4UEZA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-leu-phe-y(po2ch2)-phe-oh
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
306
structure length
306
Chain Sequence
STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN CARBOXYPEPTIDASE A1
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uezA00
1XMBA 1LAMA 3BHXA 4MCRA 3NH4A 2ZEGA 1VHOA 3VATA 1RTQA 4MHYA 3D66A 1ZG7A 2ZEDA 4OMEA 3PB9X 2XEFA 2WYRA 3WC6A 3FEEA 4MMOA 3K9TA 4DUKA 2NYQA 2CF4A 2PVWA 1XRYA 2GLFA 3BI1A 4R76A 3D7DA 5THWA 1YMEA 2ZELA 4RUHA 5J1QA 5DS0A 4AXVA 4MHZA 3H8GA 1ELLP 3VH9A 2EWBA 4MHPA 2C6GA 3S9LA 1XFOA 4ZX8A 3D7FA 4FUUA 1Y0RA 1CP7A 6CPAA 1CX8A 4UF4A 3KZWA 3L2NA 1FNOA 3FVLA 3B3WA 1LFWA 1NSAA 2PE3A 4P45A 4NGQA 3PRTA 4K3NA 4PXEA 2PJ8A 1QQ9A 4JZ0A 4KSIA 4B6ZA 1Z5RA 3PB7X 1R43A 4P4BA 1ARMA 2AFMA 2BO9A 4ZY2A 4BD9A 4F9UA 3B3VA 2XEIA 4TWEA 4P4IA 4OKOA 3N5FA 3FEDA 5CPAA 4ZY1A 1ZG9A 2VL1A 4PXCA 2C1CA 2PJ1A 1VGYA 2AFZA 1F2OA 4GM5A 3IJ3A 2IMOA 5JH9A 3WT4A 3FJUA 2CTBA 2ZEFA 3KR5A 2ZENA 2HB6A 3FMCA 3KQXA 2V8VA 3FH4A 4X2TA 3PB6X 4UEZA 1PYTB 1TKJA 2AFXA 4X8IA 3D4UA 4OIDA 5LYDA 3IO1A 3WC7A 4UIBA 3JRUA 5HVHA 4O23A 5HVFA 1VHEA 1OBRA 4FBEA 1Y7EA 1YW4A 1Y0YA 1CBXA 2GU2A 3KASA 5LYIA 4P44A 2Q4ZA 2PIZA 3B3SA 4OC0A 3MRUA 3GB0A 4NGPA 2POKA 1CG2A 4PXBA 3CPXA 3CDXA 1ARLA 1F2PA 4WJBA 4WWVA 2I3CA 4R7MA 2C6PA 8CPAA 2ZEHA 1UWYA 3NH5A 3DGVA 4NFRA 5LYLA 2FVGA 2ABZA 3ISZA 3CPAA 1JQGA 1AMPA 4H2KA 1AYEA 2Q43A 4MHNA 4NGSA 2WZNA 4UIAA 2JBKA 3GLJA 2PJAA 5JM6A 4R6TA 3DLJA 2AFUA 3D67A 4P4DA 5K8NA 3PB8X 2CTCA 3SJXA 1YSJA 2PJ6A 2F8HA 1ZG8A 1BPMA 2EK8A 4OC4A 1YLOA 2F7VA 3PEIA 2PJ2A 5K8OA 3S9NA 1LOKA 4P4EA 2OR4A 2QYVA 3IC1A 2CIJA 4CPAA 2C6CA 4A39A 1YW6A 2HC9A 3PB4X 3S9MA 2XEJA 4R8FA 2PJ0A 1PCAA 3D7HA 3RBUA 2PJ3A 3BI0A 2ZEEA 1TF8A 3SI1A 1VIXA 1F57A 4P4JA 3K2KA 3D7GA 4OC5A 4YU9A 4OC2A 2QVPA 3MN8A 1Z8LA 4P6YA 4Z65A 1BLLE 2ZEPA 2PJCA 2O53A 2O4HA 5CBMA 4OIWA 4EFDA 4EMEA 2PCUA 4DYOA 5LYFA 4ZYQA 2AFWA 3WC5A 3IIBA 1DTDA 5IB9A 5K8PA 2ZOFA 3NFZA 1HDUA 4OC3A 4NGMA 2QJ8A 1QMUA 4ONWA 5D29A 4MCSA 4G1PA 2PJBA 3LWUA 2GREA 3CT9A 4A38A 4Q7AA 3IEHA 1LAPA 4IHMA 4PQAA 5D8NA 3RAMA 1FT7A 2ZEOA 1BAVA 1GYTA 4JYWA 2AFOA 4MRIA 3FX6A 2PRQA 4ZY0A 4OP4A 2AFSA 2PJ9A 2BOAA 1R3NA 3KR4A 1LANA 3LMSA 2PJ7A 1HEEA 3I1UA 3ISXA 3PFOA 1Z2LA 4NGTA 4X3RA 2V77A 1HDQA 1TKFA 3NH8A 4P4FA 3KI9A 3H8EA 2PJ4A 3QNVA 2EK9A 1CP6A 2Q51A 5K8MA 4LQGA 3BXMA 4P10A 3IFEA 2RB7A 5HVGA 1IGBA 2V8DA 3PBBA 3B2YA 1Q7LA 2ZOGA 3SJEA 2IJZA 1ZLIA 1H8LA 3D68A 3V7ZA 4NGNA 2PJ5A 2J9AA 4F9VA 4FWUA 3TX8A 3B3TA 1IY7A 2IQ6A 4EWTA 3PFEA 2DEAA 1M4LA 3KL9A 4MCPA 3HLPA 7CPAA 4ZI6A 1EE3P 3SJFA 5LRKA 3B35A 2G9DA 4ZX9A 2BCOA 1ELMP 3FF3A 3SI2A 4DJLA 4MCQA 1TKHA 3KHZA 2XEGA 3SJGA 1DE4C 1TF9A 3PBEA 4UEEA 5I4MA 3B3CA 4IK2A 1TXRA 4OC1A 2JEWA 3KHXA 2V8HA 5F09A 2PVVA 1BPNA 3KQZA 4PXDA 2OOTA 3NA6A 1ZLHA 2NSMA 4FAIA 2V8GA 3IWWA 3GUXA 1CPSA 4MXUA 4PPZA 4UEFA 1XBUA 3T8WA 1KWMA 3RZAA 5ELYA 2RFHA 3B7IA 5JGFA 3H8FA 2ANPA 4IAVA 3FECA 3VARA 3HUVA 2GLJA 2JBJA 4A37A 5LRGA 5LRJA 4TNUA 3SI0A 1CPXA 3WABA 2ZEMA 4NGRA 2PIYA 1XJOA 4NJRA 4F8ZA 3V38A 3TC8A 4YWYA 4NJQA 3KGQA 5HXDA 4A94A 4W9YA 1LCPA
chains in the Genus database with same CATH superfamily
1XMBA 1LAMA 3DR8A 3BHXA 4R9MA 3NE7A 4MCRA 1NSLA 2JDDA 3NH4A 2ZEGA 2J8RA 4A33A 3ZJ0A 3D2MA 1VHOA 3VATA 4JLYA 1RTQA 4MHYA 3D66A 1ZG7A 4PSWA 2ZEDA 2VZYA 4OMEA 4CAFA 2HQYA 3PB9X 2Q7SA 2XEFA 4HKFA 2WYRA 3WC6A 2K5TA 3FEEA 4MMOA 3IWEA 2VEZA 3K9TA 3DDDA 2B5GA 4DUKA 2NYQA 2CF4A 2PVWA 1XRYA 4KVME 2GLFA 4MFJA 1Q2DA 2Z10A 3FIXA 2CXAA 3BI1A 2QECA 4R76A 1R57A 3D7DA 5IB0A 4Q38A 5THWA 2FS5A 3T9YA 1YMEA 2ZELA 4RUHA 5J1QA 5DS0A 4AXVA 5J8CA 4MHZA 3QAHA 3H8GA 5HH1A 1ELLP 3VH9A 2EWBA 4MHPA 4ORFA 4KVOE 4QC6A 5GCNA 3UY5A 4A30A 4MFQA 2C6GA 3S9LA 1XFOA 4ZX8A 3D7FA 2EUIA 3R96A 3D8PA 4FUUA 1IIDA 1CP7A 1Y0RA 4KLVA 2ZXVA 6CPAA 