4UEZA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-leu-phe-y(po2ch2)-phe-oh
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords HUMAN CARBOXYPEPTIDASE A1
total genus 114
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uezA00
3V38A 3PEIA 1LFWA 3CDXA 5CBMA 2PJ3A 2QJ8A 1TF9A 4LQGA 1F57A 2ZELA 4MXUA 4CPAA 5DS0A 4MCSA 2I3CA 2XEGA 1PCAA 4ZY2A 3NH4A 5JH9A 5HVFA 1YLOA 4FUUA 3FJUA 1LANA 3MRUA 3CT9A 1VHOA 5JGFA 3B3SA 4DJLA 4UF4A 3GB0A 3N5FA 4UIAA 3S9LA 4F9VA 4WJBA 2VL1A 2GU2A 3FMCA 4OC3A 4P4EA 2IJZA 3IJ3A 3K9TA 3FECA 2IQ6A 3IC1A 3KASA 1F2OA 1R43A 4A39A 3SJEA 5LYFA 1CPXA 2ZEEA 5D8NA 1Z5RA 4NGNA 4NGSA 2QYVA 4MRIA 1CG2A 4ONWA 2PVWA 4OC1A 5JM6A 5LYIA 2BOAA 4O23A 4PQAA 1ZLHA 2JBKA 2ZEMA 3VATA 4OC4A 3WT4A 3KQXA 4F9UA 3MN8A 4ZX9A 2GREA 4KSIA 2HC9A 4A94A 3CPXA 2PJ7A 4WWVA 6CPAA 2C1CA 1YW6A 2CTCA 3IIBA 4EMEA 4ZYQA 3D68A 3PBEA 4P10A 1VHEA 2F8HA 1DE4C 1DTDA 1LCPA 4NGRA 4R7MA 1OBRA 2PJBA 3I1UA 1IGBA 4NGMA 4BD9A 3B3TA 3DLJA 4UEZA 2Q43A 3D4UA 4IAVA 2CTBA 2XEIA 2G9DA 4UIBA 3H8EA 1ZG9A 5K8OA 5LRJA 4W9YA 4NJRA 1XJOA 2AFWA 4X2TA 4PXDA 4P4IA 4B6ZA 2PJCA 3HUVA 2ZOFA 3RZAA 2POKA 4NGTA 2GLJA 1AMPA 2ZEGA 2BO9A 1H8LA 2ZEFA 1XMBA 5LYDA 3B3CA 4P45A 2ZEDA 3BI0A 1HDQA 5F09A 1UWYA 2J9AA 3BHXA 3PB6X 3FH4A 3S9NA 3TC8A 3WC5A 1TKJA 3FX6A 1ARMA 3NA6A 4NFRA 2QVPA 3QNVA 1BPNA 3PB8X 4A37A 3K2KA 2XEJA 1CX8A 1KWMA 5HXDA 1EE3P 1XBUA 2ZEOA 4A38A 2PE3A 3B7IA 3FVLA 1BLLE 4YU9A 4P6YA 4MHNA 3L2NA 2FVGA 4OC5A 2PJ8A 1FNOA 3NFZA 3KL9A 3DGVA 1TKFA 2ZENA 1LAMA 4FBEA 3D7HA 2AFUA 1YMEA 2RFHA 3SJFA 4EWTA 2NSMA 3PB4X 8CPAA 4G1PA 5ELYA 2C6GA 3WABA 3IEHA 1F2PA 2WZNA 2F7VA 1CP7A 2JEWA 2ANPA 1R3NA 3V7ZA 1IY7A 3TX8A 4DYOA 3KHXA 2C6CA 3KI9A 1BPMA 2CIJA 3CPAA 1Y7EA 4X8IA 1XRYA 1YW4A 3PFOA 4JZ0A 2PJ4A 2PJ6A 3PFEA 1YSJA 1XFOA 5D29A 2OR4A 4RUHA 5K8PA 2PVVA 2PJ5A 4ZI6A 4TNUA 4JYWA 1TKHA 4P4JA 2AFXA 4ZX8A 3KHZA 4ZY1A 2DEAA 2V77A 2AFZA 4OMEA 4NJQA 3WC6A 3SJGA 4MCPA 1TXRA 3LWUA 1CPSA 3PRTA 4OIWA 3VH9A 4IHMA 4OKOA 2Q4ZA 2V8VA 1TF8A 2AFOA 3S9MA 2PJAA 2ZEPA 5J1QA 3IO1A 1JQGA 3D67A 4MCRA 4Z65A 4UEFA 2BCOA 4PXCA 4F8ZA 1VGYA 1Q7LA 2XEFA 3LMSA 1HDUA 5K8NA 5LRGA 2JBJA 1ARLA 2AFMA 2RB7A 4P4DA 2PJ9A 4OC2A 1ELLP 4OP4A 3SJXA 7CPAA 2PJ2A 1LOKA 3ISXA 1LAPA 3H8FA 5HVHA 2EWBA 4FAIA 3GLJA 3D7DA 1AYEA 3JRUA 1Z2LA 3IWWA 3IFEA 2WYRA 4H2KA 1ELMP 2Q51A 3NH8A 1ZLIA 5THWA 4ZY0A 4X3RA 4PPZA 4NGQA 4DUKA 4MMOA 5CPAA 3SI0A 4MHPA 3SI1A 2PIYA 2CF4A 3RAMA 4AXVA 2PRQA 4R6TA 1Y0RA 3ISZA 1FT7A 4P4BA 4YWYA 4P4FA 3KGQA 1ZG7A 5LYLA 4R8FA 1GYTA 3FEDA 1ZG8A 4NGPA 4UEEA 3KQZA 1PYTB 2EK9A 2V8DA 4OC0A 5K8MA 3B3VA 3B3WA 3VARA 5HVGA 1QMUA 4R76A 1Y0YA 3HLPA 4EFDA 3WC7A 4IK2A 3H8GA 1CP6A 1BAVA 4K3NA 2PIZA 5I4MA 1HEEA 2V8GA 3SI2A 4Q7AA 2O53A 4PXBA 2GLFA 3KR4A 3T8WA 4OIDA 4P44A 2PJ0A 5IB9A 1NSAA 1M4LA 3NH5A 3PBBA 3GUXA 4MHYA 1VIXA 2NYQA 3FEEA 2PCUA 2ZOGA 3BI1A 3B2YA 3RBUA 2EK8A 3D7FA 1RTQA 2PJ1A 3PB9X 2AFSA 2C6PA 2O4HA 3D7GA 3D66A 4TWEA 4FWUA 5LRKA 2ABZA 2IMOA 1QQ9A 4MHZA 1Z8LA 3PB7X 3FF3A 3KZWA 2V8HA 2ZEHA 3KR5A 4GM5A 4MCQA 1CBXA 3BXMA 2OOTA 3B35A 4PXEA 2HB6A
chains in the Genus database with same CATH superfamily
3G8WA 3V38A 3PEIA 4B5PB 3VWEA 1LFWA 2Z3MA 3CDXA 4K30A 4B14A 5IV0A 2FIAA 5IB0A 5CBMA 1KUYA 4KZTA 1NMTA 2PJ3A 2QJ8A 4A95A 1TF9A 4HNYB 1F57A 3H5ZA 4KORA 4LQGA 2ZELA 2EVNA 3FRMA 4MFJA 4MFZA 4MXUA 4CS0B 3R95A 5J8CA 1IYKA 2ARHA 2B3UA 5DS0A 4CPAA 4UFVA 1RO5A 2GANA 4MCSA 2I3CA 2XEGA 3KKWA 2D4PA 3CXSA 1PCAA 3TO6A 1RXTA 4QBJA 4ZY2A 3NH4A 3V8IA 1Z9UA 3IWEA 5JH9A 2Z3KA 2JDDA 4OADA 5HVFA 1YLOA 4FUUA 2B58A 4R3LA 4F6AA 3FJUA 4HPSA 1LANA 3MRUA 3RYOA 5A27A 5DWNA 2C27A 3CT9A 1Z4EA 4U9ZA 1VHOA 5AG5A 4AG9A 5JGFA 3B3SA 4LQ6A 1IICA 2IL4A 4FD7A 4DJLA 4UF4A 4M6HA 4KLWA 3GB0A 3N5FA 4UIAA 4MY0A 3FNCA 3QB8A 3S9LA 4F9VA 1XE4A 2VZZA 4WJBA 1PU9A 2WUUA 2JEVA 3FIXA 4JLYA 1S7LA 2VL1A 4CAWA 4C68A 