4UEZA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-leu-phe-y(po2ch2)-phe-oh
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords HUMAN CARBOXYPEPTIDASE A1
total genus 114
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uezA00
3NH5A 3N5FA 4NFRA 4UEZA 3B2YA 1VHOA 2BOAA 2ZEOA 1YSJA 4YWYA 3PB6X 4MHNA 4NGQA 1FT7A 3FH4A 4OC1A 2XEFA 1ZLIA 2DEAA 4KSIA 3TC8A 5DS0A 2JEWA 3QNVA 2XEGA 3IEHA 3PBBA 2AFXA 5HXDA 3FEDA 5THWA 2C1CA 4FBEA 3SJXA 1AMPA 3NA6A 2PE3A 3SI0A 5LYDA 1TKHA 2CTBA 5HVHA 4UEFA 3FJUA 1TXRA 2AFZA 3BXMA 3DLJA 3CPXA 3VH9A 3KGQA 3WC6A 3NH8A 2IMOA 4ZX8A 2ZEDA 2C6PA 3GUXA 3PBEA 2PJBA 1BPMA 3V7ZA 4O23A 3SI1A 4NGTA 2C6CA 3B3TA 4NJQA 1CP7A 1FNOA 2CTCA 2I3CA 4GM5A 4OC5A 3BHXA 1TKFA 3FVLA 3SJFA 3HLPA 3KQZA 3H8EA 3L2NA 2AFWA 4P4FA 1CP6A 5IB9A 1TKJA 1PCAA 3PFEA 4MXUA 3MN8A 4R8FA 5K8PA 1CBXA 2F7VA 1CPSA 4OIWA 2NSMA 2J9AA 3KZWA 5ELYA 1F57A 4A37A 3B35A 3RZAA 3KHXA 4EFDA 1CPXA 3CT9A 4A94A 3ISZA 3S9NA 3RAMA 1YW4A 2PJ1A 3S9MA 1Z2LA 3D4UA 2PIZA 1ELLP 2ZEGA 1YLOA 2JBKA 4MMOA 4B6ZA 2GLJA 3IO1A 3PB4X 3RBUA 4NGSA 2ZENA 2ZEMA 1F2OA 5HVGA 1F2PA 2EK9A 4F9UA 3FECA 5HVFA 2QVPA 4FAIA 5LYLA 3NH4A 4NGNA 1Y0RA 7CPAA 4R6TA 4AXVA 1LOKA 1XJOA 3PEIA 4IK2A 3B3CA 2PJ5A 2PJAA 2ZEPA 1HDUA 3D67A 3TX8A 1Z8LA 3FX6A 3FMCA 3VARA 1CG2A 1AYEA 1LCPA 4RUHA 2G9DA 1R43A 3NFZA 4PQAA 4PPZA 4WJBA 3KR5A 4NGRA 4P4DA 1LANA 4P4IA 4YU9A 2XEIA 5I4MA 4PXDA 4A39A 1IGBA 2ZEFA 4CPAA 2PVVA 2BO9A 4ZX9A 1R3NA 4F9VA 1GYTA 1OBRA 3FF3A 4FUUA 5D8NA 4NGMA 5CPAA 4Z65A 2OOTA 5K8NA 2AFOA 2XEJA 6CPAA 3ISXA 2V77A 4PXEA 4DUKA 2ZOGA 4H2KA 2PJ8A 4ZI6A 4OC4A 2PJ3A 5LRKA 4OP4A 1IY7A 2RFHA 2ABZA 4DYOA 2PJ9A 3D7GA 4P4EA 4X8IA 1JQGA 4Q7AA 4R7MA 2POKA 4TWEA 2Q51A 3LMSA 2PJ6A 3B3WA 1VIXA 2HC9A 5LRGA 2PJ0A 2O53A 2FVGA 1VGYA 1ARLA 4UIAA 4ONWA 1M4LA 4IAVA 3KL9A 3VATA 8CPAA 1Y0YA 3IC1A 3IJ3A 4LQGA 3FEEA 2QYVA 5K8OA 4OIDA 2WZNA 2AFUA 3CPAA 2PRQA 1QMUA 1ZG8A 4PXBA 3PRTA 3S9LA 3JRUA 4OC3A 1H8LA 1Z5RA 3PB8X 5LRJA 1HEEA 5CBMA 1VHEA 2PJCA 2C6GA 3D66A 4ZYQA 2PJ7A 2V8DA 4BD9A 1PYTB 3KQXA 3MRUA 4OMEA 3KHZA 1BLLE 2GU2A 3D7DA 4ZY0A 4FWUA 1Y7EA 5JGFA 3T8WA 3PB9X 1NSAA 4OC0A 3KR4A 2NYQA 2F8HA 3B3VA 2GREA 4NGPA 5JM6A 1RTQA 2PCUA 3DGVA 2EK8A 2AFMA 2WYRA 1BPNA 3PFOA 4MHYA 2V8HA 1ZG7A 1KWMA 1XRYA 5JH9A 5LYFA 2OR4A 1XBUA 4P44A 5K8MA 3SJGA 3BI0A 1XFOA 3WC7A 4P6YA 3I1UA 4UIBA 3B3SA 4W9YA 3WABA 1ARMA 2PIYA 4WWVA 2Q43A 2PJ2A 4MHPA 2CIJA 2O4HA 4MCQA 2VL1A 2ANPA 2Q4ZA 2RB7A 4UEEA 3K2KA 5F09A 4IHMA 3B7IA 4NJRA 4X3RA 1YW6A 4JYWA 2ZEEA 4UF4A 3D7HA 1ELMP 1DE4C 2ZELA 2ZEHA 3WC5A 4MCPA 1HDQA 1TF8A 4TNUA 3SI2A 4F8ZA 3WT4A 1TF9A 1UWYA 3HUVA 4X2TA 3D68A 5D29A 1LAPA 4G1PA 1ZLHA 4MCSA 1Q7LA 1XMBA 4MCRA 4ZY2A 4MRIA 2AFSA 2ZOFA 5LYIA 3IFEA 2QJ8A 1BAVA 1QQ9A 4R76A 3BI1A 2IJZA 3SJEA 4DJLA 2GLFA 1EE3P 3KASA 3H8GA 4P45A 3GB0A 3V38A 2V8VA 2IQ6A 2EWBA 3D7FA 4OKOA 4OC2A 3LWUA 2HB6A 4EMEA 1ZG9A 1CX8A 2PJ4A 3IIBA 2V8GA 3GLJA 4P4BA 3CDXA 2BCOA 2CF4A 4P10A 4ZY1A 3IWWA 3H8FA 4P4JA 2PVWA 1DTDA 5J1QA 4K3NA 3K9TA 4A38A 1YMEA 4MHZA 3PB7X 4EWTA 4JZ0A 3KI9A 4PXCA 1LAMA 1LFWA 2JBJA
chains in the Genus database with same CATH superfamily
2Z0ZA 3NH5A 1WWZA 4UFXA 3N5FA 4XPLA 4CAXA 4JXRA 2CY2A 2ZW6A 4NFRA 2EVNA 4U9ZA 2H5MA 4UEZA 4JXQA 5IX3A 4XPKA 3B2YA 1VHOA 1VHSA 2BOAA 2ZEOA 1YSJA 4YWYA 2C27A 2K5TA 3PB6X 4MHNA 4NGQA 1XE4A 3RNZA 1U6MA 1FT7A 4A30A 3FH4A 4HNXB 4OC1A 1Y9WA 2XEFA 1ZLIA 2DEAA 4KSIA 3TC8A 5DS0A 2JEWA 3FYNA 3QNVA 2XEGA 3IEHA 3PBBA 2AFXA 1M4GA 3GKRA 5HXDA 3FEDA 4PSXA 5THWA 2C1CA 5GCNA 4CYOA 2BUEA 4FBEA 1B6BA 3CXQA 4GS4A 2FIWA 3SJXA 1AMPA 2BEIA 3P2HA 1M1DA 3NA6A 4MFLA 2PE3A 3PZJA 1XF8A 5HH1A 3IU2A 2DXQA 3SI0A 1QSOA 1XMTA 5LYDA 1TKHA 4CAWA 1S60A 1JWQA 2CTBA 4M85A 4Y49B 4I49A 4IUSA 2OU2A 4UBRA 4EVYA 3NE7A 3I3GA 5HVHA 4UEFA 4HKFA 5EMIA 4U9YA 3D2PA 3F5BA 3FJUA 4JLYA 1TXRA 1MK4A 2AFZA 2PC1A 2RC4A 