1CX8A 2B4BA 3KZWA 4UF4A 3L2NA 1FNOA 4UCNA 3FVLA 3QAYA 2OZHA 3B3WA 3TO6A 1LFWA 1NSAA 4PK2A 2PE3A 2WPXA 4KUAA 2QMLA 4OAEA 4P45A 1I21A 4NGQA 1KUXA 2G3TA 3PRTA 4K3NA 2R98A 5ISVA 4PXEA 2PJ8A 1QQ9A 4JZ0A 4KSIA 2Q4YA 4RS2A 4B6ZA 4F0XA 1Z5RA 2Z3KA 3ZZIA 2PSWA 3PB7X 4LX9A 1R43A 4KUBA 4P4BA 1ARMA 2Z3MA 2AFMA 2BO9A 4ZY2A 4MY0A 4BD9A 1L0CA 2YNCA 4F9UA 1J4JA 3B3VA 2XEIA 4TWEA 4P4IA 4OKOA 1B6BA 3N5FA 3FEDA 2RC4A 1I1DA 5CPAA 2P6GA 4YFJA 1ZG9A 2VL1A 4ZY1A 1RXTA 4PXCA 5C82A 2C1CA 2PJ1A 1VGYA 2AFZA 4NSQA 4CYQA 1F2OA 1V0CA 4B12A 4GM5A 3IJ3A 1IU8A 2IMOA 5JH9A 3LACA 4UFVA 3WT4A 1LRZA 4XPKA 4FD6A 1YLEA 3FJUA 2CTBA 2ZEFA 3GKRA 1BOBA 4JXQA 2ZENA 2ZPAA 2HB6A 3FMCA 3KQXA 3KR5A 2V8VA 4R3LA 2GANA 3FH4A 5G20A 4X2TA 1S60A 2Z3OA 3CZXA 3PB6X 4UEZA 4OLLA 1IYLA 1PYTB 1TKJA 2AFXA 2FIAA 3D4UA 4X8IA 2Q7BA 4CGOA 4OIDA 1WWZA 2R1IA 4M6HA 5LYDA 2OH1A 3D2PA 3IO1A 4NEXA 3W6SA 2BEIA 2G0BA 3H5ZA 4UIBA 3JRUA 1Q2YA 3WC7A 4O23A 5HVFA 5HVHA 4C7HA 1VHEA 3I9SA 5HMNA 2ARHA 1OBRA 4FBEA 1Y7EA 1YW4A 1Y0YA 1CBXA 1NE9A 2GU2A 2B4DB 2Z11A 3KASA 3TOBA 2OZGA 5LYIA 4P44A 4B10A 3EC4A 4XNHC 4KOWA 4UWIA 2GIVA 2Q4ZA 4QUSA 5F46A 2PIZA 3B3SA 4OC0A 2PC1A 3MRUA 3GB0A 4NGPA 2POKA 2HUZA 5F48A 1CG2A 4KOUA 1YVKA 4PXBA 3CPXA 3CDXA 4CGMA 5AG5A 1ARLA 1F2PA 4PV6A 2PDOA 3FBUA 3R95A 4WJBA 3TO9A 4WWVA 2I3CA 1RO5A 3S6HA 1S5KA 4CAWA 2WSAA 4H6ZA 4J3GA 5E96A 4U9YA 3F5BA 2YNEA 4R7MA 3TOAA 4UCMA 3DNSA 4UBRA 4UWJA 2C6PA 4KS9A 3N7ZA 3PZJA 8CPAA 2ZEHA 2B4DA 2QIRA 3FB3A 3S6KA 3TTHA 1K4JA 1YREA 5G21A 2DPTA 1S3ZA 3IU2A 1UWYA 1YX0A 4CRZB 3SHPA 1Z8WA 2ODFA 3NH5A 3DGVA 4NFRA 4B5PB 5LYLA 4CGLA 2FVGA 4KVXA 4A32A 3PP9A 2ABZA 1GHEA 4I49A 4MFPA 3T90A 2O28A 3ISZA 3CPAA 2Q44A 1JQGA 1AMPA 4AG9A 4H2KA 1AYEA 2JDCA 2Q43A 4F6AA 4XNHB 4M6GA 3GYAA 4MHNA 1CJWA 2NMTA 4Q36A 4NGSA 2WZNA 5JPHA 3FYNA 5G22A 4BINA 2WPWA 4C2YA 4CYOA 4UIAA 2JBKA 3TFYA 3FRMA 2PRBA 2PJAA 3GLJA 3TO7A 1MJBA 4M3SA 4FD7A 4CGNA 3LODA 5JM6A 4JD6A 4E8OA 4R6TA 3DLJA 3K9UA 2AFUA 3D67A 3P2FA 4MBUA 4R87A 4Y49B 4CYNA 3VWDA 4P4DA 5AG4A 3TT2A 3PB8X 5K8NA 2CTCA 3SJXA 3S6FA 1YSJA 3GIUA 2PJ6A 1UFHA 2F8HA 1ZG8A 2D4OA 2IL4A 2OB0A 2REEA 4HPSA 4LQ6A 4B14A 1BPMA 2EK8A 4OC4A 1YLOA 2F7VA 1QSOA 3PEIA 2PJ2A 4RN7A 5K8OA 3S9NA 1LOKA 4P4EA 4AVCA 2G3AA 5H86A 2OR4A 2QYVA 2I00A 5H84A 3IC1A 1XF8A 1MK4A 1PU9A 2CIJA 4CPAA 2C6CA 5F49A 4F0YA 4A39A 3QB8A 1YK3A 1YW6A 1XEBA 2HC9A 2Y0MA 3PB4X 4XPLA 3TE4A 3S9MA 2XEJA 1OZPA 5KTCA 3GY9A 4R8FA 3R1KA 3RYOA 2PJ0A 4C2XA 1PCAA 3D7HA 3RBUA 4AG7A 4MFKA 2PJ3A 4A95A 1IOIA 3BI0A 4II9A 1MJ9A 2ZEEA 4PK3A 1TF8A 3SI1A 1VIXA 3R9FA 2J8NA 1F57A 5KTAA 4KOTA 4P4JA 1QSMA 1KUVA 1X12A 3K2KA 3D7GA 4OC5A 4YU9A 4OC2A 5CNPA 3W6XA 2QVPA 1U6MA 4C2ZA 3MN8A 1Z8LA 4P6YA 4C7IA 4Z65A 1BLLE 2ZEPA 2Z3LA 2PJCA 3RO0A 4PSXA 2F5IA 2O53A 2O4HA 4IUSA 4ONUA 5CBMA 2B3UA 1M44A 3KKWA 4OIWA 4B11A 4EFDA 4HNWB 4EMEA 2PCUA 4DYOA 5LYFA 4ZGYB 2DPSA 3VWEA 4MY3A 2Z3NA 4NF1A 4R57A 4ZYQA 2AFWA 3WC5A 3IIBA 1X10A 2R7HA 2YGWA 1DTDA 1KUYA 5AG6A 2BUEA 4CAXA 5IB9A 5K8PA 2ZOFA 3NFZA 3MGDA 1HDUA 2JEVA 4RI1A 4AB7A 1M4GA 1Y9KA 2B58A 2CNTA 3EXNA 1IICA 1QSTA 4OC3A 1YR0A 4NGMA 2PR1A 2AJ6A 2FE7A 4EVYA 2QJ8A 3JVNA 3FXTA 4QVTA 1QMUA 3PGPA 4ONWA 2GFQA 4MCSA 5D29A 4G1PA 2PJBA 2P6EA 3CXQA 5DWMA 3LWUA 1P0HA 2GREA 2P6FA 3CT9A 1N71A 3A9LA 4A38A 4Q7AA 4XPDC 1M4DA 3R9GA 3BJ8A 3IEHA 1LAPA 3SXOA 4IHMA 4PQAA 3IWGA 4NCZA 5D8NA 1WK4A 1FT7A 3RAMA 4IF5A 3JUWA 2ZEOA 4R3KA 4KOXA 4JWPA 1BAVA 2FSRA 1ZO0A 3OWCA 1XE4A 1GYTA 4JYWA 2AFOA 3IU1A 3FX6A 4MRIA 2PRQA 2H5MA 2OU2A 2WUUA 2HV2A 4U9ZA 2R8VA 2ZW5A 2Q0YA 4ZY0A 1KZFA 4OP4A 2AFSA 2PJ9A 1IOFA 2BOAA 1R3NA 4GS4A 3KR4A 1LANA 2YNCC 3LMSA 2PJ7A 1HEEA 5A27A 4KOVA 3I1UA 2ZW7A 3ISXA 2C27A 3PFOA 1Z2LA 4NGTA 4X3RA 2V77A 2DF5A 2YNDA 1HDQA 4A2ZA 1TKFA 3NH8A 4P4FA 1BO4A 3EY5A 3KI9A 3S6GA 3H8EA 2PJ4A 3DR6A 2X7BA 3QNVA 1ON0A 2EBJA 1QSRA 5DWNA 1S7LA 2EK9A 2ZW4A 3BLNA 