4UFOA

Laboratory evolved variant r-c1b1d33e6 of potato epoxide hydrolase steh1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
321
structure length
321
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIALNEEKVFVVAHDLGAYIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNKVEGLKAIYGEDHYVSRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPLYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDGVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EPOXIDE HYDROLASE
publication title Laboratory Evolved Enzymes Provide Snapshots of the Development of Enantioconvergence in Enzyme-Catalyzed Epoxide Hydrolysis.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase
total genus 118
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ufoA00
1MAHA 4H7FA 3PFBA 1LBSA 4CG3A 2PPLA 1CUGA 5EHZA 1MNQA 1O6GA 7YASA 3FLEA 2GYWA 5ALZA 1BEEA 4BDTA 2JIDA 5JZBA 5AIAA 1FFAA 3H0CA 3N0TA 3OURA 3S8YA 2EDAA 2WIGA 3IUNA 3RK4A 2QJWA 1F6WA 3W04A 4UBLA 1EA5A 1YS1X 3DJYA 4QDOA 2G63A 1MPXA 1X2BA 4L9AA 3IA2A 2WU3A 1SCIA 2ORYA 4TVKA 2AJCA 1EVEA 1XROA 3QYJA 1LPNA 1R9NA 5T4FA 4MEBA 4QWMA 4WDRA 1J1IA 4MQLA 2Z5GA 2WUEA 2PU7A 4DLNA 3MUNA 3UMJA 2PSFA 2DHCA 2WG2A 3LIPA 1DTEA 1PV1A 4G4GA 3E1GA 2C5GA 2IITA 3F96A 4AZ3A 2PU5A 3T52A 1UT6A 4BVLA 2OGZA 4OU4A 2WFLA 5ALSA 3C8HA 2HDWA 4TGLA 5JASA 4G8BA 3WWPA 4KE7A 5FOQA 5JAUA 4F60A 3ICVA 1HL7A 1R88A 3DLTA 3HC7A 2HL6A 1TK3A 3EQ7A 4CIBA 4CG1A 3D4LA 1ZI8A 4KE8A 4A5SA 3I6ZA 2ECFA 1DINA 1SCKA 4LYEA 2VJBA 2Z3WA 3B5EA 4FWBA 3S2ZA 2WTNA 4H7EA 4H77A 2CMFA 1ZIXA 4XJVA 5JANA 4FNMA 5K5EA 4EA6A 5A7GA 1AC5A 1HQDA 5ALEA 4DSZA 2QT9A 4PO3X 4H7HA 4RE6A 2XLBA 2JGMA 3W05A 3ZLVA 3HJUA 3G0IA 5CW2A 5IVDA 1JU4A 5JALA 5AI6A 1BROA 4MEAA 4J3JA 1E8MA 3WK8A 4HXGA 1E3QA 1YA4A 1XRMA 1DU4A 2HA7A 3H1AA 2HU5A 4I3FA 4FLMA 4DIUA 2I03A 3UUEA 1XZFA 1AGYA 4EBBA 1BN6A 3DYVA 3I2FA 3WJ2A 1EDBA 1BEZA 1XZEA 4HXFB 1C7IA 3WKCA 1X70A 1YASA 5ALJA 5BV7A 4H7JA 5FRDA 2OAEA 4X7BA 3BL8A 5AK5A 1JMKC 1J06A 3KOOA 2QR5A 5K3BA 1EDEA 1JFRA 2QXUA 1QLWA 1GXSA 1GPNA 2XMDA 4BAUA 1GPKA 1EB9A 3FCYA 2OG1A 4UHBA 4AO8A 2LIPA 5HF9A 1H2XA 3FWHA 3DD5A 4WY8A 5IKXA 2XUAA 3IDAA 1JU3A 2BCEA 3LIIA 5AKKA 1ODTC 4DYHA 3O4JA 4Q1VA 5DYYA 4CCWA 4ZWNA 1P0QA 3VJKA 5J3JA 1Y37A 3PF8A 4IH9A 2G5PA 2QOEA 1F0PA 5FXMA 3C6BA 4QDUA 3ZWQA 2ZSHA 3WKBA 2HU7A 3N2ZB 4N8DA 1K6EA 4L0CA 2HFJA 4UHCA 4XWGA 1E5TA 2O2HA 4A16A 1ODSA 3HSSA 1M33A 4DGQA 1ODCA 2YASA 1CUWA 4G8DA 4BRSA 1UKAA 2WLSA 3KWJA 1QJ4A 3QM1A 4LHEA 4PSDA 1U2EA 3WMRA 1HPLA 2X5XA 5BOVA 2V96A 4BP8A 3CN9A 4NMWA 4FKBA 4U2FA 4OB6A 2XUHA 2VJAA 1LLFA 3DS8A 4B80A 1VE6A 3CCBA 4GECA 3I2JA 4B83A 1USWA 3WIOA 5ALKA 3D7RA 1CLEA 4N8EA 4BBZA 2XMGA 4K6KA 5ALOA 4C6HA 4QDTA 4UHHA 4UFNA 1CUXA 2PUHA 2DR0A 5ISMA 4X92A 2WIFA 1EHYA 2HA0A 4UBMA 4XVCA 2B20A 4Q3KA 5JD5A 5KWIA 1QIMA 4Q3OA 3STXA 2WJ6A 1YCDA 4B81A 1MX5A 2NW6A 4EY6A 2H9YA 5AKHA 5LKRA 2DSNA 5FDFA 1EK2A 4E15A 5JIBA 2CUTA 5AK6A 5ALFA 5CH3A 2DQZA 1F8UA 2Y2UA 1E8DA 2XQJA 5JARA 5A7HA 3K9BA 5ALGA 4RGYA 1UKCA 5C8ZA 5CXXA 1ETHA 3BE8A 4ZXFA 3R0VA 5FUMA 1THGA 3HI4A 2I3ZA 2HA4A 3BWXA 3WK5A 2XUGA 3FNBA 1CRLA 4J0DA 4CCYA 3GFFA 4B0PA 1GKKA 3OTQA 4EB0A 5CH8A 1TCBA 4B0OA 4OCZA 3G9UA 1F0NA 3UUFA 2XQKA 5JADA 4EY7A 3QBJA 3O9VA 5AM2A 1DT3A 3Q8WA 1YSCA 2VT7A 5AKYA 2XMQA 4C88A 5AM4A 2QTBA 4KEAA 3GA7A 1DT5A 1XQYA 2PSDA 3H18A 3ICWA 3WWOA 3SWWA 3IUJA 2XUFA 5EIEA 3GELA 4JH0A 4QDZA 4CG2A 4KE9A 1ZD2P 2ZYIA 3M81A 3WL7A 4F5ZA 2GYVA 4G4JA 1NX9A 1EB8A 2HA5A 2OCKA 3NOXA 2C0PA 1Q84A 4KAFA 1U8EA 1WHTA 4CIAA 3BXPA 4KE6A 4X3CA 5DNVA 3F9CA 5AM1A 4MWSA 3H04A 1QO7A 3OC0A 4DTCA 1HKHA 4X6XA 4AO7A 2PX6A 1WB4A 4DMFA 5IVHA 2OGSA 4AN1A 3ESDA 1BE0A 5LZ2A 3STVA 2BFNA 2HRQA 1XZMA 4FFWA 1VLQA 1VA5A 5HZGA 4AMYA 1EINA 4QE3A 2VF2A 1MT3A 4X85A 2XUJA 5HFNA 3FVRA 3VKFA 4ITVA 5E4YA 2Y1KA 1ZJ4A 4H35A 4OD0A 4BAGA 2WHQA 4RNCA 1B41A 4YPVA 4DMHA 4RPCA 4RE5A 3EBLA 4L72A 1CIJA 1ORWA 4EUSA 2DQYA 4DMKA 4JEIA 4AQDA 5HK8A 1EX9A 2ZJFA 2WILA 3BDVA 1ZI9A 2RI6A 5I9IA 1UWCA 4GLBA 3OG9A 3PDCA 4M0EA 2ES4A 3PF9A 2W22A 5AI4A 4KAJA 1FFEA 3G02A 1DWPA 3WYNA 4BATA 2ZYSA 4MXDA 3ANSA 4BZWA 5AIBA 3VVMA 5JD6A 4ARBA 5IVKA 1QTIA 2D5LA 5T4EA 5CRIA 4GW3A 5AKGA 2JGLA 2V9ZA 5JAHA 4ARAA 1HBJA 2AXEA 5LP1A 4BCCA 2ACKA 3STUA 5AH0A 4QLAA 2J4FA 3WI7A 4M0MA 1ZI6A 1YB7A 4M0FA 4FLEA 2GBIA 5EIAA 3FVTA 3IUMA 1CUYA 4UPDA 1N5MA 1BS9A 1W52X 3L1HA 5AI8A 4PW0A 4N5IX 4S0XA 1Y7IA 2HA6A 3VISA 5D6OA 5I7UA 2ONCA 2WUGA 5AM5A 3GZJA 3W2TA 3CXUA 1ZIYA 5YASA 5A71A 1UKBA 3H17A 4KAAA 1CUZA 3A2MA 3C8DA 1UFOA 2ACEA 5ALNA 4WJLA 5AM3A 4UBNA 4GBGA 4YK7A 5DYTA 2OCLA 2W6CX 1IUOA 1A88A 2VTVA 2ZVDA 5F4ZA 2H1IA 3OPMA 4YASA 3R3UA 2HU8A 1PJAA 3DNMA 4K5QA 1XZJA 5ALVA 1W4LA 2WIJA 2B4KA 5AKZA 1XLVA 5AKIA 2OGTA 2R8BA 2CKMA 1AKNA 1XRRA 3D59A 4Y2YA 4P9NA 1ZD4A 5K3CA 5DYWA 1DWOA 4AXBA 3SC2A 3WKAA 3FCXA 1E8NA 1QIEA 3ESAA 2XUDA 2J3QA 4GXNA 4IH4A 1TQHA 2CZQA 4HS9A 2Y2VA 5EI5A 3O4GA 3C5WP 4QNNA 4DMCA 1R3DA 3AZOA 4FBMA 1CUJA 2WKWA 3ZLTA 3E3AA 4B82A 4JYMA 4MYDA 4ROTA 2Y6UA 4BC1A 2OLEA 4OUKX 3JYHA 1XZIA 3WK4A 3WQHA 3DOIA 3DDUA 2XLCA 3V1KA 4C4XA 4Y7DA 1GKLA 2QZPA 1MN6A 4LYDA 2WSLA 