4UEZA

Crystal structure of the human carboxypeptidase a1 in complex with the phosphinic inhibitor acetyl-leu-phe-y(po2ch2)-phe-oh
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
306
structure length
306
Chain Sequence
b'STDTFNYATYHTLEEIYDFLDLLVAENPHLVSKIQIGNTYEGRPIYVLKFSTGGSKRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLDIFLEIVTNPDGFAFTHSTNRMWRKTRSHTAGSLCIGVDPNRNWDAGFGLSGASSNPCSETYHGKFANSEVEVKSIVDFVKDHGNIKAFISIHSYSQLLMYPYGYKTEPVPDQDELDQLSKAAVTALASLYGTKFNYGSIIKAIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIIPTAKETWLALLTIMEHTLNHP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HUMAN CARBOXYPEPTIDASE A1
publication title Crystal Structure of the Human Carboxypeptidase A1 in Complex with Phosphinic Inhibitors
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 114
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 3.4.17.1: Carboxypeptidase A.
pdb deposition date 2014-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00246 Peptidase_M14 Zinc carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.10 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Zn peptidases 4uezA00
3D66A 3FECA 3KL9A 4OMEA 4YWYA 4UF4A 1XJOA 4WWVA 4PXBA 3FEDA 3SI2A 3GUXA 1BPMA 1H8LA 3DGVA 3HLPA 1CX8A 1ZG9A 5F09A 4F9UA 1FNOA 3K9TA 2GU2A 4Q7AA 4UIAA 2V8DA 2F8HA 3CPXA 2JBKA 3B35A 3B3WA 1ZG7A 1CPXA 3SJEA 4Z65A 3CDXA 1ARLA 4X3RA 5K8NA 1HEEA 1EE3P 2ZEPA 2BCOA 2PJ1A 4W9YA 1Z2LA 4OIDA 2ZEGA 3WABA 3SI0A 6CPAA 4OC1A 3SI1A 3K2KA 5HVHA 3KR5A 3D7DA 1VGYA 4PXEA 2C6GA 1CBXA 3D7FA 4NGQA 3FX6A 2AFSA 2WYRA 4OIWA 2AFOA 4ZX8A 4B6ZA 4CPAA 1XBUA 2PJ6A 1NSAA 4NGNA 4MHPA 1Y0RA 3L2NA 3HUVA 3CT9A 4IAVA 2ZEEA 2ANPA 4MXUA 5LYIA 4F9VA 4ZY0A 3PFEA 3FEEA 2EWBA 4NGSA 3KZWA 3IIBA 2IMOA 1BAVA 3CPAA 1XRYA 1ELMP 4P4DA 3V38A 4RUHA 1BLLE 1BPNA 4JYWA 4A37A 4NGMA 4OP4A 3NH8A 3V7ZA 4GM5A 1XFOA 5LYFA 2C6CA 2XEJA 5JH9A 1F2PA 3KQXA 3LMSA 4OC0A 4ZI6A 5JGFA 1DTDA 3KHXA 2XEIA 1LAPA 4DUKA 4A94A 2ZENA 1RTQA 1XMBA 1F2OA 3TC8A 3B7IA 2I3CA 4ZYQA 4A38A 2PJAA 3VH9A 4UEFA 3IFEA 5K8MA 2PJ2A 2JEWA 4IK2A 2AFXA 1OBRA 1TF8A 3H8FA 3NFZA 7CPAA 1Z8LA 4FAIA 1YLOA 2V8HA 4PXCA 3IWWA 5J1QA 2RB7A 2ZEDA 3PBBA 2PRQA 3ISXA 3PEIA 3QNVA 3S9LA 1GYTA 3S9MA 2PJ3A 2ZEMA 2Q51A 3D68A 4MMOA 4PQAA 5LYLA 1LOKA 2QJ8A 2ZOFA 3KGQA 3GLJA 5THWA 3B3CA 2PJBA 2C6PA 3WT4A 1IY7A 2BOAA 4MRIA 4FBEA 4KSIA 2RFHA 4EMEA 2QYVA 3VARA 2ZEFA 2OR4A 2Q4ZA 4MCQA 3BI1A 3JRUA 4MHZA 3FMCA 2VL1A 3GB0A 3RAMA 2O53A 4X8IA 4R76A 2C1CA 1CPSA 5K8PA 1TKHA 3D67A 2PIZA 3SJGA 4EWTA 4UEZA 3PB8X 2PJCA 2IQ6A 4UEEA 2ZEHA 3D7GA 1Z5RA 3PFOA 4MHYA 4P6YA 3KR4A 2CF4A 8CPAA 4NJQA 4ZY2A 2EK9A 2NYQA 1QMUA 4X2TA 3PB9X 4DJLA 2ZELA 5LRJA 3WC7A 3PBEA 2PJ4A 2WZNA 2PJ8A 3KHZA 1CG2A 4P4FA 1ZLHA 4G1PA 4P4JA 1CP6A 2V77A 2J9AA 3KASA 3BXMA 3H8GA 2OOTA 4TNUA 1ARMA 1FT7A 4ONWA 4DYOA 2F7VA 5LYDA 4P10A 2GLJA 1AMPA 2PCUA 4P45A 1YSJA 1TKJA 3NH4A 4OC2A 5D29A 4JZ0A 2HB6A 1VIXA 5IB9A 2XEGA 1R43A 1QQ9A 3H8EA 3TX8A 2ZOGA 3MN8A 4K3NA 4NGRA 5JM6A 1TF9A 2G9DA 5HVFA 5K8OA 1DE4C 1JQGA 4F8ZA 2AFUA 1R3NA 3SJFA 1VHEA 2NSMA 2POKA 1F57A 1ZLIA 3PB4X 5LRKA 4O23A 1LANA 1ELLP 2V8GA 1CP7A 4WJBA 3RZAA 3NA6A 4NGPA 2HC9A 3IO1A 5HXDA 4P4BA 5HVGA 2PE3A 2CTCA 1PYTB 3PB6X 1AYEA 1KWMA 4H2KA 3DLJA 4PPZA 1HDUA 3FJUA 1YMEA 2GREA 2AFZA 4OKOA 1HDQA 2XEFA 3RBUA 2EK8A 1LFWA 4MHNA 4P4EA 1M4LA 5CBMA 3B3TA 4FUUA 2PVVA 3D4UA 3IEHA 4NJRA 2PJ0A 4OC4A 4TWEA 5CPAA 2O4HA 3IJ3A 3KI9A 4NGTA 1PCAA 2FVGA 3BI0A 3NH5A 3SJXA 4R8FA 1TKFA 1Q7LA 3T8WA 4LQGA 4ZX9A 2PJ7A 3WC5A 2IJZA 3B2YA 3LWUA 4P44A 5DS0A 3I1UA 1IGBA 3WC6A 3FH4A 4MCSA 3MRUA 4FWUA 4R6TA 3IC1A 2GLFA 1YW4A 1Y7EA 2JBJA 4P4IA 1VHOA 2BO9A 2QVPA 2AFMA 4A39A 2ZEOA 5LRGA 4EFDA 3N5FA 3D7HA 3KQZA 4YU9A 1UWYA 3BHXA 1LCPA 3S9NA 2PVWA 2V8VA 1YW6A 2CTBA 4MCRA 4OC5A 5ELYA 3ISZA 4NFRA 1ZG8A 2CIJA 3PRTA 2PJ9A 3FF3A 4BD9A 4MCPA 2ABZA 2DEAA 3FVLA 5D8NA 5I4MA 4ZY1A 4AXVA 2AFWA 4OC3A 2PJ5A 3B3VA 4UIBA 1TXRA 3VATA 2PIYA 4R7MA 4PXDA 3B3SA 2Q43A 3PB7X 1LAMA 1Y0YA 4IHMA