2RC4A 2GU2A 3FMCA 4OC3A 4P4EA 2IJZA 2VQYA 3RNZA 3IJ3A 3RO0A 3K9TA 1M4IA 3EY5A 3FB3A 3PZJA 4H89A 3FECA 4KOTA 2IQ6A 3IC1A 4CAVA 3KASA 1F2OA 1R43A 2B3VA 4A39A 4A2ZA 3SJEA 2OH1A 5LYFA 3VWDA 1CPXA 2ZEEA 3PP9A 4MFLA 5D8NA 1Z5RA 3H4QA 3QAYA 4I49A 1YX0A 4NGNA 2QECA 3F5BA 4NGSA 5C88A 2QYVA 5G20A 4MRIA 3PGPA 4MHDA 1CG2A 4ONWA 4F0XA 2PVWA 3IGRA 3SXNA 2OZGA 4M6GA 3T9YA 2K5TA 4KOXA 4OC1A 4CRYB 1CJWA 1NE9A 3TT2A 5JM6A 5LYIA 3D2MA 2BOAA 4O23A 4PQAA 4U9YA 2J8MA 1ZLHA 2JBKA 2WPWA 2ZEMA 3JTKA 3R96A 1P0HA 2PR1A 3VATA 5IX3A 4OC4A 2J8RA 3TOAA 1MJ9A 5CNPA 3WT4A 3JVNA 3KQXA 4F9UA 3MN8A 4ZX9A 1MK4A 2GREA 4KSIA 2HC9A 4A94A 2Q4YA 3CPXA 2PJ7A 4WWVA 3GYAA 4JD6A 4Y49B 3T90A 4UFXA 4IUSA 1Y9KA 6CPAA 1KUVA 5G21A 2C1CA 1YW6A 2CTCA 3IIBA 4MFQA 4EMEA 2CXAA 4ZYQA 3CXQA 4RI1A 3D68A 1VHSA 2GFQA 1QSOA 3PBEA 4GS4A 1VHEA 2F8HA 4P10A 1YK3A 1DE4C 1DTDA 4UBRA 4BMHA 1LCPA 4NGRA 4RS2A 4R7MA 2Z3PA 4R3KA 1B87A 1OBRA 2PJBA 3I1UA 3MGDA 3W6XA 1IGBA 2DF5A 4NGMA 1OZPA 5AG7A 2REEA 3B3TA 3DLJA 1S7NA 4BD9A 4UEZA 4Y49C 2Q43A 3D4UA 3EFAA 3TTHA 4KOVA 1VKCA 4IAVA 4XNHB 4KLVA 4C7IA 2CTBA 2XEIA 2G9DA 4UIBA 2Q44A 4L89A 3H8EA 4UA3A 1ZG9A 3S6KA 2FIWA 5LRJA 4W9YA 5K8OA 2ZW7A 4NJRA 3BJ8A 1XJOA 2AFWA 4X2TA 4MJ8A 5ISVA 4NEXA 4PXDA 2R98A 3NE8A 4P4IA 4M85A 4B6ZA 2PJCA 3HUVA 2R7HA 3CXPA 3IU2A 4JJXA 4RN7A 4H6ZA 4BBHA 2ZOFA 3RZAA 1M44A 2POKA 4A31A 2Z3NA 4NGTA 1S7FA 3EXNA 2GLJA 1YLEA 4XNHC 3R9GA 1AMPA 4CYOA 2YNDA 2VI7A 5HH1A 1YVKA 2ZEGA 2DXQA 4HKFA 2BO9A 3UY5A 1H8LA 4ZGYB 2ZEFA 2F5IA 1XMBA 4PSWA 1S5KA 3BJ7A 3P2FA 5LYDA 3B3CA 4P45A 1I12A 2ZEDA 4M3SA 4YGOA 3BI0A 1HDQA 1IOFA 5F09A 1UWYA 2J9AA 1N71A 3DNSA 3GIUA 4QUSA 5EC4A 2EO8A 1QSRA 1K4JA 1FY7A 2PQ8A 5AG4A 3BHXA 4R9MA 4B12A 3PB6X 2PSWA 3FH4A 3S9NA 3DSBA 3TC8A 3WC5A 5I0CA 1TKJA 4R57A 2Q7SA 3FX6A 1S60A 1ARMA 1Y9WA 3NA6A 1UFHA 2QVPA 2H5MA 1BPNA 3PB8X 3QNVA 4FD5A 4NFRA 4R87A 3ZZIA 4A37A 1IYLA 2GIVA 4LUAA 3K2KA 3GY9A 2WSAA 2FT0A 2XEJA 1KUXA 4QVTA 1CX8A 1KWMA 5HXDA 2B5GA 3TCVA 4B11A 3EC4A 1EE3P 3FBUA 1XBUA 4A30A 1Q2DA 3W6SA 2ZEOA 3SHPA 4E2AA 1YR0A 4OLLA 3LD2A 4JXQA 4A38A 2PE3A 5A28A 3B7IA 3FVLA 1BLLE 4YU9A 3R9FA 4P6YA 5JPHA 4B5OA 2OB0A 4MHNA 3L2NA 4JWPA 2FVGA 3S6GA 4OC5A 2PJ8A 4KVOE 1FNOA 3NFZA 1XOVA 3KL9A 3DGVA 1IB1E 1TKFA 2ZENA 4UWIA 4ZBGA 4JXRA 1LAMA 1YVOA 4FBEA 2Y0MA 4A33A 1I1DA 1PUAA 3ZJ0A 1I21A 4CAXA 1L0CA 4B5PA 2JLMA 2PRBA 4KVXA 2R1IA 3D7HA 2AFUA 4C7HA 3S6HA 1YMEA 2I79A 2Z3OA 2RFHA 2CNSA 2FE7A 5EMIA 3SJFA 2G3AA 3LODA 4EWTA 2NSMA 2ODFA 4KUAA 4CGLA 3PB4X 8CPAA 4NSQA 4G1PA 5J8FA 1Z8TA 1QSTA 1V0CA 2C6GA 2NMTA 1LRZA 2GE3A 5ELYA 3IEHA 3WABA 1F2PA 2BEIA 2F7VA 2WZNA 1CP7A 2JEWA 2Q7BA 2ANPA 3I9SA 3GKRA 1R3NA 3V7ZA 1IY7A 3TX8A 4L8AA 4NCZA 3B8GA 4DYOA 3KHXA 4GXHA 2C6CA 2P6EA 3KI9A 4MFKA 2CY2A 2B5GB 1BPMA 3F8KA 2CIJA 3CPAA 4PK3A 1Y7EA 4X8IA 1XRYA 1YW4A 3PFOA 4JZ0A 2PJ4A 1X10A 1Q2YA 4PV6A 1MJBA 3D3SA 2PJ6A 3I3GA 1YSJA 1XFOA 1YQEA 3PFEA 3R1KA 5D29A 2B4BA 2OR4A 4E0AA 4RUHA 5HMNA 3TFYA 5K8PA 2PR8A 3E0KA 2G0BA 2PVVA 2PJ5A 2VEZA 1XF8A 4TNUA 4UCMA 1Z8XA 4JYWA 5G22A 1TKHA 2DPSA 4P4JA 2AFXA 5FVJA 4ZX8A 4PK2A 4C2ZA 3KHZA 4ZY1A 2DEAA 3K9UA 4PSXA 2V77A 1X12A 2AFZA 2P0WA 4NJQA 4OMEA 3WC6A 1YGHA 3SJGA 4FD6A 4MFPA 4ORFA 1JWQA 1IOIA 1TXRA 3LWUA 4MCPA 5F48A 2EUIA 4AB7A 1CPSA 3PRTA 4ONUA 4OIWA 4FD4A 2KCWA 3VH9A 4CGOA 4IHMA 4OKOA 4IF5A 2Q4ZA 5AG6A 2V8VA 2Q0YA 4AVAA 1TF8A 3A9LA 1CM0A 2AFOA 4MI4A 2CNTA 2P6FA 2REFA 3S9MA 4CGMA 2PJAA 2ZEPA 3C26A 2Z0ZA 2VXKA 2FSRA 4KSFA 5EBVA 5J1QA 2BUEA 3IO1A 1YREA 4NF1A 2HQYA 1JQGA 3D67A 4MCRA 4Z65A 4UEFA 2BCOA 4PXCA 2FL4A 4EVYA 2CNMA 4F8ZA 2QIRA 1VGYA 1XIXA 4UWJA 1P4NA 3IWGA 2ZPAA 3R9EA 1A2ZA 1BO4A 1Q7LA 4XPLA 4C2YA 2XEFA 3LMSA 3BLNA 1HDUA 2OZHA 5K8NA 1Z8WA 5LRGA 2JBJA 2B4DB 1ARLA 2VBQA 4X5KA 2AFMA 2RB7A 2PJ9A 2BSWA 4H6UA 4OC2A 4P4DA 3G3SA 1ELLP 5KTCA 4OP4A 3SJXA 2JDCA 3IU1A 2P6GA 4CGNA 4CRZB 