5D3KA 5ALMA 5CBKA 3PFCA 5JZ9A 1MTZA 4FFVA 3H2IA 1DX4A 3H2GA 4LXGA 5E4TA 1JJBA 2XQGA 5CTAA 2P8SA 3VDXA 3FSGD 1A7UA 3LS2A 3WL5A 1HLGA 5ALLA 2JF0A 3C5VA 3ESBA 4X97A 5DLPA 4J0KA 4NVRA 1XZCA 1GGVA 1DWQA 1XLWA 5T4HA 3DEAA 2WM2A 1IZ8A 2PVSA 4Y2XA 2BKLA 3R3VA 3D2CA 4Y9SA 1NU6A 1VXRA 4QLOA 5A62A 4BE4A 3G9TA 3MUOA 5LZ8A 1CUDA 2CJPA 2WU4A 1XZDA 1MO2A 2ROQA 2GYUA 1Q0RA 4A23A 4F21A 4QWWA 3Q0TA 6YASA 5SYMA 1CUFA 4FDMA 4BC0A 4X95A 2FX5A 2WG1A 1CPYA 2HADA 2OCGA 2C4HA 3EF3A 4UHFA 4W1PA 1EI9A 4ZGBA 4AO6A 4OB7A 1CR6A 1THTA 1CUIA 3PI6A 1H23A 2PM8A 3AIOA 3ZLUA 3K6KA 4QEKA 2PSJA 4AMZA 4GHWA 1IZ7A 5DNUA 3WIBA 3R41A 1LNSA 5AKXA 1CQZA 3BF7A 4WFJA 1RYYA 3C87A 1XZKA 1JJFA 4J0GA 5CT8A 1C7JA 5E2IA 3MVEA 4HVTA 1MNAA 2OXEA 3V9AA 2DCMA 4UFPA 2WJ4A 4BE9A 2OAGA 4PQEA 2HM7A 5LLSA 3O4IA 2VAXA 1LZLA 1UXOA 2RHWA 4H7DA 3M3DA 1AQLA 2RONA 3IIIA 5CT9A 4BVJA 1J2EA 2JEZA 3G0CA 1W75A 2XQIA 3FYUB 4LIPD 2JGEA 4C89A 2H7XA 1LPBB 3WZLA 2O2IA 2HA3A 4JUIA 4E14A 2O7RA 3R3ZA 3JWEA 3E0XA 5AOAA 1CUBA 2WTMA 3HLKA 2XMBA 2WIDA 5HKBA 3QZUA 4B85A 1RP1A 4E46A 4L3WA 1EXWA 4PNZA 2RHTA 3FYTA 4OU5A 4HXEB 1SC9A 2VSQA 3L1IA 5DTJA 1LPOA 1BN7A 1LPAB 3DQZA 1A8UA 1RWQA 3FYUC 5CT5A 4F0JA 1LPPA 2EDCA 1XLUA 2WJ3A 4N5HX 5ESRA 2OCIA 3W9BA 2VJDA 5AJHA 3R3YA 5EHNA 4J0HA 3WL6A 3WZMA 1MAAA 3G7NA 5C8XA 4FTWA 3VVLA 2WG0A 4W9RA 1Q0ZA 1H2YA 5EHXA 2Y6VA 4C01A 1JKMA 3K2IA 1CUVA 1AMNA 3AZPA 1BCSA 1TCCA 4WCVA 4Z49A 1YB6A 3WKDA 3B3QA 4DNPA 1H22A 4QA9A 1CFJA 4U2BA 4BRZA 4DNFA 2Z8XA 1QGED 1GZ7A 4W63A 4XX1A 4B6GA 4H0CA 5ALYA 4X91A 1G5FA 4EHBA 1TAHA 5HF6A 5LZ5A 3OOSA 3W06A 2DHDA 3ILSA 1MX9A 4B7ZA 4HRYA 1UK7A 3RKSA 4PV7A 4FNGA 3G8YA 2WQZA 3F67A 2XI4A 3DOHA 4KRXA 4G1FA 4UBOA 3TEJA 4OB8A 5CURA 4H7IA 3C70A 1ACJA 5HK9A 4MWTA 3OM8A 3ED1A 1W76A 5K3AA 5AK3A 4NZZA 3ZI7A 2IIVA 5AOBA 5ALUA 3IUQA 2PSHA 4Y2VA 5ALDA 1IVYA 1OILA 3R40A 4LKOA 1LBTA 2FJ0A 2OQIA 4ZI5A 1P0PA 1Z68A 4FLFA 2AJLI 4G5XA 4Q82A 1N8SA 3KD2A 1XQWA 4X71A 5C81A 1A8SA 4J7AA 4IQ4A 1VXOA 1LZKA 4Q34A 4U2DA 2V97A 2VA9A 1L7RA 1QO9A 1XZLA 3BIWA 5AM0A 2XMRA 2HRRA 3B12A 4CI9A 5E4JA 3O0DA 5K3DA 2HA2A 4Y2TA 2CB9A 4J03A 1YS2X 1MU0A 4EZIA 1WHSA 3GUUA 1YAJA 4G9EA 1CV2A 3QMVA 1TIBA 4OYLA 1U65A 1FFCA 4OPMA 4ZREA 3DYIA 3I2IA 2XMZA 4HRXA 3EQ9A 5LZ4A 2QS9A 4UBJA 1XKTA 4U2GA 2GBCA 2WHPB 5A7FA 4CFSA 4V2IA 3G9ZA 1XZBA 5LZ9A 1T2NA 3LCRA 4PSUA 2BAGA 3AINA 1LGYA 1U4NA 3WK6A 3QPCA 4H18A 3JW8A 4W1RA 2BGNA 1WM1A 3U1TA 2O2GA 3WL8A 4FHZA 1OCEA 2XB6A 3PUIA 5ALIA 1QFMA 4WDQA 3WWEA 5I8PA 2XUPA 2H7YA 5D3ZA 1WOMA 3C6ZA 3IB3A 5AP9A 4KRYA 2QKYA 4MJ3A 1CUHA 4GWLA 4X90A 4D9JA 2VAVA 4K6GA 3IBTA 4Q05A 1CUUA 4QZVA 3A2LA 4BP9A 2RAUA 2XUQA 3I28A 3DL4A 2OQVA 4HTAA 3DCNA 1UOQA 1XKLA 1N5RA 4HAIA 2HFKA 1KU0A 3SX4A 1QIGA 3QH4A 5C8VA 3QMMA 5HF5A 3WK9A 1QE3A 2UZ0A 1AUOA 4OYYA 4TPKA 1G4HA 5HKAA 1UZAA 2WFLB 1GQRA 3CCCA 2C0QA 3BJRA 2E3JA 2EEPA 5HF8A 2G5TA 1OXMA 1TKRA 5LYYA 3M82A 4LXHA 2WFZA 4BAZA 3ANTA 2WHPA 2O7VA 3A70A 1VA4A 3HACA 3L1JA 1UOOA 3D5EA 5DJ5A 3EQ8A 1ZICA 3AUKA 1QIDA 4MQMA 1XFDA 1K5PA 1MX1A 2QUBA 2CBGA 2I3DA 3WK7A 1XZGA 5AI5A 2X76A 2BUCA 5AI9A 4JNCA 5FV4A 4QDXA 5AKEA 3AIKA 1XRQA 1PFQA 4X93A 1ZD3A 1SCQA 4BVKA 1XRLA 3NGMA 4EY5A 1UK8A 1LPMA 3I2KA 2B9VA 3I2GA 2IX9A 3IURA 3D3NA 3I1IA 2QXTA 3V1NA 2C58A 5ALXA 4BYMA 4BCDA 5KREA 1VOTA 4FMPA 3PICA 3WLAA 3STYA 1ZOIA 4X94A 3O4HA 4GEGA 1QIIA 2JEYA 4I19A 4IH1A 3KSRA 5KWJA 3AIMA 1X2EA 2XMCA 2PKYX 1DQZA 1VJ5A 3F8SA 2DFPA 4Y2JA 3TRDA 3STWA 2OPHA 1XRPA 1QFSA 3I2HA 3H1BA 5ALTA 1UOPA 3HEAA 1L7AA 1R9MA 1WCYA 5D7BA 1H2ZA 2JGJA 5CT4A 5AOCA 2XUIA 3FAKA 1ZGCA 5ALWA 1FFDA 1W6RA 2Q0XA 5C7YA 1BRTA 5AO9A 4K6HA 2ZJ7A 3D0KA 1DX6A 3O95A 3YASA 1EDDA 4GDMA 3F98A 4ZV7A 4AN0A 4PSCA 1CVLA 4FOLA 3QVMA 3C43A 1SFRA 1XRNA 1QIFA 1K4YA 3WA6A 2CEKA 4C4YA 1P0IA 1BU8A 3H2KA 2AJBA 2QMQA 4H7KA 3A2NA 4BDSA 3AFIA 4U2EA 5FPPA 3G0BA 4MYSA 1L7QA 1ORVA 2WHRA 5JD4A 5EFZA 2WFMA 2XDWA 1JMYA 2GZRA 4C87A 4AX4A 1FSSA 2H7CA 3IULA 2HIHA 1WPXA 3IVMA 1XZHA 2X8BA 5JZSA 4K2AA 5LZ7A 1H2WA 3I1YA 5DNWA 4W1QA 1QZ3A 5AK4A 1ACLA 1UK6A 1BCRA 1QONA 5FLKA 1E66A 2VATA 4Y2RA 2PUJA 4XIIA 3QITA 1K8QA 1XQXA 5ALHA 3G0DA 3U0VA 5KBYA 1QOZA 4UHEA 1XQVA 2FJPA 2QRUA 5FP0A 3C45A 2ZYHA 5AKLA 3G0GA 1ZD5A 3DKKA 2YYSA 2WIKA 5K3FB 5EIHA 2J4CA 4UBKA 5HCUA 3C6YA 1QTRA 3VJLA 5LIPA 2HHAA 1FFBA 5JYCA 3KWFA 2YH2A 2VJCA 4PF1A 3WWCA 4X00A 1WB5A 1XZAA 2BUBA 3HABA 1A8QA 4Y2PA 3M83A 1DQYA 3VXKA 2QJRA 3WKEA 3WA7A 3FBWA 2XUOA 2BUAA 3LLCA 4J0CA 2I78A 1CEXA 4I4CA 3O9MA 3V48A 5ALPA 3I6YA 3EIOA 2G4LA 5IVIA 4C4ZA 3SK0A 2BGRA 3BF8A 4KACA 5K3EA 4G9GA 4CCYB 4EY8A 2XMSA 1W1IA 3GROA 5DTIA 1R1DA 3I6MA 4X6UA 4ZRDA 5JAPA 4EY4A 1AURA 3FOBA 5IH7A 4UBIA 5T4BA 1WPRA 4KJXA 3PE6A 3V1MA 3ESCA 2QVBA 2ZJ6A 4BTLA 3NUZA 1TRHA 1YR2A 4IO0A 3RM3A 3MGAA 4BB0A 4KR0A 5ALQA 2JGFA 4DM7A 3KXPA 2D0DA 2GZSA 1QIHA 3D2BA 1P0MA 3AZQA 5FKJA 3P2MA 5K3FA 1EK1A 3ZPXA 1FJ2A 1ZJ5A 5FPQA 1JJIA 3QMWA 1C4XA 4HZGA 1CUSA 4DSAA 1VZ3A 3AILA 1TCAA 5AICA 3R3XA 2ZYRA 3PUHA 4J0JA 2WUDA 5HQ3B 2BJHA 4DNOA 4JYPA 3HXKA 1HDEA 3FYUA 1R4ZA 2K2QB 3QPDA 4P93A 4KYVA 2VT6A 4AZ0A 4AB1A 4P92A 1EVQA 4UUQA 4X6YA 3RARA 4NS4A 5ALRA 2JBWA 2VQ6A 3X3HA 1AX9A 1ISPA 