4UFPA

Laboratory evolved variant r-c1b1d33 of potato epoxide hydrolase steh1
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
319
structure length
319
Chain Sequence
KIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIALNEEKVFVVAHDLGAYIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNKVEGLKAIYGEDHYVSRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPLYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Laboratory Evolved Enzymes Provide Snapshots of the Development of Enantioconvergence in Enzyme-Catalyzed Epoxide Hydrolysis.
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase
molecule keywords EPOXIDE HYDROLASE
total genus 119
structure length 319
sequence length 319
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2015-03-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ufpA00
1ISPA 5DTJA 2ROQA 2BKLA 1Y7HA 5K3EA 1ZI6A 4H7EA 2PX6A 4AZ0A 1EVEA 1LLFA 3I2FA 2BFNA 2QJWA 4LYDA 7YASA 1CFJA 1EI9A 4RNCA 2HFKA 4QZVA 3QM1A 3BL8A 3DYIA 4CCWA 4KRXA 3O4HA 3OURA 2OPHA 3W9UA 1R88A 1XZMA 2DQYA 1CUVA 2J4CA 4INZA 2XDWA 3C43A 4PO3X 5AJHA 1AX9A 3RARA 2I78A 2HA5A 5ALLA 2XQIA 3FNBA 1A8QA 3QPDA 4HRYA 4C4XA 1DX6A 3G0CA 4OPMA 2DHEA 5ALPA 3ED1A 5BWCA 1CUHA 3QVMA 3QMMA 2VT6A 1IUPA 1SCIA 4GDMA 2OCKA 3WKAA 1UKCA 1BN7A 2PKYX 3QMVA 2OCLA 2BGRA 1QIDA 2ZSHA 5HQ3B 1UXOA 4BP8A 2BUCA 2HU5A 1J2EA 2X76A 3I6YA 4K6GA 1DQZA 1CQZA 1CUAA 3KWFA 2OGSA 4G8BA 2WIJA 1QIKA 2O7VA 3HXKA 2WUEA 1FFDA 3DEAA 3I1IA 3I2IA 2JBWA 3IBTA 3LS2A 1JKMA 4HXGA 1XZFA 2OGTA 4G9GA 1UFOA 1EB8A 1ZIXA 5I7UA 1YA4A 4C6HA 1FSSA 2GZSA 4Y2XA 5FOQA 2YXPX 3C8DA 3L1HA 2GYUA 3TGLA 4G5XA 4L72A 1HQDA 1LPSA 2B4KA 1LPBB 4WDRA 2VSQA 5EHNA 3TJMA 3O4GA 3WIOA 2EDCA 2OCIA 1EDDA 4UBLA 1XROA 3DKKA 1UZAA 5AH0A 3G0GA 1H2ZA 3GELA 2G5PA 1XQWA 4J0CA 1QO7A 1QONA 1CIJA 3O4IA 1N1MA 3OOSA 3DQZA 2PBLA 4BDSA 1JJFA 2BUAA 1A7UA 1ETHA 3PE6A 4B83A 5ALEA 2WUFA 2XMRA 1YSCA 3QPAA 5DYWA 1W4LA 3SWWA 1H22A 2X8BA 1DU4A 4BE9A 1LGYA 2WG2A 3WIBA 5AI4A 3KOOA 4I3FA 2AJCA 4WFJA 1YASA 3DLTA 5LKRA 1QIGA 2GBIA 2QXTA 3AIMA 4BAGA 3KDAA 4GEGA 4F21A 1CVLA 4QLOA 4PF1A 2J3QA 1LPNA 4KE8A 3AILA 2RI6A 1MU0A 4W1RA 2VJAA 2J3DA 2WM2A 3QYJA 4FTWA 3PF8A 1R9MA 1GQRA 5AKHA 1TIBA 3MUOA 1C7JA 3P2MA 5DNVA 4MWTA 5A2GA 1GXSA 2WFLA 4HAIA 2QM0A 3DL4A 3OG9A 3PFBA 4BVLA 1BRTA 2PSJA 4B84A 4ETWA 1GT6A 1UK9A 5DYYA 4TGLA 1YS2X 1XZLA 4QNNA 4UBOA 5K3FA 3F9CA 2WFLB 3ESAA 2QR5A 4X6XA 4AMZA 1CUEA 1LPOA 2LIPA 3BF7A 4EHBA 3VDXA 2HDWA 2V9ZA 3PICA 2VF2A 4C89A 2HA6A 3IUNA 4DNOA 2RHWA 2VQ6A 5DNUA 5FKJA 4E46A 5JASA 1LPAB 1GPLA 1MAHA 4KR0A 5A71A 4GI1A 3I6ZA 2ECFA 2WU4A 3WL7A 5LZ9A 4OB6A 4JUIA 5AI9A 3BXPA 5ALIA 4ZREA 5SYNA 5J3JA 1CLEA 3BDVA 4W63A 1LBTA 1CUCA 5KWIA 4Y2PA 4FFWA 1X2BA 1HL7A 2OLEA 4Y2VA 1MX1A 2BCEA 5CBKA 1QE3A 1CUXA 5HK9A 4ZWNA 3JW8A 1F0NA 1GPNA 4DM7A 1G42A 1LBSA 5FLKA 1XRRA 4QDOA 4B81A 4FHZA 4LKOA 2O7RA 3B5EA 2GYWA 3HACA 2CZQA 1XZEA 4LYEA 4WFIA 2PSEA 4H7JA 3WKCA 4IH9A 2XMQA 3AZOA 4CIBA 4J0KA 1OCEA 1UKAA 1H2XA 2Y6UA 1MNQA 1ACJA 2I3DA 1WHSA 4BC0A 3ANSA 1DTEA 4CI9A 2JF0A 3ZV7A 1M33A 5IKXA 5EHXA 5A7GA 4QEKA 1VZ3A 4X85A 2D5LA 1CUZA 1B41A 4BYMA 4J0DA 4CFSA 3EQ8A 4Y2YA 1QIMA 1CUFA 4AN1A 4H7HA 3PUHA 1P0MA 4BTVA 3FVRA 1EVQA 1Q0ZA 5ALGA 1KEZA 1ZICA 2HA2A 5AP9A 1QFSA 1XZAA 3BIWA 3QH4A 1CUSA 2QJRA 2ZVDA 2XUFA 5EIEA 3WK9A 4HRXA 5AOAA 3DL7A 3WWPA 3U0VA 2CB9A 4XVCA 1NU6A 4OU5A 1CUBA 5E4TA 2HHAA 4P92A 4UUQA 1P0PA 5K3BA 4X92A 4X00A 5HK8A 2PUJA 1XQVA 4H35A 2DHCA 4ZXFA 4S0XA 3OPMA 5DNWA 2I3ZA 3WKDA 3V1LA 4N8EA 5IVIA 1P0IA 