 4ARZA 1P9WA 5IT5A 1XFNA 4LRZE 1S4RA 3OCLA 3HCYA 4DN0A 1XJ3A 5I5LA 3A0RA 4R38A 4WL9A 4GCZA 4CLCD 3FC7A 2WKQA 1OPXA 4EESA 2V1BA 5HPIA 3EEAA 3KO6A 4G3WA 2JKTI 2W0NA 4O01A 5DFXA 3KYQA 2XA7M 4MN7A 2IA2A 3FPVA 3E98A 2Z6CA 5TJJA 3W2ZA 1GSWA 5HD5A 1S66L 4O8GA 3F1OA 3H7WB 3KSHA 1XJ2A 5G4YA 3LIDA 1STZA 2GX5A 4PHTA 1MC0A 4HJ4A 3F1NA 4BBTA 4NXGA 3LR3A 4WELA 4IHQA 3BWLA 3UB7A 1LSWA 3B33A 1T1CA 1UWNX 3CUEA 2EWWA 3UMDA 4Y5FA 4NXEA 2P04A 4EEPA 2P08A 5EFWA 3C8CA 2QJ7A 3B42A 3H82A 3H7WA 3P01A 4CLCE 4MDZA 3IS2B 2HGVA 2M1CA 2PR6A 3K2NA 4ZRRA 3RTYA 4P6ZM 2VGLS 1N9NA 4GJ4A 3C30A 1OTAA 5TBMB 5HDSA 4BWIA 1NRJA 5MC7A 1P0ZA 2FZ0A 4KQOA 5HD3A 4EETB 3IBRA 4UQIS 2MJ6A 3MQOA 2HJEA 1MKMA 5DKKA 2VZWA 3RFBA 4WEJA 1UWPX 4R3AA 2R78A 3IS2A 1G6OA 3JVVA 2KX6A 4EQ1A 2Y8HA 3MR0A 5F6AA 4NKPA 3T4LA 1T1BA 2FH5A 3EQUA 2O0YA 4KQDA 2PR5A 2OOLA 3LR0A 5IU1A 3PBSA 3LUQA 1H8MA 4JGQA 2J3WA 3E4OA 2B18A 3R4KA 3LR4A 2WKPA 4JGPA 3PBQA 3E4PA 2EWVA 2LB9A 3FG8A 3NOTC 1GSVA 3EGXC 1EW0A 2ZOIA 5A8BA 4ETZA 2W3FA 2D02A 1S1YA 4HJ6A 5KSHA 4Y3IA 1P97A 3PBTA 2PYPA 5HSQA 3LIBA 1P9RA 4YNRA 3OC2A 5HWVA 3LI8A 4CLCC 3LICA 4LLOB 4BMWA 2JKTM 1DP6A 5L8MA 4FOFA 3PXPA 4LPZA 4WUJA 3OOVA 5G4ZA 1GSXA 4MCWA 3NOUC 4G3KA 2VJWA 4AFIA 1VB6A 1XFQA 3VOLA 2W3HA 2LB5A 5HWTA 2JKRI 3BQAA 4Z1WA 2XA7S 2M7VA 1D7EA 3F1PB 3PBRA 1T19A 5F5YA 2VV8A 3VV4A 3T4OA 2L1MA 4JGOA 3KX0X 4OOMA 1VHMA 2O9BA 4BJPA 2OWHA 3JVUA 4PKYA 1TF1A 2QWSA 3ZQ5A 1TS6A 4UEYA 3LFVA 2DMWA 3LIAA 4BBVA 4NEED 2O99A 4L0LA 2OWJA 3O5YA 3MMHA 4MMNA 3BY9A 5HDCA 2W1RA 2QKPA 2ZMFA 5FL3A 1TS7A 3UB8A 3D72A 1OJ5A 1TS8A 2JN7A 4XT2B 4HP9A 2A24B 1V9YA 4L9EA 1NWZA 3PR6A 3HJIA 2K31A 2W1TB 4HY8A 1T1AA 1TD5A 2A2LA 4MN5A 1T18A 3TE8A 3CUEC 4K08A 5AVEA 4GHIB 3PHYA 4HI4A 3E4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQ8 A;  3BQA A;  1YAX A;  4UEY A; 
#chains in the Genus database with same CATH topology
 2Y2P A;  4LFU A;  2Y2L A;  4HBT A;  1ZHH B;  4ZDX A;  4PAU A;  2J7V A;  1E25 A;  4Y2F A;  2EX8 A;  2ZM8 A;  2ZQ7 A;  1MBL A;  3I7J A;  4XUX A;  1MZU A;  3ITA A;  4WEK A;  2PT7 A;  4FTX A;  1DJB A;  3A3D A;  1LI9 A;  2VEA A;  4HH2 A;  3Q81 A;  3A0S A;  5A91 A;  5CEC A;  4FSF A;  5J3W A;  2Y91 A;  1U60 A;  3KYZ A;  3TW8 A;  3T1S A;  3SS5 A;  3GDI A;  4NXB A;  3GRJ A;  3UE0 A;  1IKI A;  2EXA A;  4BQM A;  4R6L A;  4I38 A;  1NYY A;  1BLP A;  1PWG A;  4JGR A;  3G32 A;  1RGY A;  4PM6 A;  2W27 A;  4OQI A;  3PYP A;  4JF5 A;  4WZ4 A;  1D1J A;  4FD8 A;  1K54 C;  2VLG A;  4E04 A;  5FI7 A;  3HBR A;  5HWW A;  1FSW A;  3DTI A;  1N9B A;  4U3T A;  5AQB A;  4DJ2 A;  4Y17 A;  1YPR A;  3A3E A;  2J9O A;  1GA9 A;  4KEN B;  2AVX A;  3S4X A;  2ZC4 B;  1FCN A;  1NLZ A;  5FQM A;  3E0Y A;  4IJG A;  2UV0 E;  3MXQ A;  4NET A;  1XGJ A;  1Y54 A;  1FIL A;  4HJ3 A;  1PIO A;  4P85 A;  4D2O A;  1HVB A;  1ESI A;  