1CP6A 2Q51A 5K8MA 4LQGA 2ATRA 3BXMA 3F8KA 3E0KA 4P10A 3C26A 3IFEA 3B8GA 2RB7A 1P4NA 5HVGA 1B87A 1IGBA 2VBQA 5BWAB 2VI7A 2Z3PA 1SQHA 2V8DA 1M4IA 4XPDB 3PBBA 3B2YA 1Q7LA 1Y9WA 2DXQA 2ZOGA 4FD5A 4K30A 2IJZA 2Q04A 3SJEA 4A31A 4AVBA 4B5PA 1NMTA 2CNMA 2FL4A 4M85A 2P0WA 1QSNA 1ZLIA 2JLMA 2OZUA 5IV0A 1H8LA 4BBHA 1Z8XA 4UFXA 3D68A 3V7ZA 3BJ7A 4LUAA 1S7NA 4NGNA 2PJ5A 2J9AA 4KOSA 2VZZA 3TCVA 4F9VA 4FWUA 5EC4A 1FY7A 1JWQA 1S7FA 2VXKA 5F47A 3R9EA 3TX8A 2D4PA 3B3TA 1IY7A 4E2AA 4ZBGA 4HNYB 2IQ6A 4EWTA 4KOYA 2EO8A 4OADA 4H89A 3PFEA 2DEAA 3I3GA 4MHDA 1M4LA 3KL9A 4MCPA 5IX3A 3HLPA 4JJXA 7CPAA 4ZI6A 2CNSA 5FVJA 4BMHA 4YGOA 3G3SA 4M6IA 4L89A 2BL1A 1EE3P 3SJFA 4CYPA 5LRKA 3B35A 2G9DA 2Q4VA 4ZX9A 5A28A 2B3VA 3V8IA 3W91A 2BCOA 1AUGA 1ELMP 2FCKA 4UCPA 3FF3A 3SI2A 4DJLA 4E0AA 3H4QA 1IYKA 4KZTA 4AVAA 3JTKA 4MFZA 4H6UA 4MCQA 2FIWA 1TKHA 1IB1E 3KHZA 2XEGA 3SJGA 4MJ8A 2ZW6A 5AG7A 1DE4C 4B5OA 5C88A 4X5KA 1TF9A 4CGPA 4CRYB 4DNCA 4QB9A 3IGRA 4KORA 1YVOA 1Z4EA 1Q2CA 2REFA 3G8WA 4CS0B 3PBEA 4UEEA 4C68A 5I4MA 3B3CA 4IK2A 1TXRA 4OC1A 2JEWA 3D3SA 1PUAA 3KHXA 2V8HA 4QBJA 1TIQA 1M1DA 2FT0A 4UFWA 5F09A 2PVVA 4U5YA 5J8FA 4KSAA 3EO4A 4HNXB 4CAEA 1BPNA 3KQZA 4PXDA 5KTDA 2OOTA 3NE8A 1YGHA 4MI4A 3NA6A 1ZLHA 2BSWA 2NSMA 4FAIA 1S7KA 2V8GA 3IWWA 3GUXA 1CPSA 4MXUA 4NXYA 4PPZA 4UEFA 3EFAA 4GXHA 1XBUA 1MJAA 4MFLA 5AGEA 3T8WA 1Z9UA 1KWMA 1VHSA 1XMTA 4L8AA 1Z4RA 4JXRA 5ELYA 3LD2A 2EVNA 5G1ZA 3RZAA 3SXNA 2RFHA 4UA3A 3B7IA 5JGFA 3H8FA 2ANPA 2Z0ZA 3FECA 1A2ZA 1VKCA 4IAVA 4KLWA 3VARA 3HUVA 2GLJA 2JBJA 4CAVA 1XIXA 2GE3A 4A37A 5LRGA 5LRJA 3CXPA 2PQ8A 4TNUA 2I79A 1CM0A 3RNZA 2CY2A 5EMIA 3SI0A 5I0CA 2PR8A 1CPXA 3WABA 2AE6A 2KCWA 2ZEMA 4NGRA 4KSFA 4B13A 3CXSA 2FXFA 2PIYA 1XJOA 4FD4A 2VQYA 2J8MA 4NJRA 3WR7A 4F8ZA 3V38A 4Y49C 3F0AA 2B5GB 1YQEA 1Z8TA 1XOVA 3TC8A 4YWYA 1Y7RA 4NJQA 3KGQA 3DSBA 5HXDA 1I12A 2A4NA 5EBVA 3FNCA 5JQ4A 3P2HA 4A94A 4YRHA 4W9YA 1LCPA
chains in the Genus database with same CATH topology
1XMBA 1LAMA 3BHXA 4MCRA 3NH4A 2ZEGA 1VHOA 3VATA 1RTQA 4MHYA 3D66A 1ZG7A 2ZEDA 4OMEA 3PB9X 2XEFA 2WYRA 3WC6A 3FEEA 4MMOA 3K9TA 4DUKA 2NYQA 2CF4A 2PVWA 1XRYA 2GLFA 3BI1A 4R76A 3D7DA 5THWA 1YMEA 2ZELA 4RUHA 5J1QA 5DS0A 4AXVA 4MHZA 3H8GA 1ELLP 3VH9A 2EWBA 4MHPA 2C6GA 3S9LA 1XFOA 4ZX8A 3D7FA 4FUUA 1Y0RA 1CP7A 6CPAA 1CX8A 4UF4A 3KZWA 3L2NA 1FNOA 3FVLA 3B3WA 1LFWA 1NSAA 2PE3A 4P45A 4NGQA 3PRTA 4K3NA 4PXEA 2PJ8A 1QQ9A 4JZ0A 4KSIA 4B6ZA 1Z5RA 3PB7X 1R43A 4P4BA 1ARMA 2AFMA 2BO9A 4ZY2A 4BD9A 4F9UA 3B3VA 2XEIA 4TWEA 4P4IA 4OKOA 3N5FA 3FEDA 5CPAA 4ZY1A 1ZG9A 2VL1A 4PXCA 2C1CA 2PJ1A 1VGYA 2AFZA 1F2OA 4GM5A 3IJ3A 2IMOA 5JH9A 3WT4A 3FJUA 2CTBA 2ZEFA 3KR5A 2ZENA 2HB6A 3FMCA 3KQXA 2V8VA 3FH4A 4X2TA 3PB6X 4UEZA 1PYTB 1TKJA 2AFXA 4X8IA 3D4UA 4OIDA 5LYDA 3IO1A 3WC7A 4UIBA 3JRUA 5HVHA 4O23A 5HVFA 1VHEA 1OBRA 4FBEA 1Y7EA 1YW4A 1Y0YA 1CBXA 2GU2A 3KASA 5LYIA 4P44A 2Q4ZA 2PIZA 3B3SA 4OC0A 3MRUA 3GB0A 4NGPA 2POKA 1CG2A 4PXBA 3CPXA 3CDXA 1ARLA 1F2PA 4WJBA 4WWVA 2I3CA 4R7MA 2C6PA 8CPAA 2ZEHA 1UWYA 3NH5A 3DGVA 4NFRA 5LYLA 2FVGA 2ABZA 3ISZA 3CPAA 1JQGA 1AMPA 4H2KA 1AYEA 2Q43A 4MHNA 4NGSA 2WZNA 4UIAA 2JBKA 3GLJA 2PJAA 5JM6A 4R6TA 3DLJA 2AFUA 3D67A 4P4DA 5K8NA 3PB8X 2CTCA 3SJXA 1YSJA 2PJ6A 2F8HA 1ZG8A 1BPMA 2EK8A 4OC4A 1YLOA 2F7VA 3PEIA 2PJ2A 5K8OA 3S9NA 1LOKA 4P4EA 2OR4A 2QYVA 3IC1A 2CIJA 4CPAA 2C6CA 4A39A 1YW6A 2HC9A 3PB4X 3S9MA 2XEJA 4R8FA 2PJ0A 1PCAA 3D7HA 3RBUA 2PJ3A 3BI0A 2ZEEA 1TF8A 3SI1A 1VIXA 1F57A 4P4JA 3K2KA 3D7GA 4OC5A 4YU9A 4OC2A 2QVPA 3MN8A 1Z8LA 4P6YA 4Z65A 1BLLE 2ZEPA 2PJCA 2O53A 2O4HA 5CBMA 4OIWA 4EFDA 4EMEA 2PCUA 4DYOA 5LYFA 4ZYQA 2AFWA 3WC5A 3IIBA 1DTDA 5IB9A 5K8PA 2ZOFA 3NFZA 1HDUA 4OC3A 4NGMA 2QJ8A 1QMUA 4ONWA 5D29A 4MCSA 4G1PA 2PJBA 3LWUA 2GREA 3CT9A 4A38A 4Q7AA 3IEHA 1LAPA 4IHMA 4PQAA 5D8NA 3RAMA 1FT7A 2ZEOA 1BAVA 1GYTA 4JYWA 2AFOA 4MRIA 3FX6A 