1WM1A 3G0BA 4FLMA 4J7AA 3NOXA 5ALZA 3S2ZA 3WA6A 3OTQA 1BROA 1TK3A 4L3WA 4ITVA 1A88A 1IUNA 2JGMA 4X97A 4FBLA 1NX9A 1EA5A 2HA7A 2Z8ZA 2WUGA 5CMLA 3FAKA 3ICWA 4BE4A 3KD2A 1IZ8A 4M0MA 4BDTA 4B80A 4DMFA 5LZ4A 2WFZA 3UUFA 2ACEA 4FNMA 4AO6A 5T4BA 4WFKA 3KXPA 4KJXA 5HZGA 3G0DA 3F96A 3DKRA 2XUIA 4PSCA 5AM1A 4H77A 1MPXA 5ALFA 2HADA 3W05A 2ZJ6A 2H1IA 4YPVA 3FSGA 4RE6A 2R11A 1QTIA 1YAHA 5JADA 1UT6A 3LIIA 2XQKA 3G9TA 1JMYA 2HA0A 3FYUA 4J0HA 4P9NA 5LP1A 3HRHA 4H7DA 1F0PA 3ZWQA 3M81A 5EIAA 4G9EA 1MN6A 1Z68A 4OCZA 3QBJA 4NMWA 2VEOA 5K3CA 5T4FA 4G4IA 3N2ZB 1XQYA 1TAHA 5FRDA 1YA8A 2CJPA 1EH5A 1QIFA 2XUKA 3DS8A 1E8MA 4N8DA 2C5GA 1EINA 4X7BA 1XZJA 2ZJFA 5LLSA 1BEZA 2PM8A 4B0PA 3OC0A 4UBKA 3WL5A 3G8YA 1JMKC 2XMSA 1EHYA 2VAVA 4AB1A 1ODCA 1UWCA 4B9EA 1ZJ4A 5LIPA 3T4UA 5EIHA 4BAUA 4HZGA 3VISA 3O9MA 4U2CA 1EX9A 1U65A 3Q0TA 4FNGA 5HF5A 3STXA 4KE7A 4AN0A 2VJDA 1TRHA 3LIPA 2IITA 2G5TA 3O95A 3RLIA 4MEAA 5HCUA 4OB8A 4JH0A 3HSSA 5JAOA 5ALQA 2WUDA 5AK3A 5ALSA 2PU5A 1A8SA 2ZYHA 4CIAA 1PV1A 3RKSA 5FUMA 2DR0A 5DTIA 5LKAA 2QMQA 3MVEA 3H2KA 1C4XA 1DWPA 5D6OA 1H2WA 1A8UA 1AQLA 5JD6A 4H0CA 1AURA 2O2IA 3CN7A 4UBIA 3W04A 1VE6A 1B6GA 1DWOA 3WK6A 4V2IA 2XMCA 5ALMA 3E4DA 4HVTA 5JIBA 1CUWA 1LPPA 4DMCA 2VT7A 5IVKA 3R3XA 3M82A 1LPMA 3R40A 2QOEA 2YYSA 2PVSA 1WHTA 4ARBA 1H2YA 3IUJA 1CUUA 1RWQA 3EQ7A 5EHQA 1HBJA 4QDTA 1YCDA 5AM0A 5EI5A 2GZRA 2WTMA 3WWCA 4EA6A 2QRUA 3A6ZA 2GYVA 1UKBA 5FV4A 2EDAA 3NWOA 4U2DA 4DMKA 1MO2A 4UPDA 2HU8A 2WIDA 5HKBA 4A5SA 2Q0XA 5SYMA 1DT5A 5K3FB 3I2KA 5ALOA 3I1YA 1VKHA 5AIBA 3H0CA 3F8SA 3X3HA 3DNMA 3FSGD 5HKAA 3RK4A 1X70A 3WWDA 5CH5A 3UMJA 5CRIA 4DNPA 5AKJA 4HXEB 1P0QA 1EDBA 3C6XA 3L1JA 5ALJA 5JATA 3H17A 2WTNA 4X3CA 3E3AA 4JYPA 1L7RA 1MX9A 2I03A 4Y2SA 4ZV7A 5CT6A 1BN6A 4E14A 1RYYA 3H2HA 2W22A 3AFIA 5CT8A 4EY7A 3IDAA 1X2EA 4K2AA 4WDQA 1QO9A 1FFAA 3G9ZA 1ZI9A 1DT3A 4G1FA 1SOMA 2PPLA 2H7YA 1K4YA 2WG0A 4D9JA 2PSFA 2VJCA 4UHCA 3WA7A 1VA4A 4NVRA 2XUOA 3EBLA 3D7RA 4F60A 2AXEA 1QIJA 1XRQA 4MXDA 2B20A 3VJMA 4HS9A 1QOZA 1EK1A 2VA9A 2DFPA 1W6RA 4GBGA 4E11A 1XZHA 5CT5A 3DYVA 1HDEA 3FCXA 3WKEA 1CQWA 1OILA 2XE4A 5AK4A 1MX5A 5AOBA 1QIEA 5A62A 4EY8A 3BJRA 1S8OA 5D3ZA 5JZSA 3V48A 3WYNA 2D0DA 4EZIA 4MJ3A 4JNCA 2RONA 5C81A 4OSEA 3JWEA 3AZPA 1JJIA 4FBMA 2XUGA 3FLAA 3FVTA 3O0DA 5JD4A 3F97A 3FCYA 1JT2A 4EUSA 4TPKA 4N8SA 4DIUA 3WK4A 4BB0A 5DWDA 3HZOA 3WK5A 4DGQA 1RP1A 3EF3A 5AHXA 2JGFA 1CV2A 4KEAA 2ZYRA 5ALNA 1YAJA 4G8DA 2VTVA 4X93A 2HRRA 4BRZA 3R0VA 3ZLUA 1KU0A 1XZKA 2XMZA 2WJ4A 1GGVA 1IVYA 2BJHA 3LCRA 2WJ3A 2OAGA 3D5EA 3AJAA 3C6YA 1ACLA 2XMGA 1QIIA 3D3NA 5IVDA 4BZZA 4OB7A 3GUUA 3HLKA 1R3DA 1E89A 4UHFA 5AKEA 3FYUB 2HA4A 1XFDA 2B61A 4AZ3A 5HFNA 4DLNA 2XLCA 3OM8A 4DYHA 4FLFA 4H7KA 4WCVA 4UFOA 1EK2A 4IH1A 1K63A 1K6EA 4Y2RA 3H18A 1QJ4A 5AI6A 1GZ7A 1W1IA 4Y2UA 4U2BA 3HEAA 2WHQA 4WY5A 1CUJA 5CH3A 4MQMA 3HYSA 1VJ5A 3FOBA 3HI4A 4KAJA 2PUHA 3SK0A 3H2JA 3G02A 3E0XA 3PFCA 4E15A 3R3VA 5JARA 2DQZA 1UK6A 4LXGA 2XT0A 3C8HA 3STYA 5K3AA 3BIXA 3HJUA 3W9BA 4BCBA 3H2IA 1MTZA 1CUGA 4A16A 5CXXA 5JD5A 3HABA 5ALYA 3CN9A 4UHEA 4MWSA 4I4CA 4N5HX 4DMHA 2G4LA 1SFRA 3I2JA 2PU7A 3MUNA 1XQXA 3B12A 3B3QA 2WHPA 1ODSA 4BZWA 3IUQA 5AM5A 1XKTA 2CMFA 2ACKA 1J1IA 4X6YA 4AMYA 1TKRA 3N0TA 1R50A 3C45A 4W1PA 4B0OA 1HKHA 5JYCA 2XQGA 3C6ZA 2AJLI 4MQLA 4O08A 5JAHA 4EY5A 3ILSA 4DSAA 5HQ3A 1XRPA 2WIFA 4CCYB 4LHEA 3WJ2A 1AMNA 2RHTA 3U1TA 5ESRA 3EQ9A 3DOIA 2O2HA 1HLGA 2XUAA 4KAAA 2ZJ7A 2W6CX 1Q0RA 3WJ1A 1ZIYA 3K9BA 1SCKA 4H7IA 2Z5GA 5ALDA 4Z49A 1ZI8A 3V9AA 1CUDA 1QTRA 2OG1A 1UOOA 1ZGCA 