chains in the Genus database with same CATH superfamily
3D66A 3FECA 3KL9A 4OMEA 3RO0A 4YWYA 4UF4A 1XJOA 4WWVA 4PXBA 5AG4A 3FEDA 4FD7A 3SI2A 2BEIA 3GUXA 4LX9A 4KOYA 1B6BA 1BPMA 2Q0YA 1H8LA 3DGVA 2FCKA 3HLPA 3OWCA 3R1KA 4JD6A 4U9ZA 3GY9A 1CX8A 3A9LA 1ZG9A 4KUAA 4YRHA 5F09A 4F9UA 1FNOA 3K9TA 2GU2A 3D8PA 4JXQA 4Q7AA 4UIAA 2V8DA 4KVXA 2Z3NA 2C27A 2F8HA 3CPXA 5AG5A 2JBKA 4CGLA 3B35A 4AVBA 3B3WA 1ZG7A 2WSAA 1M4DA 1CPXA 1CM0A 3EO4A 4KS9A 1XE4A 3SJEA 2FIWA 4Z65A 3CDXA 1ARLA 4X3RA 2EUIA 4X5KA 5K8NA 1HEEA 2ZW7A 1EE3P 2GE3A 2ZEPA 4GS4A 4CYQA 2BCOA 2PJ1A 4M6IA 2Z11A 5G20A 2QMLA 4W9YA 1Z2LA 1Q2DA 4OIDA 2ZEGA 4CYOA 4U5YA 3WABA 3SI0A 1QSRA 4FD6A 3EFAA 6CPAA 4OC1A 3SI1A 3K2KA 4C2ZA 5HVHA 5A28A 5I0CA 3KR5A 3D7DA 1VGYA 2PRBA 4PXEA 5EBVA 5F49A 2J8RA 4NSQA 4II9A 3FB3A 3CXSA 2OB0A 3PZJA 2C6GA 1CBXA 3D7FA 4NGQA 4AG7A 3FX6A 2AFSA 2WYRA 2VQYA 1I1DA 2DPSA 4OIWA 2AFOA 4MI4A 4ZX8A 4B6ZA 3H4QA 3K9UA 4F0YA 4CPAA 4E8OA 2X7BA 3DNSA 2JDCA 5F47A 2PJ6A 4ZGYB 1NSAA 4NGNA 4MHPA 1Y0RA 3L2NA 3HUVA 3CT9A 4IAVA 2ZEEA 2ANPA 4MXUA 5LYIA 1SQHA 4CYPA 4F9VA 3PFEA 2EO8A 3FEEA 3PP9A 2EWBA 1NMTA 3EXNA 4NGSA 1YK3A 1IYKA 3KZWA 2DXQA 3IIBA 5FVJA 1X10A 2GANA 2IMOA 1BAVA 1RO5A 3CPAA 3F0AA 1XRYA 1LAMA 3LODA 1Q2YA 1ELMP 4P4DA 3N7ZA 1M4IA 1BLLE 1BPNA 3V38A 1IB1E 4RUHA 3RNZA 3SHPA 2FT0A 2P6EA 4JYWA 3V8IA 4NGMA 4A37A 3MGDA 4OP4A 3SXOA 3IGRA 5HMNA 3GYAA 3NH8A 4KORA 4PV6A 3V7ZA 1KZFA 2WUUA 4GM5A 1XFOA 4B5PB 2B4BA 3GIUA 5LYFA 2C6CA 2XEJA 4CAXA 4UWIA 1J4JA 4F0XA 5JH9A 1F2PA 3KQXA 1B87A 3LMSA 5AGEA 4OC0A 1QSMA 4H6ZA 3R96A 4CRYB 4ONUA 4ZI6A 4C2YA 4BBHA 5JGFA 1DTDA 3KHXA 2XEIA 2Q04A 5KTAA 1LAPA 4DUKA 4A94A 4HPSA 4C68A 4UWJA 3BJ8A 4KVOE 2ZENA 1RTQA 1XMBA 1F2OA 3GKRA 4HNYB 3TC8A 4B10A 3FXTA 3B7IA 4HNXB 4A31A 1AUGA 2I3CA 3IWEA 4KOUA 4ZYQA 4JJXA 4A38A 2PJAA 2K5TA 3VH9A 3TOBA 4UEFA 1X12A 3IFEA 5K8MA 4CYNA 2PJ2A 2JEWA 4IK2A 1QSNA 1KUVA 2AFXA 2HV2A 2G3TA 3C26A 3NE7A 3S6HA 4B13A 1OBRA 2VXKA 1TF8A 4YGOA 4CGOA 3H8FA 4YFJA 3FIXA 2JDDA 3F5BA 3NFZA 5DWMA 7CPAA 2VI7A 2Z0ZA 4J3GA 1Z8LA 2J8MA 3DR8A 1KUXA 2P6FA 4PSXA 4RS2A 5HH1A 1YLOA 2V8HA 2PDOA 4PK3A 4PXCA 1NE9A 3IWWA 4QB9A 4OADA 4Y49C 3TO9A 2RB7A 4B14A 2Z3LA 2ZEDA 5F46A 5J1QA 3PBBA 5BWAB 4FAIA 2PRQA 3I3GA 3ISXA 3PEIA 3QNVA 4QVTA 3S9LA 1GYTA 1S7KA 3S9MA 5H84A 4AXVA 2PJ3A 3FNCA 2CXAA 1QSOA 2Q51A 2ZEMA 1XEBA 3D2PA 3D68A 1ON0A 4MMOA 4PQAA 3IU1A 2VZZA 5LYLA 3SXNA 1LOKA 1I12A 5AG7A 3G8WA 2QJ8A 3E0KA 2ZOFA 3EY5A 3KGQA 4HNWB 1I21A 3D3SA 3GLJA 5THWA 3B3CA 2PJBA 2C6PA 2GFQA 3WT4A 4CAVA 2G3AA 1IY7A 2BOAA 3LD2A 4MRIA 4FBEA 4KSIA 2RFHA 3TO6A 4EMEA 5IX3A 2QYVA 4ZBGA 3VARA 2NMTA 2D4OA 2ZEFA 4B11A 2R7HA 3DDDA 4E2AA 2I00A 2OR4A 5J8CA 2Q4ZA 4MCQA 3BI1A 4RN7A 1Z8XA 3JRUA 4MHZA 3FMCA 1YX0A 2VL1A 3GB0A 4MFKA 2O53A 4Y49B 3RAMA 3QAYA 3TOAA 4X8IA 2PQ8A 4H89A 4R76A 4PK2A 2C1CA 1UFHA 1BO4A 4KOSA 4CGNA 3VWDA 1CPSA 4MFJA 4A95A 5K8PA 1TKHA 1M1DA 2Z3PA 1YQEA 3D67A 2PIZA 1VKCA 3SJGA 4EWTA 2B3UA 1ZO0A 2VBQA 2YGWA 4UEZA 2P0WA 2PJCA 3T9YA 1XOVA 2IQ6A 3UY5A 4UEEA 2ZEHA 3D7GA 1Z5RA 2FS5A 3PFOA 2JEVA 2ZW4A 3BLNA 1VHSA 3TT2A 4MHYA 4QBJA 4P6YA 3KR4A 2CF4A 8CPAA 4MY0A 4MBUA 4NJQA 4ZY2A 4CGMA 2EK9A 2NYQA 2PC1A 1QMUA 4X2TA 5AG6A 1P0HA 1BOBA 3NE8A 1K4JA 2BL1A 3PB9X 5GCNA 4B12A 2OZGA 4DJLA 4EVYA 2ZELA 5LRJA 3WC7A 3TCVA 2YNCC 3PBEA 5F48A 2PJ4A 2ZPAA 5DWNA 2WZNA 2PJ8A 2QECA 2Z3MA 2CNSA 2YNDA 3WR7A 3KHZA 1CG2A 4P4FA 1U6MA 2WPXA 4IUSA 1ZLHA 4G1PA 1FY7A 5EC4A 1KUYA 1CP6A 1JWQA 2BUEA 4P4JA 5EMIA 1Z8TA 2QIRA 2V77A 4M85A 4F6AA 2J9AA 3KASA 1PU9A 2RC4A 4L8AA 3BXMA 4AG9A 3H8GA 2OOTA 4E0AA 4M6GA 4BINA 3KKWA 4LUAA 4JXRA 3VWEA 2DPTA 4B5PA 4C2XA 2O28A 2FSRA 4TNUA 3FYNA 1ARMA 4CGPA 1FT7A 3W6XA 2B4DB 1S7NA 3FBUA 4ONWA 4DYOA 2GIVA 4K30A 4A30A 2F7VA 2R1IA 5LYDA 1IOFA 4MFLA 4JWPA 4P10A 2GLJA 1AMPA 4KOWA 4UFVA 2A4NA 2PCUA 4P45A 5C82A 5J8FA 2Q7BA 4A32A 2Z3KA 3TO7A 4KOXA 3R95A 2OZUA 1QSTA 4MFZA 1YSJA 1TKJA 3NH4A 4NXYA 3W91A 4OC2A 