4UFOA

Laboratory evolved variant r-c1b1d33e6 of potato epoxide hydrolase steh1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
321
structure length
321
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIALNEEKVFVVAHDLGAYIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNKVEGLKAIYGEDHYVSRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPLYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDGVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EPOXIDE HYDROLASE
publication title Laboratory Evolved Enzymes Provide Snapshots of the Development of Enantioconvergence in Enzyme-Catalyzed Epoxide Hydrolysis.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 118
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ufoA00
2ZJFA 5HKAA 3BDVA 3H18A 4FLFA 3FWHA 1Q84A 3WJ2A 4M0MA 4AN1A 2EDAA 4FOLA 4LIPD 4S0XA 4IH1A 5EGNA 2X76A 4ZWNA 4QDZA 3WZMA 3WJ1A 4Q3KA 1XZAA 1F0PA 3KWFA 5K3DA 1Z68A 3D2CA 3A2LA 3K2IA 1L7RA 4MEAA 1JKMA 2WFMA 3C5VA 4LHEA 2GYVA 4BRZA 3ICVA 1EK2A 4B85A 2FJ0A 4P92A 2Z8XA 2XUJA 5HK9A 3KWJA 1XQWA 3WMRA 5EIEA 2XUHA 5FKJA 5T4EA 3G9TA 5BV7A 4JYPA 2GBCA 1EDBA 4ZRDA 3VJMA 3FNBA 2XI4A 2DFPA 3R3VA 2QJWA 3LIPA 2OAGA 4GW3A 3LCRA 3LLCA 4FFWA 2WUGA 1SCKA 5A2GA 5AM4A 1LPSA 4K6HA 3RLIA 1R4ZA 3D0KA 5ALVA 1XLUA 2JGKA 2HU8A 5IVDA 2WJ4A 2XUOA 5CT6A 2QUAA 4EY4A 2C0PA 3QYJA 3HZOA 2CB9A 3HEAA 5HFAA 4W63A 2Z5GA 1K5PA 3OTQA 2C4HA 3L1JA 2JIDA 2PKYX 4HVTA 3WL6A 1JJBA 2ORYA 4LXGA 3HABA 5HK8A 1S8OA 1BROA 3QZUA 4QDTA 2ZVDA 3ESCA 1BCRA 3GROA 3I2IA 4HXFB 4F5ZA 2B20A 3BXPA 1USWA 2CMFA 1WHTA 3VJLA 3I2GA 4A23A 4FMPA 1WOMA 5A62A 5KREA 2VQ6A 5DNUA 4HAIA 2I03A 2D0DA 2YXPX 5K3EA 4AZ0A 3C6BA 4Q1VA 4N5IX 5K3FB 3WWCA 3H04A 2ES4A 2GBGA 2PSFA 4J7AA 1TK3A 1TRHA 1EX9A 4Y2SA 4UBNA 4MWTA 5D3KA 2QMQA 4L9AA 1AZWA 2HU7A 4LYDA 3DOIA 1JU3A 4EA6A 3ZPXA 1E8NA 4B82A 2QTBA 4OB8A 3WK7A 2HA7A 1T4MA 4M0FA 2HFJA 1UKCA 1WHSA 2GBIA 2ACEA 2RIPA 4P9NA 4HXEB 4WDRA 3L1HA 4ETWA 5AKXA 4F21A 3GUUA 5D3ZA 4EZIA 1TCCA 1XZLA 2OAEA 3TEJA 3SK0A 5AHXA 4W1PA 1ZI6A 1QJ4A 2G63A 5ALGA 4B81A 1P0PA 2ZYSA 3SWWA 4OB7A 5A7FA 2WG1A 3BWXA 2FJPA 4ZXFA 5DTIA 3M3DA 2ZSHA 5JZBA 3HYSA 5CT5A 1O6FA 4XJVA 4B0PA 4FWBA 1QIMA 5ALRA 1CUEA 5ALQA 2Z8ZA 4IO0A 5IH7A 2PM8A 3D4LA 3WZLA 4CFSA 4GXNA 3KDAA 2JGIA 3ZI7A 4GI1A 4OYYA 2XUFA 3AJAA 1MNAA 4OUKX 1CUGA 5CH8A 3C70A 3FCYA 1XZDA 4X3CA 4H77A 2JEZA 1GGVA 5SYMA 3K6KA 5C81A 3AFIA 1BN6A 2AJ8A 4Y2YA 1VE7A 2HRQA 3STUA 3UUEA 3AIKA 1WB6A 1MX5A 2R11A 4DSAA 3AINA 2XLCA 5LLSA 2H7YA 1DU4A 2DHEA 1SOMA 1ZIXA 2O2HA 2XUKA 1BU8A 4UHEA 3ESDA 5ALHA 4AO8A 1XKTA 2WHPB 5HZGA 2CKMA 4NMWA 1W6RA 2RI6A 3W06A 3T52A 1CRLA 3YASA 5JD6A 4X71A 3STWA 5K3CA 4BB0A 5FUMA 2ECFA 4RNCA 2WSLA 2ONCA 4H18A 5BWBA 1XRPA 2XT0A 5JATA 3C5WP 5LZ2A 3S8YA 2HA6A 3CCBA 3DKRA 2XMSA 2GYUA 4X6XA 1QGED 5AH0A 1EDEA 1AKNA 4JH0A 3STVA 1WCYA 1XLWA 3KSRA 5HFNA 3IIIA 4UBMA 2D5LA 4J0HA 4DM7A 3R41A 2XB6A 5FRDA 1OXMA 1HQDA 2XMCA 2ROQA 4BVLA 1R88A 2WIKA 3I28A 3R3UA 2JEYA 4B7ZA 5LZ9A 4FNMA 3VJKA 1N5MA 2JGJA 5ISMA 1AURA 4YASA 1XRMA 5AKIA 5FPQA 5CMLA 1WPXA 5JARA 2VJCA 1R9MA 3F98A 5CURA 1VLQA 4QA9A 1ZI8A 2HL6A 2BAGA 2WHPA 4X91A 2Y2UA 3WWEA 2BFNA 1LPMA 3PE6A 3WK5A 2P8SA 1ZJ5A 3H2HA 4AZ3A 4EY7A 1ODSA 3FYUC 3VDXA 4A5SA 4PF1A 3ZV7A 3IUJA 4FTWA 1XQVA 4J0GA 2PBLA 1ORWA 2PSDA 4BTLA 1YAHA 2XQIA 2HDWA 2HA5A 1XLVA 4C4YA 3FOBA 2WKWA 5HQ3B 1EVQA 4GEGA 5A7HA 3PI6A 4C89A 3MUNA 4Y2PA 5EHNA 1XKLA 2O2GA 1QIKA 3NOXA 1MPXA 4J0KA 2J4FA 5EIAA 3L1IA 4QLAA 1VJ5A 3QMMA 3EIOA 3ZLUA 5AOBA 4HXGA 3UUFA 1VA5A 4N8DA 3ESAA 1G5FA 2V96A 1TCBA 3U1TA 3O4JA 4FBLA 5FLKA 3H1AA 5T4HA 5C8VA 1CUJA 1PV1A 1DWQA 2K2QB 3R0VA 4KAJA 2LIPA 1CUWA 3HRHA 1TQHA 3QMWA 4OCZA 1L7QA 1B41A 2PUJA 1HDEA 2OCGA 3DEAA 2EEPA 2BUBA 3AZPA 4D9JA 3B5EA 5CTAA 1JT2A 1AQLA 1NU6A 2OLEA 1K4YA 3F67A 3MVEA 2JGMA 4C4XA 4UFPA 1H2WA 5EHZA 2WIJA 4QLOA 4G1FA 2RHWA 5LZ7A 2WFZA 3AUKA 4CCYB 2OQIA 4BCBA 2Z3ZA 1GZ7A 1UOOA 1C7IA 4C6HA 1NU8A 4X90A 3LS2A 4CG2A 1QFSA 3C6YA 5FOQA 3I1YA 4H7KA 4DGQA 4G4JA 3STYA 4Q3LA 1AGYA 1ZGBA 2CZQA 2ACKA 1P0IA 1QTIA 2WLSA 1LPPA 1CUXA 1DINA 3FAKA 4GBGA 4WFIA 5CH3A 3GA7A 1QO9A 1W52X 4CCWA 5CXUA 5JD4A 4BCDA 3ED1A 3HACA 1U8EA 3TJMA 1E5TA 1GQSA 1WPRA 3PFCA 1XQYA 1ZICA 2HRRA 5AM3A 4J0CA 5ALYA 3STTA 3AZOA 1CFJA 2XDWA 2OGTA 2PU7A 5LKAA 5KBYA 3C6ZA 1CUUA 3SC2A 5C8ZA 3EQ9A 5DWDA 5I9IA 4PV7A 4PSUA 1QIDA 1R9NA 4BTVA 1X2EA 5AK5A 1E89A 4KRYA 5SYNA 1Y7HA 3U0VA 4OU5A 4HRYA 3STXA 5CXXA 4YPVA 4CCYA 2CJPA 4CIAA 2WFLB 4O08A 2VA9A 1MTZA 2DR0A 3V1MA 4J03A 5ALPA 2WIDA 4AMZA 4KYVA 4G5XA 3G9XA 4N8SA 1XZHA 4BAUA 1JMYA 4CIBA 1CV2A 1JU4A 3G7NA 2IITA 3H19A 4BC1A 5CBKA 1GQRA 1CUBA 3M83A 5EFZA 3OURA 4EB0A 1UK8A 3B12A 1U2EA 1QZ3A 4IQ4A 3JWEA 2B4KA 1GKLA 1QIGA 4QEKA 1LLFA 3NWOA 5AI9A 2AXEA 1N8SA 3D2BA 1XZFA 4NZZA 5AI6A 4MWSA 2H7XA 1HPLA 2QJRA 4CG3A 1JJFA 2GYWA 1FJ2A 3QITA 1N1MA 3FYTA 4C87A 3O95A 5HCUA 2VJBA 2V97A 1CUFA 2PUHA 3P2MA 4FFVA 1QIEA 2PSEA 5EHQA 1QONA 4BRSA 3DYVA 5E4YA 3FBWA 1XRLA 5AKKA 2DSNA 4OPMA 2XUAA 4H7JA 3IURA 3TRDA 3O4HA 2DCMA 1YCDA 2AJCA 2I78A 4AX4A 5C7YA 1UFOA 1G4HA 4QDXA 2WFLA 3WK4A 4AO6A 2ZJ6A 1ZJ4A 1EXWA 3G0GA 2XMZA 