7CPAA 4CAFA 2PJ2A 1LOKA 2QMLA 3ISXA 1LAPA 3H8FA 4KOSA 5HVHA 4II9A 2EWBA 1S3ZA 4FAIA 1J4JA 1XEBA 3GLJA 3D7DA 1IIDA 1AYEA 3DR8A 5F46A 2Q4VA 1WK4A 2X7BA 2YNEA 3JRUA 5DWMA 1Z2LA 4KOYA 3P2HA 1QSMA 1NSLA 5JQ4A 3IWWA 5H86A 3WR7A 3IFEA 2WYRA 4H2KA 2I00A 5GCNA 1ELMP 2Q51A 2Z11A 3NH8A 4AVCA 2OZUA 5E96A 1ZLIA 5THWA 4MBUA 4X3RA 1SQHA 4PPZA 4CYNA 4ZY0A 4NGQA 2D4OA 4DUKA 2AE6A 3TO7A 4MMOA 5CPAA 3SI0A 4MHPA 3SI1A 3TOBA 1M4GA 1KZFA 1WWZA 2CF4A 2PIYA 3RAMA 1Z4RA 3LACA 4QB9A 2DPTA 4HNWB 4AXVA 4AG7A 2PRQA 5F49A 1Y7RA 4HNXB 4DNCA 4R6TA 1U6MA 3F0AA 2ZW6A 3D8PA 1Y0RA 3ISZA 1FT7A 4P4BA 4YWYA 4P4FA 1M1DA 4QC6A 2FXFA 3KGQA 4UFWA 1ZG7A 4YFJA 2VZYA 5AGEA 5LYLA 3JUWA 1R57A 4R8FA 2FS5A 2ZW5A 1GYTA 3FEDA 1ZG8A 4UCNA 4M6IA 4NGPA 4UEEA 3TE4A 3KQZA 1PYTB 2EK9A 2V8DA 4OC0A 5K8MA 3B3VA 3B3WA 3VARA 3N7ZA 1B6BA 4LX9A 3SXOA 1AUGA 5HVGA 1QMUA 4R76A 4Q36A 3CZXA 1Y0YA 2B4DA 3HLPA 4CGPA 4EFDA 3S6FA 3FXTA 3WC7A 4IK2A 3H8GA 3TO9A 1CP6A 1BAVA 3OWCA 2PIZA 4K3NA 2A4NA 1HEEA 2V8GA 3D2PA 5I4MA 4XPDB 1TIQA 3SI2A 2J8NA 4KS9A 3EO4A 2YNCC 2PDOA 1M4DA 1IU8A 2O28A 4Q7AA 1QSNA 4B13A 2O53A 3FYNA 2GLFA 3KR4A 4PXBA 2ZW4A 4KOWA 4AVBA 2ATRA 1Q2CA 3T8WA 4OIDA 3W91A 3DDDA 4KVME 1MJAA 4P44A 4A32A 2PJ0A 4C2XA 5IB9A 2Z3LA 4F0YA 1GHEA 4KSAA 4CYQA 2ZXVA 2R8VA 1NSAA 1M4LA 3NH5A 2OU2A 3PBBA 3GUXA 2G3TA 4XPDC 4MHYA 5G1ZA 1BOBA 5F47A 1VIXA 4CYPA 2Q04A 2NYQA 2EBJA 3FEEA 5H84A 4CAEA 4MY3A 5C82A 5KTAA 2PC1A 2PCUA 2ZOGA 4UCPA 2FCKA 3BI1A 4B10A 4Q38A 4ZI6A 1ON0A 1S7KA 2HUZA 3B2YA 3NE7A 3RBUA 2EK8A 2AJ6A 3D7FA 1RTQA 2PJ1A 4BINA 3PB9X 2AFSA 2C6PA 4OAEA 4KUBA 2O4HA 3D7GA 2YNCA 4E8OA 3D66A 2YGWA 4FWUA 4TWEA 5BWAB 2ABZA 2HV2A 5KTDA 4NXYA 5LRKA 2IMOA 2Z10A 1QQ9A 2WPXA 4MHZA 1Z8LA 4J3GA 1ZO0A 1XMTA 3PB7X 3FF3A 3KZWA 2V8HA 2ZEHA 4KOUA 3KR5A 4GM5A 4MCQA 3QAHA 1CBXA 3BXMA 2OOTA 3B35A 4U5YA 4PXEA 3DR6A 4XPKA 2HB6A 4YRHA 2BL1A
chains in the Genus database with same CATH topology
3V38A 3PEIA 1LFWA 3CDXA 5CBMA 2PJ3A 2QJ8A 1TF9A 4LQGA 1F57A 2ZELA 4MXUA 4CPAA 5DS0A 4MCSA 2I3CA 2XEGA 1PCAA 4ZY2A 3NH4A 5JH9A 5HVFA 1YLOA 4FUUA 3FJUA 1LANA 3MRUA 3CT9A 1VHOA 5JGFA 3B3SA 4DJLA 4UF4A 3GB0A 3N5FA 4UIAA 3S9LA 4F9VA 4WJBA 2VL1A 2GU2A 3FMCA 4OC3A 4P4EA 2IJZA 3IJ3A 3K9TA 3FECA 2IQ6A 3IC1A 3KASA 1F2OA 1R43A 4A39A 3SJEA 5LYFA 1CPXA 2ZEEA 5D8NA 1Z5RA 4NGNA 4NGSA 2QYVA 4MRIA 1CG2A 4ONWA 2PVWA 4OC1A 5JM6A 5LYIA 2BOAA 4O23A 4PQAA 1ZLHA 2JBKA 2ZEMA 3VATA 4OC4A 3WT4A 3KQXA 4F9UA 3MN8A 4ZX9A 2GREA 4KSIA 2HC9A 4A94A 3CPXA 2PJ7A 4WWVA 6CPAA 2C1CA 1YW6A 2CTCA 3IIBA 4EMEA 4ZYQA 3D68A 3PBEA 4P10A 1VHEA 2F8HA 1DE4C 1DTDA 1LCPA 4NGRA 4R7MA 1OBRA 2PJBA 3I1UA 1IGBA 4NGMA 4BD9A 3B3TA 3DLJA 4UEZA 2Q43A 3D4UA 4IAVA 2CTBA 2XEIA 2G9DA 4UIBA 3H8EA 1ZG9A 5K8OA 5LRJA 4W9YA 4NJRA 1XJOA 2AFWA 4X2TA 4PXDA 4P4IA 4B6ZA 2PJCA 3HUVA 2ZOFA 3RZAA 2POKA 4NGTA 2GLJA 1AMPA 2ZEGA 2BO9A 1H8LA 2ZEFA 1XMBA 5LYDA 3B3CA 4P45A 2ZEDA 3BI0A 1HDQA 5F09A 1UWYA 2J9AA 3BHXA 3PB6X 3FH4A 3S9NA 3TC8A 3WC5A 1TKJA 3FX6A 1ARMA 3NA6A 4NFRA 2QVPA 3QNVA 1BPNA 3PB8X 4A37A 3K2KA 2XEJA 1CX8A 1KWMA 5HXDA 1EE3P 1XBUA 2ZEOA 4A38A 2PE3A 3B7IA 3FVLA 1BLLE 4YU9A 4P6YA 4MHNA 3L2NA 2FVGA 4OC5A 2PJ8A 1FNOA 3NFZA 3KL9A 3DGVA 1TKFA 2ZENA 1LAMA 4FBEA 3D7HA 2AFUA 1YMEA 2RFHA 3SJFA 4EWTA 2NSMA 3PB4X 8CPAA 4G1PA 5ELYA 2C6GA 3WABA 3IEHA 1F2PA 2WZNA 2F7VA 1CP7A 2JEWA 2ANPA 1R3NA 3V7ZA 1IY7A 3TX8A 4DYOA 3KHXA 2C6CA 3KI9A 1BPMA 2CIJA 3CPAA 1Y7EA 4X8IA 1XRYA 1YW4A 3PFOA 4JZ0A 2PJ4A 2PJ6A 3PFEA 1YSJA 1XFOA 5D29A 2OR4A 4RUHA 5K8PA 2PVVA 2PJ5A 4ZI6A 4TNUA 4JYWA 1TKHA 4P4JA 2AFXA 4ZX8A 3KHZA 4ZY1A 2DEAA 2V77A 2AFZA 4OMEA 4NJQA 3WC6A 3SJGA 4MCPA 1TXRA 3LWUA 1CPSA 3PRTA 4OIWA 3VH9A 4IHMA 4OKOA 2Q4ZA 2V8VA 1TF8A 2AFOA 3S9MA 2PJAA 2ZEPA 5J1QA 3IO1A 1JQGA 3D67A 4MCRA 4Z65A 4UEFA 2BCOA 4PXCA 4F8ZA 1VGYA 1Q7LA 2XEFA 3LMSA 1HDUA 5K8NA 5LRGA 2JBJA 1ARLA 2AFMA 2RB7A 