4N8SA 3DL7A 2RIPA 1J07A 4BTVA 3FLBA 2JGKA 3FSGA 2AJDA 1I6WA 3TGLA 5AI0A 2B61A 2J3DA 3W9UA 3G9XA 2Z3ZA 3NWOA 1SOMA 2WUFA 2YXPX 3HZOA 1JT2A 4B84A 2XUKA 2FUKA 1UK9A 1MJ5A 3LP5A 4UHDA 3F97A 4DNQA 5CXUA 2QM0A 4P08A 4ZV9A 1YA8A 2R11A 3KDAA 4YX9A 3C6XA 3WYDA 1G66A 1IUPA 4Q3LA 1T4MA 2RGUA 3CN7A 1YAHA 4J0IA 4ETWA 1B6GA 3WWDA 3A6ZA 1CUEA 3BJMA 4W1SA 5DWDA 5CH5A 4GI1A 3BDIA 5SYNA 5HQ3A 1E89A 1VKHA 5BWCA 4UFOA 1GT6A 3E4DA 2Z8ZA 3T4UA 5A6VA 2AJ8A 3RLIA 5AKJA 1S8OA 2XQFA 1CUCA 1NU8A 2C5FA 4IHAA 1JI3A 1QIKA 5BWBA 3H2JA 1Y7HA 2PBLA 4INZA 5A2GA 5LKAA 2JGIA 3TJMA 2ZSIA 1O6FA 1AZWA 5AHXA 2PSEA 3HRHA 4O08A 3DKRA 4OSEA 4E11A 4FBLA 1IMJA 1R50A 4Y2UA 1GQSA 1VE7A 1N1MA 1G42A 4BZZA 1CQWA 2XT0A 3AJAA 3FLAA 2PL5A 2VEOA 1D07A 2XE4A 1KEZA 1EH5A 2V98A 4B9AA 3GBSA 2QUAA 1CUAA 1WB6A 4WFKA 3VJMA 1QIJA 3WJ1A 3V1LA 1LPSA 2GBGA 3HYSA 5HFAA 3R3WA 1K63A 3D2AA 4Y2SA 3QPAA 4U2CA 4WFIA 4LXIA 5CT6A 4WY5A 1ZGBA 1GPLA 3H19A 5EHQA 4BCBA 5EGNA 4G4IA 5JAOA 4B9EA 1Q83A 3STTA 3H2HA 3BIXA 1IUNA 4Y2QA 5JATA 1VZ2A 5H3HA 1KU6A 2GBFA 2DHEA 3ZV7A 4G8CA 5CMLA 2C7BA
chains in the Genus database with same CATH superfamily
3ZVLA 4H7FA 2WHEA 2JCYA 3ETJA 1D2HA 4R2HA 3PFBA 3DZ8A 4WOBA 3VPXA 1CUGA 1TAQA 5IPFA 1QFYA 1DBVO 4AWBA 3ZGZA 5CDHA 1O6GA 1ZJ6A 4DSOA 5LQDA 2H29A 3FHTA 5JJIA 1A4RA 3VPHA 3RTCA 3FLEA 3KAJA 4YGXB 3EEYA 5ALZA 2ODWA 1TADA 3F9IA 2GF2A 4RH1A 2AKYA 2O4CA 4HEQA 4OGKA 4BV3A 1N8NA 1E32A 2ZSUA 1A2QA 4RA6A 4LC9A 2O8NA 5AIAA 2PGJA 4DT1B 4YAJA 1FFAA 3H0CA 1S01A 2N75A 4IHJB 3FDJA 4B6PA 3IX7A 1RLTA 1DX9A 1UFRA 2EDAA 5FL3A 3TTYA 1E1CA 4RXUA 3RK4A 1VPTA 1SUFA 3EAQA 5KOHB 1XN4A 2BLNA 1TEZA 2GERA 3IEKA 1HYGA 3W04A 5JNSA 3UV7A 3GLIB 6GPBA 3ENQA 2NZ8A 2XAUA 4PHGA 4QDOA 4EYSA 4BGEA 4DZZA 2UVPB 2BIFA 4L9AA 3VZPA 2HYIC 3SZUA 2A14A 3IA2A 1CK4A 1AF7A 4LK3A 4NBSA 2CJFA 4O3MA 2WU3A 4P33A 2QIOA 5B1DA 5IDYA 2Y68A 1SCIA 4WACA 4I50A 1O5IA 2P79A 4O4HF 2ORYA 1JG2A 1O8BA 3AR9A 3DHEA 2AJCA 4K9MA 3PL1A 3TUIC 1RI2A 2JAPA 3QYJA 3GT3A 4Q4LA 3UATA 2HBQA 4YLGA 4C14A 4EGQA 3CINA 2C4VA 3PEFA 3N8KA 1LPNA 2VRCD 4ECAA 5G40A 5FNVF 721PA 4IG9A 1LC3A 3N76A 4ARCA 4R8VA 4WDRA 1F1BA 4GMGA 1YB4A 4PANA 4TRRA 2C3MA 1NX6A 1BAPA 3TLGB 3WNQA 4AECA 2VJMA 1SQ0A 1GYPA 5C7OO 2Q7OE 5EXPA 2B4QA 4GM1A 4N01A 1QMPA 1WDMA 3OZFA 1GSOA 3OF2A 5KTYA 3CA8A 4UASA 2BM0A 1QK4A 2BONA 4IZ6A 3JVIA 1ZGAA 4HAYA 3EWNA 4GYJA 5JEEA 3TVTA 3V2GA 2AEJA 4G86A 2YVUA 3SEFA 1VG9B 3OWHA 1JNYA 3PGLA 3CPSA 2P3QA 5E1BA 3NTRA 4AX8A 4M9RA 2Z5VA 3ABSB 4BO0A 1JEDA 2R6GA 2ZRHA 3BMQB 3WYBA 2WICA 1DADA 1NLFA 3IIMA 4EW2A 3LQFA 3HFSA 2SNIE 1UDXA 3LF1A 4KN9S 3UENA 2JIZA 2C5GA 3OT5A 4PRKA 5HBRA 4W5RA 2Q3HA 1OXBB 4MEJA 2Z1DA 3HEBA 1NVVR 2P2DA 2P9YA 1REQA 3F96A 3FCOA 5G0UA 2YR0A 2NO0A 4ZAVA 3ZQ4A 3AK4A 2Q5HA 3ITEA 4N82A 4OQEA 2PU5A 1T3TA 4PAWA 1LV7A 4BMPB 3AH8A 3KQHA 2OGZA 3UJ3X 2IEBA 3MTDA 4XRRA 4PIVA 1MB3A 2ODPA 1P19A 1U8TA 1C1DB 2IW1A 3EYWA 3RO7A 1N1DA 3HB1A 2CF6A 2IHVA 4NYJR 1GQYA 2DY1A 4G8BA 4JS0A 5JDCC 1VPLA 5JASA 2O0JA 5JHGB 3LUFA 5SV2A 1WXWA 4NCBA 3N53A 5TGDA 2CB0A 4YCMA 1SD2A 1KH1A 5HF6A 5JAUA 3SXUA 3FKSA 3T94A 4LFAB 3WL3A 5K9ZA 3AFGA 3TZ6A 3WDKA 1XTPA 1QS0B 1L5VA 3IJ5A 3E9YA 5JXGA 4MRVA 2F1JA 4P4NA 4MVJI 4ABTA 1JSXA 4A2QA 5F3WB 3H1GA 5PNTA 1IY1A 3N07A 3W1EA 5BVHB 3H1TA 1G2IA 5LLTA 5EERA 1IDN1 4I08A 4KE8A 4D8YA 1KAMA 2YS7A 3C5EA 1NWCA 2P9FA 3E9EA 3NV7A 2N46A 2W6IA 1RD4A 3E6AA 1QF7A 1OVGA 2G67A 4LYEA 4K05A 4O4IF 4NXMB 1ZVMA 1I24A 5CFMA 2I65A 4NZNA 1CF4A 1YNSA 2CMFA 3AVTA 1L5YA 1UDWA 4XJVA 2OXTA 2IS2A 4FNMA 4C6SA 4BY9E 3IA7A 2PH3A 3KDSE 5L3VA 3F3KA 4C22A 1HQDA 1BWPA 1T5TA 3DHWC 4UE3S 1SVWA 5T3UA 1FFXA 4TSRA 4PBSA 1U11A 3A9WA 5P21A 2QT9A 3V80A 4E51A 1LW7A 3FJYA 3FPEA 3ORFA 4LC1A 4QC2A 4PWZA 2YFYA 4RF3A 2ODBA 1GZ5A 2AC2A 4RE6A 1Z17A 1W2GA 2HREA 2SCUA 3JTEA 2JRCA 5DI3B 3MS7A 2PRSA 3N7AA 2FN7A 5EKXA 3W05A 2BEUB 3ZJ4A 3HJUA 3D4NA 2OO7A 3N39C 4O1IA 5DNDA 2OSBA 2AC7A 2QPOA 2ZRMA 1RQRA 5JTTA 1F06A 2DKNA 2E0IA 1Y3HA 4JKYA 4AYTA 4EDHA 1JU4A 4EFMA 2OE2A 3WGGA 3PXUA 5HIAA 3JQBC 5JALA 4HUQA 1XL1A 3NTOA 3VH4A 2OK8A 3KSUA 4MCAA 3H5VA 3RUDA 3MXTA 1W36B 4OXXA 1I6MA 2FWAA 2O05A 4CDMA 1BROA 5D1HA 3S2FA 2HV8A 5BR7A 5KYUB 4C2TA 2FWRA 2V8BA 1JFLA 2RBEA 2Y99A 5JMWA 3F3SA 4JLVA 4BX3A 3PCRB 2FXIA 1X7YB 2MHCA 3WK8A 2F3RA 5BSVA 3R8FA 5EEHA 3KTFA 4WERA 3PKIA 4FGWA 1JHPA 1U8FO 2RI1A 4AS2A 1E3QA 5IHXA 1YA4A 1E5XA 4PPGA 1HI9A 2PFGA 1NVFA 1X7ZB 2HU5A 4HAUA 4OHVA 3RRYA 4H31A 4I3FA 1TU4A 1JPVA 4WK0B 3TWOA 3WBBA 1GLGA 5EMLA 2IPNA 3KPVA 3BE4A 2GK4A 1F20A 4HDKB 1X6VA 3PGXA 2ID9A 4Y6SA 2KMLA 1AGYA 3FTPA 3O8QB 4XQGA 3B13B 1EEXB 2AOTA 3QVSA 4XD7D 4NYMQ 3TQCA 3VHQA 5TSDA 1BEZA 2HW8A 4TZKA 1BYIA 1L4LA 4UCXA 4NOJA 4OQMA 4BJ3A 3PQEA 4FHFA 1H6AA 2P6RA 1NUQA 1XD9A 1FUYB 2O7QA 1YASA 2OORA 4JUBA 4PTZA 1EG7A 4TN1A 2UUPA 4EW1A 1O0SA 4UU7A 1M67A 4Q6BA 4DC0A 1JA1A 4X7BA 3PPVA 3LT1A 2DKOA 4ZRMA 1RJGA 3SVTA 3AUTA 1Z6XA 4D5GA 4BUCA 1F14A 3COZA 5HGXA 2JD0A 3O7WA 4IOKA 5FNZA 1J21A 4RPJA 4ZOAA 5BMVF 5EE5B 2VP9A 1CERA 1J5PA 3BFJA 1AKWA 2A1IA 2PBZA 1C7EA 4KVFA 3CT6A 3ZNNA 3PHCA 4TLDA 4RY2A 4WNAB 1GPNA 2G09A 2XMDA 4PAQA 4JJKA 4QL3A 5A2QA 1GPKA 3D6UA 