1DT5A 4W9RA 1R1DA 4ZREA 5JAUA 2FX5A 4QDUA 3R3WA 1XZMA 1LPOA 4TPKA 4G4IA 1ZD2P 3CN7A 3WWPA 1LBSA 4I3FA 4KAAA 2H1IA 3VKFA 5T4BA 1UOQA 1K63A 3O4GA 4QWMA 2WG0A 3DKKA 4MJ3A 4DLNA 3ESBA 2C0QA 3LP5A 2XUQA 2XUDA 4L72A 4J3JA 1F0NA 5C8XA 2WUEA 3V48A 1ODTC 1UK9A 3C87A 2O2IA 2Y6VA 3FVTA 3O9MA 3HSSA 4G8DA 4EY8A 5LZ4A 4MEBA 4W1SA 5F4ZA 3DD5A 3V1NA 5I7UA 2VAXA 5AICA 1U4NA 4B9EA 1E8MA 1OILA 2HA2A 3FVRA 2WHQA 3DS8A 2PU5A 2E3JA 3QVMA 1FFCA 4XWGA 2AJDA 4BBZA 3B3QA 1DQYA 3G02A 2Y6UA 4X7BA 1K8QA 1TCAA 1MNQA 2YYSA 3E3AA 4UHBA 4E14A 1CUVA 2HADA 4NVRA 4RE5A 2WTMA 2XQFA 5AP9A 5ALLA 4B9AA 1YAJA 4L3WA 1R50A 5K3FA 1KU0A 4B84A 3VISA 2QUBA 5IVHA 1QIHA 1EA5A 5ALDA 4BAZA 3H17A 4X97A 2QRUA 1EB8A 3IUMA 1JFRA 2OGZA 3G0DA 2QKYA 1CUAA 1BEZA 1P0MA 3KOOA 5CH5A 1WM1A 1ZD3A 5DJ5A 3D3NA 4K5QA 5DYTA 4BP8A 3WKDA 5EI5A 4G8BA 5CW2A 3IBTA 2Z3WA 2C5FA 3BDIA 1QO7A 4X95A 5CRIA 1EDDA 1LPBB 3DL7A 1L7AA 4PSDA 4EBBA 2BJHA 2DQYA 1DX4A 2YASA 1ETHA 3I6YA 3D7RA 5LYYA 1K6EA 1NX9A 1CIJA 3F97A 4MQMA 3O0DA 5IVIA 3H1BA 4BZWA 1UKBA 2XUIA 2XMBA 2ZYRA 4FHZA 5DLPA 1P0QA 4FLEA 5FDFA 3KD2A 1DWPA 1GPLA 4Q05A 5EHXA 2PSJA 5A71A 2CBGA 2J3QA 1UK7A 2O7RA 1RWQA 1DX6A 3FSGD 1WB5A 3WK8A 3A2NA 1XRNA 3BE8A 1VOTA 4EHBA 3W9UA 1X2BA 1JMKC 3E0XA 3ILSA 2QR5A 3IULA 3QPDA 4Y2VA 3I6ZA 2Y2VA 4Y2XA 2GZRA 2XUGA 3DDUA 1UOPA 2OCKA 1DQZA 2X5XA 5JIBA 3R3XA 3RK4A 4EUSA 5DNWA 3I2JA 3CCCA 1KU6A 3RM3A 2XLBA 4FNGA 5HF5A 4JNCA 3EQ7A 3EQ8A 3WKEA 4K6KA 2H9YA 5ALKA 5AK6A 1LBTA 6YASA 3DOHA 4E15A 2G5PA 5BWCA 3QPAA 1YR2A 4DMHA 1N5RA 3DNMA 5ALEA 4UFOA 4Q82A 4DMFA 1U65A 1D07A 2FUKA 3QPCA 1A8QA 4TVKA 3OC0A 2AJLI 4BCCA 5D6OA 1ACLA 2RAUA 3DL4A 3FYUB 2VT7A 5AKLA 4Y9SA 5AM2A 2QXUA 1F8UA 2GBFA 4H7DA 1IUNA 4KRXA 4C01A 4AN0A 3G0CA 1GT6A 3C8DA 4MXDA 2VF2A 4U2FA 2Y1KA 4GWLA 3CN9A 2JBWA 4ZI5A 4OYLA 5LKRA 3C43A 3SX4A 1QFMA 3N0TA 1QLWA 1YA4A 4E46A 2WJ6A 5AI5A 1A8UA 5AM1A 4QZVA 2XMRA 4BVKA 2ZYHA 4U2CA 2XUPA 1UXOA 2G4LA 1I6WA 4H35A 4Y2UA 1BRTA 2VT6A 4X92A 4WY5A 4BDTA 4U2GA 3ANSA 4PO3X 1BN7A 4G8CA 4UBOA 1ODCA 5DNVA 4DNFA 1H2YA 2WIFA 4RPCA 2RGUA 1FFAA 3ZLTA 1VZ3A 3ANTA 4XIIA 2XMQA 4HS9A 3OOSA 5K3AA 2QZPA 5JD5A 3BIWA 3BIXA 3D59A 2UZ0A 4DNPA 5HQ3A 3RKSA 5ALNA 5AM0A 2VJAA 3VXKA 3BF8A 3A2MA 4DTCA 3FLBA 4H7HA 1UKAA 2VSQA 2WM2A 3D5EA 1ZIYA 3EF3A 1VE6A 1EH5A 4B80A 3GELA 3OG9A 4HZGA 3PF8A 4J0JA 3W05A 2J4CA 1W1IA 4PSCA 2O7VA 2CEKA 3QMVA 2OGSA 1FSSA 3GFFA 4U2BA 2OQVA 4DMKA 2HFKA 5JYCA 1A8SA 1BS9A 1AC5A 4P93A 4KJXA 1LZLA 4WFKA 4J0IA 1ZD5A 4GLBA 1THTA 4FBMA 4H7FA 2OPHA 4EY6A 3WK6A 2BUCA 5JZSA 3HXKA 3F8SA 5AKJA 2R8BA 3MUOA 3JW8A 4N8EA 4Z49A 1JJIA 1UZAA 2WILA 2VJDA 3R3ZA 1YSCA 1HLGA 2VEOA 1W75A 1TIBA 1QIIA 5K3BA 5JASA 1E3QA 4BVJA 5ALIA 4WDQA 2JF0A 1A88A 5JAHA 2DHDA 2AJBA 1MN6A 2B61A 2I3ZA 2WHRA 1XZBA 1XZIA 1CUDA 4G9GA 4X93A 5ALJA 1YA8A 1H23A 4GDMA 3R40A 1PJAA 4L0CA 1EI9A 2W6CX 1YB7A 4DIUA 4A16A 1IUOA 4BC0A 2C5GA 1UT6A 2BGNA 3TGLA 2WJ3A 4I4CA 4WY8A 1ZGCA 3C6XA 4IH9A 1MAAA 2WUDA 2NW6A 3QBJA 1RP1A 2X8BA 1ORVA 1HL7A 2WQZA 2PL5A 1UWCA 3M81A 1KEZA 4UUQA 1GKKA 1MX9A 1LNSA 4K6GA 2CUTA 2HHAA 1QIJA 2BUAA 3WI7A 5AIAA 2DQZA 3WIOA 4QE3A 4FLMA 3EBLA 1H22A 3HC7A 5ESRA 1VXRA 3GZJA 5ALXA 4KR0A 2IX9A 1J2EA 2WU3A 3DCNA 4LYEA 2QVBA 5AIBA 4Y2JA 4DSZA 5AM5A 4K2AA 1X70A 3WL7A 2I3DA 5AKYA 1M33A 1F6WA 5HF9A 3Q0TA 1LPAB 3D2AA 3H2IA 1VZ2A 4AB1A 5AJHA 4INZA 1DT3A 1IZ8A 4E11A 3N2ZB 2BKLA 4BATA 3QH4A 3IVMA 1IVYA 3WA7A 5AOCA 5JAPA 1CUIA 4UHFA 1CUSA 2Q0XA 3H2JA 3KXPA 1LPNA 4Y2QA 4I19A 1CLEA 4LXIA 4ROTA 3I2KA 4TGLA 2H7CA 1YB6A 4WCVA 3RARA 2JGLA 1MX1A 1ZOIA 1SFRA 4X94A 1T2NA 3WA6A 4ZV9A 2WUFA 1YS1X 3FSGA 1XQXA 5DYWA 3WKBA 1BE0A 4KAFA 3WK9A 3E1GA 4G9EA 2QOEA 4XVCA 4Q34A 4B83A 4F60A 4FDMA 1ZD4A 3LIIA 2QXTA 1XZGA 3AILA 4OD0A 4N5HX 1W76A 2WG2A 1CQWA 2OXEA 1GXSA 5CT9A 1CVLA 3WYDA 4UFNA 1XRQA 3HI4A 4BP9A 3NGMA 1WB4A 1MJ5A 3C8HA 1FFEA 4XX1A 2HA0A 3BJRA 4X6YA 4RE6A 4HTAA 1B6GA 3WLAA 5T4FA 1O6GA 3X3HA 5HKBA 1CQZA 3V1LA 4U2EA 4DYHA 4H0CA 5KWIA 4V2IA 3IUQA 4ZV7A 2ZYIA 1J07A 5HF6A 4BDSA 1E8DA 1EB9A 4JYMA 1YS2X 5ALUA 2QM0A 1OCEA 2IIVA 2HU5A 4UHHA 5ALWA 5K5EA 4W1QA 5LIPA 3Q8WA 5AI0A 3H2KA 4B0OA 4GHWA 1EINA 4Y2TA 4BE9A 4M0EA 3I2HA 3G8YA 3HJUA 4UBLA 4MYDA 4YK7A 1J06A 4PNZA 4QDOA 5LP1A 4PQEA 5ALFA 5FP0A 1AUOA 2DHCA 5AK3A 3S2ZA 2PVSA 2PPLA 1DTEA 3WIBA 2PSHA 3MGAA 1BEEA 5HF8A 1XRRA 3PF9A 5EIHA 1GPNA 4UHDA 1AMNA 4FKBA 4DNQA 2HA3A 3OM8A 3O9VA 1RYYA 3VVMA 2XE4A 1E66A 4P08A 3WL5A 2VTVA 1G66A 1Y37A 1VA4A 4BAGA 5A6VA 1XZEA 5E2IA 4PW0A 1CEXA 3FCXA 2BGRA 3O4IA 4KE7A 1W4LA 5ALOA 5AOAA 4H7EA 5AI8A 1C7JA 5AK4A 1VXOA 3NUZA 5YASA 1CUCA 3DQZA 3PDCA 3G0BA 5E4JA 3OPMA 2XMGA 3ZWQA 5AKGA 5CT4A 1VKHA 1Y7IA 4OSEA 4AO7A 4KE8A 1MAHA 5AKZA 3VVLA 5AKHA 4LXHA 3F9CA 2G5TA 1A7UA 2JGFA 4QNNA 1SCQA 3FLEA 1QOZA 4RGYA 3H0CA 4KEAA 3AZQA 2ZSIA 3BF7A 4IH4A 3I6MA 1EVEA 5JZ9A 1ISPA 5D7BA 1GPKA 4C88A 4UPDA 4UBIA 4U2DA 5JAOA 1TAHA 4W1RA 3WKCA 3WQHA 4F0JA 2PX6A 3A6ZA 3I1IA 1ZI9A 4BE4A 1H2XA 1SCIA 2OG1A 5A7GA 5JADA 3HLKA 5LZ8A 3A70A 4KACA 2C58A 1ACJA 1CUHA 4CI9A 1R3DA 5ALZA 2RONA 3H2GA 3W9BA 5J3JA 3IB3A 4JUIA 1XZCA 1IUPA 1CUYA 1Q0RA 2HM7A 2QT9A 3PUHA 2QS9A 2HA4A 2WTNA 5KWJA 