3W6SA 2GE3A 4NEXA 3BXMA 2B3VA 3DLJA 3CPXA 4KOTA 3VH9A 3KGQA 5A28A 3WC6A 5DWMA 1PUAA 2IMOA 2EBJA 2WPWA 2Z11A 3NH8A 1RO5A 2ZW4A 3JTKA 3VWDA 5KTAA 3F0AA 2VXKA 3EY5A 5EC4A 4KS9A 4H6ZA 4ZX8A 1Q2YA 1NE9A 2C6PA 2ZEDA 3GUXA 4C2ZA 3PBEA 2PJBA 3EFAA 4KOWA 2JDCA 3R9EA 1BPMA 4C2YA 3V7ZA 1KUYA 2IL4A 3GYAA 4O23A 3SI1A 2FCKA 4E8OA 5JPHA 4NGTA 2C6CA 3B3TA 2B4BA 4NJQA 4MY3A 1CP7A 1FNOA 1P0HA 5C82A 2YNEA 2PR1A 2R98A 2CTCA 2REEA 2I3CA 1J4JA 4AG7A 4GM5A 2B5GB 4OC5A 3BHXA 1TKFA 4PSWA 4KOXA 1FY7A 1S7LA 2WSAA 3FVLA 4FD5A 4F0XA 3P2FA 4QC6A 3SJFA 3TOAA 3HLPA 3I9SA 3KQZA 2F5IA 3H8EA 1YLEA 3L2NA 4A32A 5F49A 1MJBA 3LACA 3TE4A 1Z8TA 2AFWA 4DNCA 2OZGA 1Z4RA 4P4FA 4XNHB 1CP6A 4U5YA 5IB9A 4IF5A 1TKJA 3IU1A 1PCAA 3PFEA 4MXUA 5E96A 5J8CA 3MN8A 4R8FA 3RYOA 3SXOA 5K8PA 1CBXA 2F7VA 1CPSA 1IYLA 2Z10A 2JDDA 4M6IA 4OIWA 4Q38A 2Z3LA 2NSMA 2J9AA 1YQEA 4F8ZA 4XNHC 3KZWA 5G22A 4MFQA 2BL1A 2B58A 4CRZB 1PU9A 5ELYA 4KOVA 1F57A 4C2XA 4A37A 1SQHA 3B35A 3RZAA 2HQYA 2Z3PA 3KHXA 4EFDA 1XEBA 2ODFA 1CPXA 2GIVA 3CT9A 4A94A 3ISZA 1YR0A 3IGRA 3S9NA 4CAEA 2KCWA 3RAMA 1YW4A 2PJ1A 4HPSA 1IICA 3S9MA 1Z2LA 5G21A 3D4UA 2JLMA 4KOUA 2PIZA 4KVXA 1ELLP 2ZEGA 2X7BA 1YLOA 4KUAA 5CNPA 4CYPA 2JBKA 4MMOA 4QVTA 1Q2DA 3D2MA 1RXTA 3TTHA 1Z9UA 4B6ZA 2GLJA 3WR7A 1X10A 3IO1A 3W6XA 2CNSA 3PB4X 4CGLA 4X5KA 3RBUA 2Q0YA 4KOSA 1YX0A 2P6GA 1KZFA 2ZEMA 2ZENA 1F2OA 1Y7RA 4LUAA 4NGSA 2HUZA 4OAEA 1K4JA 5HVGA 2DPSA 2GFQA 1I12A 1F2PA 2EK9A 4C7IA 4F9UA 3FECA 5HVFA 2QVPA 4FAIA 5LYLA 1IOIA 1QSTA 3NE8A 4ZBGA 4A31A 4CS0B 3NH4A 4NGNA 5A27A 4C7HA 4CGPA 5G20A 4CGNA 2PR8A 4UCNA 4Q36A 1Y0RA 7CPAA 4R6TA 4E0AA 4AXVA 3OWCA 4B11A 1LOKA 4ORFA 3S6FA 5KTCA 1XJOA 4PK3A 2Z3OA 3PEIA 4IK2A 3IWEA 3B3CA 4B14A 2FL4A 3B8GA 3QB8A 2PJ5A 1B87A 2PJAA 2ZEPA 4HNYB 4XPDC 4CYNA 2O28A 3H4QA 4Y49C 1HDUA 5EBVA 1YVKA 5C88A 3D67A 2Q04A 2YNCC 4BINA 2ZW7A 3TX8A 4JWPA 4MI4A 1Z8LA 3FX6A 1YVOA 3FMCA 3VARA 1CG2A 2YGWA 3SHPA 4JD6A 1AYEA 1Z8WA 1LCPA 4RUHA 2YNDA 2G9DA 1R43A 1S7FA 3E0KA 3NFZA 4KLVA 4PPZA 4PQAA 4WJBA 3KR5A 4ONUA 2VZZA 2D4PA 4NGRA 4P4DA 1S7NA 1LANA 2I79A 4P4IA 3QAYA 4F6AA 1P4NA 2CXAA 4M6GA 4YU9A 3EXNA 2OH1A 2XEIA 2ZPAA 3JVNA 4PXDA 3G3SA 4CAVA 4KORA 1L0CA 5I4MA 4JJXA 4A39A 1IGBA 3LD2A 3PGPA 2ZEFA 4CPAA 2PVVA 3SXNA 5BWAB 2BO9A 4ZX9A 1R3NA 3BLNA 3QAHA 4CGMA 4F9VA 5F46A 2EUIA 1GYTA 1IU8A 1XIXA 1OBRA 3FF3A 4MJ8A 4FUUA 5D8NA 4NGMA 5CPAA 2WUUA 3BJ7A 2A4NA 4Z65A 2OOTA 5K8NA 5H84A 4FD7A 2AFOA 2XEJA 3DNSA 4XPDB 6CPAA 3DSBA 3ISXA 4AVAA 3PP9A 2V77A 2Y0MA 3F8KA 3N7ZA 4PXEA 2ZOGA 5AG5A 4DUKA 3DR6A 2PJ8A 4H2KA 4ZI6A 4OC4A 2PJ3A 2ARHA 1WK4A 5LRKA 4OP4A 1IY7A 4BBHA 2RFHA 1M4DA 1YREA 2ABZA 4DYOA 2PJ9A 3D7GA 4P4EA 4X8IA 1JQGA 4Q7AA 4R7MA 5AG6A 2PQ8A 1V0CA 3G8WA 2P0WA 4B13A 4F0YA 2FXFA 2POKA 4TWEA 4LQ6A 4RS2A 2Q51A 3DDDA 3LMSA 3JUWA 1NMTA 2PJ6A 4KVME 3B3WA 1VIXA 2HC9A 5LRGA 2PJ0A 2O53A 2FVGA 2VEZA 1MJAA 2GANA 1VGYA 2I00A 3R1KA 1ARLA 4R57A 4UIAA 4ONWA 4LX9A 1M4LA 4IAVA 5AG7A 4BMHA 2J8MA 2OZHA 3KL9A 5IB0A 3VATA 8CPAA 1QSNA 1Y0YA 3IC1A 3IJ3A 1UFHA 4CAFA 4LQGA 2G3AA 3FEEA 2QYVA 5K8OA 4B12A 2DPTA 4KOYA 1QSRA 4OIDA 4B5PB 4ZGYB 2FSRA 2WZNA 2AFUA 1N71A 1BOBA 4UWIA 3CXSA 3CPAA 4MBUA 2PRQA 1QMUA 4HNWB 3C26A 1ZG8A 4PXBA 3PRTA 3ZZIA 2VZYA 4UCMA 1ZO0A 2ZXVA 3S9LA 2AE6A 3MGDA 3JRUA 5FVJA 4OC3A 1H8LA 1Q2CA 1I21A 4KVOE 3R9GA 1MJ9A 1Z5RA 2QMLA 3PB8X 4YGOA 5LRJA 2QIRA 1HEEA 4UCPA 2FE7A 5CBMA 1KUVA 4QBJA 4UWJA 1CM0A 5F47A 1VHEA 2PJCA 4B5PA 3FRMA 4C68A 2C6GA 3TCVA 4YRHA 1QSMA 1S7KA 2B4DB 5F48A 1NSLA 4AB7A 2QECA 2R7HA 3D66A 5HMNA 4ZYQA 4PK2A 5I0CA 2G0BA 2PJ7A 2V8DA 4NXYA 4BD9A 1PYTB 2PDOA 3KQXA 4M6HA 3MRUA 4QUSA 4QB9A 4OMEA 2VBQA 5IV0A 2OB0A 2REFA 3KHZA 1BLLE 2GU2A 3D7DA 4ZY0A 4KLWA 4FWUA 1Y7EA 3VWEA 5JGFA 1IB1E 3CZXA 4NF1A 3T8WA 2Q7SA 4R87A 2ATRA 2Z3KA 3PB9X 2CNTA 2FT0A 1NSAA 2R1IA 3EO4A 4OC0A 2NMTA 1X12A 4FD6A 3KR4A 2NYQA 3H5ZA 