2NU7B 3LC2O 3FCYA 4K1LA 1Y5RA 1XU4A 1W9HA 2OG1A 2QPLA 3A6DA 4Y8VA 4ZEVA 1E1RA 2CYAA 4ZCQA 4QPZA 4HN4B 1ZN8A 2DP4E 5BNIA 2P5SA 3FAZA 1N5LA 1ML4A 1Q1BA 3FWHA 4YQYA 3HXOA 4EB8A 2CMGA 3PQDA 1PGNA 1GUZA 2P78A 2CXPA 3BC1A 3MELA 4LE2A 3FPAA 5EJ4A 5LR6A 5K2MA 4IIVA 3FMVA 1JU3A 1Y6QA 2AOXA 1ZEMA 1I33A 2H06A 3RTEA 1S1CA 1RJ9B 4NEQA 3H0KA 1ODTC 4DYHA 5D00A 1OD6A 3O4VA 2XDQA 1EJ2A 2PX3A 3OHPA 4Q1VA 5DYYA 5ADVA 3GOHA 3GZNB 4PLPA 4EMBA 2JJ2A 4AKHA 4ZWNA 1H1TA 4QPNA 4CM7A 1Z2DA 4WEQA 4WKOA 1I7DA 4Q1DA 3A4IA 4NABA 1ZGJA 3K05A 3SXJA 3ISVA 4TRMA 3WISA 2OBLA 1A2BA 4D9EA 2QVGA 4G9BA 3VJKA 1N0HA 5J3JA 2EG9A 1LTHR 3QU4A 3VR4A 2QOEA 4K87A 3DAPA 5FXMA 1MKYA 2X22A 2C2YA 4C03A 2VJOA 4FGKA 1QQ6A 2FSUA 4YDRA 5JC1A 3N6XA 1AQNA 1K3FA 2X6QA 3GWZA 2PMBA 3RANA 3ZWQA 1BJRE 2WSBA 3NGXA 1NR1A 3OCJA 4NR0A 3Q1KA 4L6IA 4ZT7A 3ZX5A 4ZHSA 5HSGA 3RUHA 4IMJB 4LHZA 4N8DA 1K6EA 5TF4A 4C04A 5JQGB 4DMRA 2HFJA 3VYWA 3CWCA 1JL3A 1ZH6A 4UHCA 5L7TA 2J46A 4M9CA 3OZTA 3ORYA 4G97A 4XWGA 3K0SA 4O29A 4EW6A 2O2HA 4RFSA 2IYNA 4UJ5A 1ODSA 4FC6A 3QWFA 2YDXA 5BQ5A 3HSSA 2RJ3A 1QP4A 1AV6A 1B0UA 1IK6A 4KKVA 2GTIA 4WXRA 5KVAA 1BSVA 1L5ZA 2YASA 3IUEA 5JO9A 3FWNA 2CVOA 3RIYA 4E5KA 2GA9A 2GBLA 4K9OA 3T41A 1A9XA 1V41E 3RFCA 2WLSA 3GLGB 3KWJA 1JDSA 2J9YB 4MA4A 4EABA 4PSDA 3MIZA 4G4SP 4MSUA 4IGAA 3U4GA 3LCMA 1HPLA 4FYHA 2UZ3A 1NBMA 4YBRA 1WG8A 3KSDO 1IN5A 1R6BX 3AG6A 1LK0A 2PA3A 5GV8A 4ARVA 5DHTA 3SS7X 3JYLA 4U2FA 5JVDF 4QDKA 4CR8A 5AHWA 1LCIA 2DKFA 2GPYA 4JVSB 2XOEA 3VH1A 5AJZA 1Z62A 1LLFA 3DS8A 4S24A 3ELWA 4FEEA 3CCBA 3TLJA 1TF5A 3TLZA 2VDKB 3PQ8A 4QUJA 2GR9A 3PTZA 2C97A 2EFEB 2YZGA 1USWA 3MJEA 4P4GA 1AGPA 3BK7A 4Y1GA 5HCIA 3W9YA 5HTKA 2G25A 2JARA 1PUJA 3GDHA 4L15A 1BO6A 5EXTA 4ZO9A 3E9DA 1U7WA 4WVLA 1DHRA 4JFRA 3TB6A 5ICCA 4K6KA 3KOXA 3VZQA 4LV6A 4C6HA 3WNCA 3GMDA 1KSGA 1US8B 5FT9A 4ZVTA 2VYND 5FBLB 3W6OA 2B4TO 3QEMA 1ZA2A 2AH5A 2EL9A 2AYZA 2PUHA 1MQ8B 2DR0A 1YQEA 4GOXA 1NV9A 3N58A 2OFOA 4I4NA 5GADl 1HEUA 4K1XA 3FR8A 2R5FA 1PQ4A 3PYXA 4JLAA 5EYPB 3H7AA 3CE9A 3F73A 2R97A 2C8JA 3ZHYA 1U2GA 2XDAA 4R1QA 3NEJA 1HRKA 2HA0A 4NZOA 1P2SA 1WSAA 3AFMA 1EFPA 3QYAA 1K2WA 4MKGA 5D5QA 5JISA 2FEKA 3W3AA 4XVCA 1Q0QA 2B20A 1W8IA 4R1PA 4H6WA 2VUTA 5AYVA 3STXA 4WMLA 3UO8B 2OO5C 1KKUA 1H6CA 2F62A 1NN5A 1VHQA 2DSNA 2Y9PB 5AKHA 3UHAA 3THWA 4CM8B 1M6YA 3SBEA 2E5FA 2J9FA 3UMVA 4BVBA 5JIBA 5KYXA 4ND2A 3B1ZA 1NL3A 4A7PA 4DLLA 2CL7X 4TRJA 1PK8A 1PT7A 1FIUA 2O54A 1PL8A 3IB6A 4N3AA 1JZSA 4G4SO 2DQZA 4XTCS 1JHAA 3S29A 1AHIA 3ONNA 1RQXA 3HKDB 5EOVA 2JIBA 4JWTA 3GEMA 2YHAA 2XQJA 4HEJA 4ZVUA 4P1ZA 2IHTA 5A7HA 5JARA 4YCNA 1E9EA 3K9BA 4RVGA 1AQUA 1K8ZB 2VHWA 3I9LA 4EQZA 3EW7A 3IODA 1TYZA 1ZH8A 4RGYA 1FLAA 4CGZA 1KTVA 4E2ZA 1N78A 5AVSA 2GPWA 4BMZA 5A5GA 1Z06A 5FOXA 4M4SA 4WW0A 3OD5A 3URMA 2FGKA 1JECA 4Y6LA 4X63A 5BRAA 5ADWA 2I3ZA 5KKNB 1DTWA 1KQPA 1I9GA 1V95A 1L5WA 1NA5A 2HA4A 1HTWA 3C1TA 2HRBA 4JJFA 4UM7A 3SZLA 4BFYA 1OC2A 3FNBA 3U3JA 4EFLA 4KV7A 5JNRA 5KNDA 2CUKA 3DW1X 1RKUA 2OR3A 4CCYA 1ZL2A 3ASYA 5LQRA 1QR2A 3OTQA 4IRUB 3SYMA 4EJSA 1YVDA 2D0IA 3PDIA 1QC5A 4TMKA 3SQOA 2J67A 3AEKB 4DPLA 1VMKA 1C41A 2VBGA 4GPAA 1I4TD 5AUOB 4X62B 1F0NA 4AJEA 4LY0A 4FI3C 2Z5FA 3CEAA 5C37A 4RHCA 5JSZB 4H2DA 1XD8A 3ZV3A 2OHGA 1DT3A 3QXCA 2Q2NA 2FLVA 1WQ3A 4IS2A 4DQKA 2G8NA 3Q8WA 3Q8LA 4LHWA 5E8RA 5AW4A 2VK4A 4ENWA 2GJAA 3D6JA 2XWBF 2KYRA 4CLOB 2J9ZB 4J7CA 1AGXA 4QTXA 5FUXA 4JBIA 4ASUA 4HO1X 1SCUA 2CXHA 3A6JA 1XHLA 1O1YA 4C88A 4EVQA 1QU3A 4ZT5A 3H42B 1FJHA 1UDCA 1KQNA 1SXJB 1T9ZA 1EIZA 5F12A 4TUYB 5ICEA 1TFUA 2RAVA 4KEAA 5GJVC 5LYJB 1PNRA 3EOZA 1XQYA 4H3SA 2XE7A 1RIIA 3C0KA 2E37A 4KMMA 3V4ZA 2GFQA 4DOMA 2V4UA 1R00A 3ACDA 3ICWA 3WWOA 4BNGA 3SWWA 4JUCA 5AJTA 1XDZA 5KJEA 3AMVA 4HDNA 3HKEA 3GELA 4QDZA 4O5OA 4CG2A 3IEVA 1BYUA 3PI7A 2ECOA 1UMBB 4S04A 2WWRA 1IB0A 5TMPA 5FUBA 3DBLA 3WWZA 4JHLA 1EVKA 2D2IA 3CGWA 4MWBA 3WL7A 4F1WA 4ZYVA 2RGNA 3ZDEA 1GPMA 3OETA 4OL9A 1M34E 2DFTA 5HPYB 4QPDA 2CE2X 4QOIA 3LGAA 4A0SA 3VNRA 3BX1A 1CRZA 5K45A 3GYGA 3I1JA 4UEKA 1WHTA 3BXPA 1J42A 1BE6A 1U3UA 4KE6A 4KB5A 4X3CA 3SEQA 2IHYA 3ZE0B 1GU0A 3WIEA 2XTZA 2BOVA 5HJ7A 2WQ6A 4MHTA 2EHJA 4G5OA 1UP6A 1DAGA 4XE5A 4V0NA 4C2BA 4L4YA 4E2YA 3F9CA 5AM1A 3WQSB 1AQIA 3TAXA 3F7TA 1KK1A 2GRJA 3FZYA 1HNZB 3PNMA 3HVJA 4OQNA 4UATA 2FSHA 2RG1A 2ZVJA 3OC0A 4TROA 1UBUS 3I4CA 1NT2A 5ERGB 3SICE 3NW9A 1RI3A 4CIYA 1YZKA 1K86A 3LW7A 4I6EA 2PX6A 1WB4A 4O8CA 1Z5OA 4G07A 1NTOA 4HGYA 4DMFA 5IVHA 4H6XA 1MENA 4XWKA 1NQ5A 2TYSB 2ZRPA 2F3QA 3QEKA 2UZ1A 1SNYA 2OD7A 2R48A 2OOSA 2WT9A 2YFQA 3I6BA 3IAEA 4QUAA 5JXWA 4E07A 3A1VA 3DUFB 4NZMA 5FI0B 4LF4B 3EJWA 1PT5A 3ENVA 1QYVA 4RWZA 1TW2A 1G41A 1U5BB 3SC6A 2ZUEA 3MG9A 1J0CA 1JKXA 1VHLA 3NKFA 4C1NA 1VA5A 2G9NA 3O21A 1IJKA 2FU5C 3AEXA 1EINA 1GUDA 2VCYA 3H3JA 4J3NA 1XR3A 4TKLA 4ABYA 3HVUA 1EPUA 1HE1C 1PUIA 1YL6A 4X85A 1JHRA 1NZDA 3NHBA 1EBFA 1ECCA 2XY4A 3CH6A 4HX9A 1N7GA 4AMGA 4C3VA 1B0AA 4FR5A 4KXNA 1XA4A 3UH0A 2IYWA 4H35A 2H59A 4X45A 3IXLA 4YCCA 4DDVA 4CKZA 1SAYA 3EPRA 3JYOA 1MO5A 1TLFA 1Y8CA 1PFUA 3U3MA 2G08A 3U31A 1T8UA 4RE5A 3EBLA 4EEZA 4H1HA 4RKEA 1ZZGA 3UHJA 3ZS9A 4C7MA 1SXQA 5KYVA 1XF9A 