3W04A 4QWWA 4ZGBA 3DLTA 1MT3A 5CT8A 4Y2RA 1QTRA 5IVKA 4DMCA 3UMJA 1PFQA 1CUZA 4ARAA 4AQDA 5FXMA 4WJLA 4KE6A 3PUIA 5IKXA 3DJYA 2XQJA 5BOVA 4UBJA 1CR6A 3WWDA 3M82A 1G42A 1HBJA 4NS4A 2JGEA 4DNOA 4H7IA 1XROA 4AMYA 1Q83A 2ZJ7A 2EDCA 1LGYA 5H3HA 5ALMA 5FPPA 4JEIA 4J0DA 3IUNA 4GECA 1CPYA 1TKRA 2V98A 5ALTA 5JANA 3CXUA 3I2FA 5DYYA 1SC9A 4ITVA 1QE3A 2YH2A 2XMDA 2GZSA 3PICA 2J3DA 3ICWA 1MU0A 3T4UA 1JI3A 5E4TA 1FFDA 5LZ5A 1DWOA 1C4XA 1EK1A 1IMJA 2HIHA 1XFDA 1XZJA 3PFBA 4X85A 3W2TA 2OCIA 4ARBA 2W22A 3E4DA 4BYMA 2VAVA 3FYUA 4IHAA 4X00A 2WIGA 5JALA 1THGA 4AXBA 4BZZA 3DYIA 4G4GA 4B6GA 3WWOA 4UHCA 4OU4A 4KE9A 3G9UA 1UK6A 2B9VA 4Q3OA 3IDAA 5AKEA 5DTJA 1Q0ZA 3WL8A 2WU4A 2OCLA 4MQLA 4HRXA 4EY5A 1LZKA 5I8PA 4Y7DA 3BJMA 3QM1A 4CG1A 3F96A 4OB6A 3JYHA 3ZLVA 1J1IA 1YASA 2XQKA 2V9ZA 5ALSA 4C4ZA 4MYSA 3R3YA 3IA2A 3AIOA 1AX9A 3FLAA 3BL8A 5FV4A 1HKHA 2BCEA 1H2ZA 7YASA 1QIFA 4LKOA 3C45A 4YX9A 1EHYA 4WFJA 3V1KA 3AIMA 1BCSA 4UBKA 3WYNA 3GBSA 3K9BA 5AO9A 2XQGA 4X6UA 3WKAA 1XZKA 3G9ZA 1MO2A 1IZ7A 3V9AA 2RHTA 3G0IA 5AI4A 1FFBA 2C7BA 2VATA
chains in the Genus database with same CATH superfamily
2ZJFA 3PNPA 4JLOA 3ZCTA 4JVMA 2ZG6A 1X87A 5BYBA 2GVDC 4F7DA 4ZCSA 4L8WB 3H18A 3FWHA 1W0KD 5K8VA 4RMNA 5TPZD 5I5EA 4LVNA 1Q84A 3WJ2A 3DZGA 5J40A 4B35A 4G0UA 3JQQA 2WAXA 1O97D 2OZLA 4IS2A 4K7JA 5K1ZA 1ZMRA 1A9XB 2CFIA 1EFRA 4KTTE 1US8A 3W5CA 1BTOA 2A1UA 4L6CA 4F5DA 5F3DA 1K5HA 5T41A 4MOWA 4N5LA 1GDDA 4Q9LA 1VRVA 4RJLA 3EAGA 3ONNA 5BXYA 1ABEA 4L22A 4NJOA 3RRFA 3KWFA 3H2SA 1RACA 4MP3A 1ZGZA 1ZGAA 3UTCA 4MTLA 3GUVA 3I62A 5E7QA 3ZG6A 5CFQA 4R31A 4ZVUA 1RLOA 4AJHA 1BDIA 1XN1A 2BTQA 5JCOA 1NQWA 4F96A 4Q03A 2W6QA 1NPDA 2ATXA 3TNYA 4QUBA 1M2WA 2IYAA 1P8AA 4P3XA 4JI1B 3W7BA 1H2FA 1JKMA 1SNYA 2IQ5A 3E81A 5TQ0A 1C2TA 4ZIRA 3ZX4A 5K0NA 3GFOA 3HGMA 1D5CA 2A0UA 1AB5A 3RJMA 2CUZA 3RFCA 3BTOA 1KY2A 3AW9A 5CHEA 1VJTA 1WZNA 2O3UA 3WLKX 5HK9A 1N92A 3KWJA 2QMZA 1HE3A 4QGSA 1WD7A 4HGRA 5EIEA 4K46A 5EJAA 2H65A 4LZZA 2BM0A 1B3BA 1KVQA 3FCCA 3JD4A 2DKFA 1ORTA 1RWBA 2OQRA 2X7HA 3DXYA 4HFNA 5BV7A 4AZ0B 4JL5A 4GKKB 4HP8A 4QVGA 1JQAA 2GBCA 1A4XA 3OCXA 4ZRDA 5FFNA 5KDLA 3T9CA 4D79A 1TW3A 3OT5A 3OLCX 1Y5MA 1V8BA 1Y82A 1PG2A 2CL0X 4ALKA 4QYWA 2GK3A 4GU5A 2LIVA 2XI4A 3CZPA 1FC0A 3TX6A 2JI8A 3BFKA 4AWXA 3NWEA 4AJEA 3VZBA 2QJWA 4BBAA 3M4JA 5FJIA 3LCRA 1TMKA 1JEYA 3EBOA 4FFWA 1V3UA 3WLTA 1ULSA 1UBTS 3A3KA 2ZUVA 3DC7A 1JWAB 1RMQA 3SM9A 5KWVA 1PJTA 3OAAD 3TTVA 3OQNA 2PX5A 3EQ6A 4QARA 4R8RA 5A2GA 3G8DA 2LUOA 1NP3A 1LPSA 4DV7B 1E2QA 3CNOA 4MWCA 1R4ZA 3IQWA 3UJDA 1R4NB 4ME6A 3PL1A 4M7OA 3WOVA 2MCFA 4M1SA 1QAMA 4CE6A 3D0KA 4EG0A 5ALVA 1XLUA 1CEQA 2FYTA 3BC1A 1E6UA 3ZTWA 1EXNA 2JGKA 4FGWA 4PNPA 2GTPA 4YGXB 5DGIA 5TPWA 2Q3EA 4FYKA 1N9KA 1E9RA 4MIOA 2YFQA 2GZ3A 3DTVD 3G82C 3S70A 5ER6A 1Q11A 1WHSB 2CD7A 4RQBA 3O74A 4M1KA 4XR4A 1U2DC 3H9GA 4YAKA 2XRFA 3L8DA 1C7QA 4P98A 1OV4A 3ENVA 4ARIA 1HGXA 2JGNA 1I7DA 5EXDA 2MR5A 4O29A 1ZVQA 4W63A 3DPUA 5C5IA 4DR2B 1QX3A 3GGCA 2PUTA 3N8HA 3V8VA 2W2KB 3DE0X 1NAHA 1YDMA 2PKYX 3H42B 2CGEA 3ZD7A 4HVTA 3DJFA 4EPWA 1JJBA 4MHOA 4HWSA 1T9KA 3HKDB 5HK8A 5EJ8A 1GZDA 4NENB 1S4QA 2AMYA 2IZZA 4G1UC 1SKQA 1UQTA 2CNKA 4WV3A 3SC4A 5JS1A 4YJDA 2GVZC 3UMGA 1W85A 4QDTA 1VLLA 3HJCA 3ZZUA 4R8KA 5CBPB 4J2OA 3UJPA 1GTVA 1NATA 4ALJA 4PX9A 1NDQA 4NESA 3BCSA 4GWKA 4PQGA 5AT1A 1JV2B 4KWEA 1V96A 2B20A 3CRMA 3BXPA 1NBOA 1N6HA 1WHTA 2J8ZA 3G7SA 1E2IA 4O4HA 4CF4A 4F84A 4R84A 6NULA 3QUBA 4DZZA 5KREA 1R15A 4B40A 3KPWA 4BNXA 3QUTA 1JJVA 3GRZA 1E7SA 3N8KA 3DSRA 4NG5A 1KHHA 3LUPA 2P0YA 5DRTA 3C8UA 2E4XA 1GZVA 1XZ8A 3KX2A 2HJSA 2EBWA 4KQXA 4QJBA 1E6EA 1RPJA 2PLFA 2W2QA 5EGSA 4BKMA 4JYZA 5EZYA 2BRUC 2C03A 3WGVA 4CM8B 1G5HA 1QH8B 1E0KA 3L7DA 2AI3A 1YZGA 1PR5A 1ZITA 1O57A 3K8QA 1EVYA 3MHPA 3RC2A 3NX4A 3H04A 4K9MA 3OX4A 1SU8A 2ILVA 1JHAA 2F17A 5GY7A 3NWJA 4CM6A 4RPHA 3O8LA 4RD0A 4RVGA 5IXJA 1R7RA 4TMTA 1TK3A 2J0UB 3TE6A 4LTDA 1EX9A 1I14A 1U7ZA 5IBRA 1RBQA 3NHJA 4FS3A 4I1SA 5KO2A 2GJ8A 2XR1A 4B6JA 3EFOB 4MWTA 2DWUA 3AWIA 4E5YA 1EGVB 2XD9A 1ZU4A 3L8MA 2AV6A 2GEKA 3KTAA 5F78A 2CYCA 3FB4A 6Q21A 1UFQA 3LA8A 4FYYA 4KMMA 1F38A 4BGEA 1ATIA 1PT7A 2G83A 4L9AA 3C6MA 5DU2A 4LF5B 3LY7A 4YECA 2LCFA 3UHJA 2HU7A 4LYDA 4KX3A 1YDHA 4ZMSA 4YCJA 1NSTA 1O95D 5G0SA 4EA6A 1Y3IA 2I71A 4F2WA 3QBEA 1NF8A 2O3SA 3NPAA 1WY7A 4DLWA 4LJKA 4FHCA 3FBTA 3ADCA 1Q91A 2GHQA 2IA5A 5SY9A 2VS1A 4M0FA 3ZHCA 4V03A 1XVUA 3D6UA 7AT1A 4FWTA 1M5RA 3S8MA 4CBVA 5B2EA 3DWIA 4I9NA 2Q27A 1GAQA 5E9QA 2HAEA 2GBIA 4UXJA 1OLUB 2ACEA 2PZAA 3I5MA 4DG9A 3L1HA 3OZFA 4CTNA 5JVDF 3WHIA 3PXUA 3L77A 1A04A 4F21A 5AW0A 3VU9A 5D3ZA 3UMSA 3VKWA 3WTCA 2YKGA 2PLWA 1P7WA 2AWOA 5CP8A 3SK0A 3TEJA 3PNSA 1B8UA 3N0XA 3TUJC 3W77A 4DSUA 5BR4A 1NVAA 4ILEA 1RVDA 2OK8A 2NZXA 4XVQA 4E5VA 1QRUA 2JLVA 3R8XA 4OK5A 3NJ4A 4DLZA 4BZPA 4AZTA 2R86A 2WG1A 4LMRA 2E82A 2VRBA 4ZXFA 1WDLA 1YL6A 3HFGA 4LY0A 4F85A 4NMHA 3ZVMA 2QJTA 1T2EA 4FIZA 1G7RA 3VYSB 2QVYX 1W46A 3HYSA 3MS7A 2RDMA 3PPXA 3WMFA 4OLAA 3LVBA 4POOA 5J4VA 3EH1A 3TOCA 4GRAA 1CZRA 3NHAA 3WLHA 2VUTA 4RJKA 3OEEA 2FNAA 4N3GA 3J81k 2AN4A 1FFHA 2GBPA 3EMKA 3RVMA 1OBCA 2EKQA 4B6QA 4JR1A 