5D29A 3QAHA 3DR6A 2HB6A 4JZ0A 1VIXA 4UA3A 1XF8A 1YVKA 2VEZA 3S6FA 2EBJA 2B5GB 5IB9A 1S7LA 4XPLA 2XEGA 4R9MA 4KOVA 5KTDA 1R43A 1QQ9A 2AJ6A 1IYLA 2KCWA 4C7HA 1YLEA 2DF5A 1Z8WA 4NEXA 2FXFA 2I79A 3H8EA 4XNHC 3TX8A 2ZOGA 3MN8A 4K3NA 4NGRA 5JM6A 1TF9A 2P6GA 2G9DA 5HVFA 5G1ZA 5K8OA 5IV0A 2OU2A 4KSFA 3ZZIA 1DE4C 1JQGA 2Z10A 4GXHA 1IIDA 2PSWA 1Q2CA 2F5IA 3IU2A 2AFUA 1V0CA 1R3NA 4F8ZA 3SJFA 4UFWA 1VHEA 1IU8A 1LRZA 1ZLIA 1F57A 1RXTA 2NSMA 2POKA 2REFA 3W6SA 3PB4X 2IL4A 4ORFA 5LRKA 4KOTA 4O23A 1LANA 1ELLP 4Q36A 2V8GA 2CNMA 4U9YA 1CP7A 4MJ8A 4R57A 4WJBA 3RZAA 3S6GA 1MK4A 3NA6A 4CAFA 5JPHA 3LACA 3TE4A 2YNEA 4NGPA 2ZXVA 3P2HA 2HC9A 3IO1A 1N71A 3CXQA 1Y9WA 5HXDA 4XPDC 4P4BA 1S3ZA 4I49A 4JLYA 5CNPA 5HVGA 3FRMA 1YGHA 2PE3A 2B3VA 2OZHA 1YR0A 3JTKA 4KLWA 2CTCA 1PYTB 3CZXA 4OLLA 4AVCA 4XNHB 3PB6X 1AYEA 1MJ9A 4AVAA 1KWMA 1Z9UA 4M3SA 2Q4VA 4H2KA 3DLJA 4PPZA 4UCNA 1HDUA 3FJUA 1S7FA 1YMEA 1Z4EA 3R9EA 2GREA 2AFZA 3G3SA 4OKOA 4XPKA 4MHDA 2ATRA 1WK4A 1HDQA 2XEFA 3IWGA 4R87A 3RBUA 2EK8A 2HUZA 3R9FA 1LFWA 4MHNA 4P4EA 2J8NA 1MJAA 4R3LA 1S60A 5G21A 1M4LA 5KTCA 3JUWA 5CBMA 1Y7RA 5IB0A 3B3TA 3TTHA 4FUUA 3B8GA 3PB7X 2PVVA 1M44A 1S5KA 1Y9KA 3D4UA 3IEHA 4MFQA 1M4GA 4NJRA 2PJ0A 4OC4A 4TWEA 3EC4A 4XPDB 4QC6A 5CPAA 2O4HA 3QB8A 2Q44A 3IJ3A 3KI9A 4NGTA 4OAEA 4BMHA 4FD4A 1CJWA 4B5OA 1PCAA 4PSWA 4R3KA 1MJBA 4UFXA 2FVGA 2R98A 2OH1A 3BI0A 3NH5A 2Q7SA 3S6KA 4CAEA 3F8KA 3SJXA 4R8FA 1TKFA 1Q7LA 3T8WA 3BJ7A 4LQGA 4ZX9A 2PJ7A 3WC5A 2H5MA 2FIAA 2IJZA 5G22A 3B2YA 3LWUA 4P44A 4RI1A 4UCPA 5DS0A 1GHEA 3JVNA 4ZY0A 3H5ZA 2D4PA 3I1UA 1IGBA 3WC6A 3FH4A 4MCSA 4H6UA 4M6HA 3R9GA 3MRUA 4FWUA 4HKFA 4NF1A 4R6TA 1P4NA 3IC1A 2GLFA 2FE7A 4CAWA 5ISVA 4MY3A 1YW4A 1XMTA 1Y7EA 2JBJA 4P4IA 3T90A 5JQ4A 1VHOA 4CS0B 2BO9A 2EVNA 2QVPA 2AFMA 2B58A 4MFPA 4FD5A 4A39A 4QUSA 2ZEOA 5LRGA 4EFDA 1WWZA 1A2ZA 4IHMA 4KZTA 3N5FA 3D7HA 3KQZA 2FL4A 4YU9A 2Q4YA 2B4DA 2Z3OA 1UWYA 2AE6A 3BHXA 4A2ZA 1LCPA 1IOIA 3S9NA 2PVWA 2V8VA 2CNTA 3DSBA 4CRZB 1L0CA 1R57A 1YW6A 2CTBA 3ZJ0A 4MCRA 1IICA 5H86A 2ZW5A 4L89A 2JLMA 4KUBA 2YNCA 2WPWA 1Z4RA 4OC5A 5ELYA 3ISZA 1YVOA 3I9SA 3P2FA 4NFRA 4UBRA 1YREA 1ZG8A 4AB7A 2CIJA 2PR1A 2VZYA 2PJ9A 3FF3A 3PRTA 4KLVA 3PGPA 4NCZA 4MCPA 1NSLA 4BD9A 2ODFA 2ABZA 2HQYA 5C88A 2DEAA 4C7IA 3FVLA 5D8NA 5I4MA 4KVME 5E96A 1OZPA 2PR8A 4ZY1A 2R8VA 3D2MA 4Q38A 2AFWA 2ARHA 2B5GA 4KSAA 4OC3A 4UCMA 2PJ5A 3B3VA 4A33A 3CXPA 4LQ6A 4UIBA 1TXRA 1PUAA 2G0BA 2ZW6A 2PIYA 2BSWA 4R7MA 3VATA 3RYOA 4PXDA 5A27A 2CY2A 3B3SA 2REEA 1XIXA 4IF5A 4DNCA 3TFYA 2Y0MA 2Q43A 1TIQA 1XBUA 1Y0YA 3PB8X
chains in the Genus database with same CATH topology
3D66A 3FECA 3KL9A 4OMEA 4YWYA 4UF4A 1XJOA 4WWVA 4PXBA 3FEDA 3SI2A 3GUXA 1BPMA 1H8LA 3DGVA 3HLPA 1CX8A 1ZG9A 5F09A 4F9UA 1FNOA 3K9TA 2GU2A 4Q7AA 4UIAA 2V8DA 2F8HA 3CPXA 2JBKA 3B35A 3B3WA 1ZG7A 1CPXA 3SJEA 4Z65A 3CDXA 1ARLA 4X3RA 5K8NA 1HEEA 1EE3P 2ZEPA 2BCOA 2PJ1A 4W9YA 1Z2LA 4OIDA 2ZEGA 3WABA 3SI0A 6CPAA 4OC1A 3SI1A 3K2KA 5HVHA 3KR5A 3D7DA 1VGYA 4PXEA 2C6GA 1CBXA 3D7FA 4NGQA 3FX6A 2AFSA 2WYRA 4OIWA 2AFOA 4ZX8A 4B6ZA 4CPAA 1XBUA 2PJ6A 1NSAA 4NGNA 4MHPA 1Y0RA 3L2NA 3HUVA 3CT9A 4IAVA 2ZEEA 2ANPA 4MXUA 5LYIA 4F9VA 4ZY0A 3PFEA 3FEEA 2EWBA 4NGSA 3KZWA 3IIBA 2IMOA 1BAVA 3CPAA 1XRYA 1ELMP 4P4DA 3V38A 4RUHA 1BLLE 1BPNA 4JYWA 4A37A 4NGMA 4OP4A 3NH8A 3V7ZA 4GM5A 1XFOA 5LYFA 2C6CA 2XEJA 5JH9A 1F2PA 3KQXA 3LMSA 4OC0A 4ZI6A 5JGFA 1DTDA 3KHXA 2XEIA 1LAPA 4DUKA 4A94A 2ZENA 1RTQA 1XMBA 1F2OA 3TC8A 3B7IA 2I3CA 4ZYQA 4A38A 2PJAA 3VH9A 4UEFA 3IFEA 5K8MA 2PJ2A 2JEWA 4IK2A 2AFXA 1OBRA 1TF8A 3H8FA 3NFZA 7CPAA 1Z8LA 4FAIA 1YLOA 2V8HA 4PXCA 3IWWA 5J1QA 2RB7A 2ZEDA 3PBBA 2PRQA 3ISXA 3PEIA 3QNVA 3S9LA 1GYTA 3S9MA 2PJ3A 2ZEMA 2Q51A 3D68A 4MMOA 4PQAA 5LYLA 1LOKA 2QJ8A 2ZOFA 3KGQA 3GLJA 5THWA 3B3CA 2PJBA 2C6PA 3WT4A 1IY7A 2BOAA 4MRIA 4FBEA 4KSIA 2RFHA 4EMEA 2QYVA 3VARA 2ZEFA 2OR4A 2Q4ZA 4MCQA 3BI1A 3JRUA 4MHZA 3FMCA 2VL1A 3GB0A 3RAMA 2O53A 4X8IA 4R76A 2C1CA 1CPSA 5K8PA 