1LZLA 3BF8A 4WJLA 2Z3WA 4CG3A 4K6HA 5AKKA 1CPYA 2GBFA 2NW6A 5AM2A 2G63A 4B9AA 4X91A 5AM3A 4FFVA 3M3DA 4B6GA 2BGNA 3WQHA 2HFJA 3WZLA 1TCAA 3O9VA 2XUQA 4J0GA 5AO9A 1N5RA 2VATA 2OGZA 1IMJA 3V1KA 5JANA 5C8ZA 1G66A 5LZ5A 5IH7A 2DHDA 3DOHA 1KU6A 2OAEA 3CXUA 2QS9A 1DINA 3A2LA 4YX9A 1Q83A 4OYYA 3WI7A 4EY4A 2X5XA 3ESBA 3FLBA 2JGIA 1ZJ5A 1EDEA 4Q3OA 3WWEA 4AO7A 1QLWA 3GBSA 4TVKA 5C8VA 2XQJA 2Y1KA 3PDCA 5DLPA 4OYLA 4IHAA 4U2FA 4QDZA 2QVBA 4W9RA 1LNSA 1W75A 5F4ZA 2IX9A 1TQHA 4K6KA 3BE8A 4Y9SA 3QMWA 4P08A 1BS9A 1W76A 3I2HA 3Q8WA 2CBGA 3V1MA 4AX4A 2JGJA 2QT9A 1JU4A 2OQIA 1C7IA 3IUMA 5HFAA 2XI4A 1XLUA 3ZLVA 2ZYIA 3ESDA 4IQ4A 3WL6A 4YASA 4B7ZA 1N5MA 2JGKA 5AKLA 1VZ2A 1AC5A 3S8YA 4IH4A 1T2NA 3R3YA 1XZDA 4C88A 3A70A 4BAZA 3A2MA 2C7BA 4ZV9A 1R4ZA 3F67A 3H1AA 2C5FA 5A7FA 5ALXA 2AJDA 3TEJA 3F98A 2FX5A 5ALRA 2YASA 2Y6VA 1QIHA 3ANTA 4L9AA 2FJPA 5CXUA 1AKNA 3VXKA 2VAXA 2RAUA 4Q3LA 3D4LA 3FWHA 4G8CA 4QDUA 3VJLA 4QDXA 3IB3A 2XUPA 1JFRA 1WB6A 4YK7A 3VVMA 5ALHA 1ZGBA 2CUTA 5KREA 2XMBA 5FPQA 5IVHA 5T4HA 4N5IX 5KBYA 5CT4A 1SCQA 5CH8A 4HXFB 4X94A 3NGMA 3WKBA 2GBGA 4AQDA 1PJAA 2HIHA 2XMDA 5AKYA 5EGNA 3WK7A 3T52A 3K2IA 5AKXA 1DWQA 2WHPB 1AZWA 1XRLA 5K5EA 2DSNA 1BCSA 1GQSA 4Q3KA 3UUEA 4F5ZA 3DD5A 4XWGA 1Q84A 5ALTA 2BAGA 2GBCA 3IVMA 4C4YA 6YASA 3G9XA 5BOVA 2EEPA 5YASA 2V96A 2BUBA 1Y7IA 1E8NA 1SC9A 5LZ8A 3PUIA 1CUIA 5AKZA 3ESCA 3DJYA 3WWOA 1UK8A 4LXIA 2WFMA 4Y7DA 4K5QA 4MEBA 3GROA 1FJ2A 2XLBA 3TRDA 4P93A 4DSZA 4JEIA 4G4GA 1XZIA 4NS4A 1O6GA 4ZGBA 4RGYA 5E4JA 1VE7A 2QTBA 1O6FA 4B85A 4UHBA 3FLEA 1VXOA 4C4ZA 1ZOIA 5AI0A 2DCMA 4FKBA 5JZBA 1XZBA 4CCYA 4I19A 4PQEA 2Z3ZA 1CR6A 3C70A 3CCCA 5AICA 5DJ5A 4UFPA 3PF9A 1JI3A 3GFFA 3IURA 1DX4A 1WB5A 5KWJA 3M83A 1I6WA 4KRYA 3FYTA 4XJVA 4HTAA 1ZD5A 3D2CA 4BC1A 5K3DA 2PSHA 2PL5A 1BU8A 3DDUA 5EFZA 5T4EA 3FBWA 2PSDA 3QPCA 5ALUA 1WB4A 1XKLA 1E5TA 1AUOA 3C5WP 5ALKA 3C87A 4M0FA 4BTLA 4Q05A 4ZI5A 4ARAA 4EBBA 1D07A 4BVJA 3YASA 3C6BA 3W2TA 1XZCA 5A7HA 5AIAA 4PSUA 1GPKA 4QWWA 3NUZA 4F0JA 4OU4A 5JZ9A 2XUJA 3WL8A 5JAPA 3IA2A 2B9VA 2HM7A 3H2GA 2P8SA 3D0KA 4BRSA 4UBNA 1FFCA 3R3ZA 4X90A 1G4HA 1GKKA 4X95A 5LYYA 2H7CA 1EXWA 4XIIA 4L0CA 2QKYA 4FWBA 3ZI7A 1L7QA 5E4YA 4JYMA 2AJBA 3L1IA 2WIKA 2V98A 2WILA 5D3KA 3FYUC 4KE6A 3STVA 4A23A 3V1NA 3ZPXA 4LIPD 4UBJA 1WOMA 4BP9A 4Q82A 2XUHA 4DNQA 4QA9A 1XLWA 4U2GA 1L7AA 5AOCA 1YR2A 4BBZA 4BATA 1XRMA 2QUBA 1MT3A 1CUYA 3AIOA 2H7XA 2WKWA 4RE5A 2RGUA 5CURA 5H3HA 2ES4A 3QZUA 3C5VA 4UFNA 5ALVA 4H18A 3JYHA 5ALWA 3I28A 2QXUA 3ZLTA 3VVLA 1XLVA 2K2QB 3WMRA 2CEKA 3AIKA 5BWBA 2C0PA 1BCRA 2WSLA 4PV7A 4UHDA 1QGED 4KACA 4OUKX 1YB7A 5HF6A 2C0QA 5AI8A 2R8BA 3K6KA 3LP5A 3STTA 4OD0A 5HF8A 2Y2VA 1K5PA 5ISMA 4LXHA 4EY6A 1IUOA 2FJ0A 3D59A 1JU3A 2HU7A 3WYDA 5HF9A 1F8UA 1TCCA 3ICVA 2WG1A 1R9NA 4BVKA 2WIGA 5JALA 4QWMA 4H7FA 2IIVA 4W1QA 3HC7A 5A6VA 1NU8A 5CTAA 1J07A 3RM3A 4AO8A 1ZD3A 5AI5A 2OXEA 3STWA 3AZQA 2V97A 3CCBA 1TCBA 4Y2TA 5LZ7A 3H1BA 3H04A 2JEZA 3QITA 2Y2UA 4M0EA 1QFMA 4EB0A 4BCCA 4CG2A 3W06A 2JEYA 1MAAA 2OQVA 5CW2A 3H19A 1MNAA 1IZ7A 2ZYSA 1BEEA 1U8EA 4BCDA 5E2IA 4Q1VA 4QLAA 3AUKA 4ROTA 2XUDA 5C7YA 2YH2A 1J06A 3DCNA 3O4JA 3D2AA 4GW3A 1ZD4A 2JIDA 1XZGA 3EIOA 2QUAA 3AINA 3KSRA 1VOTA 2J4FA 1E3QA 1VXRA 1QZ3A 4GECA 5AK5A 5FDFA 5AK6A 5I8PA 1EB9A 1CRLA 2HRQA 5FPPA 1YS1X 3LLCA 4GWLA 1CEXA 3WK8A 1T4MA 3R41A 1W52X 3WLAA 5C8XA 1UK7A 4FDMA 4PSDA 1YB6A 5AM4A 5LZ2A 4PNZA 1ORWA 4GHWA 2HA3A 4GXNA 5DYTA 2UZ0A 1VLQA 1VA5A 2WJ6A 4G4JA 4DTCA 4FOLA 1U2EA 3G9UA 1R1DA 1XRNA 2XB6A 3A2NA 2WQZA 5I9IA 4ZRDA 2AJ8A 1ZD2P 