2F8HA 3B3VA 2GREA 2Q44A 3FXTA 4NGPA 1RTQA 5JM6A 4UFVA 2PCUA 1YGHA 3DR8A 2P6EA 2J8RA 4OLLA 2PRBA 3DGVA 4KSAA 2EK8A 2AFMA 2WYRA 2EO8A 4NCZA 1BPNA 3PFOA 4B5OA 4UA3A 4MHYA 1ON0A 2J8NA 2PSWA 4K30A 4MFJA 2V8HA 2YNCA 3RO0A 1ZG7A 2VI7A 1KWMA 1M44A 1XRYA 5JH9A 5LYFA 3K9UA 4J3GA 2OR4A 5ISVA 1XBUA 4AVBA 4P44A 5K8MA 3LODA 1R57A 3SJGA 2AJ6A 3BI0A 1XFOA 3D3SA 3WC7A 4P6YA 3I1UA 1LRZA 4UIBA 1OZPA 3B3SA 4A95A 4W9YA 1A2ZA 3WABA 4YFJA 1ARMA 2PIYA 1IYKA 3R95A 3KKWA 4WWVA 4UFWA 2Q43A 2G3TA 2PJ2A 3T9YA 4MHPA 2CIJA 2Z3MA 3FNCA 1XOVA 2O4HA 4MCQA 2FIAA 2VL1A 2R8VA 3TO7A 4AVCA 4CYQA 2ANPA 2Q4ZA 2RB7A 4GXHA 4UEEA 3K2KA 4KUBA 5F09A 4NSQA 4IHMA 4H6UA 4MHDA 5DWNA 3UY5A 3B7IA 4NJRA 4X3RA 4R3LA 1YW6A 3TT2A 4JYWA 2Q4VA 2ZEEA 1Z8XA 1BO4A 2OZUA 4UF4A 3D7HA 1IIDA 1ELMP 1DE4C 2DF5A 3GIUA 3TFYA 1TIQA 2ZELA 5J8FA 2ZEHA 4CRYB 3WC5A 4MCPA 1HDQA 1TF8A 4MY0A 4TNUA 2Q7BA 3SI2A 3WT4A 1TF9A 1UWYA 2B3UA 4L8AA 4MFPA 5G1ZA 3HUVA 4X2TA 3D68A 5D29A 1LAPA 4G1PA 1ZLHA 1Z4EA 4MCSA 3GY9A 1Q7LA 1IOFA 1XMBA 2ZW5A 4MFZA 4MCRA 4ZY2A 2HV2A 5AG4A 4MRIA 1CJWA 2AFSA 2ZOFA 5LYIA 3ZJ0A 3IFEA 2QJ8A 1BAVA 1QQ9A 3BJ8A 4R76A 2B4DA 3BI1A 5AGEA 2IJZA 1AUGA 1M4IA 3SJEA 3A9LA 1I1DA 4DJLA 4H89A 2GLFA 1EE3P 2JEVA 4AG9A 3KASA 3H8GA 2WPXA 4P45A 3GB0A 3R9FA 3S6KA 3S6GA 3TOBA 4RI1A 3R96A 3V38A 3CXPA 4CGOA 4OADA 3W91A 4R9MA 5JQ4A 2V8VA 2IQ6A 2EWBA 3D7FA 4OKOA 3LWUA 4OC2A 4B10A 2HB6A 4EMEA 1ZG9A 1CX8A 2PJ4A 3IIBA 2V8GA 1Y9KA 3IWGA 2P6FA 2B5GA 2VQYA 3FIXA 3GLJA 3S6HA 4P4BA 3CDXA 5H86A 5KTDA 1KUXA 4PV6A 2BCOA 4KSFA 2CF4A 4P10A 1S3ZA 4M3SA 4ZY1A 4MFKA 4II9A 1GHEA 3IWWA 2Z3NA 1YK3A 2CNMA 3H8FA 1S5KA 2Q4YA 4P4JA 2PVWA 1DTDA 4A2ZA 4E2AA 5J1QA 4K3NA 2BSWA 2D4OA 4FD4A 3K9TA 3V8IA 3FBUA 4A38A 1YMEA 1VKCA 4RN7A 3T90A 2FS5A 4MHZA 3FB3A 3TO6A 3EC4A 3PB7X 4KZTA 3KI9A 4JZ0A 3TO9A 1LAMA 4PXCA 4EWTA 1LFWA 4A33A 3D8PA 4R3KA 4L89A 2JBJA
chains in the Genus database with same CATH topology
3NH5A 3N5FA 4NFRA 4UEZA 3B2YA 1VHOA 2BOAA 2ZEOA 1YSJA 4YWYA 3PB6X 4MHNA 4NGQA 1FT7A 3FH4A 4OC1A 2XEFA 1ZLIA 2DEAA 4KSIA 3TC8A 5DS0A 2JEWA 3QNVA 2XEGA 3IEHA 3PBBA 2AFXA 5HXDA 3FEDA 5THWA 2C1CA 4FBEA 3SJXA 1AMPA 3NA6A 2PE3A 3SI0A 5LYDA 1TKHA 2CTBA 5HVHA 4UEFA 3FJUA 1TXRA 2AFZA 3BXMA 3DLJA 3CPXA 3VH9A 3KGQA 3WC6A 3NH8A 2IMOA 4ZX8A 2ZEDA 2C6PA 3GUXA 3PBEA 2PJBA 1BPMA 3V7ZA 4O23A 3SI1A 4NGTA 2C6CA 3B3TA 4NJQA 1CP7A 1FNOA 2CTCA 2I3CA 4GM5A 4OC5A 3BHXA 1TKFA 3FVLA 3SJFA 3HLPA 3KQZA 3H8EA 3L2NA 2AFWA 4P4FA 1CP6A 5IB9A 1TKJA 1PCAA 3PFEA 4MXUA 3MN8A 4R8FA 5K8PA 1CBXA 2F7VA 1CPSA 4OIWA 2NSMA 2J9AA 3KZWA 5ELYA 1F57A 4A37A 3B35A 3RZAA 3KHXA 4EFDA 1CPXA 3CT9A 4A94A 3ISZA 3S9NA 3RAMA 1YW4A 2PJ1A 3S9MA 1Z2LA 3D4UA 2PIZA 1ELLP 2ZEGA 1YLOA 2JBKA 4MMOA 4B6ZA 2GLJA 3IO1A 3PB4X 3RBUA 4NGSA 2ZENA 2ZEMA 1F2OA 5HVGA 1F2PA 2EK9A 4F9UA 3FECA 5HVFA 2QVPA 4FAIA 5LYLA 3NH4A 4NGNA 1Y0RA 7CPAA 4R6TA 4AXVA 1LOKA 1XJOA 3PEIA 4IK2A 3B3CA 2PJ5A 2PJAA 2ZEPA 1HDUA 3D67A 3TX8A 1Z8LA 3FX6A 3FMCA 3VARA 1CG2A 1AYEA 1LCPA 4RUHA 2G9DA 1R43A 3NFZA 4PQAA 4PPZA 4WJBA 3KR5A 4NGRA 4P4DA 1LANA 4P4IA 4YU9A 2XEIA 5I4MA 4PXDA 4A39A 1IGBA 2ZEFA 4CPAA 2PVVA 2BO9A 4ZX9A 1R3NA 4F9VA 1GYTA 1OBRA 3FF3A 4FUUA 5D8NA 4NGMA 5CPAA 4Z65A 2OOTA 5K8NA 2AFOA 2XEJA 6CPAA 3ISXA 2V77A 4PXEA 4DUKA 2ZOGA 4H2KA 2PJ8A 4ZI6A 4OC4A 2PJ3A 5LRKA 4OP4A 1IY7A 2RFHA 2ABZA 4DYOA 2PJ9A 3D7GA 4P4EA 4X8IA 1JQGA 4Q7AA 4R7MA 2POKA 4TWEA 2Q51A 3LMSA 2PJ6A 3B3WA 1VIXA 2HC9A 5LRGA 2PJ0A 2O53A 2FVGA 1VGYA 1ARLA 4UIAA 4ONWA 1M4LA 4IAVA 3KL9A 3VATA 8CPAA 1Y0YA 3IC1A 3IJ3A 4LQGA 3FEEA 2QYVA 5K8OA 4OIDA 2WZNA 2AFUA 3CPAA 2PRQA 1QMUA 1ZG8A 4PXBA 3PRTA 3S9LA 3JRUA 4OC3A 1H8LA 1Z5RA 3PB8X 5LRJA 1HEEA 5CBMA 1VHEA 2PJCA 2C6GA 3D66A 4ZYQA 2PJ7A 2V8DA 4BD9A 1PYTB 3KQXA 3MRUA 4OMEA 3KHZA 1BLLE 2GU2A 3D7DA 4ZY0A 4FWUA 1Y7EA 5JGFA 3T8WA 3PB9X 1NSAA 4OC0A 3KR4A 2NYQA 2F8HA 3B3VA 2GREA 