5TLSA 4XSGA 4EVIA 1CR0A 4D3ZA 4F9TA 1LRJA 2PM8A 3QXCA 5H9VA 1FSGA 5EE9A 1DMSA 3HN2A 1IOWA 1GNPA 4LI3X 4CFSA 2J0QA 4BX2A 3PFHA 2R2GA 2JGIA 1GUBA 2HK7A 4QXAA 3ZI7A 4Z4EA 2V3VA 4GI1A 5F76A 5CA1F 2O8EB 4IDBA 4OIFA 3AJAA 5AHOA 2ZS9A 4OUKX 4ZT2A 1T0UA 5EXEA 1FA9A 5KC8A 4Y1EA 3KQQA 4ZV4A 4EJSA 4AYWA 1GG9A 2ZBFA 3FCYA 3GP8A 1JPJA 1UBCA 1XZDA 2FG5A 2QD1A 2XHZA 1NPTO 1SKBA 2JEZA 2REOA 2HTEA 2WZBA 1UBOS 1VPDA 4H77A 2D0PB 1GU0A 3OBIA 4Z7OB 5LOVF 1ACMA 3T8YA 4CR7A 4RTQA 3UAVA 4URFA 3DNPA 1Y9ZA 4ZVRA 4KVAA 2C95A 5A6SB 2COUA 1IQRA 1SOAA 4MV8A 4ZHQF 1XVIA 3OOWA 1XPOA 1I3MA 4WLNA 621PA 1H4QA 2HRQA 4D82A 3SSOA 4E2YA 3NIGB 3QJGA 3UK6A 3UUEA 1F12A 3Q7QA 1CJBA 1WMSA 4JQCA 1JECA 3ZHRA 4Z99A 3L92A 3MT8A 2ZTVA 2R11A 4GP6A 1AD2A 3KPJA 4MGHA 3AINA 4Q9DA 1S8FA 5LBUA 2DHEA 4OFBA 1RAEA 2EGUA 2HWYA 2I3AA 3BZUA 3B1WA 3DE6X 1HYQA 3NNNA 3DV9A 4LHWA 4DLAA 4NFSA 5ERGB 3T95A 1T9DA 4E2FA 5JTUA 4LJ9A 4BTEA 1NXPA 1P3Y1 3VR5D 1XTTA 5ALHA 1P4RA 4NXNB 3B8HA 3B82A 3VHXB 4AYXA 3KQUA 3K96A 2R0QC 4ERXA 2DMRA 5EL0A 3MWJA 3TWOA 4COKA 4K3UA 3ZVNA 2F1IA 1RZ3A 4WZAA 4J4HA 5TS3A 1TZKA 4A6EA 5FUXA 3T52A 2V6JA 3ADOA 1A9ZA 1B8NA 1ZA2A 3A9VA 1GZUA 2WKSA 3DDWA 1FSZA 1KEEB 3HNOA 3LH5A 3OM1A 4LSZA 5K3CA 1UDWA 2IV7A 2WSIA 1UT8A 1N1EA 2ECFA 5G0WA 5FUMA 2FMXA 4RNCA 2WSLA 4WUVA 4EELA 5BWBA 4V0LA 1XRPA 5AVVA 3OZVA 1KMIY 2IZ5A 4PO1A 5FOVA 4Y7CA 2FPPB 2Z2KA 1N6NA 3WSTA 3RVLA 4UNPA 3KQVA 3WNVA 1B2LA 4ED9A 5JATA 3MWLA 3BPSA 1FDRA 1P4SA 2A88A 4WGFA 1ZK2A 3OWXA 5C8DA 1LBEA 2PZLA 3ZW8A 2AC4A 3FTPA 1JWLA 1DAMA 1ZAKA 2AUMA 2HLDA 3DE7X 3DD1A 4V0SA 1TL7C 5IZCA 2HLPA 3JQBC 4M54A 1KZ9A 6REQA 2QI9F 1NVGA 2NGRA 3H8SA 3HB4X 4JBGA 4LI0A 5D3QA 1TVKB 4BP1A 3JVEA 2UUBB 1IONA 3CR3C 4X66B 2Y27A 3ZE8A 3IIIA 3CHYA 2JRLA 3AKCA 4J0HA 4G2TA 2RKWA 2W98A 3DMTA 3Q6NA 4OKNA 4HVLA 5FRDA 1OXMA 1ZCZA 4BUJA 3L8FA 2ROQA 3L0YA 4LE2A 2DPXA 2W2VA 4PZCA 4EGAA 5EHIA 3DEYX 4BVLA 3LQYA 2YZGA 5A3QA 2G07A 3QKRB 2VPYA 4M0KA 3A6HA 4ZVQA 1FPMA 5J23A 2I7XA 4LF6B 4PLVA 4PC7A 2EQ5A 3PX3A 1I3CA 2VF5X 5LZ9A 4FNMA 3TDKA 1Z2CA 4IX9A 4PRKA 4ESHA 1YR3A 2EFYA 2JGJA 1P5RA 1PZNA 1CJKC 3T4XA 4JT2A 4MVJA 5IDYA 4COOA 4FDLA 3D4NA 2Z4TA 4Q7KA 1XRMA 2B3TA 1UM9A 1NRIA 4JC8A 5AKIA 3O82A 4CHGA 4F1WA 4A2PA 4YALA 5JARA 4IFBA 1ZN7A 1VHJA 4YBZA 2GEBA 5CURA 2QG4A 3JASA 1VLQA 2O2YA 3CVVA 5FYDA 4GL4A 4UUAA 4QA9A 1BDJA 2HL6A 3E9CA 5B3AA 3DHVA 3R7LA 2UXDB 2G4CA 4IXWA 1M8JA 1QNFA 4G0PA 2UUCB 3KUKA 1M6EX 2H2GA 3IP1A 4GPAA 3L1UA 4DLXA 4JGGA 2PWBA 5F64A 1KI6B 2O19A 4MS4B 1YGYA 3FOAA 2W6ID 1H1LA 2BEWB 4UHKA 1TU3A 2QG9A 4DA0A 3B9BA 3R74A 3U7FB 3P5BA 4Q16A 3GNQA 1A50B 4AZ3A 2FWPA 4BRUA 1CZHA 4NV0A 4MB2A 3VO2A 1WQ1R 2OD2A 4LYAA 3U7JA 3HADA 1K2VN 4A5SA 5DGHA 4PF1A 3ZV7A 2WPDA 3PBKA 2F8LA 3GAFA 3IUJA 1FUKA 3BMNA 1YC5A 3H5VA 4TMKA 5LC1A 2YNMD 3PNQA 3QV2A 2Y93A 3LSYA 3OEED 2PBLA 3JATA 5B55A 3FWZA 1MGPA 1JKXA 4YJKA 3BXZA 4S35A 1C0PA 1NBMA 2UZ1A 1DXQA 1SUIA 4FVTA 4BTLA 2R1TB 1DJMA 2CMGA 1VJDA 3OOEA 4DDHA 2XQIA 1RC1A 1X14A 3KXDA 5CDHA 2VF4X 2XHEA 4ID3A 2ZVJA 1VYHA 4JMPA 1V16B 3Q0IA 2NAFA 4PAWA 5DW3A 3JRNA 1UXGA 1WSAA 1KZYC 2WKWA 3CBGA 4QO7A 2D0OB 2ZIVB 3BBLA 1EVQA 2E4AA 2YVKA 3KQTA 4GEGA 4MAFA 3GQBB 4TT3A 3PI6A 1NUTA 5F98A 4W9NA 4P3NA 4Y2PA 4YAFA 3PNKA 1I4OA 5LDGA 1F20A 2REBA 2WAYA 1V7QA 1HTTA 2E1RA 1K5DA 1KMNA 2HSZA 2DUJA 3X2EA 4BNWA 3OCJA 1UKEA 1MPXA 4CLOB 1TO1E 3PDJA 4I14A 1YMUA 4L07A 1KRHA 2XBMA 1ND6A 1IBKB 2V7BA 3NTUA 5IYZA 5KOHA 3DFIA 4J0FA 3IQXA 4HVCA 1MJNA 4MQEB 1ZMXA 3VKGA 1FUUA 1V39A 3P0IA 5AOBA 2C7OA 1NG1A 1Z6QA 4PYOA 4WCFC 1VA5A 2DY1A 2KE5A 4Q15A 5H68A 5J63A 5KJ6A 1YUBA 3V55A 4JU8A 2X2EA 3OKCA 4IVNA 2RKOA 5LJIA 4Q7LA 5GIPE 5T4HA 5T8KC 3EUFA 3O8OB 2YHIA 3H5OA 1MB2A 4G67A 2YN0A 1SUBA 1CUJA 2VZ8A 3T3HA 4EECA 1PV1A 1DWQA 3KT8A 1IHXA 3B36A 5HM6A 2ZRAA 3CJRA 4Y1RB 1KFEB 2K2QB 2NYVA 3AO0B 3ASVA 2OCXA 4KAJA 2GCPA 5LD2B 2FWRA 3C97A 4B6EA 1L7OA 4WKCA 5JC8A 3QI7A 4ARVA 1O5OA 4E13A 3PDHA 3AETB 1OGYA 3LY9A 3OPQA 5DNEA 3ZGYA 1MA0A 2EEPA 1QB7A 2BUBA 1T9ZA 2D7JA 4YJHB 2HYDA 3I64A 2C92A 5E7MA 3UPDA 3Q7IA 3W8FA 3B5EA 1RR6A 3GLTA 4R54A 1WF3A 1JSCA 1Q1AA 2OLEA 5C51B 1FQOA 1NW4A 2WT9A 1Q0HA 3ESQA 1L4LA 1K4YA 4DCVA 1EGHA 3E3OA 1N2OA 5AJWA 4BMSA 4J3FA 4AT1A 3GLKA 4MW4A 1TUIA 4JLSA 1SXPA 1BMFD 4DRXB 1E6CA 2WIJA 4P80A 1YKSA 2DB3A 4WZZA 1OA1A 1YACA 3T4EA 1QGZA 5KTOA 3R6TA 4X1YA 5LZ7A 5BYJA 4ZHQB 2AN1A 2EKLA 3AUKA 1NVEA 1BD3A 1VRWA 1UZLA 5BMVA 2WYVA 1GZ7A 3EF0A 4HK4A 8OHMA 1NIJA 1UOOA 2GN2A 2GS9A 3FH0A 2QE7D 3LLUA 3QE4A 1ZRSA 4TTJA 3V4ZA 4QREA 4XM2A 4E5NA 3AOEC 2WWXA 1NU8A 4BFXA 5M2QA 1A5TA 5AVTA 5HS6A 5IAJA 4EYOA 2JJ1A 1I10A 4NZMA 3DBHB 1WW8A 2MSKA 3LS2A 1CTQA 4H3KB 1QFSA 3E15A 3V6LA 5FOQA 5G3YA 2NSYA 2NVBA 2RGBA 4KQKA 4OATA 1RI3A 4A8HA 2N47A 4G4JA 3STYA 2AMLA 3LGAA 1ZGBA 4Q3LA 3RJTA 1EAYA 1CWUA 1WUKS 4PE5B 3ANNA 1M1UA 2CZQA 3TLXA 3ZYZA 2FR8A 4XFDA 5E6RA 3TH5A 2XVAA 4JXJA 4MI9A 1CZOA 3MJTA 3SFVA 5KVSA 1HDGO 2H0RA 1IN4A 3FAKA 4JAVC 3AJDA 2PJZA 3DHEA 4FOPA 5D2CA 2C61A 4C6TA 4LDZA 4FR0A 4ZOEA 1IIRA 2O7QA 2R6CA 4IAOA 4CQLB 4DBZA 4CCWA 3QSYA 5JD4A 2H5JA 2ODBA 2XITA 4RSHA 4BCDA 4RADA 2VDKB 2XTJA 4Q0MA 3ZWCA 5ELLA 2K7ZA 3ZNNA 