2PRQA 4ZY0A 4OP4A 2AFSA 2PJ9A 2BOAA 1R3NA 3KR4A 1LANA 3LMSA 2PJ7A 1HEEA 3I1UA 3ISXA 3PFOA 1Z2LA 4NGTA 4X3RA 2V77A 1HDQA 1TKFA 3NH8A 4P4FA 3KI9A 3H8EA 2PJ4A 3QNVA 2EK9A 1CP6A 2Q51A 5K8MA 4LQGA 3BXMA 4P10A 3IFEA 2RB7A 5HVGA 1IGBA 2V8DA 3PBBA 3B2YA 1Q7LA 2ZOGA 3SJEA 2IJZA 1ZLIA 1H8LA 3D68A 3V7ZA 4NGNA 2PJ5A 2J9AA 4F9VA 4FWUA 3TX8A 3B3TA 1IY7A 2IQ6A 4EWTA 3PFEA 2DEAA 1M4LA 3KL9A 4MCPA 3HLPA 7CPAA 4ZI6A 1EE3P 3SJFA 5LRKA 3B35A 2G9DA 4ZX9A 2BCOA 1ELMP 3FF3A 3SI2A 4DJLA 4MCQA 1TKHA 3KHZA 2XEGA 3SJGA 1DE4C 1TF9A 3PBEA 4UEEA 5I4MA 3B3CA 4IK2A 1TXRA 4OC1A 2JEWA 3KHXA 2V8HA 5F09A 2PVVA 1BPNA 3KQZA 4PXDA 2OOTA 3NA6A 1ZLHA 2NSMA 4FAIA 2V8GA 3IWWA 3GUXA 1CPSA 4MXUA 4PPZA 4UEFA 1XBUA 3T8WA 1KWMA 3RZAA 5ELYA 2RFHA 3B7IA 5JGFA 3H8FA 2ANPA 4IAVA 3FECA 3VARA 3HUVA 2GLJA 2JBJA 4A37A 5LRGA 5LRJA 4TNUA 3SI0A 1CPXA 3WABA 2ZEMA 4NGRA 2PIYA 1XJOA 4NJRA 4F8ZA 3V38A 3TC8A 4YWYA 4NJQA 3KGQA 5HXDA 4A94A 4W9YA 1LCPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMB A;  1LAM A;  3BHX A;  4MCR A;  3NH4 A;  2ZEG A;  1VHO A;  3VAT A;  1RTQ A;  4MHY A;  3D66 A;  1ZG7 A;  2ZED A;  4OME A;  3PB9 X;  2XEF A;  2WYR A;  3WC6 A;  3FEE A;  4MMO A;  3K9T A;  4DUK A;  2NYQ A;  2CF4 A;  2PVW A;  1XRY A;  2GLF A;  3BI1 A;  4R76 A;  3D7D A;  5THW A;  1YME A;  2ZEL A;  4RUH A;  5J1Q A;  5DS0 A;  4AXV A;  4MHZ A;  3H8G A;  1ELL P;  3VH9 A;  2EWB A;  4MHP A;  2C6G A;  3S9L A;  1XFO A;  4ZX8 A;  3D7F A;  4FUU A;  1Y0R A;  1CP7 A;  6CPA A;  1CX8 A;  4UF4 A;  3KZW A;  3L2N A;  1FNO A;  3FVL A;  3B3W A;  1LFW A;  1NSA A;  2PE3 A;  4P45 A;  4NGQ A;  3PRT A;  4K3N A;  4PXE A;  2PJ8 A;  1QQ9 A;  4JZ0 A;  4KSI A;  4B6Z A;  1Z5R A;  3PB7 X;  1R43 A;  4P4B A;  1ARM A;  2AFM A;  2BO9 A;  4ZY2 A;  4BD9 A;  4F9U A;  3B3V A;  2XEI A;  4TWE A;  4P4I A;  4OKO A;  3N5F A;  3FED A;  5CPA A;  4ZY1 A;  1ZG9 A;  2VL1 A;  4PXC A;  2C1C A;  2PJ1 A;  1VGY A;  2AFZ A;  1F2O A;  4GM5 A;  3IJ3 A;  2IMO A;  5JH9 A;  3WT4 A;  3FJU A;  2CTB A;  2ZEF A;  3KR5 A;  2ZEN A;  2HB6 A;  3FMC A;  3KQX A;  2V8V A;  3FH4 A;  4X2T A;  3PB6 X;  4UEZ A;  1PYT B;  1TKJ A;  2AFX A;  4X8I A;  3D4U A;  4OID A;  5LYD A;  3IO1 A;  3WC7 A;  4UIB A;  3JRU A;  5HVH A;  4O23 A;  5HVF A;  1VHE A;  1OBR A;  4FBE A;  1Y7E A;  1YW4 A;  1Y0Y A;  1CBX A;  2GU2 A;  3KAS A;  5LYI A;  4P44 A;  2Q4Z A;  2PIZ A;  3B3S A;  4OC0 A;  3MRU A;  3GB0 A;  4NGP A;  2POK A;  1CG2 A;  4PXB A;  3CPX A;  3CDX A;  1ARL A;  1F2P A;  4WJB A;  4WWV A;  2I3C A;  4R7M A;  2C6P A;  8CPA A;  2ZEH A;  1UWY A;  3NH5 A;  3DGV A;  4NFR A;  5LYL A;  2FVG A;  2ABZ A;  3ISZ A;  3CPA A;  1JQG A;  1AMP A;  4H2K A;  1AYE A;  2Q43 A;  4MHN A;  4NGS A;  2WZN A;  4UIA A;  2JBK A;  3GLJ A;  2PJA A;  5JM6 A;  4R6T A;  3DLJ A;  2AFU A;  3D67 A;  4P4D A;  5K8N A;  3PB8 X;  2CTC A;  3SJX A;  1YSJ A;  2PJ6 A;  2F8H A;  1ZG8 A;  1BPM A;  2EK8 A;  4OC4 A;  1YLO A;  2F7V A;  3PEI A;  2PJ2 A;  5K8O A;  3S9N A;  1LOK A;  4P4E A;  2OR4 A;  2QYV A;  3IC1 A;  2CIJ A;  4CPA A;  2C6C A;  4A39 A;  1YW6 A;  2HC9 A;  3PB4 X;  3S9M A;  2XEJ A;  4R8F A;  2PJ0 A;  1PCA A;  3D7H A;  3RBU A;  2PJ3 A;  3BI0 A;  2ZEE A;  1TF8 A;  3SI1 A;  1VIX A;  1F57 A;  4P4J A;  3K2K A;  3D7G A;  4OC5 A;  4YU9 A;  4OC2 A;  2QVP A;  3MN8 A;  1Z8L A;  4P6Y A;  4Z65 A;  1BLL E;  2ZEP A;  2PJC A;  2O53 A;  2O4H A;  5CBM A;  4OIW A;  4EFD A;  4EME A;  2PCU A;  4DYO A;  5LYF A;  4ZYQ A;  2AFW A;  3WC5 A;  3IIB A;  1DTD A;  5IB9 A;  5K8P A;  2ZOF A;  3NFZ A;  1HDU A;  4OC3 A;  4NGM A;  2QJ8 A;  1QMU A;  4ONW A;  5D29 A;  4MCS A;  4G1P A;  2PJB A;  3LWU A;  2GRE A;  3CT9 A;  4A38 A;  4Q7A A;  3IEH A;  1LAP A;  4IHM A;  4PQA A;  5D8N A;  3RAM A;  1FT7 A;  2ZEO A;  1BAV A;  1GYT A;  4JYW A;  2AFO A;  4MRI A;  3FX6 A;  2PRQ A;  4ZY0 A;  4OP4 A;  2AFS A;  2PJ9 A;  2BOA