4NGPA 5JM6A 1RTQA 2PCUA 3DGVA 2EK8A 2AFMA 2WYRA 1BPNA 3PFOA 4MHYA 2V8HA 1ZG7A 1KWMA 1XRYA 5JH9A 5LYFA 2OR4A 1XBUA 4P44A 5K8MA 3SJGA 3BI0A 1XFOA 3WC7A 4P6YA 3I1UA 4UIBA 3B3SA 4W9YA 3WABA 1ARMA 2PIYA 4WWVA 2Q43A 2PJ2A 4MHPA 2CIJA 2O4HA 4MCQA 2VL1A 2ANPA 2Q4ZA 2RB7A 4UEEA 3K2KA 5F09A 4IHMA 3B7IA 4NJRA 4X3RA 1YW6A 4JYWA 2ZEEA 4UF4A 3D7HA 1ELMP 1DE4C 2ZELA 2ZEHA 3WC5A 4MCPA 1HDQA 1TF8A 4TNUA 3SI2A 4F8ZA 3WT4A 1TF9A 1UWYA 3HUVA 4X2TA 3D68A 5D29A 1LAPA 4G1PA 1ZLHA 4MCSA 1Q7LA 1XMBA 4MCRA 4ZY2A 4MRIA 2AFSA 2ZOFA 5LYIA 3IFEA 2QJ8A 1BAVA 1QQ9A 4R76A 3BI1A 2IJZA 3SJEA 4DJLA 2GLFA 1EE3P 3KASA 3H8GA 4P45A 3GB0A 3V38A 2V8VA 2IQ6A 2EWBA 3D7FA 4OKOA 4OC2A 3LWUA 2HB6A 4EMEA 1ZG9A 1CX8A 2PJ4A 3IIBA 2V8GA 3GLJA 4P4BA 3CDXA 2BCOA 2CF4A 4P10A 4ZY1A 3IWWA 3H8FA 4P4JA 2PVWA 1DTDA 5J1QA 4K3NA 3K9TA 4A38A 1YMEA 4MHZA 3PB7X 4EWTA 4JZ0A 3KI9A 4PXCA 1LAMA 1LFWA 2JBJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NH5 A;  3N5F A;  4NFR A;  4UEZ A;  3B2Y A;  1VHO A;  2BOA A;  2ZEO A;  1YSJ A;  4YWY A;  3PB6 X;  4MHN A;  4NGQ A;  1FT7 A;  3FH4 A;  4OC1 A;  2XEF A;  1ZLI A;  2DEA A;  4KSI A;  3TC8 A;  5DS0 A;  2JEW A;  3QNV A;  2XEG A;  3IEH A;  3PBB A;  2AFX A;  5HXD A;  3FED A;  5THW A;  2C1C A;  4FBE A;  3SJX A;  1AMP A;  3NA6 A;  2PE3 A;  3SI0 A;  5LYD A;  1TKH A;  2CTB A;  5HVH A;  4UEF A;  3FJU A;  1TXR A;  2AFZ A;  3BXM A;  3DLJ A;  3CPX A;  3VH9 A;  3KGQ A;  3WC6 A;  3NH8 A;  2IMO A;  4ZX8 A;  2ZED A;  2C6P A;  3GUX A;  3PBE A;  2PJB A;  1BPM A;  3V7Z A;  4O23 A;  3SI1 A;  4NGT A;  2C6C A;  3B3T A;  4NJQ A;  1CP7 A;  1FNO A;  2CTC A;  2I3C A;  4GM5 A;  4OC5 A;  3BHX A;  1TKF A;  3FVL A;  3SJF A;  3HLP A;  3KQZ A;  3H8E A;  3L2N A;  2AFW A;  4P4F A;  1CP6 A;  5IB9 A;  1TKJ A;  1PCA A;  3PFE A;  4MXU A;  3MN8 A;  4R8F A;  5K8P A;  1CBX A;  2F7V A;  1CPS A;  4OIW A;  2NSM A;  2J9A A;  3KZW A;  5ELY A;  1F57 A;  4A37 A;  3B35 A;  3RZA A;  3KHX A;  4EFD A;  1CPX A;  3CT9 A;  4A94 A;  3ISZ A;  3S9N A;  3RAM A;  1YW4 A;  2PJ1 A;  3S9M A;  1Z2L A;  3D4U A;  2PIZ A;  1ELL P;  2ZEG A;  1YLO A;  2JBK A;  4MMO A;  4B6Z A;  2GLJ A;  3IO1 A;  3PB4 X;  3RBU A;  4NGS A;  2ZEN A;  2ZEM A;  1F2O A;  5HVG A;  1F2P A;  2EK9 A;  4F9U A;  3FEC A;  5HVF A;  2QVP A;  4FAI A;  5LYL A;  3NH4 A;  4NGN A;  1Y0R A;  7CPA A;  4R6T A;  4AXV A;  1LOK A;  1XJO A;  3PEI A;  4IK2 A;  3B3C A;  2PJ5 A;  2PJA A;  2ZEP A;  1HDU A;  3D67 A;  3TX8 A;  1Z8L A;  3FX6 A;  3FMC A;  3VAR A;  1CG2 A;  1AYE A;  1LCP A;  4RUH A;  2G9D A;  1R43 A;  3NFZ A;  4PQA A;  4PPZ A;  4WJB A;  3KR5 A;  4NGR A;  4P4D A;  1LAN A;  4P4I A;  4YU9 A;  2XEI A;  5I4M A;  4PXD A;  4A39 A;  1IGB A;  2ZEF A;  4CPA A;  2PVV A;  2BO9 A;  4ZX9 A;  1R3N A;  4F9V A;  1GYT A;  1OBR A;  3FF3 A;  4FUU A;  5D8N A;  4NGM A;  5CPA A;  4Z65 A;  2OOT A;  5K8N A;  2AFO A;  2XEJ A;  6CPA A;  3ISX A;  2V77 A;  4PXE A;  4DUK A;  2ZOG A;  4H2K A;  2PJ8 A;  4ZI6 A;  4OC4 A;  2PJ3 A;  5LRK A;  4OP4 A;  1IY7 A;  2RFH A;  2ABZ A;  4DYO A;  2PJ9 A;  3D7G A;  4P4E A;  4X8I A;  1JQG A;  4Q7A A;  4R7M A;  2POK A;  4TWE A;  2Q51 A;  3LMS A;  2PJ6 A;  3B3W A;  1VIX A;  2HC9 A;  5LRG A;  2PJ0 A;  2O53 A;  2FVG A;  1VGY A;  1ARL A;  4UIA A;  4ONW A;  1M4L A;  4IAV A;  3KL9 A;  3VAT A;  8CPA A;  1Y0Y A;  3IC1 A;  3IJ3 A;  4LQG A;  3FEE A;  2QYV A;  5K8O A;  4OID A;  2WZN A;  2AFU A;  3CPA A;  2PRQ A;  1QMU A;  1ZG8 A;  4PXB A;  3PRT A;  3S9L A;  3JRU A;  4OC3 A;  1H8L A;  1Z5R A;  3PB8 X;  5LRJ A;  1HEE A;  5CBM A;  1VHE A;  2PJC A;  2C6G A;  3D66 A;  4ZYQ A;  2PJ7 A;  2V8D A;  4BD9 A;  1PYT B;  3KQX A;  3MRU A;  4OME A;  3KHZ A;  1BLL E;  2GU2 A;  3D7D A;  4ZY0 A;  4FWU A;  1Y7E A;  5JGF A;  3T8W A;  3PB9 X;  1NSA A;  4OC0 A;  3KR4 A;  2NYQ A;  2F8H A;  3B3V A;  2GRE A;  4NGP A;  5JM6 