3EOBI 4DUZB 3JZIA 2DBVO 3GRVA 2OVFA 2Y1LA 3TW8B 1WPRA 4QXMA 4BO7A 1E61A 3BUSA 1P80A 1UPUA 1QZXA 1DSSG 4LCBA 2BY4A 5JBQA 3H3XA 3R9XB 3GFGA 3PNYA 4QQFA 2HRRA 1UBNA 1Y1SA 4OMCA 3C15C 4FT4A 3SD7A 2G3YA 5JS2A 1YJQA 1PJLA 4TKZA 5K09A 2DJIA 4WADA 3OZAA 3LQKA 4ALMA 3BE4A 1RP7A 1ZQ9A 5AUNB 4R9VA 1JBKA 1WA5A 2NXJA 2H2HA 4DV2B 1F2TA 3STTA 3IOEA 4EEXA 5BQ3A 1HTBA 5JFTA 4IRXA 1FVFA 3D5TA 2PU7A 3NANA 2WPDD 3L6RA 4L5CA 3OJXA 1Y6QA 4OI2A 1QYVA 4MV0A 4RV4A 3SXJA 2IY9A 2OB1A 4NBNA 4ZAWA 1R6DA 1JR4A 5I9IA 5A06A 4YR7A 1N7JA 1MJGM 2EFJA 1D9XA 3CIOA 2PUEA 4BGIA 5KOJB 2C2KA 3DVAB 5LNK1 1DO0A 4BTVA 2YTZA 2IFTA 1VKNA 3UK1A 1YKGA 1KNXA 2B35A 4XTRA 3EEOA 3KBOA 2BJWA 1NFRA 1B16A 2B98A 2AFHE 3EOZA 4M7PA 4MWDA 1ZG3A 1UWLA 4OU5A 1WZEA 1JJ7A 1KK3A 2VTDA 3DMRA 3X1MA 5TDHA 4CMHA 2HIAA 5JNTA 5F73A 2ATIA 3HB9A 4YPVA 4MMZB 2QVLA 3GNTA 5DBOA 1I2DA 3REQA 2CJPA 4MV9A 4Y30A 4BOYA 1IK6A 3PE3A 4XW2A 1NJ6A 3PTAA 1XV5A 4IIJB 4HDRA 2R5NA 4Z3DA 2WFLB 3C1AA 4O08A 5J1SB 3HJRA 2VA9A 2CXOA 2JLBA 1MTZA 4RTOA 3JAWB 2DR0A 4OH7A 5CLFA 1C1HA 1RPTA 1S89A 2FOLA 4K03A 2YRWA 2HI0A 1QCZA 5J59A 2I65A 3DUFA 2ZJYA 2AA3A 4G5XA 3C0KA 3HH8A 3A1FA 4B6OA 4YRLA 1F14A 3G9XA 4N8SA 1XZHA 1U7UA 1JMYA 4L5JA 4RZIA 1EUDB 5H59A 5BSUA 4CIBA 4LFAB 4KQ1A 4JX8A 5LB2A 4OKSA 4D9KA 4M9QA 4YAGA 4MGYR 4KV7A 1JU4A 1YIAA 4RIFA 1BVHA 1NOIA 1RQGA 2IITA 4C2AA 3IUEA 4C7VA 3GR6A 3VNSA 2QE6A 4BC1A 4IM7A 2GJSA 3ROGA 4W5QA 1RWWA 3TDMA 2Y05A 3P2JA 2X0RA 2WYHA 1L4HA 3E82A 3M83A 1P62B 1ZWLA 5EFZA 2UXBB 3DE4X 4LMAA 1AF4A 1AN9A 1CYDA 1OV6A 2NXCA 5EINA 4BKPA 2A5GA 4IV0A 5EXXA 3PNMA 5JZMA 4RC9A 5L45A 4FFNA 2PNFA 3SEQA 1W36B 1AQ6A 2H0QA 1VIMA 3BERA 1GRVA 1HA3A 1N8NA 3H5IA 1GYQA 2YJTD 4IQ4A 3JWEA 1CRQA 5CEEA 3B51X 3HBFA 3PKJA 2AXEA 4F2PA 1FOEB 1N8SA 3ZTYA 4CNBA 1I2AA 1L5VA 5DHSA 2WD7B 3EZFA 3PRYA 3IPCA 2EWMA 4MUBA 5BP7A 2HMTA 3OM9A 2QRPA 4MWSA 1PFWA 3H83A 4GI5A 1O94D 1NXXA 2H7XA 3AY7A 4F4DA 4D96A 1FNSA 1NZDA 2GPWA 3CLRC 1FX0B 4RBNA 5EKDA 2A9FA 5CLIA 3RHTA 4KU4A 3W2IA 5KNDH 1D7AA 1KVTA 3QLUC 1MH1A 1USKA 2Q0QA 1JSZA 3QGMA 5T3UA 2BE9A 1M8FA 2MSDB 3K5WA 3K9WA 5C2JB 4PG8A 3W5AA 3W3AA 2O1EA 1N1MA 3FYTA 2IEGA 4UD6A 1PYOA 1X7WA 3EFEA 4C87A 2BVNA 2O1SA 2RD2A 3FHOA 1GPYA 3Q98A 4IBOA 3NORA 4F6LA 3J7TA 2V97A 2GN8A 2BM8A 9LDBA 3P2MA 2ZPUA 3HM2A 3G1WA 2ZFUA 5DN9A 4FFVA 4TXJA 4BGDA 5GJWC 3OJ0A 4DREA 3X43A 4DUGA 1QONA 1H5NA 3H99A 1XU7A 1D9ZA 4BRSA 4FDVA 2O0LA 3I0ZA 4S1OA 1T25A 1XRLA 3N7TA 3IMGA 3R2JA 5E3IA 1UODA 4OX9Y 5HZMA 1GWNA 1PL6A 1W2WB 2GXUA 4JR2A 4ZRNA 1FPQA 1JBQA 3ELDA 5DMXA 5BMOA 2I2AA 5JAMA 4H7JA 1J0XO 3O4HA 1THMA 4TV9A 1P2GA 1JMVA 2C4KA 1O7JA 1YCDA 3KV1A 3QU4A 3CT6A 1T2UA 3A4VA 3A1DA 4R01A 4QYTA 3X1XA 4OBBA 1XTUA 5KB3A 1XTQA 1QKIA 2QA5A 4R2HA 4B76A 3U7GA 4J7CA 2BV3A 3I8SA 2P4SA 4EG7A 3R5FA 1KERA 1NX6A 1X1BA 2V4MA 3ZDEA 4PRYA 3G2LA 2ISQA 1GEEA 2QM3A 2J07A 2QRLA 3TIVA 4LN1A 1XAHA 5AXAA 5KYUA 3ODPA 1Y1QA 3EVCA 2ZJ6A 3S1AB 2G71A 1T13A 1MO6A 1NI5A 4QDKA 5JMPA 4A6DA 2Q1UA 4N65A 1U2GC 4R05A 1E5XA 2WRZA 2B9EA 4J16C 3HJTA 2YY7A 1N0VC 1GAWA 1SZJG 1Q1GA 4W9RA 1C0EA 1R1DA 2EL7A 2IBMA 3AEQB 3H3FA 3E3NA 2PUCA 3O3CA 3E1KA 2CBXA 4LCJA 3TE7A 4JL8A 3T7AA 3M7IA 2UZ4A 2VSNA 1P9LA 3MRSA 3IVCA 3ZHZA 1E20A 2Z1MA 3HY3A 1ZD2P 3MELA 3WWPA 1JEQB 2W2LA 3T1NA 3HGTA 3WMXA 3SQXA 2JRCA 3ACBA 5E95A 5BN4B 2ZRLA 4E2ZA 5KSWB 1TJ5A 2VTEA 4HLUC 5T4BA 5GJBA 4HGYA 1YJ5A 4HNSA 4JBIA 4N3AA 5G40A 1KI9A 4EL5A 1FJHA 1W87A 2BP7A 4PTYA 1QF9A 2YINC 1JRLA 2W42A 5EJ2A 3N7AA 1VHTA 2VOEA 4X8MA 2IYNA 5AD1A 3PGJA 2CXUA 1VGRA 3BGSA 4R9RA 4BLPA 1KK1A 4FJ2A 3ONEA 2WVGA 1X7DA 2FQXA 4LYFA 1U8TA 1XD2A 3I9MA 1EUZA 2OFFA 3ESBA 1E92A 1HT2E 3LO8A 4C6RA 1VLHA 4JT8A 4WNCA 5EJ4A 3ZHBA 3D3WA 3LP5A 4I99A 3HK2A 1S2MA 4EHDA 1ML4A 1I2CA 5REQB 2XUDA 1RT9A 4LZWA 4M1EA 4BO1A 1XT6A 2IYRA 5KDDA 3M6VA 2VQFB 1NQOA 4LC0A 4HMOA 3OKFA 3DFMA 3EXG2 4JA0A 3VGJA 1VSBA 3NASA 5EMJA 5AVRA 4CEHB 2R66A 4O0LA 3K4PA 1WTCA 3U16A 3THYA 3DM5A 3UMBA 2NSJA 1WUHS 2RHCA 5THKA 2ZIXB 1WCIA 2O2IA 2QLMA 2C3YA 3BHJA 4XB6B 2ON6A 3FVTA 3O9MA 2ZR7A 1UKVY 1V11A 2P9HA 4KZPA 4MKIA 1KE1A 3WAKA 2B5VA 2QN3A 1IPEA 3D4BA 3HB0A 5ADVA 2JFVA 4AECA 4XIJA 4FE7A 3A4TA 2C4WA 4MEBA 1S2NA 4ZGWA 4AW9A 4QM6A 1GT91 1Z7WA 3NC4A 4HV4A 4NXMB 3D3KA 3EGCA 1XP5A 1NJGA 4TQ9A 3OIGA 5G2OA 5KUTA 5M34A 1EFPA 4IDHA 1W6UA 4WE3A 2QY9A 4N6GA 1U4NA 4L95C 4ARSA 2BKVA 2H1FA 2ISCA 3C5EA 1GZSA 1PVOA 3HBNA 3FJOA 3FVRA 4G85A 3DXFA 4IUDS 4NJMA 1ZW6A 3RYTC 1G18A 2C96A 3WYCA 1Y4DE 1W49A 4JKOA 4WJKB 4C4SA 2LKDA 3AI1A 3SI7A 3X1YA 2PU5A 1F51E 2H18A 3LQQA 4L4SA 4REQA 4J49A 2EFDB 4KXVA 3VSEA 2FPUA 3WNBA 2N75A 1FFXB 1KZ1A 1W2GA 2WVJA 4B3IA 1RXIA 2WU0A 1Z0UA 2Y8EA 3GV0A 4IKEA 1U2DA 2VUHB 1IYZA 1SCUB 3PR3A 1ILEA 4BY9E 3QE9Y 2LR0A 2AJDA 2Y0CA 4MQ4A 3SAJA 2XNSA 2R1VB 4R1SA 5JCXA 5HRUA 4R1NA 4WA7A 1LSSA 1CS0A 2GF9A 2ZS7A 3EW7A 3AY6A 1TCAA 3FIJA 3N07A 5DNDA 1QX4A 4DEXA 1SKUA 3E3AA 4ER5A 4N3NA 1CUVA 2NVUA 3I04A 3DO8A 4NVRA 1KDVA 3IPYA 2FN8A 2MINA 5CG2A 3ITNA 2Z9CA 2WTMA 1W73A 4X3OA 1IM2A 4DIUA 1E0SA 4P33A 5IJ0A 2XQFA 3E03A 1V35A 4DJEC 3HKEA 5BNFA 1XMPA 3WLNA 4BU0A 2NUTB 1RXWA 2ZJ4A 1TC1A 3PWZA 2OEPA 1IHUA 2VH1A 2H08A 