1E66A 1BE0A 5FXMA 1UOQA 4FMPA 3BWXA 4UBMA 3I6MA 4FLEA 3G7NA 1FFEA 2H9YA 4X6UA 1WPRA 5FP0A 4IO0A 1N8SA 5D7BA 3VJKA 1OXMA 4U2EA 4KAFA 3IULA 2E3JA 4PW0A 1JJBA 2RIPA 4NZZA 2Z8XA 4Y2JA 4CG1A 2JGLA 3D2BA 4GLBA 3SX4A 1THGA 4DNFA 4UHHA 3I2GA 1USWA 4RPCA 1LZKA 1ODTC 2HL6A 4XX1A 3STUA 3G0IA 3SC2A 3E1GA 2QZPA 2ZSIA 5BV7A 3GZJA 3PI6A 5EHZA 3KWJA 1GKLA 4J03A 1WPXA 4KE9A 1MJ5A 1HPLA 3WZMA 1THTA 3IIIA 4Y2QA 1UOPA 4KYVA 1F6WA 2WU3A 2O2GA 1E8DA 4J0IA 2JGEA 1U4NA 1ORVA 3BJMA 4Q34A 3R3WA 1DQYA 4MYDA 3BDIA 1G5FA 3R3UA 3VKFA 4X71A 1AGYA 2OCGA 4C87A 2C4HA 4B82A 3MGAA 2ORYA 4AXBA 2C58A 4MYSA 1H23A 1FFBA 1K8QA 2WLSA 4J0JA 3GA7A 4W1SA 4J3JA 5AKIA 2CKMA 2FUKA 1Y37A 5AKGA 2XQFA 2WHRA 4QE3A 1WCYA 5CT9A 2VJBA 4C01A 5JAUA 2ONCA 1PFQA 4WY8A
chains in the Genus database with same CATH superfamily
2GZDA 2HCRA 5F23A 4ZCPA 1HUQA 2XGSA 3D7KA 2A33A 1ZI6A 1RAEA 3R7WB 2AOXA 3ZWXA 2PX6A 2NZ8A 4RVDA 4ZPXA 1YB5A 4UXIA 4AZ0A 4EG6A 5D3QA 3TMYA 1YV9A 2GA8A 1DKPA 3H6GA 4ZT7A 3BD7A 1JEQA 1LLFA 4QXPA 1Q3HA 3C74A 3U48A 4BGVA 3DMGA 3OU6A 2OAQ1 1SXPA 4WN9A 4F8JA 1C8BA 3HO1A 3A1VA 2FSVA 1HQYE 2HDHA 1IAQA 4OATA 4P22A 4Z9FA 5IXJA 2GN1A 4DQXA 1SBZA 3KB1A 3KXIA 2ZIGA 4URUR 3H6KA 3PXBA 5TQ0A 3WYGA 1GZSA 1OBHA 1QRRA 2WZCA 3HMKA 4RNCA 1KORA 2HFKA 4BJ3A 3BL8A 1I7LA 2IT1A 4GP6A 3DYIA 4LJKA 2HCFA 3UUGA 3QOWA 4CKZA 2PIDA 2ZRCA 2JIMA 4RKYA 4NWIA 4TXMA 3FZYA 5F1KA 3TZ6A 2VQEB 1WMFA 1JQLB 4LJRA 5F9FA 3I9MA 3ZCVA 3MWFA 5L6LB 2DQYA 2COUA 3LCCA 5A0FA 3LKBA 4FYMA 5F1YA 4XIJA 4BVGA 2ZIVB 1YZHA 3AU8A 4NONA 3UFXA 5LQDA 4OJQA 2C9OA 3JQGA 5A02A 5L51A 2W2NA 5DRTA 5KJ6A 5LN1A 1MB2A 4UREA 3BCUA 6CHYA 2WLTA 3JS5A 3R7AA 2HWWA 1KARA 1DO8A 1JIIA 2BFMA 3NUGA 4JROA 3WRYA 1R74A 2C2ZA 3HA5A 3QPDA 1TW2A 2DWQA 4Z3OA 4JC5A 4M36A 2ZAGA 3BFXA 1IM5A 1NUUA 3OQPA 3GF4A 1V2GA 3GD7A 3HCAA 1M72A 2YRWA 4QBIA 3CX7A 5EXEA 4NR0A 1XTRA 4OPMA 2DHEA 4KQEA 1VJDA 2V4ZA 3VGJA 4BX8A 2HHLA 2IXDA 1FIUA 3ACBA 3QE2A 1A8PA 3QMMA 1PR9A 3L4BC 2VT6A 1BSVA 1BWPA 4UQOA 3M1IA 4PTYA 4WCFC 4B47A 3G8AA 4URHA 4JAVC 1SCIA 3RV3A 1EFKA 2X1VA 3T3EA 2HJGA 1FUIA 2OCKA 3OMXA 4Q37A 1OKKD 5KQLA 4BWGA 2VEDA 3QI2A 3OM9A 2BGRA 4ATNA 4J91A 2X19A 4ABTA 5A3VA 1MHPA 2CVQA 4KQ6A 4GBJA 1IIRA 2ET6A 2FUCA 3EF1A 1HZJA 4LI0A 4ZVPA 4MA4A 3ZK9A 1XC7A 1BJTA 5KDOA 4MUHA 5FPHA 4M2LA 2PZ8A 2QTWB 2Q3DA 2FHSA 2A1IA 4V39A 5BSMA 4C03A 5DGTA 4ZYWA 3QENA 1IB6A 2C2KA 1X8KA 3BRQA 3L05A 2OENG 3OIVA 3WIVA 5JQWA 2AOTB 4UZFA 3TLYA 3IVRA 4HZUB 3RANA 3GLFA 2VQDA 1Y6JA 3EZFA 1FFDA 2GO1A 3DEAA 2D5AA 2Z57A 3JASB 2JBWA 1BYIA 2BT4A 4WNCA 3HXPA 5CX1B 3TAXA 5F3RA 4RK1A 1Y9ZA 2W2LA 3K94A 2ZFUA 1YR7A 1ZKMA 2DECA 4LC0A 4PAOA 5CJPA 1FNCA 4YT2A 4QEDA 4B33A 2G07A 4TZKA 4M22A 1XGKA 5JS1A 4KLNA 4BX2A 4BL5A 1NVWQ 1QMGA 3T7JA 3U4AA 3Q4GA 3UGQA 4MPPA 3S3TA 1KPGA 3JWIA 3OSZA 3FRIA 5ARDA 5B58C 3C8DA 3VR4H 2HCTA 1RYMA 4PAQA 4BPRA 3W8EA 2ZWAA 2IUFA 4D25A 1LF5A 1PQUA 1MMFB 1IFXA 5B12A 3SP1A 2YOHA 4G5XA 4U5QA 1B16A 1NQOA 1B6RA 4G65A 4M87A 4L72A 2VSNA 4QHYA 4BTEA 4C4TA 1HQDA 2JD2A 3TE6A 2PKEA 4HAWA 4WDRA 2VSQA 4X1OA 2VCHA 3MJEA 3VI4B 3O4GA 4DDWA 2EDCA 3FAZA 3IE0A 4UAUA 5GJBA 3CA8A 4PZLA 4PRKA 1B3BA 1X3LA 3RJTA 3DPUA 2W6ID 3OZWA 2O0HA 2P6UA 3QXHA 4E07A 2IKSA 5FO1A 4FR5A 2GESA 3H5RA 2BZ0A 2GCNA 2ZBEA 3GEGA 3LCVB 4G23A 1IHYA 4HDOB 4KLRA 3REFA 2OLJA 4HQ6A 3G2IA 4LE1A 4QFBA 2H08A 1WJGA 1NMZA 2P5YA 3G82C 4JEHA 4NKRA 3TOVA 2B21A 2B8WA 4V1CB 3USZA 4O5OA 2JLWA 1KEUA 4C7KA 4PICA 2RG7A 4GKKB 2G5PA 1E2BA 3B9BA 4IHJA 1VJGA 4EEKA 5HRUA 3ISTA 3AG6A 1K75A 4CG0A 2ZYTX 4C3UA 1KQ3A 1NMXA 2R1UA 