A;  1R3N A;  3KR4 A;  1LAN A;  3LMS A;  2PJ7 A;  1HEE A;  3I1U A;  3ISX A;  3PFO A;  1Z2L A;  4NGT A;  4X3R A;  2V77 A;  1HDQ A;  1TKF A;  3NH8 A;  4P4F A;  3KI9 A;  3H8E A;  2PJ4 A;  3QNV A;  2EK9 A;  1CP6 A;  2Q51 A;  5K8M A;  4LQG A;  3BXM A;  4P10 A;  3IFE A;  2RB7 A;  5HVG A;  1IGB A;  2V8D A;  3PBB A;  3B2Y A;  1Q7L A;  2ZOG A;  3SJE A;  2IJZ A;  1ZLI A;  1H8L A;  3D68 A;  3V7Z A;  4NGN A;  2PJ5 A;  2J9A A;  4F9V A;  4FWU A;  3TX8 A;  3B3T A;  1IY7 A;  2IQ6 A;  4EWT A;  3PFE A;  2DEA A;  1M4L A;  3KL9 A;  4MCP A;  3HLP A;  7CPA A;  4ZI6 A;  1EE3 P;  3SJF A;  5LRK A;  3B35 A;  2G9D A;  4ZX9 A;  2BCO A;  1ELM P;  3FF3 A;  3SI2 A;  4DJL A;  4MCQ A;  1TKH A;  3KHZ A;  2XEG A;  3SJG A;  1DE4 C;  1TF9 A;  3PBE A;  4UEE A;  5I4M A;  3B3C A;  4IK2 A;  1TXR A;  4OC1 A;  2JEW A;  3KHX A;  2V8H A;  5F09 A;  2PVV A;  1BPN A;  3KQZ A;  4PXD A;  2OOT A;  3NA6 A;  1ZLH A;  2NSM A;  4FAI A;  2V8G A;  3IWW A;  3GUX A;  1CPS A;  4MXU A;  4PPZ A;  4UEF A;  1XBU A;  3T8W A;  1KWM A;  3RZA A;  5ELY A;  2RFH A;  3B7I A;  5JGF A;  3H8F A;  2ANP A;  4IAV A;  3FEC A;  3VAR A;  3HUV A;  2GLJ A;  2JBJ A;  4A37 A;  5LRG A;  5LRJ A;  4TNU A;  3SI0 A;  1CPX A;  3WAB A;  2ZEM A;  4NGR A;  2PIY A;  1XJO A;  4NJR A;  4F8Z A;  3V38 A;  3TC8 A;  4YWY A;  4NJQ A;  3KGQ A;  5HXD A;  4A94 A;  4W9Y A;  1LCP A; 
#chains in the Genus database with same CATH topology
 1XMB A;  1LAM A;  3DR8 A;  3BHX A;  4R9M A;  3NE7 A;  4MCR A;  1NSL A;  2JDD A;  3NH4 A;  2ZEG A;  2J8R A;  4A33 A;  3ZJ0 A;  3D2M A;  1VHO A;  3VAT A;  4JLY A;  1RTQ A;  4MHY A;  3D66 A;  1ZG7 A;  4PSW A;  2ZED A;  2VZY A;  4OME A;  4CAF A;  2HQY A;  3PB9 X;  2Q7S A;  2XEF A;  4HKF A;  2WYR A;  3WC6 A;  2K5T A;  3FEE A;  4MMO A;  3IWE A;  2VEZ A;  3K9T A;  3DDD A;  2B5G A;  4DUK A;  2NYQ A;  2CF4 A;  2PVW A;  1XRY A;  4KVM E;  2GLF A;  4MFJ A;  1Q2D A;  2Z10 A;  3FIX A;  2CXA A;  3BI1 A;  2QEC A;  4R76 A;  1R57 A;  3D7D A;  5IB0 A;  4Q38 A;  5THW A;  2FS5 A;  3T9Y A;  1YME A;  2ZEL A;  4RUH A;  5J1Q A;  5DS0 A;  4AXV A;  5J8C A;  4MHZ A;  3QAH A;  3H8G A;  5HH1 A;  1ELL P;  3VH9 A;  2EWB A;  4MHP A;  4ORF A;  4KVO E;  4QC6 A;  5GCN A;  3UY5 A;  4A30 A;  4MFQ A;  2C6G A;  3S9L A;  1XFO A;  4ZX8 A;  3D7F A;  2EUI A;  3R96 A;  3D8P A;  4FUU A;  1IID A;  1CP7 A;  1Y0R A;  4KLV A;  2ZXV A;  6CPA A;  1CX8 A;  2B4B A;  3KZW A;  4UF4 A;  3L2N A;  1FNO A;  4UCN A;  3FVL A;  3QAY A;  2OZH A;  3B3W A;  3TO6 A;  1LFW A;  1NSA A;  4PK2 A;  2PE3 A;  2WPX A;  4KUA A;  2QML A;  4OAE A;  4P45 A;  1I21 A;  4NGQ A;  1KUX A;  2G3T A;  3PRT A;  4K3N A;  2R98 A;  5ISV A;  4PXE A;  2PJ8 A;  1QQ9 A;  4JZ0 A;  4KSI A;  2Q4Y A;  4RS2 A;  4B6Z A;  4F0X A;  1Z5R A;  2Z3K A;  3ZZI A;  2PSW A;  3PB7 X;  4LX9 A;  1R43 A;  4KUB A;  4P4B A;  1ARM A;  2Z3M A;  2AFM A;  2BO9 A;  4ZY2 A;  4MY0 A;  4BD9 A;  1L0C A;  2YNC A;  4F9U A;  1J4J A;  3B3V A;  2XEI A;  4TWE A;  4P4I A;  4OKO A;  1B6B A;  3N5F A;  3FED A;  2RC4 A;  1I1D A;  5CPA A;  2P6G A;  4YFJ A;  1ZG9 A;  2VL1 A;  4ZY1 A;  1RXT A;  4PXC A;  5C82 A;  2C1C A;  2PJ1 A;  1VGY A;  2AFZ A;  4NSQ A;  4CYQ A;  1F2O A;  1V0C A;  4B12 A;  4GM5 A;  3IJ3 A;  1IU8 A;  2IMO A;  5JH9 A;  3LAC A;  4UFV A;  3WT4 A;  1LRZ A;  4XPK A;  4FD6 A;  1YLE A;  3FJU A;  2CTB A;  2ZEF A;  3GKR A;  1BOB A;  4JXQ A;  2ZEN A;  2ZPA A;  2HB6 A;  3FMC A;  3KQX A;  3KR5 A;  2V8V A;  4R3L A;  2GAN A;  3FH4 A;  5G20 A;  4X2T A;  1S60 A;  2Z3O A;  3CZX A;  3PB6 X;  4UEZ A;  4OLL A;  1IYL A;  1PYT B;  1TKJ A;  2AFX A;  2FIA A;  3D4U A;  4X8I A;  2Q7B A;  4CGO A;  4OID A;  1WWZ A;  2R1I A;  4M6H A;  5LYD A;  2OH1 A;  3D2P A;  3IO1 A;  4NEX A;  3W6S A;  2BEI A;  2G0B A;  3H5Z A;  4UIB A;  3JRU A;  1Q2Y A;  3WC7 A;  4O23 A;  5HVF A;  5HVH A;  4C7H A;  1VHE A;  