4P4DA 2PJ9A 4OC2A 1ELLP 4OP4A 3SJXA 7CPAA 2PJ2A 1LOKA 3ISXA 1LAPA 3H8FA 5HVHA 2EWBA 4FAIA 3GLJA 3D7DA 1AYEA 3JRUA 1Z2LA 3IWWA 3IFEA 2WYRA 4H2KA 1ELMP 2Q51A 3NH8A 1ZLIA 5THWA 4ZY0A 4X3RA 4PPZA 4NGQA 4DUKA 4MMOA 5CPAA 3SI0A 4MHPA 3SI1A 2PIYA 2CF4A 3RAMA 4AXVA 2PRQA 4R6TA 1Y0RA 3ISZA 1FT7A 4P4BA 4YWYA 4P4FA 3KGQA 1ZG7A 5LYLA 4R8FA 1GYTA 3FEDA 1ZG8A 4NGPA 4UEEA 3KQZA 1PYTB 2EK9A 2V8DA 4OC0A 5K8MA 3B3VA 3B3WA 3VARA 5HVGA 1QMUA 4R76A 1Y0YA 3HLPA 4EFDA 3WC7A 4IK2A 3H8GA 1CP6A 1BAVA 4K3NA 2PIZA 5I4MA 1HEEA 2V8GA 3SI2A 4Q7AA 2O53A 4PXBA 2GLFA 3KR4A 3T8WA 4OIDA 4P44A 2PJ0A 5IB9A 1NSAA 1M4LA 3NH5A 3PBBA 3GUXA 4MHYA 1VIXA 2NYQA 3FEEA 2PCUA 2ZOGA 3BI1A 3B2YA 3RBUA 2EK8A 3D7FA 1RTQA 2PJ1A 3PB9X 2AFSA 2C6PA 2O4HA 3D7GA 3D66A 4TWEA 4FWUA 5LRKA 2ABZA 2IMOA 1QQ9A 4MHZA 1Z8LA 3PB7X 3FF3A 3KZWA 2V8HA 2ZEHA 3KR5A 4GM5A 4MCQA 1CBXA 3BXMA 2OOTA 3B35A 4PXEA 2HB6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V38 A;  3PEI A;  1LFW A;  3CDX A;  5CBM A;  2PJ3 A;  2QJ8 A;  1TF9 A;  4LQG A;  1F57 A;  2ZEL A;  4MXU A;  4CPA A;  5DS0 A;  4MCS A;  2I3C A;  2XEG A;  1PCA A;  4ZY2 A;  3NH4 A;  5JH9 A;  5HVF A;  1YLO A;  4FUU A;  3FJU A;  1LAN A;  3MRU A;  3CT9 A;  1VHO A;  5JGF A;  3B3S A;  4DJL A;  4UF4 A;  3GB0 A;  3N5F A;  4UIA A;  3S9L A;  4F9V A;  4WJB A;  2VL1 A;  2GU2 A;  3FMC A;  4OC3 A;  4P4E A;  2IJZ A;  3IJ3 A;  3K9T A;  3FEC A;  2IQ6 A;  3IC1 A;  3KAS A;  1F2O A;  1R43 A;  4A39 A;  3SJE A;  5LYF A;  1CPX A;  2ZEE A;  5D8N A;  1Z5R A;  4NGN A;  4NGS A;  2QYV A;  4MRI A;  1CG2 A;  4ONW A;  2PVW A;  4OC1 A;  5JM6 A;  5LYI A;  2BOA A;  4O23 A;  4PQA A;  1ZLH A;  2JBK A;  2ZEM A;  3VAT A;  4OC4 A;  3WT4 A;  3KQX A;  4F9U A;  3MN8 A;  4ZX9 A;  2GRE A;  4KSI A;  2HC9 A;  4A94 A;  3CPX A;  2PJ7 A;  4WWV A;  6CPA A;  2C1C A;  1YW6 A;  2CTC A;  3IIB A;  4EME A;  4ZYQ A;  3D68 A;  3PBE A;  4P10 A;  1VHE A;  2F8H A;  1DE4 C;  1DTD A;  1LCP A;  4NGR A;  4R7M A;  1OBR A;  2PJB A;  3I1U A;  1IGB A;  4NGM A;  4BD9 A;  3B3T A;  3DLJ A;  4UEZ A;  2Q43 A;  3D4U A;  4IAV A;  2CTB A;  2XEI A;  2G9D A;  4UIB A;  3H8E A;  1ZG9 A;  5K8O A;  5LRJ A;  4W9Y A;  4NJR A;  1XJO A;  2AFW A;  4X2T A;  4PXD A;  4P4I A;  4B6Z A;  2PJC A;  3HUV A;  2ZOF A;  3RZA A;  2POK A;  4NGT A;  2GLJ A;  1AMP A;  2ZEG A;  2BO9 A;  1H8L A;  2ZEF A;  1XMB A;  5LYD A;  3B3C A;  4P45 A;  2ZED A;  3BI0 A;  1HDQ A;  5F09 A;  1UWY A;  2J9A A;  3BHX A;  3PB6 X;  3FH4 A;  3S9N A;  3TC8 A;  3WC5 A;  1TKJ A;  3FX6 A;  1ARM A;  3NA6 A;  4NFR A;  2QVP A;  3QNV A;  1BPN A;  3PB8 X;  4A37 A;  3K2K A;  2XEJ A;  1CX8 A;  1KWM A;  5HXD A;  1EE3 P;  1XBU A;  2ZEO A;  4A38 A;  2PE3 A;  3B7I A;  3FVL A;  1BLL E;  4YU9 A;  4P6Y A;  4MHN A;  3L2N A;  2FVG A;  4OC5 A;  2PJ8 A;  1FNO A;  3NFZ A;  3KL9 A;  3DGV A;  1TKF A;  2ZEN A;  1LAM A;  4FBE A;  3D7H A;  2AFU A;  1YME A;  2RFH A;  3SJF A;  4EWT A;  2NSM A;  3PB4 X;  8CPA A;  4G1P A;  5ELY A;  2C6G A;  3WAB A;  3IEH A;  1F2P A;  2WZN A;  2F7V A;  1CP7 A;  2JEW A;  2ANP A;  1R3N A;  3V7Z A;  1IY7 A;  3TX8 A;  4DYO A;  3KHX A;  2C6C A;  3KI9 A;  1BPM A;  2CIJ A;  3CPA A;  1Y7E A;  4X8I A;  1XRY A;  1YW4 A;  3PFO A;  4JZ0 A;  2PJ4 A;  2PJ6 A;  3PFE A;  1YSJ A;  1XFO A;  5D29 A;  2OR4 A;  4RUH A;  5K8P A;  2PVV A;  2PJ5 A;  4ZI6 A;  4TNU A;  4JYW A;  1TKH A;  4P4J A;  2AFX A;  4ZX8 A;  3KHZ A;  4ZY1 A;  2DEA A;  2V77 A;  2AFZ A;  4OME A;  4NJQ A;  3WC6 A;  3SJG A;  4MCP A;  1TXR A;  3LWU A;  1CPS A;  3PRT A;  4OIW A;  3VH9 A;  4IHM A;  4OKO A;  2Q4Z A;  2V8V A;  1TF8 A;  2AFO A;  3S9M A;  2PJA A;  2ZEP A;  5J1Q A;  3IO1 A;  1JQG A;  3D67 A;  4MCR A;  4Z65 A;  4UEF A;  2BCO A;  4PXC A;  4F8Z A;  1VGY A;  1Q7L A;  2XEF A;  3LMS A;  1HDU A;  5K8N A;  5LRG A;  2JBJ A;  1ARL A;  2AFM A;  2RB7 A;  4P4D A;  2PJ9 