5DFY A;  5FDH A;  1YKD A;  5E2H A;  3C38 A;  3CLO A;  3T4S A;  3H82 B;  3F1P A;  4DDS A;  4R70 A;  1OT9 A;  3RJU A;  3QP2 A;  3G30 A;  2XRO A;  3PAG A;  4DE3 A;  2JKF A;  1SZV A;  2VA0 A;  3ICY A;  2PD7 A;  1OTI A;  1ES4 A;  1TS0 A;  4P6Z S;  4QY5 A;  3LR5 A;  1NYM A;  3HLC A;  5FAP A;  3C7U A;  4I5S A;  4E3N A;  3DW0 A;  4EQI A;  3GMW A;  4H6J B;  3ZGA B;  2Y59 A;  1C3B A;  1CJF A;  1H5X A;  3SW1 A;  4HOI A;  5JYP A;  2ZLY A;  4Q8I A;  1LT0 A;  2VGJ A;  1BTL A;  2QJ5 A;  2FFF B;  3UDF A;  4I3A A;  4LV3 A;  1ONG A;  2VGL M;  3K3D A;  5CTM A;  4ESP A;  3KSG A;  4GB7 A;  1PWD A;  3NI9 A;  3LCE A;  4H6J A;  4GHI A;  1IOU A;  4HIA A;  4X55 A;  2W3E A;  3FPW A;  3VE3 A;  4Q0I A;  3IHA A;  4CJN A;  1L3L A;  5FAS A;  2BLS A;  2HP9 A;  3EOI A;  1ZG4 A;  5DKL A;  3HUN A;  3MQQ A;  2EFU A;  2VKS A;  3LIF A;  3ZG5 A;  4MBH A;  1KE4 A;  3S7P A;  1SDE A;  1OTE A;  4X25 A;  4S2L A;  4NXF A;  4OPZ A;  2RCX A;  3BLS A;  3ZNT A;  3KSF A;  1W63 M;  1PW1 A;  1IFQ A;  1I2S A;  1P9W A;  5IT5 A;  2Y2N A;  2EX9 A;  2WAF A;  1S4R A;  3A0R A;  5M18 A;  3WRT A;  5CHU A;  4CLC D;  2A49 A;  3FC7 A;  1K55 A;  1NZO A;  4KQQ A;  5HPI A;  1QME A;  4G3W A;  1CQA A;  4FH4 A;  5HAR A;  2XA7 M;  1BZA A;  4MN7 A;  2Z6C A;  3FWL A;  3F1O A;  3IXG A;  1XJ2 A;  4PHT A;  1PWC A;  3F1N A;  2UWX A;  4NXG A;  3D4F A;  4WEL A;  4PPR A;  1SKF A;  4KZ5 A;  4LEN A;  1LSW A;  4N9L A;  3B33 A;  1HLU P;  1M6K A;  3LO7 A;  1UWN X;  3IXD A;  3CUE A;  5CXW A;  2EWW A;  4BD0 A;  2R9W A;  5EFW A;  4EBP A;  3DTK A;  3VFF A;  3BM6 A;  2QMI A;  4CLC E;  4MDZ A;  4LV2 A;  1G5U A;  2VGK A;  1K4F A;  1O7E A;  1MWT A;  4P6Z M;  5L10 A;  1SCW A;  5FQ9 A;  3HLE A;  5GHY A;  5EVI A;  4GJ4 A;  4X1L A;  4GZB A;  3O88 A;  5HDS A;  4Y15 A;  1XXM A;  1NRJ A;  4GKU A;  4GN2 A;  3N4I A;  4UQI S;  2MJ6 A;  2HJE A;  2H10 A;  1NZU A;  2VZW A;  4JPM A;  3RFB A;  4WEJ A;  1ES5 A;  2KX6 A;  2EFX A;  5CTN A;  2V1Z A;  5F6A A;  3U4L P;  3T4L A;  1MPL A;  3EQU A;  2O0Y A;  1I5Q A;  1WYB A;  2PR5 A;  1LL5 A;  1YLZ A;  3DTM A;  3LR0 A;  5IU1 A;  3QP1 A;  3PBS A;  1H8M A;  4OPQ A;  1KVM A;  2WKP A;  5CER A;  1ONH A;  3PBQ A;  2XLN A;  3IXB A;  3HLG A;  2WZX A;  1KE3 A;  5EV0 A;  3GTC A;  3ZG9 B;  3NDE A;  2H0T A;  4E6X A;  4C3Q A;  4Y3I A;  4MBF A;  4ZJ3 A;  1P97 A;  4GNU A;  1DP6 A;  3OOV A;  3NBL A;  4MCW A;  1MWS A;  3NOU C;  5JYO A;  2C5W B;  3VOL A;  3MS6 A;  5HWT A;  3BQA A;  5EVE A;  1ZKJ A;  1VET A;  1J9M A;  1YMS A;  2VV8 A;  4RX2 A;  2L1M A;  4S2I A;  3HLD A;  1VHM A;  2O9B A;  3UE1 A;  3BYD A;  5FDS A;  1K57 A;  4WMC A;  5CGS A;  2ZC5 B;  2QWS A;  3ZQ5 A;  4UEY A;  3A3F A;  4P6B A;  3LFV A;  1M40 A;  4BBV A;  4MBK A;  4YFM A;  1GHP A;  4O7D A;  3MMH A;  1PI4 A;  1TDL A;  4PM9 A;  5FL3 A;  2OSU A;  3QNC A;  3B3X