4E12A 1KAEA 1D6MA 1Z7GA 1H0HA 4ND2A 4AWXA 5KU7A 2HYIC 3FN4A 1TMKA 1SQ6A 1Z6AA 2ISCA 3VUFA 2YXEA 3ZTTA 1P6QA 3P9KA 3R76A 1TKBA 2HB6A 1A7UA 1MD9A 1F1BA 2W11A 4IQ8A 4BGUA 4EENA 4HNVA 5IVPA 1OAAA 1XCJA 2A57A 3OX2A 3PE6A 5E7JA 3D4OA 3Q7IA 4LVNA 5JC8A 3FMFA 3T3IA 2PPVA 3JD2A 1X42A 2QR2A 5E7IA 1UMBB 1YSCA 3DYBA 4O2AB 4I9NA 1G21B 1B8OA 3EC7A 2XT6A 3QJYA 2WD7A 3WIUA 1S89A 4PLVA 1CDOA 2EJWA 3QVUA 1EK6A 4IVNA 4BE9A 4KLCA 1C8KA 3T5PA 2J6CA 5J47A 4NMXB 1BHJA 5CDUA 2O2SA 5JS6A 5A9SA 1T8PA 2DLCX 4L28A 5LKRA 2WWHA 2ZT5A 3V8VA 4K88A 2HRDA 3IAM6 1D1TA 2VBCA 2E55A 5K8TA 3L6EA 1PEDA 4GEGA 4FKZA 1LU9A 4F21A 3QTLA 4FS3A 3JU3A 3AT1A 2V7EA 4G24A 4WI1A 4UM9D 1HE4A 1SPXA 2Q5FA 1LPNA 2C1ZA 2BN4A 3EAQA 5AOVA 1CT9A 2C4NA 3BSWA 3GLVA 5ARCA 4IIDA 4EHNA 3A6HA 8OHMA 5AVUA 4R8KA 1BAPA 4W1RA 1TMOA 2GK4A 1N2GA 4M3NA 4A1OA 4ZYTA 1Y3HA 2Q3EA 1OZGA 1QVWA 4B4VA 4WADA 2JJ2A 3WGYA 5REQB 3R8CA 3JZAA 2J45A 3KV3O 4FTWA 2IVZA 4LJ4A 1YRBA 1R9MA 4ZRNA 1GQRA 3B85A 2YZGA 3OE5A 3DHWC 4MP3A 5DI3A 1JQJC 2G71A 3G6WA 5CA0A 1WNTA 2CD7A 3GNTA 4MWTA 4ZO8A 2YFYA 1EEXB 1GZHB 4KWTA 4TKUA 1UFKA 2MR6A 3GRAA 3KS9A 4XXHA 5F2EA 3V1TC 2L42A 1QUEA 5K2OA 3GFPA 7GPBA 3TW0A 1U2QA 1XDGA 2OZKA 4AC9A 4H9GA 4PSAA 4LRQA 1C0PA 1MORA 3ZDFA 4EPXA 4DV5B 1Q0UA 4B09A 3A04A 2F1HA 3SHFA 2HOQA 2DWPA 2OQ2A 3NRCA 4ND7A 3UBTA 5J63A 1QC5B 5EXDA 5EJMA 3IUPA 5DM4A 3K9WA 1EGVB 4MIOA 4MW2A 5ITSA 1AB5A 3DTVA 3ETLA 4Y6SA 2IYNA 3OZSA 2L18A 1DZ3A 5TB5A 1URPA 2WIBA 4OBEA 4M9SA 4ETWA 1KYWA 1MOPA 1NW9B 3NANA 1JHQA 4L57A 1NSYA 3MINB 5AVWA 1YS2X 5LPNA 1XZLA 4QPNA 1CNMA 1L7XA 1RYFA 1SXJE 2V7PA 3MGCA 4X6XA 2E7ZA 1Z56C 1W19A 1FFHA 1FQJA 3OY7A 4DKXA 3WGKA 5ESDA 2R4QA 2V9ZA 3PICA 3MCAA 4PFQA 1FMLA 1N7JA 4WA7A 3FDJA 4GRDA 5FD8A 5M2QA 3DLCA 1QAMA 4DUPA 5F7OA 1L4NA 3NHSA 3Q9SA 1L7PA 3DD1A 1KMCA 1V2HE 1X80A 2IXGA 2RHWA 4FGJA 1YE3A 2EGGA 4J07A 4HN4B 4B44A 1SA0A 1WS6A 4EHJA 1W4AA 4OMDA 2ODBA 5D5HA 4LRYA 4D96A 1GG9A 1T29A 2W7TA 2PFKA 3RW9A 2XZTA 2A67A 4LMBA 1UBEA 3ZWBA 1MAHA 4Q39A 4PZAA 4PS1A 2GR9A 2ZWPA 4OM8A 4A0RA 2PUAA 2V6IA 1I4LD 1J4AA 1TEHA 4BV3A 1RRCA 3U56A 3ITDA 3NBZC 4GI1A 4EVQA 1V6CA 1ZRNA 3P5BA 1P44A 4KQMA 3G3EA 4PLHA 2QW1A 1FP4A 5ED4A 4LAFA 1QLHA 3CW8X 2C31A 3EUWA 4NS1A 3T8YA 2RKWA 2JZNA 3WL7A 1ZK1A 2P2SA 1NN1A 3SDSA 5LP6B 2QX4A 1M7HA 1VMEA 5AI9A 5ALIA 5LNK6 4L22A 3CRQA 4OQYA 4X6LA 4LCBA 3HFSA 3JR7A 5J3JA 1CLEA 4FZJA 3L7IA 2BWJA 3N0VA 3WV4A 1RC0A 1L5KA 1W8DA 2O3RA 1T4DA 3WTBA 2ASVA 5K03A 3DFFA 4WOCA 1RLUA 3D3KA 4LOAA 4C4OA 1DAPA 3QFCA 5EJFA 1PLJA 4PBTA 2CXUA 1WQ1R 5EXSA 1ZJJA 2GXUA 2NXJA 1KETA 4NJEB 1BD4A 1T5HX 1YNOA 4RF3A 1FSGA 2BP7B 3NTQA 1WSAA 5CBKA 1QRUA 3MERA 1GL7A 3O83A 4JI8B 1R9JA 1ZD8A 4H1WA 5EJGA 1SIBE 1PTJA 1UCFA 4IIJF 1APBA 1YK0A 2NVUA 3JW8A 5IG2A 2BYTA 4UNNA 2OG2A 2OYSA 2J3EA 5J59A 3W34A 4I66A 4DA9A 4GH5A 4JSRA 4D0NA 1NDQA 1ZQ9A 3SQMA 1M6NA 4YUZA 1B2RA 3C3BA 1AQYA 2DC1A 3AVYA 1FTQA 3F71A 1C7FA 1G41A 1O95A 2O2XA 3FNFA 3IQHX 3O90A 1W4RA 4RJIA 2VP6A 1X1CA 1MJGA 2AI3A 5FLKA 4CV1A 4QDOA 1Z74A 5D86A 4KMMA 3SYLA 2OGUA 2VTKA 1VPEA 1P7PA 3OQ1A 3UMFA 5K8CA 2DUNA 2C61A 3B1JA 1U5BA 3DTNA 3H8SA 4M7PA 1KOLA 2UUCB 1IVNA 4LY6A 4XM2A 4RZHA 4EJSB 3GLIE 4H1VA 4D9MA 1A2BA 1PL7A 3N05A 2OORA 5DNDA 4EPRA 4ZKDA 1FLVA 5CFOA 1HYBA 3X44A 3QGMA 2NIPA 4EFNA 5FH9A 1T9AA 4GMDA 5AJWA 3RYHB 2O3UA 3VSCA 3IALA 3CBQA 5CFZA 3PEFA 3SD7A 5FLEX 1T0JB 1M73E 3AJEA 1UP7A 3LWNA 4GX0A 4K3UA 4BQRA 4DR1B 3KQVA 4LYYA 4YYZA 1P77A 3AZOA 1HQCA 4OQ4A 1T8TA 5CA0F 3HKCB 1JKIA 1M83A 5I51A 1NWCA 3HJRA 4UUBA 2ISQA 1RPZA 1Q7GA 2BFFB 5TPZD 