3I9S A;  5HMN A;  2ARH A;  1OBR A;  4FBE A;  1Y7E A;  1YW4 A;  1Y0Y A;  1CBX A;  1NE9 A;  2GU2 A;  2B4D B;  2Z11 A;  3KAS A;  3TOB A;  2OZG A;  5LYI A;  4P44 A;  4B10 A;  3EC4 A;  4XNH C;  4KOW A;  4UWI A;  2GIV A;  2Q4Z A;  4QUS A;  5F46 A;  2PIZ A;  3B3S A;  4OC0 A;  2PC1 A;  3MRU A;  3GB0 A;  4NGP A;  2POK A;  2HUZ A;  5F48 A;  1CG2 A;  4KOU A;  1YVK A;  4PXB A;  3CPX A;  3CDX A;  4CGM A;  5AG5 A;  1ARL A;  1F2P A;  4PV6 A;  2PDO A;  3FBU A;  3R95 A;  4WJB A;  3TO9 A;  4WWV A;  2I3C A;  1RO5 A;  3S6H A;  1S5K A;  4CAW A;  2WSA A;  4H6Z A;  4J3G A;  5E96 A;  4U9Y A;  3F5B A;  2YNE A;  4R7M A;  3TOA A;  4UCM A;  3DNS A;  4UBR A;  4UWJ A;  2C6P A;  4KS9 A;  3N7Z A;  3PZJ A;  8CPA A;  2ZEH A;  2B4D A;  2QIR A;  3FB3 A;  3S6K A;  3TTH A;  1K4J A;  1YRE A;  5G21 A;  2DPT A;  1S3Z A;  3IU2 A;  1UWY A;  1YX0 A;  4CRZ B;  3SHP A;  1Z8W A;  2ODF A;  3NH5 A;  3DGV A;  4NFR A;  4B5P B;  5LYL A;  4CGL A;  2FVG A;  4KVX A;  4A32 A;  3PP9 A;  2ABZ A;  1GHE A;  4I49 A;  4MFP A;  3T90 A;  2O28 A;  3ISZ A;  3CPA A;  2Q44 A;  1JQG A;  1AMP A;  4AG9 A;  4H2K A;  1AYE A;  2JDC A;  2Q43 A;  4F6A A;  4XNH B;  4M6G A;  3GYA A;  4MHN A;  1CJW A;  2NMT A;  4Q36 A;  4NGS A;  2WZN A;  5JPH A;  3FYN A;  5G22 A;  4BIN A;  2WPW A;  4C2Y A;  4CYO A;  4UIA A;  2JBK A;  3TFY A;  3FRM A;  2PRB A;  2PJA A;  3GLJ A;  3TO7 A;  1MJB A;  4M3S A;  4FD7 A;  4CGN A;  3LOD A;  5JM6 A;  4JD6 A;  4E8O A;  4R6T A;  3DLJ A;  3K9U A;  2AFU A;  3D67 A;  3P2F A;  4MBU A;  4R87 A;  4Y49 B;  4CYN A;  3VWD A;  4P4D A;  5AG4 A;  3TT2 A;  3PB8 X;  5K8N A;  2CTC A;  3SJX A;  3S6F A;  1YSJ A;  3GIU A;  2PJ6 A;  1UFH A;  2F8H A;  1ZG8 A;  2D4O A;  2IL4 A;  2OB0 A;  2REE A;  4HPS A;  4LQ6 A;  4B14 A;  1BPM A;  2EK8 A;  4OC4 A;  1YLO A;  2F7V A;  1QSO A;  3PEI A;  2PJ2 A;  4RN7 A;  5K8O A;  3S9N A;  1LOK A;  4P4E A;  4AVC A;  2G3A A;  5H86 A;  2OR4 A;  2QYV A;  2I00 A;  5H84 A;  3IC1 A;  1XF8 A;  1MK4 A;  1PU9 A;  2CIJ A;  4CPA A;  2C6C A;  5F49 A;  4F0Y A;  4A39 A;  3QB8 A;  1YK3 A;  1YW6 A;  1XEB A;  2HC9 A;  2Y0M A;  3PB4 X;  4XPL A;  3TE4 A;  3S9M A;  2XEJ A;  1OZP A;  5KTC A;  3GY9 A;  4R8F A;  3R1K A;  3RYO A;  2PJ0 A;  4C2X A;  1PCA A;  3D7H A;  3RBU A;  4AG7 A;  4MFK A;  2PJ3 A;  4A95 A;  1IOI A;  3BI0 A;  4II9 A;  1MJ9 A;  2ZEE A;  4PK3 A;  1TF8 A;  3SI1 A;  1VIX A;  3R9F A;  2J8N A;  1F57 A;  5KTA A;  4KOT A;  4P4J A;  1QSM A;  1KUV A;  1X12 A;  3K2K A;  3D7G A;  4OC5 A;  4YU9 A;  4OC2 A;  5CNP A;  3W6X A;  2QVP A;  1U6M A;  4C2Z A;  3MN8 A;  1Z8L A;  4P6Y A;  4C7I A;  4Z65 A;  1BLL E;  2ZEP A;  2Z3L A;  2PJC A;  3RO0 A;  4PSX A;  2F5I A;  2O53 A;  2O4H A;  4IUS A;  4ONU A;  5CBM A;  2B3U A;  1M44 A;  3KKW A;  4OIW A;  4B11 A;  4EFD A;  4HNW B;  4EME A;  2PCU A;  4DYO A;  5LYF A;  4ZGY B;  2DPS A;  3VWE A;  4MY3 A;  2Z3N A;  4NF1 A;  4R57 A;  4ZYQ A;  2AFW A;  3WC5 A;  3IIB A;  1X10 A;  2R7H A;  2YGW A;  1DTD A;  1KUY A;  5AG6 A;  2BUE A;  4CAX A;  5IB9 A;  5K8P A;  2ZOF A;  3NFZ A;  3MGD A;  1HDU A;  2JEV A;  4RI1 A;  4AB7 A;  1M4G A;  1Y9K A;  2B58 A;  2CNT A;  3EXN A;  1IIC A;  1QST A;  4OC3 A;  1YR0 A;  4NGM A;  2PR1 A;  2AJ6 A;  2FE7 A;  4EVY A;  2QJ8 A;  3JVN A;  3FXT A;  4QVT A;  1QMU A;  3PGP A;  4ONW A;  2GFQ A;  4MCS A;  5D29 A;  4G1P A;  2PJB A;  2P6E A;  3CXQ A;  5DWM A;  3LWU A;  1P0H A;  2GRE A;  2P6F A;  3CT9 A;  1N71 A;  3A9L A;  4A38 A;  4Q7A A;  4XPD C;  1M4D A;  3R9G A;  3BJ8 A;  3IEH A;  1LAP A;  3SXO A;  4IHM A;  4PQA A;  3IWG A;  4NCZ A;  5D8N A;  1WK4 A;  1FT7 A;  3RAM A;  4IF5 A;  3JUW A;  2ZEO A;  4R3K A;  4KOX A;  4JWP A;  1BAV A;  2FSR A;  1ZO0 A;  3OWC A;  1XE4 A;  1GYT A;  4JYW A;  2AFO A;  3IU1 A;  3FX6 A;  4MRI A;  2PRQ A;  2H5M A;  2OU2 A;  2WUU A;  2HV2 A;  4U9Z A;  2R8V A;  2ZW5 A;  2Q0Y A;  