A;  2Z2L B;  4B88 A;  3A3I A;  2ZL1 B;  4XT2 B;  1PRQ A;  1V9Y A;  3PR6 A;  3HUM A;  2XFT A;  3ZCZ A;  3Q1F A;  1W7F A;  4OQ0 A;  5L09 A;  4HY8 A;  1ESU A;  5A93 A;  3TE8 A;  4S2J A;  3PHY A;  2J9P A;  3N7W A;  2ZBB A;  2ZL1 A;  4EER A;  1TVF A;  4XT2 A;  1S67 L;  3Q7Z A;  3NDG A;  2HF6 A;  2XSS A;  2EX2 A;  2VV6 A;  4ZTK A;  4IED A;  5F1G A;  4UA6 A;  5DJT A;  4JLF A;  2PDR A;  4UA9 A;  5TBM A;  4I39 A;  4QD4 A;  1YSQ A;  1F9I A;  2KOI A;  3V3R A;  4C75 A;  5M1A A;  4L9F A;  3ZG0 A;  1E4D A;  4QJG A;  1LSX A;  4G3V A;  1OT6 A;  1ERM A;  1YLJ A;  1IKG A;  1HZO A;  1MY8 A;  3B47 A;  1FIK A;  2BTF P;  1FCM A;  1ZG6 A;  1JTD A;  4ARZ B;  5AQ7 A;  4R3J A;  3HLW A;  4RVA A;  2WAD A;  3BEB A;  1PI5 A;  3V67 A;  1XP4 A;  3TOI A;  2WGI A;  2JHE A;  3BQ8 A;  3FKW A;  4N1X A;  4LCM A;  4Q0J A;  3ISG A;  3NUL A;  4O0P A;  5GLC A;  2WAE A;  1GCE A;  3MF0 A;  3ZYT A;  5CEB A;  4WN5 A;  1YAX A;  3BW6 A;  3EGD C;  3W4Q A;  1LL8 A;  1Q2Q A;  5CGW A;  2Q9M A;  1SDN A;  2Z6D A;  3WRZ A;  2ZC6 B;  4HHD A;  1MXO A;  3H9W A;  5HL6 A;  2XFS A;  5AVF A;  2EXB A;  4WZ5 A;  3EEH A;  4NK3 A;  5C5K A;  4D60 A;  2HV1 A;  4EU0 A;  1N9O A;  2VV7 A;  2V8F A;  5L2F A;  3VP1 A;  3IXH A;  5CGX A;  3P7N A;  1FSY A;  2QZ6 A;  1OJG A;  3GVB A;  3IX4 A;  1XKZ A;  3NJA A;  3UPO A;  2DCF A;  2B95 A;  3ZG8 B;  3SH8 A;  5F68 A;  2Q9N A;  4IVK A;  1OTD A;  5EEC A;  2PU4 A;  2H28 A;  3BLM A;  4OON A;  3IF6 C;  3CIT A;  5F83 A;  1RP5 A;  4E6W A;  3FZC A;  1ES3 A;  2E8I A;  3DBA A;  2EA9 A;  3MFX A;  1DRM A;  4JXW A;  1YLP A;  2ZOH A;  5D3O A;  2X01 A;  1H8Z A;  3LY4 A;  4HBU A;  1D06 A;  1KGF A;  3LYX A;  3RH8 B;  4EWF A;  3CG5 A;  3DWZ A;  3MZE A;  5FAT A;  3UY6 A;  1CF0 A;  4JBF A;  4LCL A;  4OP8 A;  2JKG A;  1Y28 A;  4GW9 A;  1F98 A;  1CEF A;  5HW3 A;  3S7Q A;  1K4E A;  3SZT A;  4WF0 A;  4GDB A;  2OV5 A;  3S7N A;  2Y2J A;  1N9L A;  3BRM A;  3JPU A;  1Y4O A;  1LHY A;  3CMZ A;  3OCN A;  1L2S A;  3PTE A;  4KZ9 A;  1PYY A;  1W8Q A;  1H0M A;  3IH9 A;  4DN0 A;  1YQS A;  2ZM0 A;  3HVF A;  4ZAM A;  5CRF A;  2WKQ A;  1OPX A;  2V1B A;  4DE0 A;  3EEA A;  1PZP A;  2Q0O A;  2JKT I;  5EE8 A;  1FR1 A;  4Y0U A;  4JXG A;  2BG1 A;  2VK3 A;  3L7H A;  1GSW A;  3VFH A;  1STZ A;  2GX5 A;  5M19 A;  1MC0 A;  3E2K A;  1E3U D;  3LR3 A;  3BWL A;  4UHU A;  3IF6 B;  1SHV A;  1T1C A;  2V8C A;  3T12 B;  4B4X A;  5GLA A;  4NXE A;  2IWB A;  2V2F F;  2QJ7 A;  3H82 A;  3VOZ A;  1YLT A;  1DY6 A;  5FI6 A;  1ERQ A;  1OME A;  3GQZ A;  3IS2 B;  5DTK A;  1VM1 A;  4UA7 A;  2H0Y A;  2Y2K A;  1NY0 A;  5MC7 A;  1P0Z A;  3SOI A;  1KGE A;  4DXB A;  4EET B;  2X71 A;  3CZD A;  4JF4 A;  1UWP X;  2R78 A;  3IS2 A;  5E2F A;  4BL2 A;  4NKP A;  3DWK A;  4KZ6 A;  1CK3 A;  3TG9 A;  5EVI D;  3WS1 A;  3ZFZ A;  1BT5 A;  4PM5 A;  4KZA A;  3S22 