2WHYA 3GRKA 1MNQA 2IZOA 4TWAA 3LGSA 3VDQA 4DNXA 1EM8A 1TTPB 1ZZEA 5JCOA 2ZDHA 2YC4C 5T3UA 1YI8A 1QF7A 1NXQA 1T26A 1P39A 1D7OA 1V3TA 2JAXA 1FRVA 1LF0A 2CF6A 1CQPA 2OOSA 4C6SA 4IDGA 3WSTA 4I4NA 2OEPA 4ZO9A 2VHJA 3L4BA 2XCOA 4R1SA 2WBLC 4XQGA 3UMRA 4YHBA 4AF7A 1GYQA 5EZYB 3OBBA 4OHMA 4FI3C 3KALA 3U9TA 2ZCJA 4CUKA 2AT1A 1FQKA 5AW6A 3SS9X 1B41A 3IR7A 5FBZA 2O2CA 1UINA 3GNLA 3L7JA 3PC3A 3EA0A 3H13A 2B8TA 3EQ8A 1H2FA 3QKTA 4X7RA 4Y2YA 1QIMA 3KC2A 2I6XA 1E3WB 1EK0A 2C5HA 4TXNA 3SPXA 2A9OA 3HDQA 1Z5NA 2EIXA 4ZQHA 1CR1A 2BF7A 2O0MA 3JQAA 1CIVA 2DWUA 3ZY6A 4H3KB 1WPGA 2K2WA 3CUTA 1ID1A 4YIKA 3VTKA 2JJQA 2BFBA 4KX3A 5C80A 5T6BA 3JSXA 2OAP1 4DLRA 4I1VA 2X14A 1ZICA 3VDNB 3W5UA 4DWOA 4EG4A 5K0ZA 4PYIA 1RRFA 2QZ4A 2C54A 3W90A 2VZ8A 3EXAA 3I72A 1UOEA 2IA5A 1I3CA 2FSPA 3BIWA 3QH4A 5TMEA 1MRZA 3UKOA 2IEBA 3WK9A 1TVKA 1WA5A 5H7XA 4RA6A 5L7TA 1X7GA 1HDZA 2ZXEA 2ILVA 3U0VA 1WZNA 2CB9A 2RHMA 1EFHA 2X7HA 3V2HA 1Z22A 2RGEA 3A1NA 1Q1ZA 5E4TA 4DJAA 5JMOA 2VP3A 1JKJA 4NZYA 1TOAA 4FEAA 2HMUA 2A9FA 2NUAB 5BQ3A 1TX4B 3W79A 1L8QA 1P0PA 4US2R 2CLLB 4NV0A 4PY2A 1GYRA 3JWHA 3JD1A 5AUOB 4MGIR 5FEUA 3ZV4A 1BH2A 1WETA 4GX5A 2C04A 2PUJA 1C3LA 1R9GA 2AR0A 4GPZA 5FT9A 2UAGA 3PXEA 4TTRA 4ZO7A 4KR3A 1SKBA 5DFAA 4C06A 4AX8A 1WXEA 2X8AA 4OA5A 3ROFA 3OPMA 5DNWA 4NPAA 4OBBA 4FGLA 4A8JA 1PLKA 3E9YA 1RHUA 3P2KA 1YVRA 3PUKA 4YS6A 3VR6A 3WKDA 1PJ4A 1LTHR 4HDKB 2EERA 621PA 4TQUS 4ZU3A 4R6XA 5EUMA 4YCJA 1PG2A 3CZQA 4A92A 3C15C 4A2QA 2VUUA 4LI3X 1WM1A 3TX6A 4Y1RA 1P1CA 1Q0LA 5T3YA 2Y66A 3AY7A 3CEPB 5GY7A 4L5CA 3B9QA 4ZYYA 2FN4A 4FLMA 4JB2A 1QHIA 4AM8A 5JO0A 1DBSA 3DAYA 3K8ZA 3K5WA 1I4DD 2VJLA 1QG2A 3CNEA 2IY8A 3WDMA 4CIXA 4JLKA 3O9ZA 1HQKA 3FVWA 5ALZA 3GJZA 5TR9A 2JIBA 2CLMB 3F1KA 4DGSA 5GMOA 1H1LB 4TYNA 3WA6A 4B6JA 3CX3A 4QELA 3OTQA 3FR8A 5LXTB 4RQUA 1EJ0A 1MOSA 3F6YA 2JD1A 3D7SA 1A88A 2JGMA 2GK3A 3P32A 5C8YF 1EA5A 1FMCA 1WQ3A 2Z8ZA 3KQPA 3OCYA 3EEYA 1QO0D 1S01A 1KYXA 1GGKA 1QQTA 5D3MB 1KQNA 5ITWA 2G9UA 4RFSA 2XNHA 4V3CA 2D2VA 2P4QA 2OCDA 4BV2A 4RTSA 3OMWA 3ICWA 4Z1MD 2RK6A 3MD0A 1JNXX 1RVDA 3KD2A 1I3LA 1KJWA 2J0VA 1O97C 4MRPA 4XD2A 3AEQB 2WF9A 1RQPA 3KHUA 3PEWA 1V43A 2VO1A 1BKSB 4Q1CA 3ZK8A 3BXHA 1JH8A 2R7MA 2YMMA 3G79A 1EFRA 2OKGA 2RARA 3NS7A 4UMVA 1JLSA 5IJ9B 1ZVVA 1JHMA 3I61A 4H27A 2ACEA 4BNTA 1AT1A 4LYHA 4HMQA 2IL1A 2V7BA 4FU0A 2ZS9A 3NDJA 4WFKA 4NQZA 4ZTBA 5T4BA 5BW5A 1N2OA 5T8KC 4KR2A 3G0DA 2Q5LA 1UBLS 2CLOB 4JI1B 3QVJA 3UW3A 1SUBA 3DKRA 5B6IA 5ECYA 3BMXA 2I99A 4XYBA 2WIAA 1EUZA 3EA5A 2EAUA 2MYNA 4ZC1A 4H77A 1GYPA 2IGTA 2P4EA 2QENA 2W4MA 2YMLA 4BO1A 2MSEB 2VK1A 3UEOA 4Z4CA 2YTZA 3RG8A 1S8AA 1ZKDA 3W05A 3QX3A 3DMRA 1ZH6A 3DAOA 1O03A 3JARB 4OQXA 3LBAA 1X1DA 3IVXA 2OCBA 4WVLA 2FLVA 4XJSA 3T3OA 3IHTA 5CB6A 4BJHB 2CMDA 3GEEA 4LNAA 2FDRA 3OZEA 3LBNA 5FCDA 2PZKA 4YN3A 1O5TA 2IZ6A 3VPXA 4LOIA 1UT6A 1GO2A 1O08A 1U7OA 5TLSA 1IE3A 4P80A 3ROPA 2VDVE 1QV7A 5E0KB 2OO5C 3G9TA 1WW8A 4RAQA 2P9FA 3VHQA 1UPUA 1KRHA 3MPUA 3GYBA 1BCSB 1FRFS 2V7WA 4P9NA 5LP1A 4DCMA 3LGAA 5B3KA 2WSSD 3WGVA 4DCPA 2Q45A 3KXLA 3L7AA 3U6KA 4AQ7A 3ZWQA 1YMQA 4ZZIA 2Q1UA 2RHDA 1UIRA 2AHRA 5FWXA 2XMPA 1KH1A 2NO7A 1Z68A 3LZDA 4Q4CA 4NPCA 2JZCA 3GJTA 1L4HA 4I2VA 4E30A 3A4TA 1HE1C 3WGJA 1SO8A 4FFPA 4QYSA 2VEOA 2Y68A 5EIWA 3WYCA 3W3AH 2V6MA 3C3MA 3K2BA 4G4IA 3IAEA 1QRAA 3FVVA 3BM5A 3UK0A 2I0FA 3N2ZB 2WM9B 4UDXX 5E9QA 2W70A 1NI4A 2HY7A 3LPAA 4G56A 4BMPB 4XWKA 3SHTA 1TAHA 1QAQA 3V8NA 4DV2B 3HVKA 1QB7A 5HCNA 4IYRA 1KL7A 1LI4A 2A2ZA 4Y2HA 3SQNA 3UHPA 4WOKA 4F2DA 3RTEA 4CNQA 5FI5A 2I67A 