A;  4OC2 A;  1ELL P;  4OP4 A;  3SJX A;  7CPA A;  2PJ2 A;  1LOK A;  3ISX A;  1LAP A;  3H8F A;  5HVH A;  2EWB A;  4FAI A;  3GLJ A;  3D7D A;  1AYE A;  3JRU A;  1Z2L A;  3IWW A;  3IFE A;  2WYR A;  4H2K A;  1ELM P;  2Q51 A;  3NH8 A;  1ZLI A;  5THW A;  4ZY0 A;  4X3R A;  4PPZ A;  4NGQ A;  4DUK A;  4MMO A;  5CPA A;  3SI0 A;  4MHP A;  3SI1 A;  2PIY A;  2CF4 A;  3RAM A;  4AXV A;  2PRQ A;  4R6T A;  1Y0R A;  3ISZ A;  1FT7 A;  4P4B A;  4YWY A;  4P4F A;  3KGQ A;  1ZG7 A;  5LYL A;  4R8F A;  1GYT A;  3FED A;  1ZG8 A;  4NGP A;  4UEE A;  3KQZ A;  1PYT B;  2EK9 A;  2V8D A;  4OC0 A;  5K8M A;  3B3V A;  3B3W A;  3VAR A;  5HVG A;  1QMU A;  4R76 A;  1Y0Y A;  3HLP A;  4EFD A;  3WC7 A;  4IK2 A;  3H8G A;  1CP6 A;  1BAV A;  4K3N A;  2PIZ A;  5I4M A;  1HEE A;  2V8G A;  3SI2 A;  4Q7A A;  2O53 A;  4PXB A;  2GLF A;  3KR4 A;  3T8W A;  4OID A;  4P44 A;  2PJ0 A;  5IB9 A;  1NSA A;  1M4L A;  3NH5 A;  3PBB A;  3GUX A;  4MHY A;  1VIX A;  2NYQ A;  3FEE A;  2PCU A;  2ZOG A;  3BI1 A;  3B2Y A;  3RBU A;  2EK8 A;  3D7F A;  1RTQ A;  2PJ1 A;  3PB9 X;  2AFS A;  2C6P A;  2O4H A;  3D7G A;  3D66 A;  4TWE A;  4FWU A;  5LRK A;  2ABZ A;  2IMO A;  1QQ9 A;  4MHZ A;  1Z8L A;  3PB7 X;  3FF3 A;  3KZW A;  2V8H A;  2ZEH A;  3KR5 A;  4GM5 A;  4MCQ A;  1CBX A;  3BXM A;  2OOT A;  3B35 A;  4PXE A;  2HB6 A; 
#chains in the Genus database with same CATH topology
 3G8W A;  3V38 A;  3PEI A;  4B5P B;  3VWE A;  1LFW A;  2Z3M A;  3CDX A;  4K30 A;  4B14 A;  5IV0 A;  2FIA A;  5IB0 A;  5CBM A;  1KUY A;  4KZT A;  1NMT A;  2PJ3 A;  2QJ8 A;  4A95 A;  1TF9 A;  4HNY B;  1F57 A;  3H5Z A;  4KOR A;  4LQG A;  2ZEL A;  2EVN A;  3FRM A;  4MFJ A;  4MFZ A;  4MXU A;  4CS0 B;  3R95 A;  5J8C A;  1IYK A;  2ARH A;  2B3U A;  5DS0 A;  4CPA A;  4UFV A;  1RO5 A;  2GAN A;  4MCS A;  2I3C A;  2XEG A;  3KKW A;  2D4P A;  3CXS A;  1PCA A;  3TO6 A;  1RXT A;  4QBJ A;  4ZY2 A;  3NH4 A;  3V8I A;  1Z9U A;  3IWE A;  5JH9 A;  2Z3K A;  2JDD A;  4OAD A;  5HVF A;  1YLO A;  4FUU A;  2B58 A;  4R3L A;  4F6A A;  3FJU A;  4HPS A;  1LAN A;  3MRU A;  3RYO A;  5A27 A;  5DWN A;  2C27 A;  3CT9 A;  1Z4E A;  4U9Z A;  1VHO A;  5AG5 A;  4AG9 A;  5JGF A;  3B3S A;  4LQ6 A;  1IIC A;  2IL4 A;  4FD7 A;  4DJL A;  4UF4 A;  4M6H A;  4KLW A;  3GB0 A;  3N5F A;  4UIA A;  4MY0 A;  3FNC A;  3QB8 A;  3S9L A;  4F9V A;  1XE4 A;  2VZZ A;  4WJB A;  1PU9 A;  2WUU A;  2JEV A;  3FIX A;  4JLY A;  1S7L A;  2VL1 A;  4CAW A;  4C68 A;  2RC4 A;  2GU2 A;  3FMC A;  4OC3 A;  4P4E A;  2IJZ A;  2VQY A;  3RNZ A;  3IJ3 A;  3RO0 A;  3K9T A;  1M4I A;  3EY5 A;  3FB3 A;  3PZJ A;  4H89 A;  3FEC A;  4KOT A;  2IQ6 A;  3IC1 A;  4CAV A;  3KAS A;  1F2O A;  1R43 A;  2B3V A;  4A39 A;  4A2Z A;  3SJE A;  2OH1 A;  5LYF A;  3VWD A;  1CPX A;  2ZEE A;  3PP9 A;  4MFL A;  5D8N A;  1Z5R A;  3H4Q A;  3QAY A;  4I49 A;  1YX0 A;  4NGN A;  2QEC A;  3F5B A;  4NGS A;  5C88 A;  2QYV A;  5G20 A;  4MRI A;  3PGP A;  4MHD A;  1CG2 A;  4ONW A;  4F0X A;  2PVW A;  3IGR A;  3SXN A;  2OZG A;  4M6G A;  3T9Y A;  2K5T A;  4KOX A;  4OC1 A;  4CRY B;  1CJW A;  1NE9 A;  3TT2 A;  5JM6 A;  5LYI A;  3D2M A;  2BOA A;  4O23 A;  4PQA A;  4U9Y A;  2J8M A;  1ZLH A;  2JBK A;  2WPW A;  2ZEM A;  3JTK A;  3R96 A;  1P0H A;  2PR1 A;  3VAT A;  5IX3 A;  4OC4 A;  2J8R A;  3TOA A;  1MJ9 A;  5CNP A;  3WT4 A;  3JVN A;  3KQX A;  4F9U A;  3MN8 A;  4ZX9 A;  1MK4 A;  2GRE A;  4KSI A;  2HC9 A;  4A94 A;  2Q4Y A;  3CPX A;  2PJ7 A;  4WWV A;  3GYA A;  4JD6 A;  4Y49 B;  3T90 A;  4UFX A;  4IUS A;  1Y9K A;  6CPA A;  1KUV A;  5G21 A;  2C1C A;  1YW6 A;  2CTC A;  3IIB A;  4MFQ A;  4EME A;  2CXA A;  4ZYQ A;  3CXQ A;  4RI1 A;  3D68 A;  1VHS A;  2GFQ A;  1QSO A;  3PBE A;  4GS4 A;  1VHE A;  2F8H A;  4P10 A;  1YK3 A;  1DE4 C;  1DTD A;  4UBR A;  4BMH A;  1LCP A;  4NGR A;  4RS2 A;  4R7M A;  2Z3P A;  4R3K A;  