A;  2PAV P;  4JGQ A;  1MWU A;  2J3W A;  2Y2Q A;  3G4P A;  2B18 A;  4JGP A;  3G2Z A;  3E4P A;  5CHJ A;  4EBL A;  3FG8 A;  1K54 A;  1GSV A;  1O07 A;  1K56 D;  2ZOI A;  3G2Y A;  4U0T A;  1KDW A;  5A8B A;  1KE0 A;  4YIN A;  1BLS A;  2W3F A;  2XK1 A;  1S1Y A;  5EVL A;  2PYP A;  1P9R A;  3OC2 A;  3W4P A;  4CLC C;  3LIC A;  3N6I A;  4LLO B;  4BMW A;  5L8M A;  1JWZ A;  2PRF A;  1IEL A;  1YM1 A;  4Y13 A;  1LLB A;  1K38 A;  4AFI A;  3M2K A;  2LB5 A;  1IEM A;  2JKR I;  1PFL A;  5FAO A;  1K6S A;  4GD6 A;  4UAA A;  3AGE A;  4X53 A;  3KX0 X;  4S2N C;  3UB5 P;  4OOM A;  3MSH A;  2WKE A;  2J8Y A;  3JVU A;  1TF1 A;  3VOY A;  1FQG A;  4NEE D;  2O99 A;  5AQA A;  1ACF A;  2Y4A A;  2ZMF A;  3SS4 A;  2HP5 A;  3HUO A;  3D72 A;  1OJ5 A;  1JWP A;  3MFD A;  5HAP A;  2JN7 A;  4HP9 A;  2GDN A;  2A24 B;  4L9E A;  1NWZ A;  4KZ8 A;  2P74 A;  5FA7 A;  4X69 A;  4BL3 A;  3HJI A;  2K31 A;  4WMC D;  1XGI A;  1W5D A;  1Q2P A;  2A2L A;  4R1G A;  1CEG A;  1T18 A;  4S2P A;  4K08 A;  3IHB A;  5AVE A;  2CC1 A;  3A3J A;  4HI4 A;  3EQV A;  4JXV A;  4DXC A;  1DJA A;  1XJ6 A;  4HP4 A;  3UB6 A;  3BFE A;  3MJQ A;  4GS9 B;  3VSL A;  3MQ0 A;  2A24 A;  2XDM A;  4C6Y A;  3U2A A;  4F3L B;  4LV0 A;  4B9O A;  2IWD A;  4PKY G;  4KQR A;  1VEU B;  3VP0 A;  3BY8 A;  4IUK A;  1RGZ A;  4HNB A;  3CJM A;  4I3I A;  2V9A A;  2BAS A;  3D3O A;  4CLC B;  4OVD A;  4RYE A;  3KSI A;  1NLY A;  4GS9 A;  5FEG A;  5DVA A;  4F3L A;  3NEC A;  3GEC A;  3VE4 A;  5KMW A;  4YOF A;  1VEU A;  2WKR A;  4F94 A;  3K3C A;  5G18 A;  5FSR A;  2Y79 A;  2QHK A;  3P09 A;  5TGF A;  4QHC A;  2GZA A;  3GR2 A;  5E2E A;  5FI2 A;  5EM0 A;  3ZVT A;  1IYP A;  1YSP A;  1F5M A;  4IUH A;  4FH2 A;  5J8X A;  4B93 A;  4R0Q A;  4PM8 A;  2ZMA A;  2PHY A;  4CPK A;  4KZ3 A;  5K5B A;  1YMX A;  2XF3 A;  3G34 A;  1ODV A;  2V20 A;  1WA9 A;  2HJ9 C;  4R4S A;  4LRY C;  3HJK A;  4EEU A;  4GD8 A;  4NG2 A;  4ID4 A;  4KUO A;  2Y2H A;  3BFF A;  3PBO A;  3T4Q A;  4DKI A;  1JNU A;  2L4R A;  3E2L A;  2ZM2 A;  2G7U A;  1ZTU A;  3BEC A;  1CI9 A;  2GJ3 A;  1BUE A;  4EUV A;  1KOU A;  3OPR A;  4LRX C;  4II7 A;  4WLA A;  1H8Y A;  2B02 A;  4S2M A;  3T1Q B;  4N9K A;  2M7U A;  4HH3 A;  1G28 A;  4QWO A;  3IH8 A;  3PBN A;  5FQQ A;  3MZD A;  2ACG A;  1XJ4 A;  3T4J A;  2NUT C;  2Z2M B;  4WZ5 C;  5EM1 A;  2YKF A;  5FAQ A;  3LEQ A;  5GHX A;  3IWO A;  5DF9 A;  1S4S A;  2W3G A;  5DJU A;  2PD8 A;  4HQA A;  4IBR A;  3WS4 A;  4BBU A;  3CAX A;  5HZH A;  1PNE A;  2JC7 A;  2HP6 A;  4RQ9 A;  5EUA A;  2KLI A;  1BYW A;  5HX9 A;  3UB9 A;  2D01 A;  3LIE A;  5LBR A;  1S0W A;  2CMN A;  1FR6 A;  1DP8 A;  5HPF A;  3T4K A;  1QMF A;  4UQI M;  2ZQ8 A;  1LL9 A;  2V0W A;  5KSC A;  1H3Q A;  1RCJ A;  1S1Z A;  4IVI A;  1TEM A;  3V50 A;  3WWX A;  3OBF A;  2WUQ A;  3G35 A;  4OPR A;  2G2U A;  3NCK A;  