4L4ZA 3UT5A 1C0LA 5FRDA 4P3YA 2WWGA 3RABA 1H3EA 1VLJA 4LF8B 4JYAB 3BE4A 5DXAA 2O8BA 3JZMA 4F96A 3DS8A 4P38A 4N8DA 2C5GA 4FFLA 3BILA 3OJEA 3MWEA 4XQ0A 5IBPA 4H4DA 4MV8A 4JXKA 3ZYZA 1U7UA 2FRVA 3HYCA 5HWSA 3EXIA 3M5WA 3NAMA 1A7KA 4CV0A 2PGJA 4B0PA 3MLAA 2VCYA 3PX3A 1JHPA 1I0IA 1JZSA 1U3CA 1VTKA 2C7GA 2F4NA 2GCIA 4X63A 2C2GA 4NCBA 1FDUA 1EHIA 2HSJA 5BSHA 4KPFC 3HSYA 1DRJA 4OI4A 4LK2A 1ESDA 3FGPA 3FRJA 3W7BA 3C1UA 3ABSB 5IJ0B 1NI3A 2VAVA 1I01A 4AB1A 2D59A 1ODCA 1OTXA 1UWCA 4ANFA 1QH1A 1ZJ4A 4HEA1 3RQSA 5CB8A 3T4UA 2OB2A 2ORIA 3WMFA 3D3WA 4JJAA 2GN0A 2YV5A 4OLHA 3TR6A 2AVNA 2GZAA 3BHIA 3N7AA 5HKKD 1AO0A 3R9IA 3O31A 1RC8A 4OOEA 3VISA 4HN9A 4JJFA 1CVIA 4O2RA 3Q2OA 1EX9A 1J2TA 3U81A 3F46A 5GTDA 1NVXQ 5K6RA 2IZZA 1QAOA 3L79A 3RV4A 4B34A 4E7PA 5KYUB 5IF9A 4M1TA 4WZBA 2ZSBA 2CSXA 1JVNA 3COPA 4AN0A 2VJDA 4UDOA 1YDHA 3N86A 5C18A 2V9PA 1UJNA 3PUWA 2FOLA 3M9WA 2H2FA 1H2EA 1E3WA 4ZJZA 3IPLA 2Q7XA 1E3SA 2LRHA 3F8WA 4HVCA 1H3FA 4MQEA 4WMLA 4HNGA 7MDHA 2GJAA 4WD3A 1EBBA 3DSRA 3QUQA 1P7CA 1ZG3A 5HCUA 3F0TA 4XPIA 1JH9A 4C0XA 3HSSA 3ELBA 3CHYA 5ALQA 3GQVA 2QVXX 4DKJA 3NBQA 1MJNA 1YHZA 4UM7A 2QP3A 3UJHA 4HQKA 1A8SA 2JJMA 5I7AA 1RE0A 3ZHCA 1VSVA 2JB9A 3LBHA 3TEFA 4KDFA 4M86A 5K01A 1I94B 1E0KA 4YBZA 4NULA 4I4LA 1R8QA 3MVEA 4UTVA 3ZDCA 4RQBA 4PEVA 1WULS 5DLYA 3RJZA 3BT7A 2CT8A 5D6OA 1H2WA 3I53A 4N7MA 4ZC8A 3PQCA 3EULA 3AHDA 3LF2A 4Y1GA 3JYLA 4UCFA 4TRJA 4EI2A 3WB1A 4EYOA 1JR6A 2F9LA 2XOKA 3LO8A 1DWOA 1UANA 2XGMA 4HRVA 3FWZA 4P4LA 2NU8A 1RBZA 1Y98A 2OOKA 1Y8RB 3T5GA 1JEQB 5KOJB 4B3FX 3EGIA 4G5QA 5ALMA 2CDRA 3NV7A 5TSDA 4O3MA 4KREA 1QQ5A 4LBYA 2W2XA 3OWHA 5JIBA 2E48A 4YQYA 1LWNA 4EF5A 3CRRA 2FSIA 3RC7A 2C5EA 4DMCA 4Q4AB 2NQTA 1VL0A 1PT8A 2WM3A 3TQIA 5BW6B 3G5LA 5L4SA 3GFGA 4C0HA 3HKDA 1TYEB 2ZAOA 5HSGA 2F90A 4FXPA 4G3XA 4Z3KA 4W9MC 1ESNA 3MJCA 1IYZA 3FCSB 5FL7D 5ES3A 4MINA 1W9MA 2QTNA 1FFXA 5FI0B 2PVSA 2FN7A 1R6DA 1WHTA 1FDSA 1RWQA 3IERA 2IDMA 3EF0A 1RJEA 4A6DA 3KT3A 3GJ4A 1TECE 2NTYC 4CKCB 3ADBA 1XLTC 3GWZA 5KTOA 3VI3B 2UXDB 5DH9A 3V1YA 3WFZA 2RHBA 3R74A 3G8CA 3WBBA 2GZRA 2P9HA 4EA6A 2NTNA 3PUYA 2QRUA 4P8RA 5G2OA 1UKBA 3PD7A 1YB1A 3GI1A 2EDAA 4AUEA 1RZRD 3OA0A 1FMJA 1HXHA 3AP2A 1NQTA 1PN3A 1DZIA 3IL2A 5BSTA 1EUQA 4R40A 1XNRB 3VPHA 3WDLA 3O8BA 3LF1A 1U98A 1JIKA 3N53A 1Q20A 1GRNA 1BS1A 4O4LF 1GSOA 4C0LA 1GFIA 2Z30A 2X0NA 4M0KA 4BLUA 4CEHA 4DMKA 4MA5A 2K7ZA 3ANXA 3P45A 1U0FA 2EBHX 3H11B 1CZNA 2WWIA 1QZUA 4WZBB 5CCEA 2HU8A 4AF6A 2FZCA 3W8FA 5LA6F 1PDOA 2EFYA 2R25B 3ER8A 1WLYA 5HKBA 2R1VA 3AXSA 5PNTA 3EARA 1UFRA 3HA3A 1P33A 2AN5A 4DLBA 2J6IA 3OTIA 5EZSA 3I1YA 5DI3B 1VKHA 4N03A 5L7YA 3IKJA 2ZWIA 4CKBA 4OBXA 4RMGA 4NQRA 5JFTA 2FQQA 5HW0A 2J9XB 2IP2A 3F8SA 1J2RA 3C4VA 1MO6A 1V7QA 4DZRA 1P9RA 1WKCA 3X2FA 2ZBPA 3QBDA 4RHFA 5J2TA 1XNJA 5A06A 1M2OA 4EKDA 3EOZA 1XCLA 1RW4A 5AKJA 1NQAO 5K4HA 4H6PA 5JSUA 1REQA 3RPEA 4JZKA 4DR2B 5FJIA 1P0QA 3EXIB 3LA6A 3MTJA 1DELA 1V26A 5K4AA 3UT6A 4CMIB 3ZD9A 3BMCA 4PAMA 2IEIA 1Z4KA 5G0VA 4JJGA 3GP5A 1E4OA 4KBGA 4RM3A 2VVTA 4EA9A 2Z2KA 5ALJA 3SOZA 5L4LA 2WTUA 2PZMA 5JATA 3HCOA 3CRW1 5KJFA 5DGCA 1YWGO 4ZYXA 3LUGA 3GUZA 1NOIA 2GK6A 2OV3A 1VL5A 1MDFA 4NDNE 4E1BA 4MRNA 3TPCA 4CF6A 1SR8A 2I03A 3BJIC 3D0OA 3KQLA 3TVYA 1P1KA 2DH6A 4X65B 1PGNA 2H2GA 3KTDA 4EZBA 3LTNC 2O59A 4O2BF 4JIGA 4JC4A 2REQA 4ZV7A 1W88A 3RSZA 4WACA 1BN6A 3LKZA 3BZUA 4IFBA 3UK1A 4RHEA 1NWHA 2JIQA 4L6CA 4EIWA 2C1EA 3AFIA 3DDSA 4FHEA 1PVVA 4AG5A 4PLZA 1PQPA 1QCYA 3ZXXA 3IDAA 1X2EA 3Q9LA 2NWQA 3EXHB 1ZYUA 2I1QA 5FQNA 2J9ZB 4K2AA 5I47A 1HDYA 