4ZY0 A;  1KZF A;  4OP4 A;  2AFS A;  2PJ9 A;  1IOF A;  2BOA A;  1R3N A;  4GS4 A;  3KR4 A;  1LAN A;  2YNC C;  3LMS A;  2PJ7 A;  1HEE A;  5A27 A;  4KOV A;  3I1U A;  2ZW7 A;  3ISX A;  2C27 A;  3PFO A;  1Z2L A;  4NGT A;  4X3R A;  2V77 A;  2DF5 A;  2YND A;  1HDQ A;  4A2Z A;  1TKF A;  3NH8 A;  4P4F A;  1BO4 A;  3EY5 A;  3KI9 A;  3S6G A;  3H8E A;  2PJ4 A;  3DR6 A;  2X7B A;  3QNV A;  1ON0 A;  2EBJ A;  1QSR A;  5DWN A;  1S7L A;  2EK9 A;  2ZW4 A;  3BLN A;  1CP6 A;  2Q51 A;  5K8M A;  4LQG A;  2ATR A;  3BXM A;  3F8K A;  3E0K A;  4P10 A;  3C26 A;  3IFE A;  3B8G A;  2RB7 A;  1P4N A;  5HVG A;  1B87 A;  1IGB A;  2VBQ A;  5BWA B;  2VI7 A;  2Z3P A;  1SQH A;  2V8D A;  1M4I A;  4XPD B;  3PBB A;  3B2Y A;  1Q7L A;  1Y9W A;  2DXQ A;  2ZOG A;  4FD5 A;  4K30 A;  2IJZ A;  2Q04 A;  3SJE A;  4A31 A;  4AVB A;  4B5P A;  1NMT A;  2CNM A;  2FL4 A;  4M85 A;  2P0W A;  1QSN A;  1ZLI A;  2JLM A;  2OZU A;  5IV0 A;  1H8L A;  4BBH A;  1Z8X A;  4UFX A;  3D68 A;  3V7Z A;  3BJ7 A;  4LUA A;  1S7N A;  4NGN A;  2PJ5 A;  2J9A A;  4KOS A;  2VZZ A;  3TCV A;  4F9V A;  4FWU A;  5EC4 A;  1FY7 A;  1JWQ A;  1S7F A;  2VXK A;  5F47 A;  3R9E A;  3TX8 A;  2D4P A;  3B3T A;  1IY7 A;  4E2A A;  4ZBG A;  4HNY B;  2IQ6 A;  4EWT A;  4KOY A;  2EO8 A;  4OAD A;  4H89 A;  3PFE A;  2DEA A;  3I3G A;  4MHD A;  1M4L A;  3KL9 A;  4MCP A;  5IX3 A;  3HLP A;  4JJX A;  7CPA A;  4ZI6 A;  2CNS A;  5FVJ A;  4BMH A;  4YGO A;  3G3S A;  4M6I A;  4L89 A;  2BL1 A;  1EE3 P;  3SJF A;  4CYP A;  5LRK A;  3B35 A;  2G9D A;  2Q4V A;  4ZX9 A;  5A28 A;  2B3V A;  3V8I A;  3W91 A;  2BCO A;  1AUG A;  1ELM P;  2FCK A;  4UCP A;  3FF3 A;  3SI2 A;  4DJL A;  4E0A A;  3H4Q A;  1IYK A;  4KZT A;  4AVA A;  3JTK A;  4MFZ A;  4H6U A;  4MCQ A;  2FIW A;  1TKH A;  1IB1 E;  3KHZ A;  2XEG A;  3SJG A;  4MJ8 A;  2ZW6 A;  5AG7 A;  1DE4 C;  4B5O A;  5C88 A;  4X5K A;  1TF9 A;  4CGP A;  4CRY B;  4DNC A;  4QB9 A;  3IGR A;  4KOR A;  1YVO A;  1Z4E A;  1Q2C A;  2REF A;  3G8W A;  4CS0 B;  3PBE A;  4UEE A;  4C68 A;  5I4M A;  3B3C A;  4IK2 A;  1TXR A;  4OC1 A;  2JEW A;  3D3S A;  1PUA A;  3KHX A;  2V8H A;  4QBJ A;  1TIQ A;  1M1D A;  2FT0 A;  4UFW A;  5F09 A;  2PVV A;  4U5Y A;  5J8F A;  4KSA A;  3EO4 A;  4HNX B;  4CAE A;  1BPN A;  3KQZ A;  4PXD A;  5KTD A;  2OOT A;  3NE8 A;  1YGH A;  4MI4 A;  3NA6 A;  1ZLH A;  2BSW A;  2NSM A;  4FAI A;  1S7K A;  2V8G A;  3IWW A;  3GUX A;  1CPS A;  4MXU A;  4NXY A;  4PPZ A;  4UEF A;  3EFA A;  4GXH A;  1XBU A;  1MJA A;  4MFL A;  5AGE A;  3T8W A;  1Z9U A;  1KWM A;  1VHS A;  1XMT A;  4L8A A;  1Z4R A;  4JXR A;  5ELY A;  3LD2 A;  2EVN A;  5G1Z A;  3RZA A;  3SXN A;  2RFH A;  4UA3 A;  3B7I A;  5JGF A;  3H8F A;  2ANP A;  2Z0Z A;  3FEC A;  1A2Z A;  1VKC A;  4IAV A;  4KLW A;  3VAR A;  3HUV A;  2GLJ A;  2JBJ A;  4CAV A;  1XIX A;  2GE3 A;  4A37 A;  5LRG A;  5LRJ A;  3CXP A;  2PQ8 A;  4TNU A;  2I79 A;  1CM0 A;  3RNZ A;  2CY2 A;  5EMI A;  3SI0 A;  5I0C A;  2PR8 A;  1CPX A;  3WAB A;  2AE6 A;  2KCW A;  2ZEM A;  4NGR A;  4KSF A;  4B13 A;  3CXS A;  2FXF A;  2PIY A;  1XJO A;  4FD4 A;  2VQY A;  2J8M A;  4NJR A;  3WR7 A;  4F8Z A;  3V38 A;  4Y49 C;  3F0A A;  2B5G B;  1YQE A;  1Z8T A;  1XOV A;  3TC8 A;  4YWY A;  1Y7R A;  4NJQ A;  3KGQ A;  3DSB A;  5HXD A;  1I12 A;  2A4N A;  5EBV A;  3FNC A;  5JQ4 A;  3P2H A;  4A94 A;  4YRH A;  4W9Y A;  1LCP A; 
#chains in the Genus database with same CATH homology