2P7J A;  4CQH A;  3LY3 A;  5CX7 A;  2C6W B;  2ZC7 A;  3M2J A;  4QB8 A;  1FOF A;  3OLO A;  2XQZ A;  3Q7V B;  3T1R A;  3IT9 A;  4QY6 A;  2DRW A;  2ZMV A;  2HPB A;  4M3K A;  3UPP A;  4MEZ A;  1NXY A;  1WE4 A;  2K7S A;  3HLB A;  2A3U A;  3EWK A;  5BOH A;  1W79 A;  4EUZ A;  4ARZ A;  1SKO B;  1F2K A;  4KZ7 A;  4LRZ E;  3OCL A;  1TDG A;  5DF7 A;  4OH0 A;  3ZHH A;  4R38 A;  3V3S A;  4WL9 A;  4GCZ A;  5F82 A;  4EES A;  3FYZ A;  3KO6 A;  3OPL A;  4LGW A;  5DFX A;  3UNW A;  3FPV A;  5TJJ A;  5HD5 A;  1S66 L;  3MBZ A;  3H7W B;  3KSH A;  1SKO A;  3UDI A;  1L0E A;  3LID A;  2R9X A;  2I72 A;  4BBT A;  2PU2 A;  4IHQ A;  3CPT B;  1FCO A;  4OPY A;  3IX8 A;  4Y5F A;  3Q07 A;  3T1X A;  4EEP A;  3C8C A;  3G31 A;  5HL1 A;  2PBD P;  3H7W A;  2HGV A;  3K2N A;  1JWV A;  3MKE A;  2Y55 A;  2VGL S;  3C30 A;  3DAV A;  1OTA A;  3D9Y A;  2ZQD A;  3SH9 A;  3VMA A;  4BWI A;  3WS0 A;  4JXS A;  1CI8 A;  5DKK A;  3AGD A;  3QP4 A;  3FV7 A;  3MXS A;  1G6O A;  3ZNY A;  1MWR A;  4S2O A;  1T1B A;  2FH5 A;  2XD5 A;  4KQD A;  3VP4 A;  4MNR A;  3LUQ A;  3E4O A;  2XH9 A;  3R4K A;  5A92 A;  4Y7P A;  2LB9 A;  3OZH A;  3EGX C;  4IBX A;  1EW0 A;  1XA1 A;  2EX6 A;  4GOG A;  3UO9 A;  4ETZ A;  3V5M A;  5KSH A;  1NRF A;  2OLV A;  1AXB A;  3LI8 A;  1Z6F A;  2JKT M;  3PXP A;  4WUJ A;  1EI5 A;  5G4Z A;  1YLY A;  1GHM A;  3ITB A;  2PBY A;  2VJW A;  1W8Y A;  1LI0 A;  1XFQ A;  2W3H A;  5F1F A;  3V39 A;  4N92 A;  2XA7 S;  2M7V A;  1D7E A;  3F1P B;  2RL3 A;  1ES2 A;  1EWZ A;  5GHZ A;  2ZQA A;  4DRT A;  4JGO A;  3LEZ A;  4BJP A;  4QU3 A;  3O87 A;  4K0W A;  2OWH A;  4Y0T A;  1TS6 A;  2HDQ A;  4L0L A;  1K55 C;  4BLM A;  4MMN A;  2ZD8 A;  2Y2G A;  1ALQ A;  1GHI A;  4WM9 A;  3C5A A;  2ZJ9 A;  4S2K A;  2JE5 A;  1TS8 A;  4HEF A;  1Z09 A;  2OLU A;  1IYQ A;  5DTS A;  4Z9Q A;  1KDS A;  3ZDJ A;  2XD1 A;  5EOE A;  3UN7 A;  5I94 A;  2W1T B;  4PM7 A;  2ZC3 B;  3HL9 A;  2WYX A;  1JVJ A;  4MLL A;  4KZB A;  4MN5 A;  3ZG7 B;  3IF6 A;  3CUE C;  4PMA A;  4GHI B;  4ME4 A;  3WS2 A;  3TRC A;  1HD8 A;  1VQQ A;  4KG2 A;  5KIZ A;  1V9Z A;  5IS1 A;  3S7O A;  3IWQ A;  2W1T A;  1K25 A;  2V0U A;  2OAQ 1;  4HES A;  1A0K A;  3LI9 A;  5EVI C;  4Q0H A;  4P0M A;  1IYS A;  4OLD A;  2GNX A;  2P9V B;  2ZQ9 A;  4DE2 A;  4EV4 A;  3DTE A;  5J7E A;  1XA7 A;  1X0O A;  1IYO A;  2J80 A;  5EPH A;  2QYB A;  2WKI A;  4GDN A;  4L9G A;  3VSK A;  3NC8 A;  4B4Z A;  1G68 A;  3UME A;  4OLG A;  4OKP A;  2P9V A;  3G6O A;  3NOP C;  2JKR M;  2WGV A;  2HDU A;  3CI6 A;  3OPP A;  4EBN A;  4XUZ A;  2H5S A;  5E2G A;  4E3M A;  2OAP 1;  1BLH A;  3F1O B;  4DF6 A;  2PYR A;  2WKH A;  3UE3 A;  1E3U A;  3TSG A;  1OTB A;  5DTT A;  2O9C A;  3BFG A;  3VP2 A;  4I3J A;  4LV1 A;  5GLB A;  4KG6 A;  3F1N B;  4X68 A;  3P98 A;  4ETX A;  2W3D A;  1LSV A;  2IWC A;  2XRN A;  1I2W