1RQPA 4HPWA 4XJSA 5CUQA 1GN8A 4D0LB 4JEIA 4QPJC 4M8LA 2X23A 5U4QA 3LP8A 3VBEA 3IILA 1EX9A 1P5ZB 2YX1A 3R23A 5DCLA 5FUWA 3BDVA 4R84A 4DMLA 1WZCA 4QECA 4KZPA 5A4IS 2OTCA 4DJAA 2RI6A 4JP5A 4YHBA 4MKFA 4NIMA 2AFHA 1FQWA 2C8VA 2CXNA 3KP1A 1CNFA 1OMOA 1I2DA 4HNSA 4LOIA 4JL5A 2ES4A 3PF9A 1Y42X 2W22A 4AVYA 2PYIA 2PZMA 1M8PA 4IIBA 3A4TA 1FFEA 3RBZA 4U6NA 3MFYA 3OIUA 4P34A 5JWHA 3G02A 3VYRB 4AZSA 5K0LA 3ESXA 3EVCA 5TNXA 3C7TA 4N5NA 4IQ0A 3WYNA 1ABEA 1V6SA 4BATA 4C0KA 1C29B 1TM2A 2FZEA 4UMVA 4QIHA 3K0FB 4D42A 9MHTA 4YRCA 3UW3A 2P7IA 5B7NA 4IJMA 3DV9A 2VWHA 4Y30A 1DIHA 1TGVA 2HWYA 4MINA 3VVMA 5JD6A 1VHDA 1YJXA 2D5LA 1UDAA 1KRHA 3CO5A 3Q15C 4WKBA 4YJHA 5T4EA 4WZAA 4PRYA 3AQ4A 3UHFA 4J1QA 4D4KA 1SVKA 3HO1A 1U1FA 2G9ZA 1E2LA 3DMFA 1RQGA 5CNKA 1PZXA 2A4KA 4IIDA 5JAHA 5HNKA 5IBRA 4KLAA 4PQYA 1DG9A 1RAFA 3NEYA 3L0PA 3LD9A 4X24A 4MVJF 4Y2GA 3WX0A 5K0SA 5AXBA 4QBTA 1KOFA 1CS0A 4G1UC 3DC7A 4BO6A 2HMTA 2QV0A 5F7OA 4NU8X 4JP8A 1QH1A 1JYSA 1U3FA 2FUG6 3BJZA 3Q7SA 2BN4A 5KVSA 3FPLA 3IIJA 1HG0A 3QEOA 1HDXA 4DMGA 4LTDA 1W9MA 3HNPA 3E35A 4INPA 1KAOA 3ZE6A 3RQSA 3M70A 2QTAA 3B7WA 3IUMA 3BMNB 4A4DA 5JUWA 1A7JA 1VSQA 2I1WA 4H6PA 5SY4A 5HBGA 1N5MA 3KQTA 1I51A 3TW8A 3G49A 3Q6NA 1O7JA 4X65B 4NATA 3ZQ6A 1EP2B 1M6VB 3AHDA 3M89A 4NG5A 4CIDA 5K0JA 1IEXA 1CEEA 4BV9A 1Y7IA 2LKCA 2QQFA 5D6OA 4D8UA 5I7UA 1GYRA 1ZN2A 3QVLA 4KQXA 1Z35A 1VGRA 2CFRA 5G1PA 4O4JF 1EFVA 3ENWA 3LVQE 2I8AA 5JXJA 4KL8S 4BNFA 1Q6ZA 4V1CA 4FYKA 3PHIA 4HGZA 3X2FA 2AN4A 4KAAA 1CUZA 4ODIA 4C20A 3VO8A 1M0TA 1JLMA 1KWGA 2GM3A 1LSOA 2I4LA 5DBHX 4EG7A 1EE2A 2BD0A 1UFOA 1TDJA 2ATVA 1OLXA 3D4OA 5JAQA 4JQZA 5DGHA 1A5ZA 5HDBB 1HY3A 2JI9A 2JS7A 4UBNA 2ERYA 4YK7A 2PUVA 3QOXA 1KH3A 5DYTA 3ZX4A 5B7QA 2VTVA 1A88A 5F4ZA 5LQSA 1C3VA 4DR5B 4DL9A 4EO7A 4H4EA 1O94D 1NLYA 4NMLA 1Y8QB 4M1QA 4UCFA 2Q2OA 5JHHB 3CLUC 4YASA 2BGKA 3SP1A 3D3JA 2VDNB 1U0JA 1PJAA 4KLNA 2J4DA 5DNCA 1HYHA 1F12A 1H69A 2H1VA 4ZYWA 2O3QA 2GYYA 3RVKA 5AXAA 1GNTA 2FP3A 2WTBA 3K2QA 3CLSC 1IE3A 5KYNA 2Q2VA 5KKAA 1KOGA 1A77A 1E5DA 1JDUA 3PQ3A 1HLDA 3HCDA 1O58A 2LDBA 5U9CA 1I0ZA 3Q7EA 4MAAA 5BNFA 1N2CB 1ZCJA 2A33A 4Z3DA 4Q4HA 1HURA 3ZHOA 1TM4E 4CW7A 5K8TA 3AWDA 5LQMA 4JJGA 2MSDB 2MYTA 2Z0MA 3UWPA 1AKNA 1JILA 1Y3CE 3GBPA 3C3MA 3N6VA 4H3KB 1AY0A 4Y9UA 4GZMA 5JYEA 1A9QA 1H6BA 4JZYA 4C05A 1ZD4A 5K3CA 1EUYA 1KO5A 3HVKA 4MRNA 5DYWA 5DMXA 3DMHA 2F8SA 2VP4A 3MIIA 4P2BA 5BWOA 5EJ5A 2YHBA 2P4HX 4KBYA 2EZTA 3RC9A 2ZXEA 4UUAA 5J58A 3IUBA 4AXBA 4DB4A 2R85A 1D4AA 3V4FA 3PS9A 4NBWA 3FCAA 4QULA 4BBJA 2PMEA 5FWYA 2V6MA 3K9NA 3TI7A 1QIEA 4P5EA 4R2KA 4FJ1A 5CJJA 5TMEA 1RXEA 2ZCUA 3TW6A 4M1OA 4HGPA 5L9AA 2HLNA 3ERCA 3N2KB 1J20A 5EIWA 4C0JA 4U8HA 2ZBVA 3D1LA 4PG7A 4IH4A 1B1CA 1ZMBA 2QUJA 2WK1A 3N8IA 4KRFA 2EBHX 2JRLA 1XXHE 4RGVA 3RS7A 1DG1G 1QRAA 2PWPA 3LPMA 4E31A 3DWIA 3AZOA 4GWGA 4N39A 4HLUC 3BEDA 1Z2OX 5ANRB 3ZY2A 2QT0A 1EXNA 3HE3A 1C1XB 3CW2A 3CVVA 3GT4A 3K70D 1C4OA 3NXSA 5L51A 4Z0PA 3ZDAA 2YXNA 3C3DA 5A04A 3BD7A 2OLEA 1X13A 2L82A 3GJRA 1Z2EA 2ISSD 3B51X 3QUCA 4OQYA 2HMVA 3LCUA 4IJ5A 5JNVA 4C0BA 3WQHA 1XDDA 3DOIA 4MGHA 4JMPA 2FPLA 4IHJA 2GDZA 2P6PA 1L7PA 4IFTA 4XDZA 2YV1A 4YRTA 1JDNA 3SQDA 4C4XA 1G8HA 1R8YA 3BIOA 4Y7DA 2GN6A 2G9RA 2V7WA 2WOJA 4NFHA 1LDEA 3TW4A 1JA9A 3GRPA 1F7VA 5M34A 3IEUA 1NE7A 4B75A 1QDLB 2DPYA 2QZPA 3GLIA 3K8QA 3EEIA 1MN6A 1SKUA 4IX9A 1YS4A 2HJRA 1V45E 2UVPA 2WVAA 2ZBDA 5CFOA 1QRTA 1P9NA 3PFCA 4IKPA 2QAGA 1MTZA 4YIKA 2I3AA 1P91A 5HE8A 2Q8NA 4FFRA 3H2IA 1CVRA 2RB4A 1DX4A 4NU5A 3WWYA 3FBTA 5EXSA 4M21A 4PVCA 4JNKA 4CM4A 4YO7A 1T2UA 2P8SA 2QSUA 1YDMA 3OHMA 1EK0A 1DKNA 2VXBA 4XSGA 1BMFD 2OB2A 2WYUA 5EE1A 4ZALA 1OLSA 2OCBA 5EE0A 5CB4F 3ZWKA 1SCAA 3IAS6 3FMGA 1SIBE 3ER8A 5BSGA 3KYDA 5DLPA 2FPPB 3FPKA 3WDLA 2R1ZA 4BOYA 1CIPA 2R8RA 3SHVA 5IT0A 3HBFA 1WF3A 1UP7A 3BWEA 3FTNA 2OV4A 4LY3A 3UOWA 1TYEB 4HSGA 4YRPA 1E0KA 4HRVA 3TD6A 5BNZA 2I1QA 4QQFA 4S05A 1Q3KA 3I39X 2O8FB 1ZPDA 4R3NA 3TFWA 4Q3EA 4P80A 3NDPA 3MS2A 4FD2A 5AW8A 2AS0A 1PQYA 3FF4A 3VR3A 1MRNA 4Y2XA 3FCCA 2BKLA 4NFLA 5JPIA 3BMQA 3BJIC 3D2CA 1NVXQ 4UOZA 1NU6A 2NT3A 4QRDA 3RYCA 1ORRA 1ZJZA 5LU9A 3NHPA 1W30A 3PD7A 3G3EA 2QD2A 3ROPA 4G2TA 3T7CA 4W5TA 1XNRB 5LZ8A 2OCYC 2PKCA 2VTBB 4RVNA 2VQDA 4O25A 3SAJA 5M2QA 3GLFB 2IYXA 3U17A 1OTXA 4FJ0A 4Q7EA 1KZHA 3RAPR 2BFFB 2GEFA 3NHZA 5ETJA 3LY7A 1QYWA 3HA2A 2QL7A 1Q0RA 1B15A 2GK6A 3DMDA 3IPLA 3ZWXA 2LP4Y 3ZS8A 4IKEA 3Q0TA 4PU0A 3SKXA 3GFQA 3HCOA 4BMSA 6YASA 1C1DA 3AETB 5K0CA 1BHSA 1Y1KE 2PXCA 3L0OA 1CPYA 1RM0A 1IOZA 2HADA 4KP7A 4PYQA 4YAGA 1YULA 3BH6A 3E8XA 3CB2A 5I9LA 2ECPA 3HO8A 1Z74A 4LPSA 2JI7A 2LNDA 4MMXB 4D3ZA 4PLWA 4LXQA 2D7DA 3Q6IA 1QRRA 3R4CA 3ILVA 3MJ4A 4N76A 3GUVA 3PHGA 2A1UB 3EH1A 2FMUA 1WY7A 3H4IA 4MUEA 4PO9A 1W35A 2X4GA 4CM9A 1VE5A 1CR6A 4I36A 2BELA 1YT5A 4LGCA 3SGLA 5BVHA 5EEGA 2IQIA 3FBGA 5ITVA 1FRNA 3GHHA 4RIEA 4DUPA 4K26A 5JDIA 1B74A 1Z5ZA 2QGZA 1YMUA 4UUNA 3ZLUA 4LZPA 3K6KA 5TT0A 4DCJA 2PAFA 1T2DA 3HJBA 1CWUA 1S3FA 4BEJA 1ZP6A 1KI1A 1L4UA 4L4UA 4HUJA 5HUJA 4L5AA 1SWVA 4ER0A 1Y3DE 4GHWA 1L5LA 1RU3A 3IAXA 3R41A 1LNSA 1Z07A 2FPRA 2HMAA 1NMEA 1CR4A 3JASA 4HG2A 2W6MA 3F3YA 3BF7A 4HS4A 