A;  1RTQ A;  2PCU A;  3DGV A;  2EK8 A;  2AFM A;  2WYR A;  1BPN A;  3PFO A;  4MHY A;  2V8H A;  1ZG7 A;  1KWM A;  1XRY A;  5JH9 A;  5LYF A;  2OR4 A;  1XBU A;  4P44 A;  5K8M A;  3SJG A;  3BI0 A;  1XFO A;  3WC7 A;  4P6Y A;  3I1U A;  4UIB A;  3B3S A;  4W9Y A;  3WAB A;  1ARM A;  2PIY A;  4WWV A;  2Q43 A;  2PJ2 A;  4MHP A;  2CIJ A;  2O4H A;  4MCQ A;  2VL1 A;  2ANP A;  2Q4Z A;  2RB7 A;  4UEE A;  3K2K A;  5F09 A;  4IHM A;  3B7I A;  4NJR A;  4X3R A;  1YW6 A;  4JYW A;  2ZEE A;  4UF4 A;  3D7H A;  1ELM P;  1DE4 C;  2ZEL A;  2ZEH A;  3WC5 A;  4MCP A;  1HDQ A;  1TF8 A;  4TNU A;  3SI2 A;  4F8Z A;  3WT4 A;  1TF9 A;  1UWY A;  3HUV A;  4X2T A;  3D68 A;  5D29 A;  1LAP A;  4G1P A;  1ZLH A;  4MCS A;  1Q7L A;  1XMB A;  4MCR A;  4ZY2 A;  4MRI A;  2AFS A;  2ZOF A;  5LYI A;  3IFE A;  2QJ8 A;  1BAV A;  1QQ9 A;  4R76 A;  3BI1 A;  2IJZ A;  3SJE A;  4DJL A;  2GLF A;  1EE3 P;  3KAS A;  3H8G A;  4P45 A;  3GB0 A;  3V38 A;  2V8V A;  2IQ6 A;  2EWB A;  3D7F A;  4OKO A;  4OC2 A;  3LWU A;  2HB6 A;  4EME A;  1ZG9 A;  1CX8 A;  2PJ4 A;  3IIB A;  2V8G A;  3GLJ A;  4P4B A;  3CDX A;  2BCO A;  2CF4 A;  4P10 A;  4ZY1 A;  3IWW A;  3H8F A;  4P4J A;  2PVW A;  1DTD A;  5J1Q A;  4K3N A;  3K9T A;  4A38 A;  1YME A;  4MHZ A;  3PB7 X;  4EWT A;  4JZ0 A;  3KI9 A;  4PXC A;  1LAM A;  1LFW A;  2JBJ A; 
#chains in the Genus database with same CATH topology
 2Z0Z A;  3NH5 A;  1WWZ A;  4UFX A;  3N5F A;  4XPL A;  4CAX A;  4JXR A;  2CY2 A;  2ZW6 A;  4NFR A;  2EVN A;  4U9Z A;  2H5M A;  4UEZ A;  4JXQ A;  5IX3 A;  4XPK A;  3B2Y A;  1VHO A;  1VHS A;  2BOA A;  2ZEO A;  1YSJ A;  4YWY A;  2C27 A;  2K5T A;  3PB6 X;  4MHN A;  4NGQ A;  1XE4 A;  3RNZ A;  1U6M A;  1FT7 A;  4A30 A;  3FH4 A;  4HNX B;  4OC1 A;  1Y9W A;  2XEF A;  1ZLI A;  2DEA A;  4KSI A;  3TC8 A;  5DS0 A;  2JEW A;  3FYN A;  3QNV A;  2XEG A;  3IEH A;  3PBB A;  2AFX A;  1M4G A;  3GKR A;  5HXD A;  3FED A;  4PSX A;  5THW A;  2C1C A;  5GCN A;  4CYO A;  2BUE A;  4FBE A;  1B6B A;  3CXQ A;  4GS4 A;  2FIW A;  3SJX A;  1AMP A;  2BEI A;  3P2H A;  1M1D A;  3NA6 A;  4MFL A;  2PE3 A;  3PZJ A;  1XF8 A;  5HH1 A;  3IU2 A;  2DXQ A;  3SI0 A;  1QSO A;  1XMT A;  5LYD A;  1TKH A;  4CAW A;  1S60 A;  1JWQ A;  2CTB A;  4M85 A;  4Y49 B;  4I49 A;  4IUS A;  2OU2 A;  4UBR A;  4EVY A;  3NE7 A;  3I3G A;  5HVH A;  4UEF A;  4HKF A;  5EMI A;  4U9Y A;  3D2P A;  3F5B A;  3FJU A;  4JLY A;  1TXR A;  1MK4 A;  2AFZ A;  2PC1 A;  2RC4 A;  3W6S A;  2GE3 A;  4NEX A;  3BXM A;  2B3V A;  3DLJ A;  3CPX A;  4KOT A;  3VH9 A;  3KGQ A;  5A28 A;  3WC6 A;  5DWM A;  1PUA A;  2IMO A;  2EBJ A;  2WPW A;  2Z11 A;  3NH8 A;  1RO5 A;  2ZW4 A;  3JTK A;  3VWD A;  5KTA A;  3F0A A;  2VXK A;  3EY5 A;  5EC4 A;  4KS9 A;  4H6Z A;  4ZX8 A;  1Q2Y A;  1NE9 A;  2C6P A;  2ZED A;  3GUX A;  4C2Z A;  3PBE A;  2PJB A;  3EFA A;  4KOW A;  2JDC A;  3R9E A;  1BPM A;  4C2Y A;  3V7Z A;  1KUY A;  2IL4 A;  3GYA A;  4O23 A;  3SI1 A;  2FCK A;  4E8O A;  5JPH A;  4NGT A;  2C6C A;  3B3T A;  2B4B A;  4NJQ A;  4MY3 A;  1CP7 A;  1FNO A;  1P0H A;  5C82 A;  2YNE A;  2PR1 A;  2R98 A;  2CTC A;  2REE A;  2I3C A;  1J4J A;  4AG7 A;  4GM5 A;  2B5G B;  4OC5 A;  3BHX A;  1TKF A;  4PSW A;  4KOX A;  1FY7 A;  1S7L A;  2WSA A;  3FVL A;  4FD5 A;  4F0X A;  3P2F A;  4QC6 A;  3SJF A;  3TOA A;  3HLP A;  3I9S A;  3KQZ A;  2F5I A;  3H8E A;  1YLE A;  3L2N A;  4A32 A;  5F49 A;  1MJB A;  3LAC A;  3TE4 A;  1Z8T A;  2AFW A;  4DNC A;  2OZG A;  1Z4R A;  4P4F A;  4XNH B;  1CP6 A;  4U5Y A;  5IB9 A;  4IF5 A;  1TKJ A;  3IU1 A;  1PCA A;  3PFE A;  4MXU A;  5E96 A;  5J8C A;  3MN8 A;  4R8F A;  3RYO A;  3SXO A;  5K8P A;  1CBX A;  2F7V A;  1CPS A;  1IYL A;  2Z10 A;  2JDD A;  4M6I A;  4OIW A;  4Q38 A;  2Z3L A;  2NSM A;  2J9A A;  1YQE A;  4F8Z A;  4XNH C;  3KZW A;  5G22 A;  4MFQ A;  2BL1 A;  2B58 A;  4CRZ B;  