1MKYA 4KKVA 4LWPA 1FFSA 2ZATA 1QDEA 1YAJA 4G37A 1QHHA 4YRGA 1FMTA 5K3FA 3K20A 3I23A 1RRVA 4HCJA 2DR3A 1QHIA 4GGOA 3HBLA 4B84A 2QUBA 3K4HA 4EB3A 1N5OX 3KPUA 4K0RA 1NDUA 3RS8A 2HNBA 1EA5A 4QBFA 1WETA 1QFYA 2C94A 2XVMA 3JQAA 3RIGA 3GC6A 3CLUC 1AHNA 1A82A 2FZVA 3B5IA 3O90A 4YCCA 3RSQA 2E1PA 1PTKA 1MJFA 4X97A 1FMCA 4ACBA 2C1ZA 2ADFA 1EB8A 1T9BA 2ID8A 2VDLB 4JBXA 5IAOA 4MVJG 2OGZA 4E5DA 3L46A 2BRUA 3AVPA 3FWKA 3JD0A 5ECYA 4PC6A 5GQSA 2C29D 1CUAA 3DT6A 1RM0A 4PEVA 3TOSA 1WUYA 3WYBA 1P0MA 1PD0A 2Z6VA 4LHXA 1MA3A 3VDMA 3JVVA 1ADBA 5JC1A 2QGFA 3OCZA 3F2VA 4KQ9A 4OFZA 1UJBA 5DJ5A 4B43A 2QK4A 4P7GA 4K5QA 4WX2B 3UNXA 1FP4B 2AG6A 2HNAA 3HN7A 1UAAA 2R48A 2IS2A 1Z34A 1KR5A 2QZ9A 3ZK9A 4DARA 4DHEA 2PUGA 4LXTA 4CV2A 2B92A 1VG8A 3SS7X 2Z3WA 2A8YA 2BGTA 4DSTA 1QO7A 3C3WA 3Q7SA 4X95A 1JKJA 1PZMA 2GNPA 3AR3A 4IVQA 3ZU5A 3DL7A 3O2SB 4BLUA 1HRDA 5G3ZA 4F4UA 1DO2A 2QNIA 4GS5A 5HA5A 4I8XA 3CWCA 1QPGA 3ORSA 1QE5A 5D00A 1M34E 1SH7A 2YYZA 3KWLA 4QG3A 1EE1A 3VC1A 2V7TA 2XDQA 2Z8YM 4L16A 4RPGA 3LQ1A 3K53A 4P86A 3DLHA 1TT5B 1OB5A 3DL2A 4XUEA 3TM4A 1DX4A 1VE5A 1KOLA 1ZZEA 3KKEA 1RJ9B 1THZA 2HUNA 3C4JA 2P0EA 1IL0A 2PY6A 1GA1A 1KI3A 4JBLA 3RAEC 1NRJB 3B85A 2EZ9A 1K6EA 4EYQA 1NX9A 4CEJB 5KS2A 2I34A 1MBZA 4MGEA 4QELA 3C24A 3I8OA 2AMFA 4KO2S 3EEBA 3H1BA 4CMEC 4ZQGA 1FMFA 2WIBA 1OSNA 2ZYRA 5DLPA 1N2EA 3LI2A 1C9KA 1N2CA 4MDFA 1DWPA 3V8RA 4C21A 5I6DA 4KO8A 2PSJA 3HU3A 3OU6A 1H2HA 1H6AA 3QE3A 5FPYA 4YRDA 1ZINA 2HK8A 3OIVA 1OXTA 4A8JB 5KTPA 4OOFA 2J3QA 4X8LA 4ND8A 3RJ5A 1UK7A 4ZQHA 3UXYA 2C5AA 2OT3B 1PSZA 1RWQA 4DYVA 1IXYA 4JZKA 4KXLA 3AUAA 4DWOA 1NC1A 1NQ5A 2I7VA 3B2QA 3BXEA 1MP0A 4MH0R 4XVUA 1VP9A 1KJ9A 1XRNA 1V95A 3CLHA 1ZJ6A 1SHUX 1DC8A 3DEZA 3GRPA 3OZXA 4IDGA 5BPHA 5J43A 4KR3A 1W25A 5B30A 4LX8A 4KPEC 4X44A 1ZXBA 2BISA 4RF5A 3NDIA 1XCBA 2HEIA 1OU0A 4UCQA 3UA3A 4C20A 2IZ6A 3IRUA 3ISTA 4MUGA 2QR5A 2C7QA 5U4XA 2PRYA 2G77B 1Z15A 1EFVB 2CW5A 1OFUA 2VYFA 1FNBA 2ZT6A 2J7KA 2H31A 3S55A 4RM2A 4BMDA 1PI3A 3A1EA 4ZI7B 2Y2VA 3HVJA 1P6QA 2IP1A 1FVXA 5I8WA 3DDUA 1AS2A 4RESA 4RF4A 2OCKA 3EG9A 1VGQA 1ZFNA 1JHUA 1M8KA 3KLNA 5C32A 3WGIA 3THRA 4DY4A 2QR2A 4HYYA 4KQ2A 2R8OA 3NTLA 4G56A 4PWZA 4C4AA 3I2JA 1VHWA 4Z7JA 1IDOA 2FOXA 4DSOA 3AVYA 4GVLA 3G3EA 4YUWA 1ID1A 2ANBA 3Q11A 2C83A 1A2KC 1KK2A 4JLDA 3MGKA 2VHEA 2C9DA 3KZOA 5A4JA 2H5EA 2HNKA 4RPJA 4D8UA 5TT0A 3GY0A 3K0FA 4OA5A 4GNRA 2C88A 3SJ7A 2CXQA 3WDSA 3ZD6A 3Q6IA 3HWSA 3LUCA 3U3RA 4FGUA 2WB4A 1CT9A 1YR2A 2C9ZA 4RVDA 1OLSA 2HHJA 3WNQA 4J4BA 3WDMA 1JP7A 4YB8A 5FNZA 2Y1FA 3DVLA 3SQDA 4ENTA 1YRLA 2NUAA 2ZI7A 5ALEA 4TVOA 2CLKB 5F9MA 3N2GA 1ECJA 3LVFO 4KYIB 1MW9X 4DQUA 3SHOA 4XZ3A 4D26A 3FPFA 4IR7A 2AHRA 1GTSA 1D07A 2B34A 1KYVA 1I5RA 4FPXA 4AJKA 2MDTA 4U63A 4W9MC 2K7FA 1VHDA 4HFMA 3RSFA 4YGYA 4DOMA 1JSRA 2JB9A 4A6XA 2IYQA 1ACLA 2AZTA 2DY0A 3ELWA 2J32A 3DL4A 1BGVA 4CLHA 2ECOA 4O1HA 1KPIA 2VT7A 4Z8XA 4HI0E 4G07A 4CM5A 4DIKA 821PA 4XLZA 3BRSA 2QXUA 2NTEA 2O2ZA 1F8UA 3LZ6A 3IUYA 4ND6A 5FPHA 3T9BA 5CDFE 5CIQA 3U62A 5DLDA 5F1PA 5FPSA 4C4PA 3PFFA 4KRXA 1ZISA 2NO0A 2FN9A 3HHEA 3ICCA 2VP5A 1EZ1A 1KJZA 5A3SA 4DWWA 1EVLA 3I09A 3C8DA 3Q3GE 5EZYF 3U0BA 2NYUA 4CGZA 3JQAD 2VNAA 4UVEA 4PCUA 4S1WA 4MXDA 5D84A 2B6NA 1RLUA 5EERA 3HSKA 2GAOA 2NXEA 2C7GA 3R4CA 4GR4A 1SZDA 3JQBA 3K9LA 1V45E 4DDWA 1G41A 1RRMA 2I8AA 1Y48E 5L6LB 1IU9A 1QGUB 3H0EA 5GINE 3MEQA 3O75A 4OYLA 3GVHA 4GLFA 1ZOLA 1QFMA 3AONB 2W8ZA 1N3YA 2ONYA 3N0TA 1M7BA 5EA2A 3RDPA 2WWYA 1JPUA 1MOSA 2CEAA 3A0RB 3AJ8A 2GAJA 3N59A 2VL7A 2ZBUA 4E46A 4KC0A 4G0YA 1ZMBA 3UN1A 1S2GA 2F3SA 3ZHSA 4HC4A 5JOQA 1D0SA 1HT3A 5AI5A 2P6RA 4MV3A 1KO7A 2VJMB 4HNTA 5F7OA 2PUFA 3I9V1 3ID6C 3QW2A 4UVDA 4YT5A 2Q5EA 3CRQA 1TUBA 4HL6A 4WH0A 4LPKA 4QZVA 2JFNA 3QPWA 1XNGA 1JH9A 2ZLBA 2XUPA 1UXOA 3O91A 4C0JA 4BFCA 2GWRA 3C7DB 4G3XA 1J2YA 2OFXA 4BKRA 3GRUA 1F8FA 3BULA 3PJFA 2VPZA 4Y2UA 1GM5A 4BX0A 1I9CA 1A2OA 1PJ3A 2NXWA 5D3MB 1Z83A 4IXNA 1UJ6A 4A36A 4HLNA 3O2NA 4WUTA 2WM9B 5D85A 4CR6A 1JFTA 1O6ZA 4PZPA 4X92A 3UXHA 4BQEA 4Q47A 2AX4A 4WY5A 1BQEA 4ALLA 1NLUA 1K4KA 1AUXA 1NTOA 1KEWA 1BN7A 3GDFA 3SIXA 7MDHA 4OXQA 3UM9A 1DKOA 4Y3UA 1M10A 4BWFB 5J2UA 1T3GA 3KYJB 5DWQA 1XSEA 4YP6A 2XVYA 5IAKA 5C18A 3JQ7B 2NO1A 4UD2A 3KXKA 2A84A 1A9QA 1NE2A 3C85A 2B2NA 3A11A 3GMTA 1NW8A 2QAGB 1GG2A 2R85A 1FFAA 2D1QA 3EVNA 4YI5A 3SF8B 2AS0A 3VHRA 3ANTA 5A4MS 3HDVA 1Y7TA 4LGMA 5AVZA 3L8CA 1FDOA 2FEKA 1Y6FA 1BA3A 3FNHA 4P3KA 1QBGA 1RRFA 1PZEA 3NRCA 1PT5A 1UKYA 1L4BA 4HS9A 2CHFA 5SY6A 2CLIB 2FEXA 3UHOA 1YS4A 2B1RA 1ECFA 5K3AA 2N9UA 2YOGA 4BLOA 1R5OA 1YOVB 5AUOB 4MP8A 4XB2A 3I53A 4YFVA 3VC2A 2M6SA 5AQ1A 1KETA 2WHYA 3AEKA 4S3MA 1WD5A 3K92A 4BIMA 2B30A 2P6PA 3AVQA 4UARA 3OF2A 4QFMA 5HSGA 2H00A 3TL3A 3HYLA 5BNIA 1XF9A 1GRNA 3F71A 3KCQA 3NIFB 1P29A 3OCCA 4MARA 4CLRA 2IPOA 2VJAA 2F9LA 4BV9A 2X0DA 5FTWA 3GJTA 4HNVA 1A9OA 3OCVA 4JR0A 4RABA 3EIQA 3U37A 1QSGA 1OGJA 1UKAA 2OZLB 2TECE 3AL2A 3QIVA 4DCUA 1E1YA 4J1NA 1I2ZA 4G0XA 1US8B 2GK7A 4RCYA 2A1UB 4PPYA 2YBDA 3PFIA 3C2QA 1Q7EA 2WM2A 1DGQA 1V1RA 2FV8A 3T9AA 1L5WA 1ZIYA 4C0WA 3F90A 4X6LA 1NWHA 5EOVA 5DWVA 3UJ6A 5CA0B 2HD4A 2GLUA 4B80A 3GELA 3M2TA 