1TKHA 3D67A 2PIZA 3SJGA 4EWTA 4UEZA 3PB8X 2PJCA 2IQ6A 4UEEA 2ZEHA 3D7GA 1Z5RA 3PFOA 4MHYA 4P6YA 3KR4A 2CF4A 8CPAA 4NJQA 4ZY2A 2EK9A 2NYQA 1QMUA 4X2TA 3PB9X 4DJLA 2ZELA 5LRJA 3WC7A 3PBEA 2PJ4A 2WZNA 2PJ8A 3KHZA 1CG2A 4P4FA 1ZLHA 4G1PA 4P4JA 1CP6A 2V77A 2J9AA 3KASA 3BXMA 3H8GA 2OOTA 4TNUA 1ARMA 1FT7A 4ONWA 4DYOA 2F7VA 5LYDA 4P10A 2GLJA 1AMPA 2PCUA 4P45A 1YSJA 1TKJA 3NH4A 4OC2A 5D29A 4JZ0A 2HB6A 1VIXA 5IB9A 2XEGA 1R43A 1QQ9A 3H8EA 3TX8A 2ZOGA 3MN8A 4K3NA 4NGRA 5JM6A 1TF9A 2G9DA 5HVFA 5K8OA 1DE4C 1JQGA 4F8ZA 2AFUA 1R3NA 3SJFA 1VHEA 2NSMA 2POKA 1F57A 1ZLIA 3PB4X 5LRKA 4O23A 1LANA 1ELLP 2V8GA 1CP7A 4WJBA 3RZAA 3NA6A 4NGPA 2HC9A 3IO1A 5HXDA 4P4BA 5HVGA 2PE3A 2CTCA 1PYTB 3PB6X 1AYEA 1KWMA 4H2KA 3DLJA 4PPZA 1HDUA 3FJUA 1YMEA 2GREA 2AFZA 4OKOA 1HDQA 2XEFA 3RBUA 2EK8A 1LFWA 4MHNA 4P4EA 1M4LA 5CBMA 3B3TA 4FUUA 2PVVA 3D4UA 3IEHA 4NJRA 2PJ0A 4OC4A 4TWEA 5CPAA 2O4HA 3IJ3A 3KI9A 4NGTA 1PCAA 2FVGA 3BI0A 3NH5A 3SJXA 4R8FA 1TKFA 1Q7LA 3T8WA 4LQGA 4ZX9A 2PJ7A 3WC5A 2IJZA 3B2YA 3LWUA 4P44A 5DS0A 3I1UA 1IGBA 3WC6A 3FH4A 4MCSA 3MRUA 4FWUA 4R6TA 3IC1A 2GLFA 1YW4A 1Y7EA 2JBJA 4P4IA 1VHOA 2BO9A 2QVPA 2AFMA 4A39A 2ZEOA 5LRGA 4EFDA 3N5FA 3D7HA 3KQZA 4YU9A 1UWYA 3BHXA 1LCPA 3S9NA 2PVWA 2V8VA 1YW6A 2CTBA 4MCRA 4OC5A 5ELYA 3ISZA 4NFRA 1ZG8A 2CIJA 3PRTA 2PJ9A 3FF3A 4BD9A 4MCPA 2ABZA 2DEAA 3FVLA 5D8NA 5I4MA 4ZY1A 4AXVA 2AFWA 4OC3A 2PJ5A 3B3VA 4UIBA 1TXRA 3VATA 2PIYA 4R7MA 4PXDA 3B3SA 2Q43A 3PB7X 1LAMA 1Y0YA 4IHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D66 A;  3FEC A;  3KL9 A;  4OME A;  4YWY A;  4UF4 A;  1XJO A;  4WWV A;  4PXB A;  3FED A;  3SI2 A;  3GUX A;  1BPM A;  1H8L A;  3DGV A;  3HLP A;  1CX8 A;  1ZG9 A;  5F09 A;  4F9U A;  1FNO A;  3K9T A;  2GU2 A;  4Q7A A;  4UIA A;  2V8D A;  2F8H A;  3CPX A;  2JBK A;  3B35 A;  3B3W A;  1ZG7 A;  1CPX A;  3SJE A;  4Z65 A;  3CDX A;  1ARL A;  4X3R A;  5K8N A;  1HEE A;  1EE3 P;  2ZEP A;  2BCO A;  2PJ1 A;  4W9Y A;  1Z2L A;  4OID A;  2ZEG A;  3WAB A;  3SI0 A;  6CPA A;  4OC1 A;  3SI1 A;  3K2K A;  5HVH A;  3KR5 A;  3D7D A;  1VGY A;  4PXE A;  2C6G A;  1CBX A;  3D7F A;  4NGQ A;  3FX6 A;  2AFS A;  2WYR A;  4OIW A;  2AFO A;  4ZX8 A;  4B6Z A;  4CPA A;  1XBU A;  2PJ6 A;  1NSA A;  4NGN A;  4MHP A;  1Y0R A;  3L2N A;  3HUV A;  3CT9 A;  4IAV A;  2ZEE A;  2ANP A;  4MXU A;  5LYI A;  4F9V A;  4ZY0 A;  3PFE A;  3FEE A;  2EWB A;  4NGS A;  3KZW A;  3IIB A;  2IMO A;  1BAV A;  3CPA A;  1XRY A;  1ELM P;  4P4D A;  3V38 A;  4RUH A;  1BLL E;  1BPN A;  4JYW A;  4A37 A;  4NGM A;  4OP4 A;  3NH8 A;  3V7Z A;  4GM5 A;  1XFO A;  5LYF A;  2C6C A;  2XEJ A;  5JH9 A;  1F2P A;  3KQX A;  3LMS A;  4OC0 A;  4ZI6 A;  5JGF A;  1DTD A;  3KHX A;  2XEI A;  1LAP A;  4DUK A;  4A94 A;  2ZEN A;  1RTQ A;  1XMB A;  1F2O A;  3TC8 A;  3B7I A;  2I3C A;  4ZYQ A;  4A38 A;  2PJA A;  3VH9 A;  4UEF A;  3IFE A;  5K8M A;  2PJ2 A;  2JEW A;  4IK2 A;  2AFX A;  1OBR A;  1TF8 A;  3H8F A;  3NFZ A;  7CPA A;  1Z8L A;  4FAI A;  1YLO A;  2V8H A;  4PXC A;  3IWW A;  5J1Q A;  2RB7 A;  2ZED A;  3PBB A;  2PRQ A;  3ISX A;  3PEI A;  3QNV A;  3S9L A;  1GYT A;  3S9M A;  2PJ3 A;  2ZEM A;  2Q51 A;  3D68 A;  4MMO A;  4PQA A;  5LYL A;  1LOK A;  2QJ8 A;  2ZOF A;  3KGQ A;  3GLJ A;  5THW A;  3B3C A;  2PJB A;  2C6P A;  3WT4 A;  1IY7 A;  2BOA A;  4MRI A;  4FBE A;  4KSI A;  2RFH A;  4EME A;  2QYV A;  3VAR A;  2ZEF A;  2OR4 A;  2Q4Z A;  4MCQ A;  3BI1 A;  3JRU A;  4MHZ A;  3FMC A;  2VL1 A;  3GB0 A;  3RAM A;  2O53 A;  4X8I A;  4R76 A;  2C1C A;  1CPS A;  5K8P A;  1TKH A;  3D67 A;  2PIZ A;  3SJG A;  4EWT A;  4UEZ A;  3PB8 X;  2PJC A;  2IQ6 A;  4UEE A;  2ZEH A;  3D7G A;  1Z5R A;  3PFO A;  4MHY A;  4P6Y A;  3KR4 A;  2CF4 A;  8CPA A;  4NJQ A;  4ZY2 A;  2EK9 A;  2NYQ A;  1QMU A;  4X2T A;  3PB9 X;  4DJL A;  2ZEL A;  5LRJ A;  3WC7 A;  3PBE A;  2PJ4 A;  2WZN A;  2PJ8 A;  3KHZ A;  1CG2 A;  4P4F A;  1ZLH A;  4G1P A;  4P4J A;  1CP6 A;  2V77 A;  2J9A A;  3KAS A;  3BXM