A;  3VP3 A;  3C2W A;  2V1A A;  4ZBE A;  3BFC A;  1UGU A;  3HLF A;  5J4E A;  5CED A;  4DMZ A;  3NIA A;  3N8R A;  1PW8 A;  1W63 Q;  2L0W A;  3CHW P;  1K57 C;  4E3I A;  1DP9 A;  5FQI A;  2YKH A;  5HDD A;  2X02 A;  4QPR A;  2O9A A;  2WZZ A;  3NHQ A;  5EVI B;  3MXR A;  3QP8 A;  4XXR A;  3N8L A;  3TJZ C;  2WK0 A;  2NUP C;  3PAE A;  4MN6 A;  2XR0 A;  4KUK A;  4N1H A;  3QP6 A;  3JYI A;  3T50 A;  3R7W B;  1K0K A;  2I9V A;  2INW A;  5U47 A;  3S1Y A;  2DNS A;  4OOL A;  3ULF A;  1XX2 A;  2Y2M A;  2KDK A;  5EOO A;  1GA0 A;  3BJN A;  4M4X A;  1L0D A;  4KG5 A;  3UPN A;  3NY4 A;  5FQK A;  2K2N A;  1J3W A;  1K56 A;  2J3T C;  5AJG A;  3A0V A;  3R7W A;  3IF5 A;  3UE6 A;  5DF8 A;  3T4T A;  2J3T D;  1ERO A;  2ZQC A;  2VX8 A;  4GLQ A;  3MKF A;  3LGO A;  4YWZ A;  4EW7 A;  2B5R A;  3W8K A;  1KGG A;  3IBJ A;  3MZF A;  4CLC A;  1WYC A;  4Y0O A;  5F69 A;  4DJ3 A;  3WS5 A;  4ZJ1 A;  3CWF A;  3RXX A;  4EXO A;  1VET B;  3AGF A;  2WGW B;  4X1M A;  3C4P A;  4S2N A;  1XFN A;  4FCF A;  3HCY A;  1XJ3 A;  5I5L A;  5HFO A;  4DE1 A;  4X6T A;  3HRE A;  3C4O A;  4KZ4 A;  2W0N A;  4O01 A;  3KYQ A;  2IA2 A;  3E98 A;  4FUW A;  2WGW A;  4JF6 A;  5A90 A;  1BLC A;  3W2Z A;  1YLW A;  4O8G A;  2QPN A;  5G4Y A;  4JKT A;  4WYY A;  5TFQ A;  1KVL A;  1NJ4 A;  4HJ4 A;  4E3J A;  2XEP A;  4K0X A;  3UB7 A;  4E3O A;  3QNB A;  3UMD A;  2P04 A;  3N8S A;  4OOY A;  2P08 A;  3B42 A;  5FQJ A;  4E3L A;  1JTG A;  3P01 A;  2M1C A;  2PR6 A;  4OQH A;  4ZRR A;  3RTY A;  4BEN A;  3IQA A;  3SS3 A;  1N9N A;  4X56 A;  1ZC2 A;  5TBM B;  2FZ0 A;  4KQO A;  4WBG A;  5HD3 A;  2E8J A;  3GSG A;  3IBR A;  3MQO A;  1MKM A;  4R3B A;  5HAI A;  4R3A A;  3JVV A;  1XPB A;  4EQ1 A;  2Y8H A;  5KZH A;  4OQG A;  3MR0 A;  2OOL A;  4R4R A;  4A5R A;  3BFD A;  4H8R A;  1HTZ A;  3IX3 A;  3LR4 A;  2EWV A;  3NOT C;  5FEF A;  1BUL A;  2D02 A;  4HJ6 A;  3O3V A;  4ZJ2 A;  3IWI A;  4R23 A;  4P87 A;  2HDR A;  3PBT A;  3W4O A;  5HSQ A;  3UDX A;  3LIB A;  4E3K A;  4DDY A;  4YNR A;  4BD1 A;  5HWV A;  5E43 A;  3C7V A;  4FOF A;  3KYE A;  4LPZ A;  2FFY A;  3GV9 A;  3OPH A;  1GSX A;  3Q7V A;  4G3K A;  2XGN A;  2Y2I A;  1VB6 A;  4U0X A;  1K6R A;  3RXW A;  3O86 A;  4K91 A;  3FKV A;  4Z1W A;  5TR7 A;  3M6H A;  3PBR A;  3QP5 A;  1MKI A;  1T19 A;  2Y2O A;  5F5Y A;  4RA7 A;  3VV4 A;  3T4O A;  3Q82 A;  1YT4 A;  4OP5 A;  5GL9 A;  4PKY A;  2HDS A;  1AWI A;  1L0F A;  3LIA A;  2DMW A;  3ZVW A;  3SH7 A;  1N4O A;  1S6R A;  5IHV A;  2OWJ A;  3O5Y A;  5L07 A;  5HAQ A;  3BY9 A;  5HDC A;  1L0G A;  2W1R A;  2QKP A;  3L9K A;  1G6A A;  1TS7 A;  3UB8 A;  1DJC A;  3QHY A;  5GLD A;  2JCH A;  2HZ5 A;  1T1A A;  1TD5 A;  2JBF A;  5AQ9 A;  3CPT A;  3M6B A;  1PZO A;  2G2W A;  5CHM A;  4RX3 A;  1BSG A;  3E4Q A; 
#chains in the Genus database with same CATH homology