3V97A 1YVRA 5T57A 2QLJA 3GK3A 1NI4A 4EPYA 3FOEC 4DV1B 3DXXA 2BTQB 4MUYA 2PQ2A 3AP2A 1ZGGA 2J4CA 3P94A 1MZVA 4D0SA 3ZDCA 3V8PA 4Z4QA 5TB5A 3EZYA 3QMVA 3B13B 1FSSA 4RK7A 3VAZA 5TQ0B 2GD1O 3PXCX 4Z86A 3OC6A 5A9RA 1OXXK 3S29A 4Q9JA 4WCFA 4U2BA 1K6MA 3FPHA 1KYXA 2GN6A 4PNHA 3W9YA 4MW5A 4DMKA 5J1TB 2CXHA 5A7HA 4B3BA 3OTHA 4ZYLA 1DBWA 1BS9A 3W5VA 4A3SA 1QHNA 3DZKA 2WWFA 4L27A 3V4LA 4JYAB 1N78A 2IYUA 1RBMA 1DKUA 4PIVA 4R2IA 3JX9A 4P93A 4KJXA 1HT0A 3PX7A 1E2UA 4PZUA 1CVRA 3E61A 1GY8A 2ETXA 5T8KA 1NFFA 4WMLA 3M89A 2KHZA 1QK5A 2M2IA 1CR4A 2FZEA 1V25A 2XIJA 4H7FA 4I0WB 2XCUA 5JO0A 4U7PB 2O07A 1UXIA 3DZJA 3OT4A 1ZK1A 2F8TA 5CVUA 3FFAA 1XN4A 2XV1A 3SOZA 2P6OA 2EC5A 3D8HA 1EU1A 2CNLA 4MVJP 4DYDA 2PYDA 2NP7A 1P4GA 2VXBA 2ZJBA 2IW1A 1Y9JA 5KPJA 2X86A 3F8SA 2QSYA 4A03A 3PHIA 3W78A 1O03A 4CF3A 4ENVA 1DAKA 1V5WA 5CFOA 5I3ZA 3TTWA 2C2ZA 3Q41A 3FYSA 1JJIA 4RX1A 3ROMA 4UE3S 4ZN6A 1JEYB 1BU5A 3GH3A 1BW9A 5EJ5A 5A4FS 3CW2A 1QVVA 2VJDA 4BQSA 2CC2A 3JPYA 2PXHA 1U2TA 1ZL0A 1YSCA 5JNWA 2WOJA 3GAAA 4DPLA 3IBYA 2QX6A 3OT1A 4KGXA 4P7FA 1TIBA 4QUAA 3WLEA 1G3RA 5EHGA 4OQYA 2XEXA 2VHXA 1HDRA 2D1YA 4BEVA 1GA4A 2PK3A 3IODA 4LZNA 1QR6A 4HQLA 2GPAA 1T9AA 5HCIA 3G2PA 5JXWA 4EK9A 5DTRA 1ML3A 3ETGA 3P96A 5G0TA 3SJCA 1BWPA 2JF0A 5TPWB 1W0JA 4C06A 1DKMA 3C3AA 4KFSA 1ZEMA 4KXYA 3FPJA 1S02A 3WGLA 4HNHA 3ZEAA 5JEEA 1RI4A 1T8WA 3TLGA 3UMFA 3AOEA 1Q92A 4URHA 1Z0FA 4GBMA 3T3OA 2QTMA 3KR9A 2DHDA 1WMBA 4EI2A 4KOEC 1SUFA 1Y8CA 2XADA 3SS9X 3FOZA 4AG6A 3OX2A 2N0SA 3ELYA 2AFIA 2LP4Y 3PNBA 4NULA 1TD9A 3OZCA 5DGDA 1FFYA 4G9GA 4R1OA 3FKJA 3OQOA 4MVJF 1SBNE 8ATCA 1IC6A 2F62A 4QIHA 4FW8A 3ZN2A 1H23A 1H0KA 4GDMA 3JU3A 2QLTA 1PJAA 4L0CA 1JNXX 1EI9A 2W6CX 2O9JA 2RBKA 1U8XX 3M4ZA 1B26A 1B73A 4TN1A 4B2IA 3DDZX 1L4NA 1W85B 1IUOA 1EKXA 3V2UA 1FDVA 3ZDFA 4YRFA 3DOUA 2Y66A 3VPDA 2P4EA 4I4CA 1Q7CA 1E96A 5E3HA 1E2BA 2W90A 4AKSA 3EVBA 2OG2A 1WHTB 5TF4A 4A0RA 1KIMA 3BJIC 1MAAA 1Q5PA 1ZDMA 3A4IA 4O4HB 2WUDA 1I24A 4TZTA 5E2AA 5E6SA 2Q6KA 3IBGA 3QBJA 3QVTA 1Q7RA 2X8BA 4ZI2A 2YJ5A 2P6MA 2X9VA 2R8EA 5CVTA 3LOQA 1F2UA 2HGZA 3FOFC 4LZLA 3NH9A 2N3ZA 3L0ZA 3IMCA 1U81A 1E9CA 1VYTA 2GXSA 2PL5A 1SWWA 4O2BB 1M2EA 2P9TA 5D8DA 1ZD9A 2JARA 3M81A 2AT1A 2WNHA 3RUHA 5CD1A 1NQXA 4MULA 4KIFA 3GBVA 3SMVA 3R09A 2CDNA 3OQMA 4MRAA 2P5UA 3OTIA 3DWFA 1QHSA 1P60A 2HHAA 2R96A 5J4LA 4AS1A 1V6CA 4N82A 2J9FA 1GXSB 2BIFA 3H3JA 4QE3A 4EW3A 4HJRA 1PSWA 3L6EA 2MT9A 1E9FA 4I1OA 2BFDB 3EBLA 2QU7A 3JYNA 2P79A 3R5SA 2HIGA 3RANA 1ADFA 3DF7A 1QTNA 4YAOA 1H22A 2VHWA 4EFDA 2WSSA 2PLRA 1EM6A 1DFIA 1OMOA 2WJVA 3GX1A 4JFAA 3EXIA 3GZJA 5ALXA 5HJ2A 3CA8A 3TL2A 4KR0A 2IX9A 2X5KO 1J2EA 1N8TA 3KTAB 1ZH4A 2HB6A 2GASA 2Y1CA 1J00A 5AM5A 3NIDB 5DNAA 1X70A 3SJAA 1RHRA 3TECE 3WL7A 1V0JA 5I7VA 5AKYA 3GCGA 1PCXA 1G2PA 4J94A 4LJRA 2AYXA 2UDPA 2ZSFA 3A6FA 1QR2A 3Q0TA 1OUMA 1LPAB 1UUFA 1UXJA 4XIFA 2ET6A 3W7AA 1BQ3A 1VZ2A 4D4KA 4TKVA 1IZ8A 2Q62A 3RODA 1NXTA 3RE1A 4EG4A 3F46A 1IOVA 2R9VA 5IEJA 5IYZF 2XNCA 4L2IB 3R7BA 3KAPA 3VNAA 2R84A 3SDSA 3WA7A 1G9SA 2NLOA 5CGQB 3TUIC 4CFZA 3GRKA 2AI1A 2OV1A 3IAUA 3L05A 4QATA 1CUSA 4XGRA 1NXSA 2EZTA 2Q0XA 4BO8A 4A0SA 2J9GA 2WYUA 1ADCA 4Y2QA 1IIBA 4MEJA 4FMBB 1RKBA 2IPXA 2OORC 3UCFA 1H4SA 3DHWC 4ZCLA 4RVOA 3SHQA 3I2KA 2VHCA 3OLWA 5DSZA 2JGLA 3RARA 1ZOIA 5DXAA 1HOXA 2BHLA 3M1LA 5NLLA 2CWDA 1G8SA 1R6XA 2G8LA 3NNDA 2CLLB 2OXCA 3AR4A 3GJZA 3G6KA 4GM4A 4OP3A 5T5QA 3RHSA 4DL9A 3DULA 1CNMA 2EWVA 1J5XA 1SCAA 5AR1A 5ADWA 4ZV9A 1FTWA 1UMDA 3G88A 3T7CA 1KEVA 2AL7A 5I7OA 4FE4A 4JLAA 2FDRA 4XTCS 5EWMB 1P0FA 5F3RA 2YXBA 5I8ZA 1V8DA 1XQXA 2NV2B 2CD9A 3TLAA 3PFGA 5MN5A 2G9NA 1ZCJA 3MFYA 1LQ2A 1GV1A 2OZEA 3IESA 3NHFA 3FETA 2Q4OA 3HP4A 4RLHA 1OBHA 3WB1A 5CU7A 3GJ6A 4KAFA 1XRJA 3ICOA 3FG9A 3WK9A 3KHKA 1KO4A 1VMEA 3E1GA 4G9EA 3HBAA 5IU6A 1LU9A 4Q34A 5CB8A 4LRSB 4LSGA 1ADGA 3GP5A 4X1KA 3VR3D 3R5TA 1Z2EA 3AW8A 2CHVA 3C4QA 3IQHX 1NBAA 1KVUA 5HZKA 5T67A 1Z75A 3PPWA 4CIVA 3ADDA 4EO7A 3QLUA 1AV6A 1TQ8A 1W76A 3LDUA 4MIYA 2RSLA 4L9SA 5FB3A 2O54A 3ZWXA 1PWHA 1FY2A 1EK5A 1T6YA 5CM9C 4M1QA 4U5XA 2H2IA 1L1RA 2LD4A 1J25A 4PR0A 1HLPA 2D7CA 2QD5A 3FF4A 1HFEL 2BBOA 1XRQA 1XMVA 4MROA 3VTZA 4BP9A 2QT1A 2O6LA 1C4OA 1MDBA 3C8HA 1FFEA 1P39A 4E6EA 3AL3A 4OGGA 1GPJA 4B3SB 1SXQA 3VU0A 3LBIA 4YTEA 3R9WA 3QENA 3GN1A 2NG1A 2ZTHA 3JYLA 1U1FA 1YIDA 1C30A 2HJRA 3M9XA 3SE7A 4Q7QA 1XC7A 2OL4A 3IO5A 3PWSA 2I1VB 4W6ZA 5JBNA 4KQGA 2OLKA 2PTGA 1B6GA 3WLAA 2ZW9A 1Z35A 2PZ8A 5C8YA 3ZV3A 4F2GA 3EYWA 1U8CB 1CQZA 2P2LA 4U2EA 1G9XA 1GU7A 3AP1A 3Q1KA 4H0CA 5LLTA 3V2HA 4E07A 2YZ7A 5KWIA 2NZ2A 1O8CA 4C0KA 5H5JA 3IUBA 3QNWA 4ZC1A 3ZUGA 2UUOA 3QHQA 3U3ZA 1E1CA 5KJ1A 4HH4A 4WZAB 2ZM6B 1KQ3A 4CL2A 3M8KA 2P7HA 1GYRA 3NIWA 2P1DA 4LGYA 5BQFA 2VUUA 5BR7A 1H4VB 4IEFB 4DCTA 3FDJA 1E8DA 1EB9A 2QQ0A 1YS2X 4JYMA 1IEWA 5ALUA 1U2GA 3ZXSA 3ZWBA 1L6RA 3C7AA 4BLWA 1DIHA 4KVGA 5EJIA 2PJUA 4P7JA 2A9QA 2AOWA 1A8PA 3AUTA 3DAPA 5BO5A 4G41A 1DTSA 1W5FA 3N70A 3TKYA 2VWQA 1NMZA 3O94A 1W48A 5PNTA 4CM3A 4D0NA 4AZSA 1J99A 4B0OA 4IXTA 4Y2TA 4LEIA 5AHWA 2YC4C 4BE9A 3M34A 4M0EA 3I2HA 4I4IA 3TRKA 2XSZD 2VP2A 1GQOA 2PRIA 3DBLA 3NTRA 2VNIA 2J9RA 3QI2A 