A;  3H8G A;  2OOT A;  4TNU A;  1ARM A;  1FT7 A;  4ONW A;  4DYO A;  2F7V A;  5LYD A;  4P10 A;  2GLJ A;  1AMP A;  2PCU A;  4P45 A;  1YSJ A;  1TKJ A;  3NH4 A;  4OC2 A;  5D29 A;  4JZ0 A;  2HB6 A;  1VIX A;  5IB9 A;  2XEG A;  1R43 A;  1QQ9 A;  3H8E A;  3TX8 A;  2ZOG A;  3MN8 A;  4K3N A;  4NGR A;  5JM6 A;  1TF9 A;  2G9D A;  5HVF A;  5K8O A;  1DE4 C;  1JQG A;  4F8Z A;  2AFU A;  1R3N A;  3SJF A;  1VHE A;  2NSM A;  2POK A;  1F57 A;  1ZLI A;  3PB4 X;  5LRK A;  4O23 A;  1LAN A;  1ELL P;  2V8G A;  1CP7 A;  4WJB A;  3RZA A;  3NA6 A;  4NGP A;  2HC9 A;  3IO1 A;  5HXD A;  4P4B A;  5HVG A;  2PE3 A;  2CTC A;  1PYT B;  3PB6 X;  1AYE A;  1KWM A;  4H2K A;  3DLJ A;  4PPZ A;  1HDU A;  3FJU A;  1YME A;  2GRE A;  2AFZ A;  4OKO A;  1HDQ A;  2XEF A;  3RBU A;  2EK8 A;  1LFW A;  4MHN A;  4P4E A;  1M4L A;  5CBM A;  3B3T A;  4FUU A;  2PVV A;  3D4U A;  3IEH A;  4NJR A;  2PJ0 A;  4OC4 A;  4TWE A;  5CPA A;  2O4H A;  3IJ3 A;  3KI9 A;  4NGT A;  1PCA A;  2FVG A;  3BI0 A;  3NH5 A;  3SJX A;  4R8F A;  1TKF A;  1Q7L A;  3T8W A;  4LQG A;  4ZX9 A;  2PJ7 A;  3WC5 A;  2IJZ A;  3B2Y A;  3LWU A;  4P44 A;  5DS0 A;  3I1U A;  1IGB A;  3WC6 A;  3FH4 A;  4MCS A;  3MRU A;  4FWU A;  4R6T A;  3IC1 A;  2GLF A;  1YW4 A;  1Y7E A;  2JBJ A;  4P4I A;  1VHO A;  2BO9 A;  2QVP A;  2AFM A;  4A39 A;  2ZEO A;  5LRG A;  4EFD A;  3N5F A;  3D7H A;  3KQZ A;  4YU9 A;  1UWY A;  3BHX A;  1LCP A;  3S9N A;  2PVW A;  2V8V A;  1YW6 A;  2CTB A;  4MCR A;  4OC5 A;  5ELY A;  3ISZ A;  4NFR A;  1ZG8 A;  2CIJ A;  3PRT A;  2PJ9 A;  3FF3 A;  4BD9 A;  4MCP A;  2ABZ A;  2DEA A;  3FVL A;  5D8N A;  5I4M A;  4ZY1 A;  4AXV A;  2AFW A;  4OC3 A;  2PJ5 A;  3B3V A;  4UIB A;  1TXR A;  3VAT A;  2PIY A;  4R7M A;  4PXD A;  3B3S A;  2Q43 A;  3PB7 X;  1LAM A;  1Y0Y A;  4IHM A; 
#chains in the Genus database with same CATH topology
 3D66 A;  3FEC A;  3KL9 A;  4OME A;  3RO0 A;  4YWY A;  4UF4 A;  1XJO A;  4WWV A;  4PXB A;  5AG4 A;  3FED A;  4FD7 A;  3SI2 A;  2BEI A;  3GUX A;  4LX9 A;  4KOY A;  1B6B A;  1BPM A;  2Q0Y A;  1H8L A;  3DGV A;  2FCK A;  3HLP A;  3OWC A;  3R1K A;  4JD6 A;  4U9Z A;  3GY9 A;  1CX8 A;  3A9L A;  1ZG9 A;  4KUA A;  4YRH A;  5F09 A;  4F9U A;  1FNO A;  3K9T A;  2GU2 A;  3D8P A;  4JXQ A;  4Q7A A;  4UIA A;  2V8D A;  4KVX A;  2Z3N A;  2C27 A;  2F8H A;  3CPX A;  5AG5 A;  2JBK A;  4CGL A;  3B35 A;  4AVB A;  3B3W A;  1ZG7 A;  2WSA A;  1M4D A;  1CPX A;  1CM0 A;  3EO4 A;  4KS9 A;  1XE4 A;  3SJE A;  2FIW A;  4Z65 A;  3CDX A;  1ARL A;  4X3R A;  2EUI A;  4X5K A;  5K8N A;  1HEE A;  2ZW7 A;  1EE3 P;  2GE3 A;  2ZEP A;  4GS4 A;  4CYQ A;  2BCO A;  2PJ1 A;  4M6I A;  2Z11 A;  5G20 A;  2QML A;  4W9Y A;  1Z2L A;  1Q2D A;  4OID A;  2ZEG A;  4CYO A;  4U5Y A;  3WAB A;  3SI0 A;  1QSR A;  4FD6 A;  3EFA A;  6CPA A;  4OC1 A;  3SI1 A;  3K2K A;  4C2Z A;  5HVH A;  5A28 A;  5I0C A;  3KR5 A;  3D7D A;  1VGY A;  2PRB A;  4PXE A;  5EBV A;  5F49 A;  2J8R A;  4NSQ A;  4II9 A;  3FB3 A;  3CXS A;  2OB0 A;  3PZJ A;  2C6G A;  1CBX A;  3D7F A;  4NGQ A;  4AG7 A;  3FX6 A;  2AFS A;  2WYR A;  2VQY A;  1I1D A;  2DPS A;  4OIW A;  2AFO A;  4MI4 A;  4ZX8 A;  4B6Z A;  3H4Q A;  3K9U A;  4F0Y A;  4CPA A;  4E8O A;  2X7B A;  3DNS A;  2JDC A;  5F47 A;  2PJ6 A;  4ZGY B;  1NSA A;  4NGN A;  4MHP A;  1Y0R A;  3L2N A;  3HUV A;  3CT9 A;  4IAV A;  2ZEE A;  2ANP A;  4MXU A;  5LYI A;  1SQH A;  4CYP A;  4F9V A;  3PFE A;  2EO8 A;  3FEE A;  3PP9 A;  2EWB A;  1NMT A;  3EXN A;  4NGS A;  1YK3 A;  1IYK A;  3KZW A;  2DXQ A;  3IIB A;  5FVJ A;  1X10 A;  2GAN A;  2IMO A;  1BAV A;  1RO5 A;  3CPA A;  3F0A A;  1XRY A;  1LAM A;  3LOD A;  1Q2Y A;  1ELM P;  4P4D A;  3N7Z A;  1M4I A;  1BLL E;  1BPN A;  3V38 A;  1IB1 E;  4RUH A;  3RNZ A;  3SHP A;  2FT0 A;  2P6E A;  4JYW A;  3V8I A;  4NGM A;  4A37 A;  3MGD A;  4OP4 A;  3SXO A;  3IGR A;  5HMN A;  3GYA A;  3NH8 A;  4KOR A;  4PV6 A;  3V7Z A;  1KZF A;  2WUU A;  4GM5 A;  1XFO A;  4B5P B;  2B4B A;  3GIU