5FWDA 4GVXA 4DLSA 2I1LA 4NX2A 3LC7O 1B42A 4V0SA 3AYZB 5JY6A 4J0GA 3CZ4A 3GEHA 1XNJA 4JLUA 3QLVC 1C7JA 3I0NA 3LQ2A 2O0HA 2LUOA 1CKEA 2J7KA 4HVTA 1J33A 1KORA 2GASA 1J7KA 5DI3A 3UW1A 3GJXC 2YHSA 2FEPA 1L7NA 2PH7A 2Y4NA 4XDGA 3DWGA 2AI1A 1GZSA 1B26A 1M2OB 2K7FA 4B4OA 4BE9A 1VB3A 1NV8A 3UEOA 2O5RA 4HQFA 4Q9NA 4E0BA 1O94C 1CE8B 4NBTA 1YIOA 4EPTA 5DLEA 3ZGXA 4M1EA 1JFVA 1QG6A 1LZLA 5TLSA 5E9AA 1Q0TA 1AS3A 5KCZA 2I2DA 3L92A 1RRKA 5KYUA 1BJKA 3BA6A 4RSHA 3S8MA 1H66A 2NXEA 4H7DA 1AQLA 2GD1O 3E7WA 4XR9A 4QGGA 5CA0A 3M3DA 2XRZA 4KIFA 3Q88A 4RVHA 3CLRC 3MOIA 3LUCA 4BVJA 2COKA 2ZS9A 1J2EA 1AHPA 3CQ9A 4GG1A 3NLLA 3V4OA 3WB1A 1JHXA 3JQ8B 3KSMA 4LDJA 2RHBA 4B76A 2OKGA 4QOJA 2G70A 3I5XA 1FMFA 3LK7A 2BGJA 1ZJJA 3EZ7A 3E9ZA 4C7XA 3ZJUA 2Q4TA 3AF2A 3PQFA 1LPBB 5IFKA 2X15A 2JFNA 3WZLA 2HQOA 1NP6A 2ZSJA 5I8WA 3UBTA 4WH0A 1ZA1A 5FADA 2JAQA 2WDPA 1A2OA 2X9LA 4FDVA 4O4LA 3L4BC 5DLYA 1DC3A 3D9QX 3ORRA 3WBKA 5F77A 4RAOA 2NZWA 3C8MA 3RD5A 2BGWA 3HLKA 4X6LA 5G3YA 1G5IA 1YZFA 1J5EB 3GAZA 1NYTA 4MV5A 1VKZA 4R01A 1BFUA 3IJPA 4I8DA 3VYSB 5BNTA 3AHCA 1MDBA 3OZSA 2FB9A 4AYWA 1EXWA 3B7PA 3G5UA 5BQPA 3V00A 3OQIB 3X1ZA 3KS9A 2OBNA 4HXEB 2O2EA 3REFA 1SELA 2NXWA 2QLMA 2V3CC 1NZFA 5CYGA 3PUZA 2WWXA 4DHEA 3M5PA 4WLUA 2E4ZA 4JJ6A 1GCOA 3HKCB 1Q50A 2BRUA 3PNLA 5B1HA 1ONPA 3I6IA 1Y3AA 4IPTA 2XJ9A 1E2PA 1K6IA 1LPAB 3H1PA 4OVKA 1NI3A 4WNAA 5BXYA 2M1XA 3HL0A 2C88A 2R84A 1F8XA 4W5JA 3ZD9A 4A26A 1BGXT 2DULA 1Z6PA 5DF1A 4NBRA 3RVLA 3S2SA 1LPPA 2ILVA 1J23A 4FEYA 1K75A 2EDCA 1Z6GA 3QUAA 3IKMB 4TKVB 3F8TA 2DYKA 3CT4A 5IDVA 4UXJA 4RLQA 1V2HE 5ESRA 3AFHA 3QX7A 4OOEA 3ZKAA 4U7DA 2XRMA 4KVGA 3LLVA 5AJHA 1JEQB 3CFYA 3PYLA 1OH7A 2IC5A 1Q2UA 5I5GA 3F6EX 3KR2A 2HJWA 1FL9A 1XHEA 1WV1A 4QOSA 3T99A 2A1TR 3STHA 3A37A 3T3PB 3V2IA 3LXXA 1BDIA 4KR7A 5EHNA 5TGZA 1VM6A 2CJWB 3D8UA 3IPCA 5G4LA 4C08A 3GZNA 4GMXA 4REQB 1T8RA 2CVPA 2H1LA 3G7NA 3UMCA 1E99A 1X7WA 1Y81A 1NJ5A 4WOKA 1HQCA 4FTWA 3ZR4B 4E5VA 1H9CA 3QVXA 1DVRA 2J59A 1ONSA 1EK6A 2WG0A 4QGSA 2ZSAA 3CVOA 4I1UA 3D5QA 3T7SA 4D43A 4O2AB 4JB0A 1JE0A 1RWNA 2WJGA 1H2YA 1OFUA 3ONVA 3LC0A 1KQOA 5CK4A 2PGLA 4WBSA 2I0FA 2CCKA 1I4EB 4WA8A 1TU0A 4QFMA 2BCGY 5D3MA 3IP1A 2HO5A 4OKIA 1JKMA 3J80A 1M2GA 2B34A 3DT9A 1LEHA 4WXMA 2DFKB 3U26A 3JWPA 3MBOA 3UFXA 1L6RA 5H59A 1XLTC 2A3NA 5JQGA 3AZPA 3R75A 3AJ8A 2VLBA 3MMNA 1GGEA 1Z37A 2XYQA 3NV9A 4LYYA 3VOSA 2Q49A 2XWQA 1NURA 3KB8A 3NG1A 3WKDA 4D0NA 1ORIA 3DLBA 1VSTA 3SHFA 4I0WB 4I1VA 4XJXA 4JT8A 1SKYB 3N7TA 3T5TA 1GZ4A 4IKOA 3TZHA 3MD0A 4M7OA 2P2SA 2P77A 3NT4A 3S1AB 1BQEA 3SBOA 3BXHA 4BU1A 3I0MA 2Z8XA 3KE8A 1A8PA 5AVRA 3OT4A 1FSGA 1F2TB 3SZOA 4LKRA 1WW2A 4Q1EA 1NSTA 2IDMA 1NNEA 3O8BA 5LQAA 1ULSA 4B6GA 2JGAA 1BFKA 3QBEA 1LI7A 4H0CA 3ZE9A 4BX2A 5H80A 1K6XA 2BHSA 3INNA 4FFMA 4RPHA 5LP6A 5M04A 4QVIA 1SMKA 2QTCA 4X91A 3DEJA 2Q0HA 1PN3A 3CZ5A 4CKBB 4F1JA 1BDJA 1LLQA 4EHBA 2JIZD 1NN0A 4FINA 4WOPA 2OV1A 5CCDA 3KUUA 1C2YA 5BOSB 4I5FA 3U7RA 3PFGA 1Y82A 3KL4A 2XCTB 2DE0X 2B4YA 1L9KA 3TO5A 3EZLA 3LBAA 3NEAA 3GCWA 1OXVA 2P90A 1T26A 3DVSX 3M1LA 2EX1A 4HRYA 4RL4A 4CE6A 4C4AA 4KWTA 3QE4A 5EIBC 4PV7A 4FNGA 3G8YA 2OBBA 4F3TA 4WOJA 3LY9A 3OJLA 1ZMXA 1TJ3A 5CXQA 4DWWA 1K7YA 4QUHA 1QTQA 5DM2A 4ENTA 2R87A 2O7SA 2XIJA 1O2DA 3DOHA 4PLHA 4KRXA 3DOJA 1C0EA 2RIRA 4GRAA 2Z98A 5ADHA 1Y6JA 4ZHQA 4TTPA 1L5QA 1Y4SA 1E4OA 1SKAA 1RW4A 3C98A 3FKSD 3ADDA 4FGJA 4Q4AB 1TM1E 3DZBA 3I01A 3EE6A 1ICEA 1LKZA 1JN0A 5EYPA 3RRMA 3BHMA 3OM8A 4HBGA 4K9DA 2BZGA 3LHFA 5K3AA 4MB0A 4JLBA 3P9IA 3RUCA 4FZJA 3R5JA 1DEOA 1PEAA 3G2PA 1GADO 5AOBA 4G41A 2W6ID 3IUQA 4PY2A 1KYVA 4KBGA 3PGVA 5ALDA 3INTA 3N2LA 5J9FA 5BR4A 4AG3A 1VG1A 1VI6A 1NVKA 1A7AA 2WMDA 3GLTA 3A9CA 2O07A 4ZI5A 2MSLA 4NEGA 3KR9A 2P4UA 3I9KA 3L84A 4BB5A 4JI5B 5T6MA 1LJUA 1PJLA 3KD2A 5EG5A 4HDOB 5KMGA 2DQSA 3FKJA 5C81A 3DOUA 2DAPA 2P5UA 2Z6AA 2ZJ5A 5F3DA 1PQUA 3KB2A 3BIFA 3AR4A 3RG8A 2PPVA 1FP1D 2V97A 5C1DA 1OROA 2B99A 1QO9A 3IQFA 4HNQA 3HKDA 1TMYA 4P36A 1T43A 2HJSA 1QHHA 3MMSA 2MSEB 1XB2A 2CV1A 1AUPA 4J7XA 2BVNA 3Q8KA 1ZDMA 4CKXA 1OFVA 2ZUWA 4YAEA 4GQAA 4AC9A 2NSHA 2HA2A 4B6JA 4CPDA 4EPWA 5M29A 3TX2A 1YJCA 4XIJA 2CB9A 2RH9B 1PD0A 4DKXA 4Z4FA 1KXZA 4J03A 2Q27A 3CX4A 3GH3A 1H1DA 3NJ4A 4MJXA 1RWWA 3VZBA 5EQJB 1QGUA 1OWOA 1WHSA 3T7TA 1E9AA 3DL0A 3MM4A 2HIGA 2IZ5A 3HSYA 4G9EA 3SOPA 1CV2A 1XZNA 1C50A 3AW8A 4DQLA 4ENRA 2QMEA 4JD5A 1UBEA 3I32A 3ZZTA 1JBEA 1E7SA 4MRRA 2A3RA 3QMVA 1U65A 3EOBI 1NMQA 3JR7A 1KKLA 4KRGA 5CJPA 1J5XA 3QVVA 1A7KA 2AXPA 3VU8A 3GN2A 1IYZA 3QKIA 4KXVA 4EMUA 4RCVA 2HLHA 3S8EA 2YZ7A 3DSRA 5LZ4A 1OSNA 2QS9A 2AN1A 4Z4HA 5I4CA 2IS4A 4R69A 1P75A 2EW8A 2FEMA 3A28A 1HH4A 2ZIUB 3EY9A 1SK8A 4K46A 3TVYA 3AR5A 3TLAA 5IUJC 4JB2A 5JJBA 4CLOA 2YXDA 3ZVMA 3SR4A 1N6LA 5CJ2A 4YMTA 5HFJA 4Q7JB 4MW9A 3QVUA 5K20A 1NKSA 3C3WA 4YGYA 4ARZA 2OV8A 2XYHA 5DNAA 1VLMA 2PR7A 4TUYA 3I37X 3F6PA 3AINA 4N0DA 5KHLB 1U4NA 2HHLA 1TO1E 1E94E 4BLWA 1P0FA 4EKYA 3U1TA 1WM1A 4BHTA 5FTWA 1U0OC 4JI1B 3Q11A 4GZ6A 1E3EA 1X1SA 3PUIA 3T3EA 1GGNA 1UKZA 5CVJA 3ZGNA 4MW5A 2Y0EA 1DCMA 3ILYA 4X1YB 3LBHA 1KEVA 1Q14A 2ZRJA 3QRWA 3VDNB 4E5PA 1MGPA 1T34A 3PLAE 3WWEA 3C6QA 3TR0A 