2DZDA 4HLUA 4IUBS 3O1IC 4WBXC 4LJ5A 3ZWAA 5LXTA 1N4AA 2W6MA 3FMOB 4I08A 1CW2B 2WT8A 5U4QA 3ZYCA 1O5TA 2R3SA 4UTNA 3X2FA 4QDOA 1Y9DA 3N7UA 4O6VA 2W11A 5CYPA 4FFRA 4EUEA 4G1CA 1EWVA 4JLBA 3NEYA 4DIBA 1JHQA 2FPSA 4FCVA 1E2KA 3PFWO 1M0TA 5AW9A 2JH9A 3WV4A 3OA0A 1W7AA 2O4CA 3ZIAA 2PVSA 4GPIB 2XB2A 4QOJA 5FOUA 3SE0A 1WDKA 1GSHA 1KWKA 3NMUF 1LW7A 2UUPA 2VWGA 4HDMB 4MS1B 3VAAA 1XHLA 4I4TA 4P5EA 2IYWA 3HDYA 2PSHA 1M7GA 4PRZA 1G21E 3D0OA 1II8A 3GI1A 3AXTA 5ADUS 2D13A 5EIBC 4AY3A 2PQMA 4TUYA 4YNBA 5LUAA 2YMLA 4J76A 5EIHA 3VBEA 1GL3A 1GPNA 1Z3CA 4NCXA 4TMWA 2CUNA 5KNDD 1NV9A 2ZTMA 3EGXA 3HVUA 3ZXYA 4QLBA 3OM8A 3LBNA 2IE0A 3LCJA 4J90A 5H82A 1CJUC 4PGAA 1UM9B 1YI0A 1FYDA 2X1MA 3U2QA 3VO1A 1KORA 3B6ZA 4P5DA 2VTVA 1G66A 5DLYA 2Y0EA 1Y37A 1Z08A 1XELA 3F7NA 3SX0A 2COEA 1K6JA 1VA4A 3W6UA 4BAGA 5A6VA 2R7AA 3JASB 3ZDDA 1XZEA 4INJA 4KBYA 4BP3A 2RMKA 4WN9B 1Y1PA 2AH5A 3AERA 3DOCA 4UCFA 1OX5A 3VU8A 4ER6A 5L7WA 3HDGA 4RTRA 2CCJA 2BGRA 3VH2A 2EYUA 4N7JA 1GR0A 3Q2OA 1WW3A 3E23A 3ON5A 4P35A 5J58A 3RVKA 2CE7A 3HWRA 4WACA 1C9NA 4YDSA 5AOAA 3OHSX 1RZRD 5D1NA 1H1LB 1AN0A 1WMAA 3HO6A 3K15A 1VRCA 1Z6AA 3VSAA 3QUQA 2JI9A 5YASA 3OLVA 1CUCA 3GJ7A 2IHTA 3W6ZA 3EQZA 4AZ3B 4EMUA 3DQZA 1MTOA 3PDCA 3MPUA 3OJCA 4DFDA 1NJ1A 1UMCA 3DTNA 2V3CC 3K3PA 2MIIA 4F12A 2ZS8A 1A9YA 5FEUA 2NO4A 3BMNB 3S3TA 2PMCA 2MYNA 3ASYA 5CT4A 4EW2A 1I32A 2QRVA 4ENSA 5GGXA 2ZRDA 1XNRB 4OSEA 4GYKA 4WN3A 4BQQA 3VHQA 4WL0A 2OXTA 2V6IA 3TN7A 5CB4A 5DDIP 5AKZA 5J2TA 4JQYA 4PC2A 3HL0A 1VMDA 3VVLA 4C3UA 2PGLA 1O0BA 4OK6A 2Q29A 3HCAA 1N2IA 4LXHA 5I4CA 1ZN9A 3HWWA 3TPFA 3SJBA 1XEWX 4XWKA 2CCKA 3ZVKA 3I9FA 3CLRD 2A35A 1Z6PA 2CVQA 2ZJOA 5H02A 4KPFC 5I7SA 4EG8A 1SCQA 3FLEA 2O3JA 3E9NA 1PJRA 3MJRA 2C4UA 2DHRA 4IFIA 4LDNA 3ZOKA 1U9IC 5ICGA 2FR1A 2O52A 4O4IF 2XT9A 2PKCA 4PX2A 5BN5A 3BF7A 4IH4A 3URKA 3H97A 4PG4A 4DQXA 1EVEA 4NRDA 3RKRA 5IYZB 3TRFA 1ISPA 4YA6A 1U0BB 221PA 2HJVA 1DBPA 1Z6ZA 2VQEB 2NU6A 1D1PA 1KMQA 4JYBA 4W1RA 3WKCA 3CLSD 4TV9F 2JD1A 1NR5A 3CLTD 3MINA 1ZI9A 4KIWA 3O8CA 3HV0A 4YV7A 2GDZA 2JFYA 3GG9A 1H2XA 3IP8A 1YHYA 1ZKDA 4Q1FA 3IAXA 3M6MD 2QUKA 5A7GA 3JQDA 3EEYA 3GPLA 2O48X 1QAOA 3A32A 4HOYA 2YHIB 5HW0A 4JI2B 5F1OA 1ISHA 1OKKD 1U8FO 2W6PA 2FAXA 2XAAA 5LZ8A 4YPOA 2BTOA 4A2WA 1U90A 3CF4A 3NKFA 3LOUA 5JT1A 1FCJA 3AUXA 3QYPA 2CJXA 3MW8A 2NOAA 1SY7A 2XYVA 3MQFA 3TZEA 4A0GA 3NYRA 1NVFA 1PX2A 4XX0A 5DCWA 4BMOB 1QV7A 1RABA 1YI1A 5CG1A 5ENZA 5BR1A 4MINA 2IC5A 1BA2A 3FWPA 2YYYA 1RCFA 4WKBA 2JLYA 3A1SA 5J3JA 2W6JD 1PZFA 4ZEMA 1KRWA 4JUIA 1XZCA 2IHBA 2V1UA 1E2EA 1CUYA 2Q5QA 1NOJA 2HM7A 4ILKA 3TUZC 3PUHA 1IFXA 4NV1A 1PFGA 4FX5A 1NXOA 4OGFA 1P4HA 4KDRA 1YI8A 3QWHA 1P5JA 4UAJA 1Z0IA 5FLEX 4YIHA 5BNWA 3PJDA 3C39A 1L1EA 3GZNB 4UNSA 1JBEA 4PG7A 2RKBA 1DV1A 2QV0A 3ORYA 2AEEA 3JTEA 2O14A 1MT3A 3OSUA 4GXQA 5CT8A 1XGKA 2AQ8A 2G17A 1QTRA 1HDZA 4Y2RA 5FULA 4CMEA 4DV5B 1SXIA 3QLTA 5IVKA 2R65A 3PFNA 1PFQA 4FGZA 2CFOA 4ARAA 4X1YB 3GLHE 3S99A 2IRWA 1CJMA 4FYWA 4OQMA 4PG6A 2HBZA 4U00A 4D9FA 5BN1A 5EIXA 2VP4A 5BMVB 1QP4A 2JI7A 2P5TB 3PUIA 4ER7A 4DXHA 4LYHA 2F90A 4EF4A 4ESEA 5KJCA 4IL5A 1HMYA 2ERCA 4K26A 1X7ZA 3EFHA 5DT2A 2FG6C 4LKRA 3UKJA 1MO4A 1G5IA 4YCLA 4RHXA 2A1IA 2O2JA 4MKRA 1E1RD 2H4WA 2PKQO 2XIQA 3NP9A 4K3VA 4U3JA 1G5QA 1PK8A 3AYZB 2PVPA 3DLAA 3SYRA 3M82A 2DQSA 3FTFA 2X5NA 4LHYA 3A1UA 4NS4A 2GK4A 3WR5A 3I52A 4JT4A 4R69A 5EVCA 1VCOA 2DXIA 3DPSA 2GETA 5EJGA 4FFBA 1U0GA 2I3BA 2E4WA 3EYAA 2PRZA 3ZZ1A 4FBGA 1E4EA 3PVSA 1PE0A 3FI0A 1T5IA 4J0DA 1NYTA 2WF6A 1E9VA 2GM9A 1ORHA 3OUUA 4PN7A 1QYDA 3TSYA 4A0FA 2WAOA 2NZVG 3O8NA 4Q12A 4U8GA 5ALTA 4BUCA 4TYWA 1WVIA 2PKRA 1IH8A 4FGSA 2O1XA 2P68A 4KV9A 4Y0AA 4U0JA 3RKUA 1FVHA 1L7BA 1SC9A 1Z5ZA 4WESA 3FZNA 4WNYA 4IS3A 3UG7A 3I73A 4Z0NA 3Q7EA 4JWKA 2YH2A 1YTUA 4QYSA 4KHPB 1GZ5A 4N48A 4TZ0A 5JHHB 2M1ZA 4GIBA 1PNRA 2YMPA 2P75A 1S1MA 3INNA 5L4LA 4M0DA 1YS7A 4PO8A 5G4KA 3JVUA 3OOJA 2XRYA 2NSDA 3ILVA 121PA 1T5HX 1X7XA 4LWZA 4WKNA 5LZ5A 4AKEA 5JR3A 4PGFA 1UMBA 3J7AC 5KSYA 1SURA 2D59A 3TVTA 2E18A 1KOGA 3KVNA 4KB5A 3H4IA 1BVRA 2IXBA 3W2GA 1GJRA 2QROA 3CRZA 4OV6B 3W2TA 2UVDA 4ZANA 1TMYA 2QTVA 4IV8A 4Q6BA 1TKCA 2VAVA 3FYUA 4TV8A 5HR5A 3M6FA 2WIGA 4TT3D 1UJ5A 4BZXA 5K0FA 3VTFA 5SZHB 4AXBA 3WE7A 4BZZA 3DYIA 4G4GA 1EG2A 4FXOA 1E7QA 3KYBA 5JAPA 2WQ6A 2FPKA 3W34A 2EP5A 4OMUA 3ZHQA 4GG1A 4HFJA 1AM4D 3ES9A 2GPJA 4B34A 1C1XA 3V9PA 1G20E 1JLSA 3EVDA 4A7PA 3P7MA 4UHCA 4OU4A 5L6MB 3NV9A 3HZRA 1ODLA 1Z26A 4MLZA 1XTKA 5EJ7A 3L02A 4KPUA 3O7WA 1WABA 2QUIA 3U7QA 2QBYB 2X6TA 1X1DA 4DNXA 4KXMA 1GQFA 4R40A 1G8GA 1NVTA 3FGNA 3QNMA 1SXJE 2FW0A 4TLBA 5TE9A 4F5WA 3IDAA 1Z36A 4ZPXA 1Q15A 4L5BA 4AF8A 5LQRA 5AKEA 5EUBA 5DIZA 4ICIA 1D2HA 2OCLA 2PL3A 2C99A 3DUFB 5FHQA 2HJHA 3GPIA 1JXQA 4ZDJA 2Z4SA 1JPVA 2F3QA 3HS3A 2X77A 3E3MA 1XTSA 1OIXA 2OO5C 3EW9A 4ATNA 4DSNA 2HMVA 2WP8J 1TDJA 3B3AA 4V0RA 5A3JA 5I8PA 1AXEA 1FSPA 2V7QD 3KV3O 1OJ7A 5F9HA 3AR7A 3LYAA 3DEJA 3H4VA 3BJMA 3MMNA 4C0HA 1YZ3A 1NULA 3OY2A 2B0CA 1IWPB 3CPEA 5ERXA 4NBSA 3D5QA 1Z06A 2RK3A 5SZIA 3IIMA 3NBFA 4OFWA 3GARA 3LFHA 3EHDA 4Y1GA 2EERA 4J91A 1SD5A 3JYHA 1WE2A 1IRXA 1J1IA 1YASA 1IVSA 1EBUA