A;  5LYF A;  2C6C A;  2XEJ A;  4CAX A;  4UWI A;  1J4J A;  4F0X A;  5JH9 A;  1F2P A;  3KQX A;  1B87 A;  3LMS A;  5AGE A;  4OC0 A;  1QSM A;  4H6Z A;  3R96 A;  4CRY B;  4ONU A;  4ZI6 A;  4C2Y A;  4BBH A;  5JGF A;  1DTD A;  3KHX A;  2XEI A;  2Q04 A;  5KTA A;  1LAP A;  4DUK A;  4A94 A;  4HPS A;  4C68 A;  4UWJ A;  3BJ8 A;  4KVO E;  2ZEN A;  1RTQ A;  1XMB A;  1F2O A;  3GKR A;  4HNY B;  3TC8 A;  4B10 A;  3FXT A;  3B7I A;  4HNX B;  4A31 A;  1AUG A;  2I3C A;  3IWE A;  4KOU A;  4ZYQ A;  4JJX A;  4A38 A;  2PJA A;  2K5T A;  3VH9 A;  3TOB A;  4UEF A;  1X12 A;  3IFE A;  5K8M A;  4CYN A;  2PJ2 A;  2JEW A;  4IK2 A;  1QSN A;  1KUV A;  2AFX A;  2HV2 A;  2G3T A;  3C26 A;  3NE7 A;  3S6H A;  4B13 A;  1OBR A;  2VXK A;  1TF8 A;  4YGO A;  4CGO A;  3H8F A;  4YFJ A;  3FIX A;  2JDD A;  3F5B A;  3NFZ A;  5DWM A;  7CPA A;  2VI7 A;  2Z0Z A;  4J3G A;  1Z8L A;  2J8M A;  3DR8 A;  1KUX A;  2P6F A;  4PSX A;  4RS2 A;  5HH1 A;  1YLO A;  2V8H A;  2PDO A;  4PK3 A;  4PXC A;  1NE9 A;  3IWW A;  4QB9 A;  4OAD A;  4Y49 C;  3TO9 A;  2RB7 A;  4B14 A;  2Z3L A;  2ZED A;  5F46 A;  5J1Q A;  3PBB A;  5BWA B;  4FAI A;  2PRQ A;  3I3G A;  3ISX A;  3PEI A;  3QNV A;  4QVT A;  3S9L A;  1GYT A;  1S7K A;  3S9M A;  5H84 A;  4AXV A;  2PJ3 A;  3FNC A;  2CXA A;  1QSO A;  2Q51 A;  2ZEM A;  1XEB A;  3D2P A;  3D68 A;  1ON0 A;  4MMO A;  4PQA A;  3IU1 A;  2VZZ A;  5LYL A;  3SXN A;  1LOK A;  1I12 A;  5AG7 A;  3G8W A;  2QJ8 A;  3E0K A;  2ZOF A;  3EY5 A;  3KGQ A;  4HNW B;  1I21 A;  3D3S A;  3GLJ A;  5THW A;  3B3C A;  2PJB A;  2C6P A;  2GFQ A;  3WT4 A;  4CAV A;  2G3A A;  1IY7 A;  2BOA A;  3LD2 A;  4MRI A;  4FBE A;  4KSI A;  2RFH A;  3TO6 A;  4EME A;  5IX3 A;  2QYV A;  4ZBG A;  3VAR A;  2NMT A;  2D4O A;  2ZEF A;  4B11 A;  2R7H A;  3DDD A;  4E2A A;  2I00 A;  2OR4 A;  5J8C A;  2Q4Z A;  4MCQ A;  3BI1 A;  4RN7 A;  1Z8X A;  3JRU A;  4MHZ A;  3FMC A;  1YX0 A;  2VL1 A;  3GB0 A;  4MFK A;  2O53 A;  4Y49 B;  3RAM A;  3QAY A;  3TOA A;  4X8I A;  2PQ8 A;  4H89 A;  4R76 A;  4PK2 A;  2C1C A;  1UFH A;  1BO4 A;  4KOS A;  4CGN A;  3VWD A;  1CPS A;  4MFJ A;  4A95 A;  5K8P A;  1TKH A;  1M1D A;  2Z3P A;  1YQE A;  3D67 A;  2PIZ A;  1VKC A;  3SJG A;  4EWT A;  2B3U A;  1ZO0 A;  2VBQ A;  2YGW A;  4UEZ A;  2P0W A;  2PJC A;  3T9Y A;  1XOV A;  2IQ6 A;  3UY5 A;  4UEE A;  2ZEH A;  3D7G A;  1Z5R A;  2FS5 A;  3PFO A;  2JEV A;  2ZW4 A;  3BLN A;  1VHS A;  3TT2 A;  4MHY A;  4QBJ A;  4P6Y A;  3KR4 A;  2CF4 A;  8CPA A;  4MY0 A;  4MBU A;  4NJQ A;  4ZY2 A;  4CGM A;  2EK9 A;  2NYQ A;  2PC1 A;  1QMU A;  4X2T A;  5AG6 A;  1P0H A;  1BOB A;  3NE8 A;  1K4J A;  2BL1 A;  3PB9 X;  5GCN A;  4B12 A;  2OZG A;  4DJL A;  4EVY A;  2ZEL A;  5LRJ A;  3WC7 A;  3TCV A;  2YNC C;  3PBE A;  5F48 A;  2PJ4 A;  2ZPA A;  5DWN A;  2WZN A;  2PJ8 A;  2QEC A;  2Z3M A;  2CNS A;  2YND A;  3WR7 A;  3KHZ A;  1CG2 A;  4P4F A;  1U6M A;  2WPX A;  4IUS A;  1ZLH A;  4G1P A;  1FY7 A;  5EC4 A;  1KUY A;  1CP6 A;  1JWQ A;  2BUE A;  4P4J A;  5EMI A;  1Z8T A;  2QIR A;  2V77 A;  4M85 A;  4F6A A;  2J9A A;  3KAS A;  1PU9 A;  2RC4 A;  4L8A A;  3BXM A;  4AG9 A;  3H8G A;  2OOT A;  4E0A A;  4M6G A;  4BIN A;  3KKW A;  4LUA A;  4JXR A;  3VWE A;  2DPT A;  4B5P A;  4C2X A;  2O28 A;  2FSR A;  4TNU A;  3FYN A;  1ARM A;  4CGP A;  1FT7 A;  3W6X A;  2B4D B;  1S7N A;  3FBU A;  4ONW A;  4DYO A;  2GIV A;  4K30 A;  4A30 A;  2F7V A;  2R1I A;  5LYD A;  1IOF A;  4MFL A;  4JWP A;  4P10 A;  2GLJ A;  1AMP A;  4KOW A;  4UFV A;  2A4N A;  2PCU A;  4P45 A;  5C82 A;  5J8F A;  2Q7B A;  4A32 A;  2Z3K A;  3TO7 A;  4KOX A;  3R95 A;  2OZU A;  1QST A;  4MFZ A;  1YSJ A;  1TKJ A;  3NH4 A;  4NXY A;  3W91 A;  4OC2 A;  5D29 A;  3QAH A;  3DR6 A;  2HB6 A;  4JZ0 A;  1VIX A;  4UA3 A;  1XF8 A;  1YVK A;  2VEZ A;  3S6F A;  2EBJ A;  2B5G B;  5IB9 A;  1S7L A;  4XPL A;  2XEG A;  4R9M A;  4KOV A;  5KTD A;  1R43 A;  1QQ9 A;  2AJ6 A;  1IYL A;  2KCW A;  4C7H A;  1YLE A;  2DF5 A;  1Z8W