1G3QA 5GIPE 3LDFA 3FRJA 3ZK7A 4COKA 4KRYA 2R66A 1CZRA 2WWWA 3GNLA 1B8OA 3P20A 2FN8A 3Q9LA 3WTCA 3CRW1 2R68A 1E1RD 2O2YA 1XAGA 4Z7QB 3F4BA 3FW1A 4CV0A 1CUUA 4WBNF 3HU5A 2CMHA 4QZVA 5KTTA 3CUTA 4KQ2A 1TYCA 3A2LA 1YWGO 4N7MA 2AX4A 1N9GA 4CR7A 2XVZA 2RAUA 4MLPA 2X0RA 5FOSA 1HF3A 1TYBE 4LWOA 4NAVA 1QE0A 1EX1A 3ZBPA 2PD6A 4WRRA 2NZUG 5A05A 1P1IA 3CONA 3VR1A 2CY0A 1XKLA 1SQFA 5DIZA 4YT4A 2P2GA 2JJ2D 1E7WA 1G5RA 2HFKA 2X7JA 3I62A 1LDMA 1PQWA 2PANA 4EKGA 1RPJA 2JLSA 1WZEA 4EBFA 1QVWA 5C8VA 4RC9A 4JR2A 4DXAA 1QE3A 1E6MA 3ANLA 3G1WA 3VR4D 2EL7A 1D6SA 3DUFA 4KV9A 5B30A 3FOZA 3A1FA 3FHCB 4I2VA 1TT7A 1AUOA 4CIVA 2G72A 4MGZR 5CA1B 2O1WA 2QW8A 1U5BA 4P7KA 5AWFC 1Y8RB 1UZAA 1OAAA 3PNKA 4AURA 2X3UA 4WADA 3I61A 5E7IA 5A06A 1KIAA 5CG1A 5KQRA 1GQRA 2R6AA 4II3A 4R9RA 3OPVA 2C0QA 2CVFA 5D3QA 2J0SA 3CX7A 2JIOA 2QYSA 3QUQA 5JAZA 3GGCA 2DM6A 2R7NA 3KUCA 4NICA 5GAJA 4PC3A 4DXHA 1FJXA 4JLKA 3QEJA 3KXIA 3GLHB 3T3GA 3E7DA 4FB4A 3LYLA 4LXHA 1ZMTA 1BQ3A 2H48A 1JYEA 2ZUTA 4E94A 4G0MA 1WXHA 3NDIA 5F23A 1DTSA 3PRKE 5FFNA 4EHKA 1SRRA 1RTTA 1ULTA 3DTYA 4I55A 2WHPA 4Z4CA 2D0OB 1PFWA 3JATA 3P94A 4ITRC 5KQSA 1OB5A 5TY0A 4I5EA 1G3RA 2NG1A 1UOOA 3L1JA 4ER5A 1NW6A 1YE5A 2Q1YA 2V7BA 3CZ9A 3EQ8A 2Q5LA 4O0LA 4PC7A 5DJ5A 2IE0A 5TPWB 3LWNA 3NCHA 4YTEA 1IK4A 2ZAGA 16PKA 1GG5A 1NBMD 1XFDA 4DSTA 2Q3MA 1Z8NA 2GO1A 4W7HA 1MX1A 4IDDA 2QUBA 3V8RA 3D3WB 2JBAA 2ZTVA 4NPHA 2IUFA 2IU3A 3LUPA 4RTQA 1AO3A 2BPOA 4ARIA 2BFPA 2I3DA 4GS5A 1C14A 3NCTA 4LBYA 3KKQA 1Z73A 2HO4A 5DE3A 4AU1A 2GXQA 3KZMA 4NFSA 4RJKA 5FD8A 3BMCB 3AY0A 3QXHA 2NU6B 5MDHA 2HPZA 1BGVA 5AI5A 2FCAA 2HHCA 2BUCA 2PCLA 1T2CA 1AU9A 4Q16A 3WLHA 2HRCA 3S2GA 1MO4A 1XRQA 3MYRA 5A9SB 1A9PA 4B40A 5FNVB 5P8WA 4TV9A 1G6HA 1ZD3A 5DNEA 1N92A 2Z2JA 2ORED 3MD9A 1XRLA 3K0FA 3QNUA 3QXSA 4QU0A 5HS6A 5HX7A 7MHTA 3KB1A 1II0A 1M2EA 2H57A 2QHXA 3AKDA 1Z0SA 4Q21A 1V5EA 2QA5A 5HXAA 2LV8A 3RVNA 4K9PA 4E88A 2YKGA 1FS6A 1V8PA 2FUG1 1AF4A 1JQDA 2I8CA 4MARA 4AJ4A 1NF3A 2JHPA 3D8SA 1XQ6A 1KAQA 1YZYA 2ZSEA 1T24A 4EO9A 3IVGA 4UZEA 3D3NA 3GG2A 3FZQA 3VDRA 2QXTA 5AW5A 1L7MA 3B6ZA 1U6IA 2A2ZA 1TU3A 4K6CA 2XB4A 3M8KA 4GOOD 4OP1A 4QBIA 3TLYA 3ICQB 3ZZUA 3W3AD 2O8BB 4BCDA 1ISFA 2H1WA 4ZOQI 1RLJA 1WBJB 1XWIA 3WLAA 3HCPA 1QGOA 2A84A 1GDTA 3BSSA 4QFDA 3M6MD 1GA1A 1J39A 4FNOA 1PKXA 4LFCB 1YGPA 4DCNA 2HUPA 3CNEA 4GEGA 2BMVA 1ZESA 4I19A 2OKCA 5JS7A 3WGZA 4RETA 5ITSA 1D0SA 4ENVA 1GVNB 3B38A 1KSHA 5EE9A 5IRCD 2H00A 3BMNA 1YR9A 2PGIA 1Z3IX 2O20A 1G5TA 4NBKA 5EWJA 4PG6A 1DQZA 5BURA 5IKEA 5FLYA 1OTYA 1VJ5A 1ZISA 2JFBA 1MAWA 1NT4A 4FCVA 3EZYA 1ISGA 3RVOA 4NCXA 1BZYA 3TRDA 4EG1A 2VJPA 2ZP1A 3OQMA 2PNJA 3STWA 5JROA 1I4WA 2BDUA 1YRQA 2F17A 3N2NA 4W5HA 1XRPA 3GLQA 1W29A 1XTIA 3EA0A 1QFSA 1NUHA 2RSLA 4PE5B 2JFYA 4OHXA 1G7SA 1A2KC 4W5NA 1I2CA 1NJGA 3MWLA 3ANNA 3C85A 3T0FA 1L7AA 1GO2A 5FBZA 2FPUA 3I6QA 3QTBA 5H83A 4NAHA 1WQ4A 2JLQA 4E5YA 1F7UA 2BHLA 4YCDA 2CKDA 4HKTA 3TKLA 3D6AA 2VVTA 5BUSA 1S2MA 1GSHA 2GCOB 4LSMA 3GRRA 1SBNE 4YRIA 1B14A 1MC4A 2P5TB 1DJLA 2PHZA 5KNDD 1BKSB 1HKUA 4N0MA 5A4KA 4JN6B 5HJ5A 4DYVA 2FQ1A 4PAOA 3MHTA 2GUGA 4IJ6A 2DF8A 1W4ZA 3L0DA 1L1FA 1Y8QA 3Q85A 2NPFA 1DXYA 3LBFA 4HDMA 4URVR 1Q95A 4U8GA 4RCZA 1ZNZA 4XARA 4F5DA 2F9LA 2Q6IA 4Z1MA 1PV2A 1QHNA 4QNRA 4R4JA 3LBNA 3NIGB 4D96A 4JYZA 3QELA 3QFHA 2I7XA 5J4KA 5LMUB 1ZITA 5BN4B 1N0UA 4GDMA 3ZN2A 3PK0A 5BQFA 3F98A 4PS1A 3OEWA 1P7ZA 4DBZA 4RTPA 4GDFA 2ZJ2A 3NPMA 2QTFA 4FGUA 3EUWA 2NTEA 1RWPA 1CVLA 2QQEA 4FOLA 3MWDA 2NYAA 3S40A 3C43A 2B7BA 3NAGA 4U1RA 1CY1A 1YR6A 3ONFA 4L4RA 4ASUD 1SFRA 3JZFA 1J7JA 1XRNA 2OORC 4KXQA 1QFXA 2WF8A 4HATA 1YZNA 2HPAA 4MVCA 2B7CA 2CNNA 5H9VA 2QY9A 1KYZA 2A9PA 4OMUA 4WGFA 1KNQA 5HQJA 3EPHA 2AMVA 3G5AA 1IHOA 2YTZA 3M2TA 3N2EA 3TXXA 3H1EA 3WV4A 3ROQA 4A3SA 3AP1A 1OU4A 4P5PA 4TTIA 3KZOA 4RABA 3PFNA 4RAQA 4M60A 1QWOA 1KBOA 2AJBA 2QMQA 3F49S 4GKVA 3V1UA 4BXOB 1C3LA 5JWOA 3ND8A 1MJGA 3C16C 2VH1A 3FPGA 1IFXA 1SUWA 4RLHA 4TN5A 1BS2A 2J6IA 2YWCA 1Z7GA 4JKOA 1EAYA 1V48A 3IYLW 4MW7A 2GH1A 3CSUA 4YJ2F 1MLDA 1IOWA 3DR3A 1ONBA 2HIMA 4F8JA 2YINC 2XTAA 4H17A 3KQUA 2C3UA 2PWYA 3JPWA 5GZ1A 2PR2A 4Z8YA 1VP9A 2WHRA 1FXWA 3N2KA 1C4WA 2I4MA 4H1VA 1XU7A 4JAVC 1SIWA 4L85A 2IYRA 5AVZA 1ZR2A 3IP3A 3FTEA 1WS6A 5LIPA 4MO9A 1SEVA 2ZE5A 5B2EA 1JTVA 3DJFA 3KYJB 5T57A 3GFVA 1QXSA 4AX4A 1ZL0A 4RYLA 3R7LA 3RWBA 1KFBB 2D3WA 5GMOA 3U61B 3L7AA 1YVUA 3H3XA 1IG3A 1MF7A 4N0QA 4AAYA 2HIHA 3KZXA 3MMPA 5LA6F 3R20A 4C0XA 3TLKA 3ZCSA 1VPEA 2WU1A 3GFSA 4UDXX 3IVMA 1HT3A 1ZO8A 2FVYA 2R8YA 3PRYA 2ARKA 2RC5A 4OQDA 1CDDA 2X8BA 3V4PB 5JZSA 3QEBZ 2E4VA 2CLFB 2XF8A 3GRZA 2WSIA 2AZMA 4MCHA 2OVFA 2QTWB 4Q66C 4WZZA 3D1JA 3I1YA 3A6GA 4RA9B 2DWUA 4HX5A 4EYGA 4H0FA 4FGZA 5CBPA 4DUZB 5AK4A 1LC0A 3ZWOA 1UK6A 1QONA 3IVRA 2BFEB 4EHDA 5CCBA 4LHYA 2VATA 3LUJA 2PUJA 1Q7BA 4XIIA 3AOGA 2SKDA 2VF7A 1EJ0A 2WAMA 3O82A 3SFZA 3IELA 3TM4A 2CNDA 5GZ3A 5J1TB 3UGTA 3HTXA 2FZWA 5ALHA 4HH0A 3RVJA 2Q1TA 3L40A 3SZGA 3IAS1 3VPAA 5BORA 3ZV6A 2W70A 5KBYA 4AUKA 3IO3A 2R8PA 1SGWA 1XPJA 1YNOA 1TZBA 4N12A 4ALNA 1BA2A 4H08A 1PL6A 4IFBA 1F4LA 1RKBA 1TZCA 1T2AA 1VFPA 4RGBA 5JS1A 2R6DA 4R51A 1IHPA 2ZYHA 