1PU9 A;  5ELY A;  4KOV A;  1F57 A;  4C2X A;  4A37 A;  1SQH A;  3B35 A;  3RZA A;  2HQY A;  2Z3P A;  3KHX A;  4EFD A;  1XEB A;  2ODF A;  1CPX A;  2GIV A;  3CT9 A;  4A94 A;  3ISZ A;  1YR0 A;  3IGR A;  3S9N A;  4CAE A;  2KCW A;  3RAM A;  1YW4 A;  2PJ1 A;  4HPS A;  1IIC A;  3S9M A;  1Z2L A;  5G21 A;  3D4U A;  2JLM A;  4KOU A;  2PIZ A;  4KVX A;  1ELL P;  2ZEG A;  2X7B A;  1YLO A;  4KUA A;  5CNP A;  4CYP A;  2JBK A;  4MMO A;  4QVT A;  1Q2D A;  3D2M A;  1RXT A;  3TTH A;  1Z9U A;  4B6Z A;  2GLJ A;  3WR7 A;  1X10 A;  3IO1 A;  3W6X A;  2CNS A;  3PB4 X;  4CGL A;  4X5K A;  3RBU A;  2Q0Y A;  4KOS A;  1YX0 A;  2P6G A;  1KZF A;  2ZEM A;  2ZEN A;  1F2O A;  1Y7R A;  4LUA A;  4NGS A;  2HUZ A;  4OAE A;  1K4J A;  5HVG A;  2DPS A;  2GFQ A;  1I12 A;  1F2P A;  2EK9 A;  4C7I A;  4F9U A;  3FEC A;  5HVF A;  2QVP A;  4FAI A;  5LYL A;  1IOI A;  1QST A;  3NE8 A;  4ZBG A;  4A31 A;  4CS0 B;  3NH4 A;  4NGN A;  5A27 A;  4C7H A;  4CGP A;  5G20 A;  4CGN A;  2PR8 A;  4UCN A;  4Q36 A;  1Y0R A;  7CPA A;  4R6T A;  4E0A A;  4AXV A;  3OWC A;  4B11 A;  1LOK A;  4ORF A;  3S6F A;  5KTC A;  1XJO A;  4PK3 A;  2Z3O A;  3PEI A;  4IK2 A;  3IWE A;  3B3C A;  4B14 A;  2FL4 A;  3B8G A;  3QB8 A;  2PJ5 A;  1B87 A;  2PJA A;  2ZEP A;  4HNY B;  4XPD C;  4CYN A;  2O28 A;  3H4Q A;  4Y49 C;  1HDU A;  5EBV A;  1YVK A;  5C88 A;  3D67 A;  2Q04 A;  2YNC C;  4BIN A;  2ZW7 A;  3TX8 A;  4JWP A;  4MI4 A;  1Z8L A;  3FX6 A;  1YVO A;  3FMC A;  3VAR A;  1CG2 A;  2YGW A;  3SHP A;  4JD6 A;  1AYE A;  1Z8W A;  1LCP A;  4RUH A;  2YND A;  2G9D A;  1R43 A;  1S7F A;  3E0K A;  3NFZ A;  4KLV A;  4PPZ A;  4PQA A;  4WJB A;  3KR5 A;  4ONU A;  2VZZ A;  2D4P A;  4NGR A;  4P4D A;  1S7N A;  1LAN A;  2I79 A;  4P4I A;  3QAY A;  4F6A A;  1P4N A;  2CXA A;  4M6G A;  4YU9 A;  3EXN A;  2OH1 A;  2XEI A;  2ZPA A;  3JVN A;  4PXD A;  3G3S A;  4CAV A;  4KOR A;  1L0C A;  5I4M A;  4JJX A;  4A39 A;  1IGB A;  3LD2 A;  3PGP A;  2ZEF A;  4CPA A;  2PVV A;  3SXN A;  5BWA B;  2BO9 A;  4ZX9 A;  1R3N A;  3BLN A;  3QAH A;  4CGM A;  4F9V A;  5F46 A;  2EUI A;  1GYT A;  1IU8 A;  1XIX A;  1OBR A;  3FF3 A;  4MJ8 A;  4FUU A;  5D8N A;  4NGM A;  5CPA A;  2WUU A;  3BJ7 A;  2A4N A;  4Z65 A;  2OOT A;  5K8N A;  5H84 A;  4FD7 A;  2AFO A;  2XEJ A;  3DNS A;  4XPD B;  6CPA A;  3DSB A;  3ISX A;  4AVA A;  3PP9 A;  2V77 A;  2Y0M A;  3F8K A;  3N7Z A;  4PXE A;  2ZOG A;  5AG5 A;  4DUK A;  3DR6 A;  2PJ8 A;  4H2K A;  4ZI6 A;  4OC4 A;  2PJ3 A;  2ARH A;  1WK4 A;  5LRK A;  4OP4 A;  1IY7 A;  4BBH A;  2RFH A;  1M4D A;  1YRE A;  2ABZ A;  4DYO A;  2PJ9 A;  3D7G A;  4P4E A;  4X8I A;  1JQG A;  4Q7A A;  4R7M A;  5AG6 A;  2PQ8 A;  1V0C A;  3G8W A;  2P0W A;  4B13 A;  4F0Y A;  2FXF A;  2POK A;  4TWE A;  4LQ6 A;  4RS2 A;  2Q51 A;  3DDD A;  3LMS A;  3JUW A;  1NMT A;  2PJ6 A;  4KVM E;  3B3W A;  1VIX A;  2HC9 A;  5LRG A;  2PJ0 A;  2O53 A;  2FVG A;  2VEZ A;  1MJA A;  2GAN A;  1VGY A;  2I00 A;  3R1K A;  1ARL A;  4R57 A;  4UIA A;  4ONW A;  4LX9 A;  1M4L A;  4IAV A;  5AG7 A;  4BMH A;  2J8M A;  2OZH A;  3KL9 A;  5IB0 A;  3VAT A;  8CPA A;  1QSN A;  1Y0Y A;  3IC1 A;  3IJ3 A;  1UFH A;  4CAF A;  4LQG A;  2G3A A;  3FEE A;  2QYV A;  5K8O A;  4B12 A;  2DPT A;  4KOY A;  1QSR A;  4OID A;  4B5P B;  4ZGY B;  2FSR A;  2WZN A;  2AFU A;  1N71 A;  1BOB A;  4UWI A;  3CXS A;  3CPA A;  4MBU A;  2PRQ A;  1QMU A;  4HNW B;  3C26 A;  1ZG8 A;  4PXB A;  3PRT A;  3ZZI A;  2VZY A;  4UCM A;  1ZO0 A;  2ZXV A;  3S9L A;  2AE6 A;  3MGD A;  3JRU A;  5FVJ A;  4OC3 A;  1H8L A;  1Q2C A;  1I21 A;  4KVO E;  3R9G A;  1MJ9 A;  1Z5R A;  2QML A;  3PB8 X;  4YGO A;  5LRJ A;  2QIR A;  1HEE A;  4UCP A;  2FE7 A;  5CBM A;  1KUV A;  4QBJ A;  4UWJ A;  1CM0 A;  5F47 A;  1VHE A;  2PJC A;  4B5P A;  3FRM A;  4C68 A;  2C6G A;  3TCV A;  4YRH A;  1QSM A;  1S7K A;  2B4D B;  5F48 A;  