A;  4NEX A;  2FXF A;  2I79 A;  3H8E A;  4XNH C;  3TX8 A;  2ZOG A;  3MN8 A;  4K3N A;  4NGR A;  5JM6 A;  1TF9 A;  2P6G A;  2G9D A;  5HVF A;  5G1Z A;  5K8O A;  5IV0 A;  2OU2 A;  4KSF A;  3ZZI A;  1DE4 C;  1JQG A;  2Z10 A;  4GXH A;  1IID A;  2PSW A;  1Q2C A;  2F5I A;  3IU2 A;  2AFU A;  1V0C A;  1R3N A;  4F8Z A;  3SJF A;  4UFW A;  1VHE A;  1IU8 A;  1LRZ A;  1ZLI A;  1F57 A;  1RXT A;  2NSM A;  2POK A;  2REF A;  3W6S A;  3PB4 X;  2IL4 A;  4ORF A;  5LRK A;  4KOT A;  4O23 A;  1LAN A;  1ELL P;  4Q36 A;  2V8G A;  2CNM A;  4U9Y A;  1CP7 A;  4MJ8 A;  4R57 A;  4WJB A;  3RZA A;  3S6G A;  1MK4 A;  3NA6 A;  4CAF A;  5JPH A;  3LAC A;  3TE4 A;  2YNE A;  4NGP A;  2ZXV A;  3P2H A;  2HC9 A;  3IO1 A;  1N71 A;  3CXQ A;  1Y9W A;  5HXD A;  4XPD C;  4P4B A;  1S3Z A;  4I49 A;  4JLY A;  5CNP A;  5HVG A;  3FRM A;  1YGH A;  2PE3 A;  2B3V A;  2OZH A;  1YR0 A;  3JTK A;  4KLW A;  2CTC A;  1PYT B;  3CZX A;  4OLL A;  4AVC A;  4XNH B;  3PB6 X;  1AYE A;  1MJ9 A;  4AVA A;  1KWM A;  1Z9U A;  4M3S A;  2Q4V A;  4H2K A;  3DLJ A;  4PPZ A;  4UCN A;  1HDU A;  3FJU A;  1S7F A;  1YME A;  1Z4E A;  3R9E A;  2GRE A;  2AFZ A;  3G3S A;  4OKO A;  4XPK A;  4MHD A;  2ATR A;  1WK4 A;  1HDQ A;  2XEF A;  3IWG A;  4R87 A;  3RBU A;  2EK8 A;  2HUZ A;  3R9F A;  1LFW A;  4MHN A;  4P4E A;  2J8N A;  1MJA A;  4R3L A;  1S60 A;  5G21 A;  1M4L A;  5KTC A;  3JUW A;  5CBM A;  1Y7R A;  5IB0 A;  3B3T A;  3TTH A;  4FUU A;  3B8G A;  3PB7 X;  2PVV A;  1M44 A;  1S5K A;  1Y9K A;  3D4U A;  3IEH A;  4MFQ A;  1M4G A;  4NJR A;  2PJ0 A;  4OC4 A;  4TWE A;  3EC4 A;  4XPD B;  4QC6 A;  5CPA A;  2O4H A;  3QB8 A;  2Q44 A;  3IJ3 A;  3KI9 A;  4NGT A;  4OAE A;  4BMH A;  4FD4 A;  1CJW A;  4B5O A;  1PCA A;  4PSW A;  4R3K A;  1MJB A;  4UFX A;  2FVG A;  2R98 A;  2OH1 A;  3BI0 A;  3NH5 A;  2Q7S A;  3S6K A;  4CAE A;  3F8K A;  3SJX A;  4R8F A;  1TKF A;  1Q7L A;  3T8W A;  3BJ7 A;  4LQG A;  4ZX9 A;  2PJ7 A;  3WC5 A;  2H5M A;  2FIA A;  2IJZ A;  5G22 A;  3B2Y A;  3LWU A;  4P44 A;  4RI1 A;  4UCP A;  5DS0 A;  1GHE A;  3JVN A;  4ZY0 A;  3H5Z A;  2D4P A;  3I1U A;  1IGB A;  3WC6 A;  3FH4 A;  4MCS A;  4H6U A;  4M6H A;  3R9G A;  3MRU A;  4FWU A;  4HKF A;  4NF1 A;  4R6T A;  1P4N A;  3IC1 A;  2GLF A;  2FE7 A;  4CAW A;  5ISV A;  4MY3 A;  1YW4 A;  1XMT A;  1Y7E A;  2JBJ A;  4P4I A;  3T90 A;  5JQ4 A;  1VHO A;  4CS0 B;  2BO9 A;  2EVN A;  2QVP A;  2AFM A;  2B58 A;  4MFP A;  4FD5 A;  4A39 A;  4QUS A;  2ZEO A;  5LRG A;  4EFD A;  1WWZ A;  1A2Z A;  4IHM A;  4KZT A;  3N5F A;  3D7H A;  3KQZ A;  2FL4 A;  4YU9 A;  2Q4Y A;  2B4D A;  2Z3O A;  1UWY A;  2AE6 A;  3BHX A;  4A2Z A;  1LCP A;  1IOI A;  3S9N A;  2PVW A;  2V8V A;  2CNT A;  3DSB A;  4CRZ B;  1L0C A;  1R57 A;  1YW6 A;  2CTB A;  3ZJ0 A;  4MCR A;  1IIC A;  5H86 A;  2ZW5 A;  4L89 A;  2JLM A;  4KUB A;  2YNC A;  2WPW A;  1Z4R A;  4OC5 A;  5ELY A;  3ISZ A;  1YVO A;  3I9S A;  3P2F A;  4NFR A;  4UBR A;  1YRE A;  1ZG8 A;  4AB7 A;  2CIJ A;  2PR1 A;  2VZY A;  2PJ9 A;  3FF3 A;  3PRT A;  4KLV A;  3PGP A;  4NCZ A;  4MCP A;  1NSL A;  4BD9 A;  2ODF A;  2ABZ A;  2HQY A;  5C88 A;  2DEA A;  4C7I A;  3FVL A;  5D8N A;  5I4M A;  4KVM E;  5E96 A;  1OZP A;  2PR8 A;  4ZY1 A;  2R8V A;  3D2M A;  4Q38 A;  2AFW A;  2ARH A;  2B5G A;  4KSA A;  4OC3 A;  4UCM A;  2PJ5 A;  3B3V A;  4A33 A;  3CXP A;  4LQ6 A;  4UIB A;  1TXR A;  1PUA A;  2G0B A;  2ZW6 A;  2PIY A;  2BSW A;  4R7M A;  3VAT A;  3RYO A;  4PXD A;  5A27 A;  2CY2 A;  3B3S A;  2REE A;  1XIX A;  4IF5 A;  4DNC A;  3TFY A;  2Y0M A;  2Q43 A;  1TIQ A;  1XBU A;  1Y0Y A;  3PB8 X; 
#chains in the Genus database with same CATH homology