 3EQV A;  2ZBB A;  3TRC A;  1XJ6 A;  4HP4 A;  3UB6 A;  3MJQ A;  4EER A;  1ZHH B;  4GS9 B;  4XT2 A;  5KIZ A;  1S67 L;  4PAU A;  3MQ0 A;  2A24 A;  4Y2F A;  1V9Z A;  3U2A A;  4F3L B;  4B9O A;  2HF6 A;  4PKY G;  2XSS A;  5IS1 A;  3S7O A;  3BY8 A;  2VV6 A;  4IUK A;  2W1T A;  1MZU A;  2V0U A;  2OAQ 1;  4WEK A;  2PT7 A;  3LI9 A;  4HNB A;  4I3I A;  4Q0H A;  5DJT A;  2V9A A;  2VEA A;  4HH2 A;  2PDR A;  2BAS A;  2GNX A;  3D3O A;  4I39 A;  5TBM A;  4CLC B;  3A0S A;  1YSQ A;  1F9I A;  2KOI A;  4FSF A;  5J3W A;  3KSI A;  4L9F A;  1NLY A;  3KYZ A;  5J7E A;  4GS9 A;  1LSX A;  3TW8 A;  1X0O A;  4G3V A;  1OT6 A;  4F3L A;  3GEC A;  3VE4 A;  3GDI A;  4YOF A;  2J80 A;  4NXB A;  2QYB A;  2WKR A;  3B47 A;  3K3C A;  2Y79 A;  4R6L A;  2QHK A;  4I38 A;  4L9G A;  4ARZ B;  3UME A;  2GZA A;  4JGR A;  3G6O A;  3NOP C;  2JKR M;  1YSP A;  3CI6 A;  2W27 A;  3PYP A;  1F5M A;  4IUH A;  2VLG A;  3V67 A;  4B93 A;  4E04 A;  5HWW A;  2PHY A;  2JHE A;  3BQ8 A;  4DJ2 A;  5K5B A;  4Q0J A;  2OAP 1;  4O0P A;  1ODV A;  3F1O B;  1WA9 A;  2HJ9 C;  2PYR A;  3MF0 A;  3ZYT A;  3UE3 A;  4LRY C;  1OTB A;  3HJK A;  2O9C A;  4WN5 A;  4I3J A;  1YAX A;  1NLZ A;  3BW6 A;  3F1N B;  4EEU A;  3E0Y A;  3EGD C;  1LL8 A;  4IJG A;  3MXQ A;  4KUO A;  4ETX A;  2W3D A;  3PBO A;  3T4Q A;  1JNU A;  2L4R A;  2Z6D A;  2G7U A;  4HJ3 A;  1ZTU A;  4HHD A;  1LSV A;  2XRN A;  5DFY A;  3H9W A;  5HL6 A;  1YKD A;  3C38 A;  3C2W A;  2GJ3 A;  3CLO A;  5AVF A;  3T4S A;  3H82 B;  3F1P A;  2V1A A;  4R70 A;  3EEH A;  1OT9 A;  5C5K A;  4EUV A;  1KOU A;  2XRO A;  1UGU A;  5J4E A;  2HV1 A;  4DMZ A;  4EU0 A;  1N9O A;  2VV7 A;  2L0W A;  1W63 Q;  4LRX C;  4II7 A;  4WLA A;  2VA0 A;  1DP9 A;  3ICY A;  2PD7 A;  1OTI A;  2B02 A;  1TS0 A;  3P7N A;  2YKH A;  5HDD A;  4QPR A;  4P6Z S;  2O9A A;  1OJG A;  3NHQ A;  3NJA A;  2M7U A;  4HH3 A;  3LR5 A;  1G28 A;  4I5S A;  3PBN A;  3TJZ C;  2NUP C;  4MN6 A;  1XJ4 A;  3T4J A;  2NUT C;  2YKF A;  4H6J B;  4KUK A;  5DF9 A;  3T50 A;  3R7W B;  1S4S A;  2W3G A;  3SW1 A;  5F68 A;  4HOI A;  2I9V A;  2PD8 A;  5DJU A;  2INW A;  4HQA A;  1OTD A;  4BBU A;  3CAX A;  5HZH A;  1LT0 A;  4OOL A;  3ULF A;  4RQ9 A;  2H28 A;  2KDK A;  2KLI A;  1BYW A;  2QJ5 A;  3BJN A;  4I3A A;  4M4X A;  2VGL M;  3UB9 A;  3K3D A;  3KSG A;  3CIT A;  2D01 A;  3LIE A;  5LBR A;  2CMN A;  2K2N A;  1DP8 A;  5HPF A;  4H6J A;  3T4K A;  4GHI A;  1IOU A;  3MFX A;  3DBA A;  2EA9 A;  1DRM A;  2J3T C;  5AJG A;  4HIA A;  4UQI M;  2V0W A;  3A0V A;  3R7W A;  1H3Q A;  2W3E A;  2ZOH A;  3UE6 A;  3FPW A;  3T4T A;  3VE3 A;  2J3T D;  4Q0I A;  1S1Z A;  1D06 A;  3OBF A;  3LYX A;  3RH8 B;  2VX8 A;  4GLQ A;  2P7J A;  3EOI A;  4YWZ A;  4EW7 A;  4CQH A;  5DKL A;  5CX7 A;  3MQQ A;  3IBJ A;  2VKS A;  3LIF A;  1Y28 A;  3OLO A;  4GW9 A;  4CLC A;  4ME4 A;  1F98 A;  3S7P A;  