1NSL A;  4AB7 A;  2QEC A;  2R7H A;  3D66 A;  5HMN A;  4ZYQ A;  4PK2 A;  5I0C A;  2G0B A;  2PJ7 A;  2V8D A;  4NXY A;  4BD9 A;  1PYT B;  2PDO A;  3KQX A;  4M6H A;  3MRU A;  4QUS A;  4QB9 A;  4OME A;  2VBQ A;  5IV0 A;  2OB0 A;  2REF A;  3KHZ A;  1BLL E;  2GU2 A;  3D7D A;  4ZY0 A;  4KLW A;  4FWU A;  1Y7E A;  3VWE A;  5JGF A;  1IB1 E;  3CZX A;  4NF1 A;  3T8W A;  2Q7S A;  4R87 A;  2ATR A;  2Z3K A;  3PB9 X;  2CNT A;  2FT0 A;  1NSA A;  2R1I A;  3EO4 A;  4OC0 A;  2NMT A;  1X12 A;  4FD6 A;  3KR4 A;  2NYQ A;  3H5Z A;  2F8H A;  3B3V A;  2GRE A;  2Q44 A;  3FXT A;  4NGP A;  1RTQ A;  5JM6 A;  4UFV A;  2PCU A;  1YGH A;  3DR8 A;  2P6E A;  2J8R A;  4OLL A;  2PRB A;  3DGV A;  4KSA A;  2EK8 A;  2AFM A;  2WYR A;  2EO8 A;  4NCZ A;  1BPN A;  3PFO A;  4B5O A;  4UA3 A;  4MHY A;  1ON0 A;  2J8N A;  2PSW A;  4K30 A;  4MFJ A;  2V8H A;  2YNC A;  3RO0 A;  1ZG7 A;  2VI7 A;  1KWM A;  1M44 A;  1XRY A;  5JH9 A;  5LYF A;  3K9U A;  4J3G A;  2OR4 A;  5ISV A;  1XBU A;  4AVB A;  4P44 A;  5K8M A;  3LOD A;  1R57 A;  3SJG A;  2AJ6 A;  3BI0 A;  1XFO A;  3D3S A;  3WC7 A;  4P6Y A;  3I1U A;  1LRZ A;  4UIB A;  1OZP A;  3B3S A;  4A95 A;  4W9Y A;  1A2Z A;  3WAB A;  4YFJ A;  1ARM A;  2PIY A;  1IYK A;  3R95 A;  3KKW A;  4WWV A;  4UFW A;  2Q43 A;  2G3T A;  2PJ2 A;  3T9Y A;  4MHP A;  2CIJ A;  2Z3M A;  3FNC A;  1XOV A;  2O4H A;  4MCQ A;  2FIA A;  2VL1 A;  2R8V A;  3TO7 A;  4AVC A;  4CYQ A;  2ANP A;  2Q4Z A;  2RB7 A;  4GXH A;  4UEE A;  3K2K A;  4KUB A;  5F09 A;  4NSQ A;  4IHM A;  4H6U A;  4MHD A;  5DWN A;  3UY5 A;  3B7I A;  4NJR A;  4X3R A;  4R3L A;  1YW6 A;  3TT2 A;  4JYW A;  2Q4V A;  2ZEE A;  1Z8X A;  1BO4 A;  2OZU A;  4UF4 A;  3D7H A;  1IID A;  1ELM P;  1DE4 C;  2DF5 A;  3GIU A;  3TFY A;  1TIQ A;  2ZEL A;  5J8F A;  2ZEH A;  4CRY B;  3WC5 A;  4MCP A;  1HDQ A;  1TF8 A;  4MY0 A;  4TNU A;  2Q7B A;  3SI2 A;  3WT4 A;  1TF9 A;  1UWY A;  2B3U A;  4L8A A;  4MFP A;  5G1Z A;  3HUV A;  4X2T A;  3D68 A;  5D29 A;  1LAP A;  4G1P A;  1ZLH A;  1Z4E A;  4MCS A;  3GY9 A;  1Q7L A;  1IOF A;  1XMB A;  2ZW5 A;  4MFZ A;  4MCR A;  4ZY2 A;  2HV2 A;  5AG4 A;  4MRI A;  1CJW A;  2AFS A;  2ZOF A;  5LYI A;  3ZJ0 A;  3IFE A;  2QJ8 A;  1BAV A;  1QQ9 A;  3BJ8 A;  4R76 A;  2B4D A;  3BI1 A;  5AGE A;  2IJZ A;  1AUG A;  1M4I A;  3SJE A;  3A9L A;  1I1D A;  4DJL A;  4H89 A;  2GLF A;  1EE3 P;  2JEV A;  4AG9 A;  3KAS A;  3H8G A;  2WPX A;  4P45 A;  3GB0 A;  3R9F A;  3S6K A;  3S6G A;  3TOB A;  4RI1 A;  3R96 A;  3V38 A;  3CXP A;  4CGO A;  4OAD A;  3W91 A;  4R9M A;  5JQ4 A;  2V8V A;  2IQ6 A;  2EWB A;  3D7F A;  4OKO A;  3LWU A;  4OC2 A;  4B10 A;  2HB6 A;  4EME A;  1ZG9 A;  1CX8 A;  2PJ4 A;  3IIB A;  2V8G A;  1Y9K A;  3IWG A;  2P6F A;  2B5G A;  2VQY A;  3FIX A;  3GLJ A;  3S6H A;  4P4B A;  3CDX A;  5H86 A;  5KTD A;  1KUX A;  4PV6 A;  2BCO A;  4KSF A;  2CF4 A;  4P10 A;  1S3Z A;  4M3S A;  4ZY1 A;  4MFK A;  4II9 A;  1GHE A;  3IWW A;  2Z3N A;  1YK3 A;  2CNM A;  3H8F A;  1S5K A;  2Q4Y A;  4P4J A;  2PVW A;  1DTD A;  4A2Z A;  4E2A A;  5J1Q A;  4K3N A;  2BSW A;  2D4O A;  4FD4 A;  3K9T A;  3V8I A;  3FBU A;  4A38 A;  1YME A;  1VKC A;  4RN7 A;  3T90 A;  2FS5 A;  4MHZ A;  3FB3 A;  3TO6 A;  3EC4 A;  3PB7 X;  4KZT A;  3KI9 A;  4JZ0 A;  3TO9 A;  1LAM A;  4PXC A;  4EWT A;  1LFW A;  4A33 A;  3D8P A;  4R3K A;  4L89 A;  2JBJ A; 
#chains in the Genus database with same CATH homology