 3D66 A;  3FEC A;  3KL9 A;  4OME A;  4YWY A;  4UF4 A;  1XJO A;  4WWV A;  4PXB A;  3FED A;  3SI2 A;  3GUX A;  1BPM A;  1H8L A;  3DGV A;  3HLP A;  1CX8 A;  1ZG9 A;  5F09 A;  4F9U A;  1FNO A;  3K9T A;  2GU2 A;  4Q7A A;  4UIA A;  2V8D A;  2F8H A;  3CPX A;  2JBK A;  3B35 A;  3B3W A;  1ZG7 A;  1CPX A;  3SJE A;  4Z65 A;  3CDX A;  1ARL A;  4X3R A;  5K8N A;  1HEE A;  1EE3 P;  2ZEP A;  2BCO A;  2PJ1 A;  4W9Y A;  1Z2L A;  4OID A;  2ZEG A;  3WAB A;  3SI0 A;  6CPA A;  4OC1 A;  3SI1 A;  3K2K A;  5HVH A;  3KR5 A;  3D7D A;  1VGY A;  4PXE A;  2C6G A;  1CBX A;  3D7F A;  4NGQ A;  3FX6 A;  2AFS A;  2WYR A;  4OIW A;  2AFO A;  4ZX8 A;  4B6Z A;  4CPA A;  1XBU A;  2PJ6 A;  1NSA A;  4NGN A;  4MHP A;  1Y0R A;  3L2N A;  3HUV A;  3CT9 A;  4IAV A;  2ZEE A;  2ANP A;  4MXU A;  5LYI A;  4F9V A;  4ZY0 A;  3PFE A;  3FEE A;  2EWB A;  4NGS A;  3KZW A;  3IIB A;  2IMO A;  1BAV A;  3CPA A;  1XRY A;  1ELM P;  4P4D A;  3V38 A;  4RUH A;  1BLL E;  1BPN A;  4JYW A;  4A37 A;  4NGM A;  4OP4 A;  3NH8 A;  3V7Z A;  4GM5 A;  1XFO A;  5LYF A;  2C6C A;  2XEJ A;  5JH9 A;  1F2P A;  3KQX A;  3LMS A;  4OC0 A;  4ZI6 A;  5JGF A;  1DTD A;  3KHX A;  2XEI A;  1LAP A;  4DUK A;  4A94 A;  2ZEN A;  1RTQ A;  1XMB A;  1F2O A;  3TC8 A;  3B7I A;  2I3C A;  4ZYQ A;  4A38 A;  2PJA A;  3VH9 A;  4UEF A;  3IFE A;  5K8M A;  2PJ2 A;  2JEW A;  4IK2 A;  2AFX A;  1OBR A;  1TF8 A;  3H8F A;  3NFZ A;  7CPA A;  1Z8L A;  4FAI A;  1YLO A;  2V8H A;  4PXC A;  3IWW A;  5J1Q A;  2RB7 A;  2ZED A;  3PBB A;  2PRQ A;  3ISX A;  3PEI A;  3QNV A;  3S9L A;  1GYT A;  3S9M A;  2PJ3 A;  2ZEM A;  2Q51 A;  3D68 A;  4MMO A;  4PQA A;  5LYL A;  1LOK A;  2QJ8 A;  2ZOF A;  3KGQ A;  3GLJ A;  5THW A;  3B3C A;  2PJB A;  2C6P A;  3WT4 A;  1IY7 A;  2BOA A;  4MRI A;  4FBE A;  4KSI A;  2RFH A;  4EME A;  2QYV A;  3VAR A;  2ZEF A;  2OR4 A;  2Q4Z A;  4MCQ A;  3BI1 A;  3JRU A;  4MHZ A;  3FMC A;  2VL1 A;  3GB0 A;  3RAM A;  2O53 A;  4X8I A;  4R76 A;  2C1C A;  1CPS A;  5K8P A;  1TKH A;  3D67 A;  2PIZ A;  3SJG A;  4EWT A;  4UEZ A;  3PB8 X;  2PJC A;  2IQ6 A;  4UEE A;  2ZEH A;  3D7G A;  1Z5R A;  3PFO A;  4MHY A;  4P6Y A;  3KR4 A;  2CF4 A;  8CPA A;  4NJQ A;  4ZY2 A;  2EK9 A;  2NYQ A;  1QMU A;  4X2T A;  3PB9 X;  4DJL A;  2ZEL A;  5LRJ A;  3WC7 A;  3PBE A;  2PJ4 A;  2WZN A;  2PJ8 A;  3KHZ A;  1CG2 A;  4P4F A;  1ZLH A;  4G1P A;  4P4J A;  1CP6 A;  2V77 A;  2J9A A;  3KAS A;  3BXM A;  3H8G A;  2OOT A;  4TNU A;  1ARM A;  1FT7 A;  4ONW A;  4DYO A;  2F7V A;  5LYD A;  4P10 A;  2GLJ A;  1AMP A;  2PCU A;  4P45 A;  1YSJ A;  1TKJ A;  3NH4 A;  4OC2 A;  5D29 A;  4JZ0 A;  2HB6 A;  1VIX A;  5IB9 A;  2XEG A;  1R43 A;  1QQ9 A;  3H8E A;  3TX8 A;  2ZOG A;  3MN8 A;  4K3N A;  4NGR A;  5JM6 A;  1TF9 A;  2G9D A;  5HVF A;  5K8O A;  1DE4 C;  1JQG A;  4F8Z A;  2AFU A;  1R3N A;  3SJF A;  1VHE A;  2NSM A;  2POK A;  1F57 A;  1ZLI A;  3PB4 X;  5LRK A;  4O23 A;  1LAN A;  1ELL P;  2V8G A;  1CP7 A;  4WJB A;  3RZA A;  3NA6 A;  4NGP A;  2HC9 A;  3IO1 A;  5HXD A;  4P4B A;  5HVG A;  2PE3 A;  2CTC A;  1PYT B;  3PB6 X;  1AYE A;  1KWM A;  4H2K A;  3DLJ A;  4PPZ A;  1HDU A;  3FJU A;  1YME A;  2GRE A;  2AFZ A;  4OKO A;  1HDQ A;  2XEF A;  3RBU A;  2EK8 A;  1LFW A;  4MHN A;  4P4E A;  1M4L A;  5CBM A;  3B3T A;  4FUU A;  2PVV A;  3D4U A;  3IEH A;  4NJR A;  2PJ0 A;  4OC4 A;  4TWE A;  5CPA A;  2O4H A;  3IJ3 A;  3KI9 A;  4NGT A;  1PCA A;  2FVG A;  3BI0 A;  3NH5 A;  3SJX A;  4R8F A;  1TKF A;  1Q7L A;  3T8W A;  4LQG A;  4ZX9 A;  2PJ7 A;  3WC5 A;  2IJZ A;  3B2Y A;  3LWU A;  4P44 A;  5DS0 A;  3I1U A;  1IGB A;  3WC6 A;  3FH4 A;  4MCS A;  3MRU A;  4FWU A;  4R6T A;  3IC1 A;  2GLF A;  1YW4 A;  1Y7E A;  2JBJ A;  4P4I A;  1VHO A;  2BO9 A;  2QVP A;  2AFM A;  4A39 A;  2ZEO A;  5LRG A;  4EFD A;  3N5F A;  3D7H A;  3KQZ A;  4YU9 A;  1UWY A;  3BHX A;  1LCP A;  3S9N A;  2PVW A;  2V8V A;  1YW6 A;  2CTB A;  4MCR A;  4OC5 A;  5ELY A;  3ISZ A;  4NFR A;  1ZG8 A;  2CIJ A;  3PRT A;  2PJ9 A;  3FF3 A;  4BD9 A;  4MCP A;  2ABZ A;  2DEA A;  3FVL A;  5D8N A;  5I4M A;  4ZY1 A;  4AXV A;  2AFW A;  4OC3 A;  2PJ5 A;  3B3V A;  4UIB A;  1TXR A;  3VAT A;  2PIY A;  4R7M A;  4PXD A;  3B3S A;  2Q43 A;  3PB7 X;  1LAM A;  1Y0Y A;  4IHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...