1B87 A;  1OBR A;  2PJB A;  3I1U A;  3MGD A;  3W6X A;  1IGB A;  2DF5 A;  4NGM A;  1OZP A;  5AG7 A;  2REE A;  3B3T A;  3DLJ A;  1S7N A;  4BD9 A;  4UEZ A;  4Y49 C;  2Q43 A;  3D4U A;  3EFA A;  3TTH A;  4KOV A;  1VKC A;  4IAV A;  4XNH B;  4KLV A;  4C7I A;  2CTB A;  2XEI A;  2G9D A;  4UIB A;  2Q44 A;  4L89 A;  3H8E A;  4UA3 A;  1ZG9 A;  3S6K A;  2FIW A;  5LRJ A;  4W9Y A;  5K8O A;  2ZW7 A;  4NJR A;  3BJ8 A;  1XJO A;  2AFW A;  4X2T A;  4MJ8 A;  5ISV A;  4NEX A;  4PXD A;  2R98 A;  3NE8 A;  4P4I A;  4M85 A;  4B6Z A;  2PJC A;  3HUV A;  2R7H A;  3CXP A;  3IU2 A;  4JJX A;  4RN7 A;  4H6Z A;  4BBH A;  2ZOF A;  3RZA A;  1M44 A;  2POK A;  4A31 A;  2Z3N A;  4NGT A;  1S7F A;  3EXN A;  2GLJ A;  1YLE A;  4XNH C;  3R9G A;  1AMP A;  4CYO A;  2YND A;  2VI7 A;  5HH1 A;  1YVK A;  2ZEG A;  2DXQ A;  4HKF A;  2BO9 A;  3UY5 A;  1H8L A;  4ZGY B;  2ZEF A;  2F5I A;  1XMB A;  4PSW A;  1S5K A;  3BJ7 A;  3P2F A;  5LYD A;  3B3C A;  4P45 A;  1I12 A;  2ZED A;  4M3S A;  4YGO A;  3BI0 A;  1HDQ A;  1IOF A;  5F09 A;  1UWY A;  2J9A A;  1N71 A;  3DNS A;  3GIU A;  4QUS A;  5EC4 A;  2EO8 A;  1QSR A;  1K4J A;  1FY7 A;  2PQ8 A;  5AG4 A;  3BHX A;  4R9M A;  4B12 A;  3PB6 X;  2PSW A;  3FH4 A;  3S9N A;  3DSB A;  3TC8 A;  3WC5 A;  5I0C A;  1TKJ A;  4R57 A;  2Q7S A;  3FX6 A;  1S60 A;  1ARM A;  1Y9W A;  3NA6 A;  1UFH A;  2QVP A;  2H5M A;  1BPN A;  3PB8 X;  3QNV A;  4FD5 A;  4NFR A;  4R87 A;  3ZZI A;  4A37 A;  1IYL A;  2GIV A;  4LUA A;  3K2K A;  3GY9 A;  2WSA A;  2FT0 A;  2XEJ A;  1KUX A;  4QVT A;  1CX8 A;  1KWM A;  5HXD A;  2B5G A;  3TCV A;  4B11 A;  3EC4 A;  1EE3 P;  3FBU A;  1XBU A;  4A30 A;  1Q2D A;  3W6S A;  2ZEO A;  3SHP A;  4E2A A;  1YR0 A;  4OLL A;  3LD2 A;  4JXQ A;  4A38 A;  2PE3 A;  5A28 A;  3B7I A;  3FVL A;  1BLL E;  4YU9 A;  3R9F A;  4P6Y A;  5JPH A;  4B5O A;  2OB0 A;  4MHN A;  3L2N A;  4JWP A;  2FVG A;  3S6G A;  4OC5 A;  2PJ8 A;  4KVO E;  1FNO A;  3NFZ A;  1XOV A;  3KL9 A;  3DGV A;  1IB1 E;  1TKF A;  2ZEN A;  4UWI A;  4ZBG A;  4JXR A;  1LAM A;  1YVO A;  4FBE A;  2Y0M A;  4A33 A;  1I1D A;  1PUA A;  3ZJ0 A;  1I21 A;  4CAX A;  1L0C A;  4B5P A;  2JLM A;  2PRB A;  4KVX A;  2R1I A;  3D7H A;  2AFU A;  4C7H A;  3S6H A;  1YME A;  2I79 A;  2Z3O A;  2RFH A;  2CNS A;  2FE7 A;  5EMI A;  3SJF A;  2G3A A;  3LOD A;  4EWT A;  2NSM A;  2ODF A;  4KUA A;  4CGL A;  3PB4 X;  8CPA A;  4NSQ A;  4G1P A;  5J8F A;  1Z8T A;  1QST A;  1V0C A;  2C6G A;  2NMT A;  1LRZ A;  2GE3 A;  5ELY A;  3IEH A;  3WAB A;  1F2P A;  2BEI A;  2F7V A;  2WZN A;  1CP7 A;  2JEW A;  2Q7B A;  2ANP A;  3I9S A;  3GKR A;  1R3N A;  3V7Z A;  1IY7 A;  3TX8 A;  4L8A A;  4NCZ A;  3B8G A;  4DYO A;  3KHX A;  4GXH A;  2C6C A;  2P6E A;  3KI9 A;  4MFK A;  2CY2 A;  2B5G B;  1BPM A;  3F8K A;  2CIJ A;  3CPA A;  4PK3 A;  1Y7E A;  4X8I A;  1XRY A;  1YW4 A;  3PFO A;  4JZ0 A;  2PJ4 A;  1X10 A;  1Q2Y A;  4PV6 A;  1MJB A;  3D3S A;  2PJ6 A;  3I3G A;  1YSJ A;  1XFO A;  1YQE A;  3PFE A;  3R1K A;  5D29 A;  2B4B A;  2OR4 A;  4E0A A;  4RUH A;  5HMN A;  3TFY A;  5K8P A;  2PR8 A;  3E0K A;  2G0B A;  2PVV A;  2PJ5 A;  2VEZ A;  1XF8 A;  4TNU A;  4UCM A;  1Z8X A;  4JYW A;  5G22 A;  1TKH A;  2DPS A;  4P4J A;  2AFX A;  5FVJ A;  4ZX8 A;  4PK2 A;  4C2Z A;  3KHZ A;  4ZY1 A;  2DEA A;  3K9U A;  4PSX A;  2V77 A;  1X12 A;  2AFZ A;  2P0W A;  4NJQ A;  4OME A;  3WC6 A;  1YGH A;  3SJG A;  4FD6 A;  4MFP A;  4ORF A;  1JWQ A;  1IOI A;  1TXR A;  3LWU A;  4MCP A;  5F48 A;  2EUI A;  4AB7 A;  1CPS A;  3PRT A;  4ONU A;  4OIW A;  4FD4 A;  2KCW A;  3VH9 A;  4CGO A;  4IHM A;  4OKO A;  4IF5 A;  2Q4Z A;  5AG6 A;  2V8V A;  2Q0Y A;  4AVA A;  1TF8 A;  3A9L A;  1CM0 A;  2AFO A;  4MI4 A;  2CNT A;  2P6F A;  2REF A;  3S9M A;  4CGM A;  2PJA A;  2ZEP A;  3C26 A;  2Z0Z A;  2VXK A;  2FSR A;  4KSF A;  5EBV A;  5J1Q A;  2BUE A;  3IO1 A;  