3V4VB 4M9UA 4DZRA 3E7XA 5J23A 5AHRA 3BDAA 4IQ8A 4L51A 4XWYA 2BM8A 1TECE 2AF4C 1DC8A 1SEPA 3G0GA 3K9CA 2YJNA 3K1JA 1WVGA 2NNLD 3CKMA 3KLPX 4KHZA 4M8KA 4D9IA 3IE1A 3LAWA 2YV3A 3CR8A 3EHEA 3U3RA 6Q21A 3KOWA 4Z7JA 1FXUA 5JJLA 2PXHA 2FPPA 4ZQEA 4Q7QA 2DBYA 4C1BA 1Q6YA 4ZOLF 2KX7A 1EA7A 3KQMA 4PYNA 3VJLA 3WDSA 1HO3A 1FNDA 2GTPA 2ZI9A 4JR0A 3OCUA 4FEAA 3SZRA 3HJNA 3MBKA 4XLTA 4PPYA 3AY7A 3D4PA 4ERNA 1WDKA 1WEKA 3HI6A 1G60A 1X8JA 3I1FA 4ZQFA 1IIBA 4PRLA 1I3CA 3FUTA 2GX6A 3AVPA 3G5MA 5JYCA 4K9NA 4FSDA 2FK7A 4MI3A 2YH2A 1MB0A 1KJIA 1KI6B 2C5AA 1S2NA 5LWHA 1E59A 3H5NA 3NAMA 5CB6A 2NV2B 1G3IA 4G3XA 3GVCA 4K8RB 5BRJA 3L4EA 3QJ5A 4BU0A 2BUBA 4CQMB 2PFSA 1EGMB 3H0EA 4FW9A 3HABA 4Y2PA 2N47A 3A1WA 3G2LA 3G2HA 3M83A 3QIVA 4R0NA 1IG0A 5KNCH 5JO0A 5EAIA 4DV1B 1FSPA 1YJ8A 4HFNA 1G5PA 5CIWA 5HIJA 2G04A 3I34X 1K8RA 5C7IO 3WA7A 2DSTA 2PJUA 2BFFA 3L7KA 4IUDS 4Q15A 1G2PA 3SQLA 4FS8A 3VKGA 2P6UA 5ICGA 4MUMA 2Q28A 2CMDA 2B1RA 3FRHA 5IJAA 5EQFA 4BNHA 2QN9A 5BSWA 1WCXA 2DR2A 5LDDC 2ZIVB 2OB1A 4M8IA 4MW6A 3V48A 5ALPA 5HKKA 5C35A 5DDIP 2ZCJA 1R74A 4GKAA 5IVIA 2NYVA 2FLKA 3VC2A 4ESEA 1COZA 4QUEA 4XYBA 3KKOA 5DEIA 2OWDA 1D6JA 1I3OA 3DL2A 4O63O 5LPNA 2WABA 4KACA 3NIDB 3O1HB 1BWSA 5K3EA 4FUTA 4XGKA 1E1KA 2X5OA 4ND3A 1L8XA 2A1UA 1R1DA 4IW3B 4HB4A 4AJ1A 3CVWA 2C95A 2G9UA 2RK4A 3VUEA 4X6UA 1IONA 2GZHA 3FCEA 3QKUA 3RFXA 4B3JA 3LX4A 2XKJE 4MV4A 5JAPA 1RPAA 4EY4A 5F64A 4NJMB 5JVDB 3FOBA 1N9KA 4AG5A 4IXTA 1AB5A 5LXTF 1KDOA 3C6MA 4DDUA 1R6XA 1N34B 3KFVA 4HFRA 3ZK8A 4ZYTA 2CLDX 2CNBA 4AROA 3ESCA 1IN1A 4BTLA 4GOJA 4IIXA 1Z2AA 3FNIA 4MW1A 1DAMA 3KJHA 1KGSA 1TRHA 2FSGA 1BS1A 4YXFA 1ZEJA 5I3ZA 1I2AA 2O7NA 3BQMB 1BDHA 2QRZA 1R4MA 4EG4A 3MGAA 2QP3A 4MRSA 4BB0A 3FRIA 1I0LA 3Q12A 4KR0A 4BRWA 2A9OA 4Q19A 5ALQA 3RADC 4E4YA 2JFWA 4KTVE 1PEKE 2R6FA 2IZOA 3CX6A 2LGJA 4H60A 5DTEA 5BN1A 2IOYA 1XEXB 2R5NA 1QIHA 1TF7A 3ABRB 5CM8B 5LBIA 1WF6A 3NORA 1K98A 1XK7A 4TLMB 2C2WA 5IDWA 2B98A 2GWHA 2HD4A 3DBOB 2QDXA 1ZJ5A 1JHOA 1ND6A 3T1OA 3ZU6A 2BH2A 2HXSA 5T41A 3HWSA 4JLWA 1EDOA 4L9SA 2JLUA 1SY7A 3P9SA 3RHTA 5CAEB 4HZGA 5FWXA 1CUSA 3EC2A 1PW5A 5BPFA 1HNXB 2CDBA 1WOYA 2BJVA 4Q1CA 4BLTA 3LV8A 2EX0A 2O8DA 1G9SA 1ZJWA 2NUTB 4OI1A 2WPNA 4KVZA 5I6DA 2E4YA 5AICA 3TTXA 2ZYRA 3PUHA 2WOOA 4NFYA 4LV5B 3KPWA 1C8VB 4PCVA 2FUEA 3SHOA 5BUZA 2BJHA 5B53A 1YZVA 2PT5A 1UIRA 3LY5A 5JWRA 2GPBA 4AZWA 1JFSA 1R66A 2NU8B 1KO7A 1XCGB 1R4ZA 3LNTA 4U0JA 5DGCA 4DUYB 6NULA 3DV0B 1R18A 5EC8A 3EAFA 2XGJA 4PSVA 1NONA 1IOLA 2QJFA 4NYMR 4EA7A 1YL5A 2VT6A 4AZ0A 1RJDA 1J9GA 4TLEA 4ZIRA 5KHOC 3FX2A 4P92A 1O54A 4DV0B 3VNUA 4R2LA 2EW1A 3N1UA 3GR6A 3AF3A 3B1KA 3OQVA 2FMHA 3EN0A 1C7FA 3AM1A 1UP4A 3SI7A 1I7PA 2V74B 5TT1A 1T4BA 4OLFA 2G8LA 3IKLA 2AVDA 3R2JA 2X14A 4BNIA 1M8KA 4RTSA 3KELA 5IAAA 1Q16A 4IR7A 4X60A 1RC8A 2VPZA 2CDCA 3VPDA 2X86A 1GNVA 1Z7BA 1ORTA 2RGNC 1PT8A 1X8KA 1Z4NA 2O6LA 3EDMA 4WAUA 3UXYA 2XADA 2Q7XA 4NOKA 1EJ6A 4Y9TA 4GH5A 3NJRA 2QU7A 2SHKA 3EXEB 3RIGA 1K8YB 5F5LA 2N1MA 1XOIA 1PCXA 3HKCA 5IHPA 4ZDIA 5JRZA 3R5SA 1C9DB 2AFIA 4G6ZA 1IQUA 3CYFA 4Z8XA 1Q19A 3KQWA 4IDEA 4QU8A 4ZVLA 3ZW8A 2D3TA 2ID4A 1ADFA 4L5BA 2IKSA 3NRCA 3UK0A 1YZHA 3SDBA 2BCJQ 4CMEA 2V5VA 2NO5A 5EJ6A 3LOQA 3PPIA 2LPMA 2AD5A 4XJTA 3K53A 1T6NA 3ABIA 1N2IA 1N2SA 2F3SA 5BXQC 1BH6A 3OH8A 4PXSA 1JT2A 4UZFA 2BJWA 4LX0A 3G17A 1KZ7B 3FOAA 2D2VA 1VE1A 2JIRA 3GJQA 3P26A 4A8TA 1I4DD 4P81A 1RHQA 4CJXA 1JEQA 1Z28A 4JV5B 3UJPA 1I0IA 3P1JA 1VL1A 3OPYA 4QXPA 1KZ6A 3PFIA 1K8XB 1U5CA 3B9QA 1KDRA 5DGIA 3MQ4A 3TSZA 4N4AA 3G7UA 3LP5A 4UHDA 4PPFA 1G6OA 3RSSA 2F7SA 5DP2A 4RZXA 3B85A 1KBQA 2CJWA 3HBAA 5L6LB 2I76A 1X0XA 5GZ6A 2WWIA 1P1FA 3F97A 2Y66A 4REQA 2J3HA 2QM0A 1FYVA 2HKIA 1RWKA 4J76A 1EXDA 1D4OA 2EZUA 1TW3A 1TXGA 5UKDA 3WRWA 2R11A 3KDAA 1I1OA 3EXFA 3T7JA 3M5CA 1T8WA 4O2AA 2PUFA 3K0BA 3CLTD 2J5QA 3OUUA 5D51S 1KR5A 5GJWC 2O52A 3CJTA 4CTKA 1IUPA 1ZHHA 4YHHB 1NW3A 2C4MA 3RGGA 3PUWA 4C2AA 3CN7A 4AYXA 2JFUA 4H0NA 3GHYA 3LZ6A 1QG2A 4I4TA 3OZBA 4B3IA 4JP3A 1GPYA 4IBOA 3VR6H 3AHFA 4D3SA 5LDHA 1UH5A 3V46A 1QV9A 1P2DA 3BG5A 1A8HA 1MVOA 2VQFB 1WR8A 3GRVA 1X7HA 1EJBA 1HXHA 1UT8A 1M1YA 3BDIA 4P7GA 4ERXA 1NPTO 2CHQA 3AM3A 4IILA 3K7EA 5SYNA 3A8TA 3PLRA 4F84A 3FYHA 4AKIA 3DQPA 4GGOA 3VC1A 1NP3A 4L7VA 4NHEA 1FY2A 2PZAA 4GGPA 5J2TA 3EVNA 2Q4OA 4RMJA 5FHRA 4DJFC 2PKEA 4XB6B 2O50A 1NNSA 5JCPA 5AKJA 1S8OA 4LJLA 2EP8A 3RUAA 1CUCA 1XNGA 4OH1A 2JFHA 4CHTA 2IWRA 2C20A 3C8ZA 3QYPA 1WXGA 3RNLA 4HAZA 1O87A 2EC5A 1VJDA 5ELLA 1KR2A 3VR3D 1QIKA 3DNPA 5FA8A 1UXKA 3NMUF 3FNEA 2JLVA 3HLYA 2FF7A 2X13A 2Y1DA 3DDNA 4RBNA 4DY6A 3A3YA 1POWA 4INZA 1CZOA 1OLUB 4G8JA 3ZNOA 4TS9A 4CKBA 3U4CA 5KYGA 3QU5A 3QX8A 3O8CA 1X7XB 1OH5A 3I05A 4MAFA 1LRKA 1UQUA 1NMZA 10MHA 1VJ1A 4KDEA 1QRUA 3F5QA 1G4UR 5KWVA 2VHVA 3QVJA 4AF8A 1GNQA 3GVHA 1FDOA 3UZUA 4B34A 2PDAA 4R9VA 1AZWA 2CHVA 4M8NE 5AHXA 3HRHA 1FFSA 4PSKA 2AMYA 4EVIA 3IKTA 1U3WA 1UC5B 4WKPA 4LFBB 4WZ6A 1ODKA 2AR9A 4B3DA 3L3BA 3L8DA 2V45A 3R0XA 4N65A 1R50A 3ZCTA 3P0RA 4HB2A 3X43A 4AS3A 5KEIA 4DLYA 4GEKA 3EGOA 1L3BA 3HFRA 5EMHA 2VT2A 4NP6A 5D85A 3C1OA 4UHJA 5IKOA 4FX5A 4L6AA 3TDNA 2Q5FA 2ZI6A 3F5SA 3CS3A