 1XMB A;  1LAM A;  3BHX A;  4MCR A;  3NH4 A;  2ZEG A;  1VHO A;  3VAT A;  1RTQ A;  4MHY A;  3D66 A;  1ZG7 A;  2ZED A;  4OME A;  3PB9 X;  2XEF A;  2WYR A;  3WC6 A;  3FEE A;  4MMO A;  3K9T A;  4DUK A;  2NYQ A;  2CF4 A;  2PVW A;  1XRY A;  2GLF A;  3BI1 A;  4R76 A;  3D7D A;  5THW A;  1YME A;  2ZEL A;  4RUH A;  5J1Q A;  5DS0 A;  4AXV A;  4MHZ A;  3H8G A;  1ELL P;  3VH9 A;  2EWB A;  4MHP A;  2C6G A;  3S9L A;  1XFO A;  4ZX8 A;  3D7F A;  4FUU A;  1Y0R A;  1CP7 A;  6CPA A;  1CX8 A;  4UF4 A;  3KZW A;  3L2N A;  1FNO A;  3FVL A;  3B3W A;  1LFW A;  1NSA A;  2PE3 A;  4P45 A;  4NGQ A;  3PRT A;  4K3N A;  4PXE A;  2PJ8 A;  1QQ9 A;  4JZ0 A;  4KSI A;  4B6Z A;  1Z5R A;  3PB7 X;  1R43 A;  4P4B A;  1ARM A;  2AFM A;  2BO9 A;  4ZY2 A;  4BD9 A;  4F9U A;  3B3V A;  2XEI A;  4TWE A;  4P4I A;  4OKO A;  3N5F A;  3FED A;  5CPA A;  4ZY1 A;  1ZG9 A;  2VL1 A;  4PXC A;  2C1C A;  2PJ1 A;  1VGY A;  2AFZ A;  1F2O A;  4GM5 A;  3IJ3 A;  2IMO A;  5JH9 A;  3WT4 A;  3FJU A;  2CTB A;  2ZEF A;  3KR5 A;  2ZEN A;  2HB6 A;  3FMC A;  3KQX A;  2V8V A;  3FH4 A;  4X2T A;  3PB6 X;  4UEZ A;  1PYT B;  1TKJ A;  2AFX A;  4X8I A;  3D4U A;  4OID A;  5LYD A;  3IO1 A;  3WC7 A;  4UIB A;  3JRU A;  5HVH A;  4O23 A;  5HVF A;  1VHE A;  1OBR A;  4FBE A;  1Y7E A;  1YW4 A;  1Y0Y A;  1CBX A;  2GU2 A;  3KAS A;  5LYI A;  4P44 A;  2Q4Z A;  2PIZ A;  3B3S A;  4OC0 A;  3MRU A;  3GB0 A;  4NGP A;  2POK A;  1CG2 A;  4PXB A;  3CPX A;  3CDX A;  1ARL A;  1F2P A;  4WJB A;  4WWV A;  2I3C A;  4R7M A;  2C6P A;  8CPA A;  2ZEH A;  1UWY A;  3NH5 A;  3DGV A;  4NFR A;  5LYL A;  2FVG A;  2ABZ A;  3ISZ A;  3CPA A;  1JQG A;  1AMP A;  4H2K A;  1AYE A;  2Q43 A;  4MHN A;  4NGS A;  2WZN A;  4UIA A;  2JBK A;  3GLJ A;  2PJA A;  5JM6 A;  4R6T A;  3DLJ A;  2AFU A;  3D67 A;  4P4D A;  5K8N A;  3PB8 X;  2CTC A;  3SJX A;  1YSJ A;  2PJ6 A;  2F8H A;  1ZG8 A;  1BPM A;  2EK8 A;  4OC4 A;  1YLO A;  2F7V A;  3PEI A;  2PJ2 A;  5K8O A;  3S9N A;  1LOK A;  4P4E A;  2OR4 A;  2QYV A;  3IC1 A;  2CIJ A;  4CPA A;  2C6C A;  4A39 A;  1YW6 A;  2HC9 A;  3PB4 X;  3S9M A;  2XEJ A;  4R8F A;  2PJ0 A;  1PCA A;  3D7H A;  3RBU A;  2PJ3 A;  3BI0 A;  2ZEE A;  1TF8 A;  3SI1 A;  1VIX A;  1F57 A;  4P4J A;  3K2K A;  3D7G A;  4OC5 A;  4YU9 A;  4OC2 A;  2QVP A;  3MN8 A;  1Z8L A;  4P6Y A;  4Z65 A;  1BLL E;  2ZEP A;  2PJC A;  2O53 A;  2O4H A;  5CBM A;  4OIW A;  4EFD A;  4EME A;  2PCU A;  4DYO A;  5LYF A;  4ZYQ A;  2AFW A;  3WC5 A;  3IIB A;  1DTD A;  5IB9 A;  5K8P A;  2ZOF A;  3NFZ A;  1HDU A;  4OC3 A;  4NGM A;  2QJ8 A;  1QMU A;  4ONW A;  5D29 A;  4MCS A;  4G1P A;  2PJB A;  3LWU A;  2GRE A;  3CT9 A;  4A38 A;  4Q7A A;  3IEH A;  1LAP A;  4IHM A;  4PQA A;  5D8N A;  3RAM A;  1FT7 A;  2ZEO A;  1BAV A;  1GYT A;  4JYW A;  2AFO A;  4MRI A;  3FX6 A;  2PRQ A;  4ZY0 A;  4OP4 A;  2AFS A;  2PJ9 A;  2BOA A;  1R3N A;  3KR4 A;  1LAN A;  3LMS A;  2PJ7 A;  1HEE A;  3I1U A;  3ISX A;  3PFO A;  1Z2L A;  4NGT A;  4X3R A;  2V77 A;  1HDQ A;  1TKF A;  3NH8 A;  4P4F A;  3KI9 A;  3H8E A;  2PJ4 A;  3QNV A;  2EK9 A;  1CP6 A;  2Q51 A;  5K8M A;  4LQG A;  3BXM A;  4P10 A;  3IFE A;  2RB7 A;  5HVG A;  1IGB A;  2V8D A;  3PBB A;  3B2Y A;  1Q7L A;  2ZOG A;  3SJE A;  2IJZ A;  1ZLI A;  1H8L A;  3D68 A;  3V7Z A;  4NGN A;  2PJ5 A;  2J9A A;  4F9V A;  4FWU A;  3TX8 A;  3B3T A;  1IY7 A;  2IQ6 A;  4EWT A;  3PFE A;  2DEA A;  1M4L A;  3KL9 A;  4MCP A;  3HLP A;  7CPA A;  4ZI6 A;  1EE3 P;  3SJF A;  5LRK A;  3B35 A;  2G9D A;  4ZX9 A;  2BCO A;  1ELM P;  3FF3 A;  3SI2 A;  4DJL A;  4MCQ A;  1TKH A;  3KHZ A;  2XEG A;  3SJG A;  1DE4 C;  1TF9 A;  3PBE A;  4UEE A;  5I4M A;  3B3C A;  4IK2 A;  1TXR A;  4OC1 A;  2JEW A;  3KHX A;  2V8H A;  5F09 A;  2PVV A;  1BPN A;  3KQZ A;  4PXD A;  2OOT A;  3NA6 A;  1ZLH A;  2NSM A;  4FAI A;  2V8G A;  3IWW A;  3GUX A;  1CPS A;  4MXU A;  4PPZ A;  4UEF A;  1XBU A;  3T8W A;  1KWM A;  3RZA A;  5ELY A;  2RFH A;  3B7I A;  5JGF A;  3H8F A;  2ANP A;  4IAV A;  3FEC A;  3VAR A;  3HUV A;  2GLJ A;  2JBJ A;  4A37 A;  5LRG A;  5LRJ A;  4TNU A;  3SI0 A;  1CPX A;  3WAB A;  2ZEM A;  4NGR A;  2PIY A;  1XJO A;  4NJR A;  4F8Z A;  3V38 A;  3TC8 A;  4YWY A;  4NJQ A;  3KGQ A;  5HXD A;  4A94 A;  4W9Y A;  1LCP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...