1YRE A;  4NF1 A;  2HQY A;  1JQG A;  3D67 A;  4MCR A;  4Z65 A;  4UEF A;  2BCO A;  4PXC A;  2FL4 A;  4EVY A;  2CNM A;  4F8Z A;  2QIR A;  1VGY A;  1XIX A;  4UWJ A;  1P4N A;  3IWG A;  2ZPA A;  3R9E A;  1A2Z A;  1BO4 A;  1Q7L A;  4XPL A;  4C2Y A;  2XEF A;  3LMS A;  3BLN A;  1HDU A;  2OZH A;  5K8N A;  1Z8W A;  5LRG A;  2JBJ A;  2B4D B;  1ARL A;  2VBQ A;  4X5K A;  2AFM A;  2RB7 A;  2PJ9 A;  2BSW A;  4H6U A;  4OC2 A;  4P4D A;  3G3S A;  1ELL P;  5KTC A;  4OP4 A;  3SJX A;  2JDC A;  3IU1 A;  2P6G A;  4CGN A;  4CRZ B;  7CPA A;  4CAF A;  2PJ2 A;  1LOK A;  2QML A;  3ISX A;  1LAP A;  3H8F A;  4KOS A;  5HVH A;  4II9 A;  2EWB A;  1S3Z A;  4FAI A;  1J4J A;  1XEB A;  3GLJ A;  3D7D A;  1IID A;  1AYE A;  3DR8 A;  5F46 A;  2Q4V A;  1WK4 A;  2X7B A;  2YNE A;  3JRU A;  5DWM A;  1Z2L A;  4KOY A;  3P2H A;  1QSM A;  1NSL A;  5JQ4 A;  3IWW A;  5H86 A;  3WR7 A;  3IFE A;  2WYR A;  4H2K A;  2I00 A;  5GCN A;  1ELM P;  2Q51 A;  2Z11 A;  3NH8 A;  4AVC A;  2OZU A;  5E96 A;  1ZLI A;  5THW A;  4MBU A;  4X3R A;  1SQH A;  4PPZ A;  4CYN A;  4ZY0 A;  4NGQ A;  2D4O A;  4DUK A;  2AE6 A;  3TO7 A;  4MMO A;  5CPA A;  3SI0 A;  4MHP A;  3SI1 A;  3TOB A;  1M4G A;  1KZF A;  1WWZ A;  2CF4 A;  2PIY A;  3RAM A;  1Z4R A;  3LAC A;  4QB9 A;  2DPT A;  4HNW B;  4AXV A;  4AG7 A;  2PRQ A;  5F49 A;  1Y7R A;  4HNX B;  4DNC A;  4R6T A;  1U6M A;  3F0A A;  2ZW6 A;  3D8P A;  1Y0R A;  3ISZ A;  1FT7 A;  4P4B A;  4YWY A;  4P4F A;  1M1D A;  4QC6 A;  2FXF A;  3KGQ A;  4UFW A;  1ZG7 A;  4YFJ A;  2VZY A;  5AGE A;  5LYL A;  3JUW A;  1R57 A;  4R8F A;  2FS5 A;  2ZW5 A;  1GYT A;  3FED A;  1ZG8 A;  4UCN A;  4M6I A;  4NGP A;  4UEE A;  3TE4 A;  3KQZ A;  1PYT B;  2EK9 A;  2V8D A;  4OC0 A;  5K8M A;  3B3V A;  3B3W A;  3VAR A;  3N7Z A;  1B6B A;  4LX9 A;  3SXO A;  1AUG A;  5HVG A;  1QMU A;  4R76 A;  4Q36 A;  3CZX A;  1Y0Y A;  2B4D A;  3HLP A;  4CGP A;  4EFD A;  3S6F A;  3FXT A;  3WC7 A;  4IK2 A;  3H8G A;  3TO9 A;  1CP6 A;  1BAV A;  3OWC A;  2PIZ A;  4K3N A;  2A4N A;  1HEE A;  2V8G A;  3D2P A;  5I4M A;  4XPD B;  1TIQ A;  3SI2 A;  2J8N A;  4KS9 A;  3EO4 A;  2YNC C;  2PDO A;  1M4D A;  1IU8 A;  2O28 A;  4Q7A A;  1QSN A;  4B13 A;  2O53 A;  3FYN A;  2GLF A;  3KR4 A;  4PXB A;  2ZW4 A;  4KOW A;  4AVB A;  2ATR A;  1Q2C A;  3T8W A;  4OID A;  3W91 A;  3DDD A;  4KVM E;  1MJA A;  4P44 A;  4A32 A;  2PJ0 A;  4C2X A;  5IB9 A;  2Z3L A;  4F0Y A;  1GHE A;  4KSA A;  4CYQ A;  2ZXV A;  2R8V A;  1NSA A;  1M4L A;  3NH5 A;  2OU2 A;  3PBB A;  3GUX A;  2G3T A;  4XPD C;  4MHY A;  5G1Z A;  1BOB A;  5F47 A;  1VIX A;  4CYP A;  2Q04 A;  2NYQ A;  2EBJ A;  3FEE A;  5H84 A;  4CAE A;  4MY3 A;  5C82 A;  5KTA A;  2PC1 A;  2PCU A;  2ZOG A;  4UCP A;  2FCK A;  3BI1 A;  4B10 A;  4Q38 A;  4ZI6 A;  1ON0 A;  1S7K A;  2HUZ A;  3B2Y A;  3NE7 A;  3RBU A;  2EK8 A;  2AJ6 A;  3D7F A;  1RTQ A;  2PJ1 A;  4BIN A;  3PB9 X;  2AFS A;  2C6P A;  4OAE A;  4KUB A;  2O4H A;  3D7G A;  2YNC A;  4E8O A;  3D66 A;  2YGW A;  4FWU A;  4TWE A;  5BWA B;  2ABZ A;  2HV2 A;  5KTD A;  4NXY A;  5LRK A;  2IMO A;  2Z10 A;  1QQ9 A;  2WPX A;  4MHZ A;  1Z8L A;  4J3G A;  1ZO0 A;  1XMT A;  3PB7 X;  3FF3 A;  3KZW A;  2V8H A;  2ZEH A;  4KOU A;  3KR5 A;  4GM5 A;  4MCQ A;  3QAH A;  1CBX A;  3BXM A;  2OOT A;  3B35 A;  4U5Y A;  4PXE A;  3DR6 A;  4XPK A;  2HB6 A;  4YRH A;  2BL1 A; 
#chains in the Genus database with same CATH homology