 3NH5 A;  3N5F A;  4NFR A;  4UEZ A;  3B2Y A;  1VHO A;  2BOA A;  2ZEO A;  1YSJ A;  4YWY A;  3PB6 X;  4MHN A;  4NGQ A;  1FT7 A;  3FH4 A;  4OC1 A;  2XEF A;  1ZLI A;  2DEA A;  4KSI A;  3TC8 A;  5DS0 A;  2JEW A;  3QNV A;  2XEG A;  3IEH A;  3PBB A;  2AFX A;  5HXD A;  3FED A;  5THW A;  2C1C A;  4FBE A;  3SJX A;  1AMP A;  3NA6 A;  2PE3 A;  3SI0 A;  5LYD A;  1TKH A;  2CTB A;  5HVH A;  4UEF A;  3FJU A;  1TXR A;  2AFZ A;  3BXM A;  3DLJ A;  3CPX A;  3VH9 A;  3KGQ A;  3WC6 A;  3NH8 A;  2IMO A;  4ZX8 A;  2ZED A;  2C6P A;  3GUX A;  3PBE A;  2PJB A;  1BPM A;  3V7Z A;  4O23 A;  3SI1 A;  4NGT A;  2C6C A;  3B3T A;  4NJQ A;  1CP7 A;  1FNO A;  2CTC A;  2I3C A;  4GM5 A;  4OC5 A;  3BHX A;  1TKF A;  3FVL A;  3SJF A;  3HLP A;  3KQZ A;  3H8E A;  3L2N A;  2AFW A;  4P4F A;  1CP6 A;  5IB9 A;  1TKJ A;  1PCA A;  3PFE A;  4MXU A;  3MN8 A;  4R8F A;  5K8P A;  1CBX A;  2F7V A;  1CPS A;  4OIW A;  2NSM A;  2J9A A;  3KZW A;  5ELY A;  1F57 A;  4A37 A;  3B35 A;  3RZA A;  3KHX A;  4EFD A;  1CPX A;  3CT9 A;  4A94 A;  3ISZ A;  3S9N A;  3RAM A;  1YW4 A;  2PJ1 A;  3S9M A;  1Z2L A;  3D4U A;  2PIZ A;  1ELL P;  2ZEG A;  1YLO A;  2JBK A;  4MMO A;  4B6Z A;  2GLJ A;  3IO1 A;  3PB4 X;  3RBU A;  4NGS A;  2ZEN A;  2ZEM A;  1F2O A;  5HVG A;  1F2P A;  2EK9 A;  4F9U A;  3FEC A;  5HVF A;  2QVP A;  4FAI A;  5LYL A;  3NH4 A;  4NGN A;  1Y0R A;  7CPA A;  4R6T A;  4AXV A;  1LOK A;  1XJO A;  3PEI A;  4IK2 A;  3B3C A;  2PJ5 A;  2PJA A;  2ZEP A;  1HDU A;  3D67 A;  3TX8 A;  1Z8L A;  3FX6 A;  3FMC A;  3VAR A;  1CG2 A;  1AYE A;  1LCP A;  4RUH A;  2G9D A;  1R43 A;  3NFZ A;  4PQA A;  4PPZ A;  4WJB A;  3KR5 A;  4NGR A;  4P4D A;  1LAN A;  4P4I A;  4YU9 A;  2XEI A;  5I4M A;  4PXD A;  4A39 A;  1IGB A;  2ZEF A;  4CPA A;  2PVV A;  2BO9 A;  4ZX9 A;  1R3N A;  4F9V A;  1GYT A;  1OBR A;  3FF3 A;  4FUU A;  5D8N A;  4NGM A;  5CPA A;  4Z65 A;  2OOT A;  5K8N A;  2AFO A;  2XEJ A;  6CPA A;  3ISX A;  2V77 A;  4PXE A;  4DUK A;  2ZOG A;  4H2K A;  2PJ8 A;  4ZI6 A;  4OC4 A;  2PJ3 A;  5LRK A;  4OP4 A;  1IY7 A;  2RFH A;  2ABZ A;  4DYO A;  2PJ9 A;  3D7G A;  4P4E A;  4X8I A;  1JQG A;  4Q7A A;  4R7M A;  2POK A;  4TWE A;  2Q51 A;  3LMS A;  2PJ6 A;  3B3W A;  1VIX A;  2HC9 A;  5LRG A;  2PJ0 A;  2O53 A;  2FVG A;  1VGY A;  1ARL A;  4UIA A;  4ONW A;  1M4L A;  4IAV A;  3KL9 A;  3VAT A;  8CPA A;  1Y0Y A;  3IC1 A;  3IJ3 A;  4LQG A;  3FEE A;  2QYV A;  5K8O A;  4OID A;  2WZN A;  2AFU A;  3CPA A;  2PRQ A;  1QMU A;  1ZG8 A;  4PXB A;  3PRT A;  3S9L A;  3JRU A;  4OC3 A;  1H8L A;  1Z5R A;  3PB8 X;  5LRJ A;  1HEE A;  5CBM A;  1VHE A;  2PJC A;  2C6G A;  3D66 A;  4ZYQ A;  2PJ7 A;  2V8D A;  4BD9 A;  1PYT B;  3KQX A;  3MRU A;  4OME A;  3KHZ A;  1BLL E;  2GU2 A;  3D7D A;  4ZY0 A;  4FWU A;  1Y7E A;  5JGF A;  3T8W A;  3PB9 X;  1NSA A;  4OC0 A;  3KR4 A;  2NYQ A;  2F8H A;  3B3V A;  2GRE A;  4NGP A;  5JM6 A;  1RTQ A;  2PCU A;  3DGV A;  2EK8 A;  2AFM A;  2WYR A;  1BPN A;  3PFO A;  4MHY A;  2V8H A;  1ZG7 A;  1KWM A;  1XRY A;  5JH9 A;  5LYF A;  2OR4 A;  1XBU A;  4P44 A;  5K8M A;  3SJG A;  3BI0 A;  1XFO A;  3WC7 A;  4P6Y A;  3I1U A;  4UIB A;  3B3S A;  4W9Y A;  3WAB A;  1ARM A;  2PIY A;  4WWV A;  2Q43 A;  2PJ2 A;  4MHP A;  2CIJ A;  2O4H A;  4MCQ A;  2VL1 A;  2ANP A;  2Q4Z A;  2RB7 A;  4UEE A;  3K2K A;  5F09 A;  4IHM A;  3B7I A;  4NJR A;  4X3R A;  1YW6 A;  4JYW A;  2ZEE A;  4UF4 A;  3D7H A;  1ELM P;  1DE4 C;  2ZEL A;  2ZEH A;  3WC5 A;  4MCP A;  1HDQ A;  1TF8 A;  4TNU A;  3SI2 A;  4F8Z A;  3WT4 A;  1TF9 A;  1UWY A;  3HUV A;  4X2T A;  3D68 A;  5D29 A;  1LAP A;  4G1P A;  1ZLH A;  4MCS A;  1Q7L A;  1XMB A;  4MCR A;  4ZY2 A;  4MRI A;  2AFS A;  2ZOF A;  5LYI A;  3IFE A;  2QJ8 A;  1BAV A;  1QQ9 A;  4R76 A;  3BI1 A;  2IJZ A;  3SJE A;  4DJL A;  2GLF A;  1EE3 P;  3KAS A;  3H8G A;  4P45 A;  3GB0 A;  3V38 A;  2V8V A;  2IQ6 A;  2EWB A;  3D7F A;  4OKO A;  4OC2 A;  3LWU A;  2HB6 A;  4EME A;  1ZG9 A;  1CX8 A;  2PJ4 A;  3IIB A;  2V8G A;  3GLJ A;  4P4B A;  3CDX A;  2BCO A;  2CF4 A;  4P10 A;  4ZY1 A;  3IWW A;  3H8F A;  4P4J A;  2PVW A;  1DTD A;  5J1Q A;  4K3N A;  3K9T A;  4A38 A;  1YME A;  4MHZ A;  3PB7 X;  4EWT A;  4JZ0 A;  3KI9 A;  4PXC A;  1LAM A;  1LFW A;  2JBJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...