5F69 A;  1OTE A;  2ZMV A;  4DJ3 A;  3CWF A;  3S7Q A;  4WF0 A;  4NXF A;  2K7S A;  3S7N A;  4EXO A;  1N9L A;  3EWK A;  3KSF A;  1W63 M;  3OCN A;  1IFQ A;  4ARZ A;  1P9W A;  5IT5 A;  1XFN A;  4LRZ E;  1S4R A;  3OCL A;  3HCY A;  4DN0 A;  1XJ3 A;  5I5L A;  3A0R A;  4R38 A;  4WL9 A;  4GCZ A;  4CLC D;  3FC7 A;  2WKQ A;  1OPX A;  4EES A;  2V1B A;  5HPI A;  3EEA A;  3KO6 A;  4G3W A;  2JKT I;  2W0N A;  4O01 A;  5DFX A;  3KYQ A;  2XA7 M;  4MN7 A;  2IA2 A;  3FPV A;  3E98 A;  2Z6C A;  5TJJ A;  3W2Z A;  1GSW A;  5HD5 A;  1S66 L;  4O8G A;  3F1O A;  3H7W B;  3KSH A;  1XJ2 A;  5G4Y A;  3LID A;  1STZ A;  2GX5 A;  4PHT A;  1MC0 A;  4HJ4 A;  3F1N A;  4BBT A;  4NXG A;  3LR3 A;  4WEL A;  4IHQ A;  3BWL A;  3UB7 A;  1LSW A;  3B33 A;  1T1C A;  1UWN X;  3CUE A;  2EWW A;  3UMD A;  4Y5F A;  4NXE A;  2P04 A;  4EEP A;  2P08 A;  5EFW A;  3C8C A;  2QJ7 A;  3B42 A;  3H82 A;  3H7W A;  3P01 A;  4CLC E;  4MDZ A;  3IS2 B;  2HGV A;  2M1C A;  2PR6 A;  3K2N A;  4ZRR A;  3RTY A;  4P6Z M;  2VGL S;  1N9N A;  4GJ4 A;  3C30 A;  1OTA A;  5TBM B;  5HDS A;  4BWI A;  1NRJ A;  5MC7 A;  1P0Z A;  2FZ0 A;  4KQO A;  5HD3 A;  4EET B;  3IBR A;  4UQI S;  2MJ6 A;  3MQO A;  2HJE A;  1MKM A;  5DKK A;  2VZW A;  3RFB A;  4WEJ A;  1UWP X;  4R3A A;  2R78 A;  3IS2 A;  1G6O A;  3JVV A;  2KX6 A;  4EQ1 A;  2Y8H A;  3MR0 A;  5F6A A;  4NKP A;  3T4L A;  1T1B A;  2FH5 A;  3EQU A;  2O0Y A;  4KQD A;  2PR5 A;  2OOL A;  3LR0 A;  5IU1 A;  3PBS A;  3LUQ A;  1H8M A;  4JGQ A;  2J3W A;  3E4O A;  2B18 A;  3R4K A;  3LR4 A;  2WKP A;  4JGP A;  3PBQ A;  3E4P A;  2EWV A;  2LB9 A;  3FG8 A;  3NOT C;  1GSV A;  3EGX C;  1EW0 A;  2ZOI A;  5A8B A;  4ETZ A;  2W3F A;  2D02 A;  1S1Y A;  4HJ6 A;  5KSH A;  4Y3I A;  1P97 A;  3PBT A;  2PYP A;  5HSQ A;  3LIB A;  1P9R A;  4YNR A;  3OC2 A;  5HWV A;  3LI8 A;  4CLC C;  3LIC A;  4LLO B;  4BMW A;  2JKT M;  1DP6 A;  5L8M A;  4FOF A;  3PXP A;  4LPZ A;  4WUJ A;  3OOV A;  5G4Z A;  1GSX A;  4MCW A;  3NOU C;  4G3K A;  2VJW A;  4AFI A;  1VB6 A;  1XFQ A;  3VOL A;  2W3H A;  2LB5 A;  5HWT A;  2JKR I;  3BQA A;  4Z1W A;  2XA7 S;  2M7V A;  1D7E A;  3F1P B;  3PBR A;  1T19 A;  5F5Y A;  2VV8 A;  3VV4 A;  3T4O A;  2L1M A;  4JGO A;  3KX0 X;  4OOM A;  1VHM A;  2O9B A;  4BJP A;  2OWH A;  3JVU A;  4PKY A;  1TF1 A;  2QWS A;  3ZQ5 A;  1TS6 A;  4UEY A;  3LFV A;  2DMW A;  3LIA A;  4BBV A;  4NEE D;  2O99 A;  4L0L A;  2OWJ A;  3O5Y A;  3MMH A;  4MMN A;  3BY9 A;  5HDC A;  2W1R A;  2QKP A;  2ZMF A;  5FL3 A;  1TS7 A;  3UB8 A;  3D72 A;  1OJ5 A;  1TS8 A;  2JN7 A;  4XT2 B;  4HP9 A;  2A24 B;  1V9Y A;  4L9E A;  1NWZ A;  3PR6 A;  3HJI A;  2K31 A;  2W1T B;  4HY8 A;  1T1A A;  1TD5 A;  2A2L A;  4MN5 A;  1T18 A;  3TE8 A;  3CUE C;  4K08 A;  5AVE A;  4GHI B;  3PHY A;  4HI4 A;  3E4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...