 3V38 A;  3PEI A;  1LFW A;  3CDX A;  5CBM A;  2PJ3 A;  2QJ8 A;  1TF9 A;  4LQG A;  1F57 A;  2ZEL A;  4MXU A;  4CPA A;  5DS0 A;  4MCS A;  2I3C A;  2XEG A;  1PCA A;  4ZY2 A;  3NH4 A;  5JH9 A;  5HVF A;  1YLO A;  4FUU A;  3FJU A;  1LAN A;  3MRU A;  3CT9 A;  1VHO A;  5JGF A;  3B3S A;  4DJL A;  4UF4 A;  3GB0 A;  3N5F A;  4UIA A;  3S9L A;  4F9V A;  4WJB A;  2VL1 A;  2GU2 A;  3FMC A;  4OC3 A;  4P4E A;  2IJZ A;  3IJ3 A;  3K9T A;  3FEC A;  2IQ6 A;  3IC1 A;  3KAS A;  1F2O A;  1R43 A;  4A39 A;  3SJE A;  5LYF A;  1CPX A;  2ZEE A;  5D8N A;  1Z5R A;  4NGN A;  4NGS A;  2QYV A;  4MRI A;  1CG2 A;  4ONW A;  2PVW A;  4OC1 A;  5JM6 A;  5LYI A;  2BOA A;  4O23 A;  4PQA A;  1ZLH A;  2JBK A;  2ZEM A;  3VAT A;  4OC4 A;  3WT4 A;  3KQX A;  4F9U A;  3MN8 A;  4ZX9 A;  2GRE A;  4KSI A;  2HC9 A;  4A94 A;  3CPX A;  2PJ7 A;  4WWV A;  6CPA A;  2C1C A;  1YW6 A;  2CTC A;  3IIB A;  4EME A;  4ZYQ A;  3D68 A;  3PBE A;  4P10 A;  1VHE A;  2F8H A;  1DE4 C;  1DTD A;  1LCP A;  4NGR A;  4R7M A;  1OBR A;  2PJB A;  3I1U A;  1IGB A;  4NGM A;  4BD9 A;  3B3T A;  3DLJ A;  4UEZ A;  2Q43 A;  3D4U A;  4IAV A;  2CTB A;  2XEI A;  2G9D A;  4UIB A;  3H8E A;  1ZG9 A;  5K8O A;  5LRJ A;  4W9Y A;  4NJR A;  1XJO A;  2AFW A;  4X2T A;  4PXD A;  4P4I A;  4B6Z A;  2PJC A;  3HUV A;  2ZOF A;  3RZA A;  2POK A;  4NGT A;  2GLJ A;  1AMP A;  2ZEG A;  2BO9 A;  1H8L A;  2ZEF A;  1XMB A;  5LYD A;  3B3C A;  4P45 A;  2ZED A;  3BI0 A;  1HDQ A;  5F09 A;  1UWY A;  2J9A A;  3BHX A;  3PB6 X;  3FH4 A;  3S9N A;  3TC8 A;  3WC5 A;  1TKJ A;  3FX6 A;  1ARM A;  3NA6 A;  4NFR A;  2QVP A;  3QNV A;  1BPN A;  3PB8 X;  4A37 A;  3K2K A;  2XEJ A;  1CX8 A;  1KWM A;  5HXD A;  1EE3 P;  1XBU A;  2ZEO A;  4A38 A;  2PE3 A;  3B7I A;  3FVL A;  1BLL E;  4YU9 A;  4P6Y A;  4MHN A;  3L2N A;  2FVG A;  4OC5 A;  2PJ8 A;  1FNO A;  3NFZ A;  3KL9 A;  3DGV A;  1TKF A;  2ZEN A;  1LAM A;  4FBE A;  3D7H A;  2AFU A;  1YME A;  2RFH A;  3SJF A;  4EWT A;  2NSM A;  3PB4 X;  8CPA A;  4G1P A;  5ELY A;  2C6G A;  3WAB A;  3IEH A;  1F2P A;  2WZN A;  2F7V A;  1CP7 A;  2JEW A;  2ANP A;  1R3N A;  3V7Z A;  1IY7 A;  3TX8 A;  4DYO A;  3KHX A;  2C6C A;  3KI9 A;  1BPM A;  2CIJ A;  3CPA A;  1Y7E A;  4X8I A;  1XRY A;  1YW4 A;  3PFO A;  4JZ0 A;  2PJ4 A;  2PJ6 A;  3PFE A;  1YSJ A;  1XFO A;  5D29 A;  2OR4 A;  4RUH A;  5K8P A;  2PVV A;  2PJ5 A;  4ZI6 A;  4TNU A;  4JYW A;  1TKH A;  4P4J A;  2AFX A;  4ZX8 A;  3KHZ A;  4ZY1 A;  2DEA A;  2V77 A;  2AFZ A;  4OME A;  4NJQ A;  3WC6 A;  3SJG A;  4MCP A;  1TXR A;  3LWU A;  1CPS A;  3PRT A;  4OIW A;  3VH9 A;  4IHM A;  4OKO A;  2Q4Z A;  2V8V A;  1TF8 A;  2AFO A;  3S9M A;  2PJA A;  2ZEP A;  5J1Q A;  3IO1 A;  1JQG A;  3D67 A;  4MCR A;  4Z65 A;  4UEF A;  2BCO A;  4PXC A;  4F8Z A;  1VGY A;  1Q7L A;  2XEF A;  3LMS A;  1HDU A;  5K8N A;  5LRG A;  2JBJ A;  1ARL A;  2AFM A;  2RB7 A;  4P4D A;  2PJ9 A;  4OC2 A;  1ELL P;  4OP4 A;  3SJX A;  7CPA A;  2PJ2 A;  1LOK A;  3ISX A;  1LAP A;  3H8F A;  5HVH A;  2EWB A;  4FAI A;  3GLJ A;  3D7D A;  1AYE A;  3JRU A;  1Z2L A;  3IWW A;  3IFE A;  2WYR A;  4H2K A;  1ELM P;  2Q51 A;  3NH8 A;  1ZLI A;  5THW A;  4ZY0 A;  4X3R A;  4PPZ A;  4NGQ A;  4DUK A;  4MMO A;  5CPA A;  3SI0 A;  4MHP A;  3SI1 A;  2PIY A;  2CF4 A;  3RAM A;  4AXV A;  2PRQ A;  4R6T A;  1Y0R A;  3ISZ A;  1FT7 A;  4P4B A;  4YWY A;  4P4F A;  3KGQ A;  1ZG7 A;  5LYL A;  4R8F A;  1GYT A;  3FED A;  1ZG8 A;  4NGP A;  4UEE A;  3KQZ A;  1PYT B;  2EK9 A;  2V8D A;  4OC0 A;  5K8M A;  3B3V A;  3B3W A;  3VAR A;  5HVG A;  1QMU A;  4R76 A;  1Y0Y A;  3HLP A;  4EFD A;  3WC7 A;  4IK2 A;  3H8G A;  1CP6 A;  1BAV A;  4K3N A;  2PIZ A;  5I4M A;  1HEE A;  2V8G A;  3SI2 A;  4Q7A A;  2O53 A;  4PXB A;  2GLF A;  3KR4 A;  3T8W A;  4OID A;  4P44 A;  2PJ0 A;  5IB9 A;  1NSA A;  1M4L A;  3NH5 A;  3PBB A;  3GUX A;  4MHY A;  1VIX A;  2NYQ A;  3FEE A;  2PCU A;  2ZOG A;  3BI1 A;  3B2Y A;  3RBU A;  2EK8 A;  3D7F A;  1RTQ A;  2PJ1 A;  3PB9 X;  2AFS A;  2C6P A;  2O4H A;  3D7G A;  3D66 A;  4TWE A;  4FWU A;  5LRK A;  2ABZ A;  2IMO A;  1QQ9 A;  4MHZ A;  1Z8L A;  3PB7 X;  3FF3 A;  3KZW A;  2V8H A;  2ZEH A;  3KR5 A;  4GM5 A;  4MCQ A;  1CBX A;  3BXM A;  2OOT A;  3B35 A;  4PXE A;  2HB6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...