2WWYA 1L7NA 1ECBA 4RVFA 5E1OA 4D1YA 5JSQA 3EVTA 2WU1A 1HG1A 3MLBA 1ECPA 1TJNA 3IEIA 5DHSA 1SOMA 1Y9AA 2PPLA 1VBNA 3WIEA 1K4YA 1FXUA 3GEIA 4RHTA 3SX2A 3RROA 4ONEA 4EP1A 4D9JA 2B3TA 2X4LA 3DMNA 4GOMD 3TJRA 4C43A 3PWTA 4GDFA 4DMLA 2HWXA 1A9TA 2MJLA 4ZK2A 1XPRA 3J81k 4L5BA 1UJ6A 2IEYA 4TZ6A 5TPWA 3S4YA 2XE6A 3WA7A 4U63A 4S24A 1TJPB 3D5TA 3QU2A 1ZPDA 2BFCA 2PRSA 3EBLA 3D7RA 1SCUA 4RKFA 3QG5A 4LV8B 1P4SA 4E5YA 4TSFA 4F60A 2X86A 4QQKA 4F9FA 1YUMA 3O7WA 3PZRA 4CKXA 4ZVRA 1WV0A 1RRMA 4FFOA 4KQIA 2CL7X 5GONF 3OJWA 5KSOA 4MXDA 4MDHA 1ZH0A 4Z9XA 5CNMA 3OLVA 3IBYA 5EP2A 1JBQA 2TECE 1U2GA 1KJYA 3W77A 2XYRA 4E3WA 4G84A 3E23A 4EJFA 2ZRHA 3S0JA 2ZB7A 1PG0A 2PO7A 2VDLB 4JITA 1NM5C 1OOEA 5CX4A 5DXJA 1NN3A 2DFPA 2IYPA 4UVEA 3H1GA 3EGDA 3N2KB 1PK7A 1VHTA 5CT5A 2FP3A 2RGDA 5KZMB 1K8ZB 3B1KA 3AFOA 4MLPA 4JCOA 4R2MA 4BNZA 4Z7NB 1MXHA 2WVHA 4NMLA 5FTKA 1UC9A 1HDEA 1XP8A 3CJQA 1NVTA 2NQ8A 3FCXA 4KH0A 5IP5A 4EABA 3ZY5A 1AU9A 3IP1A 3WKEA 1CQWA 1OILA 3K6SA 1IJEA 3CR8A 3ND9A 5A6SA 1GU0A 1J7KA 1LRKA 2CN1A 3GPCA 5BN5B 3UC9A 1VPWA 3I3SR 1RHJA 3C48A 2C4VA 1XVLA 4MWOA 3UJAA 3G8BA 5A62A 3Q8LA 4TTQA 4C2TA 1R0ZA 5IN4A 5JEEA 2RBKA 4KNYA 3BJRA 1S8OA 1Y3CE 1P1HA 5D3ZA 1GJRA 1T9GR 2EKBA 3CG4A 3AI3A 4NYJQ 5JZSA 4DV7B 2LWIA 2D0DA 1MO4A 3KHKA 1DEOA 4CMKA 4F5YA 2A3RA 4JNCA 2RONA 3BK2A 4LV5B 3I52A 1I7DA 5FBQB 1E3DA 3JWEA 1E2DA 3T7DA 1QZTA 4HFMA 1JJIA 1L5NA 1UDCA 1KIFA 4FBMA 3OIYA 2PQMA 2PX0A 4CL0A 1SJ9A 3ETGA 3ROTA 4E31A 4MWZA 3WGOA 5BNZA 4NL4H 5JD4A 3KJZA 3IP3A 1B2LA 5DBHX 3IE2A 1X1RA 2WJZB 4DMMA 3VO1A 3MJHA 4TPKA 4FNAA 1E2FA 2BI4A 3UANA 4DIUA 1Z6ZA 2IHNA 2JFVA 5F7XA 1SHZA 4G9BA 4R71A 2XXAB 1WY5A 1WCIB 2CLCX 2FFRA 5AXDA 1KQPA 4XIYA 1LX7A 3SLKA 5DWDA 3NAQA 3UUWA 3ZX5A 4DY6A 3D6FA 4S3MA 2QL9A 2JI9A 1V5EA 1C14A 1U0SY 2VBIA 1F4LA 4FDAA 1QC5A 1C1XB 3DQQA 2MSLA 2CZCA 4M98A 3W6PA 4I0WB 4QBTA 5CITA 1J5EB 1PKEA 1YAJA 2REOA 4QU0A 5KSYA 3KQNA 4HGRA 1N2XA 4RTMA 3QFSA 2UVPA 3OCVA 3R0VA 3ZLUA 4WGGA 2C9CA 4WK4B 3SNHA 4KI7A 2FOIA 2ZJ4A 2XMZA 2WJ4A 2D2XA 3OX4A 2AYXA 3IA7A 4M0DA 3C3WA 5TVKA 2HSEA 2C20A 5L4NA 3F3MA 3DV0A 2WD8A 5LM3A 1ZUD1 3D5EA 3L7LA 2ZQYA 4FEYA 4QYXA 4YT4A 1OGJA 1ZWKA 3K92A 3ROZA 2JIZA 3CRMA 4N65A 5E1MA 1O0SA 3DF7A 5J9FA 3L02A 3VVCA 1X8XA 2HNBA 2FUG1 3X43A 1SXJB 4EJMA 1X14A 1Y4UA 4X7PA 5DYGA 3CWZA 3BKXA 2A7QA 2OXCA 1WDMA 2GGSA 5IARA 5TIIA 4PZ0A 5H80A 2FZ5A 1DKMA 2PYZA 4ZVSA 4GWGA 5LOVB 3FVQA 4QYMA 1PZEA 1H8HD 3GUUA 3HLKA 3RFVA 3KJHA 2IXAA 3PC8A 1P2TA 1OJ7A 2WTBA 4UHFA 3FYUB 4GMXA 4UU8A 3DBVO 3HN2A 2HA4A 4L4XA 4NBKA 5EXXA 1HE8B 5JZVA 1QK4A 2B78A 1T2UA 1K0FA 2GMWA 3KKEA 2DBRA 2XLCA 4DYHA 1KJ9A 4FLFA 4G5RA 4GMHA 2QU7A 1NXPA 4MCJA 1QKJA 3T7RA 2J8ZA 2QVYX 3EOBI 5HPYB 2HX1A 1EK2A 2JFBA 3JR3A 3N8IA 1KMNA 5KOHA 1PFWA 1V11A 4BEWA 1QJ4A 2E49A 2AFHA 2OORC 2Y92A 2C8LA 3FTPA 4LJSA 2IIBA 5FWXB 3N5CA 1SQGA 2CHGA 4DCJA 5DWVA 4GL4A 4IJ6A 1MXFA 3SYTA 2VK8A 5DDIP 4BIMA 4UE6A 2WHQA 2I33A 5DLQC 1CUJA 2QTMA 3OEYA 2ZIEA 2AV6A 4RTRA 3BULA 2H1OA 1OFUX 2PX5A 3R3JA 5CDTA 5HVNA 1ULAA 4PINA 3SR4A 2Z08A 3MWJA 2LCQA 4OI2A 1U5BB 2VK2A 4IHQA 3ZS8A 1XVVA 1NW7A 2P9BA 1NR7A 4RPLA 2YHBA 4E15A 1WP9A 1Q95A 3FPSA 4L7VA 3UICA 1JDPA 4DLXA 1Q0PA 4EW2A 1TO6A 1ZRHA 1QTNA 2FEPA 4L50A 1C9MA 2AOUA 2FMIA 3DAHA 5JARA 1QORA 2QQGA 3OUTA 3K6JA 1QYCA 4D56A 1UK6A 2ECPA 3T9EA 1E7SA 1HK7A 3X2SA 4C21A 3PEYA 4KODA 4P36A 3C8HA 3U44A 4OV6B 1DX9A 5IAGA 4K7JA 2BEJA 4FEEA 3HPQA 3GG2A 3HJUA 2NZ2A 3LDGA 4IIJB 5K3AA 2PZEA 1CUGA 2EWMA 2ZAIA 4BCBA 4P7KA 4PHGA 4CR8A 3FOFC 3I64A 3R7NA 4I7EA 4KQJA 3C3CA 4XSVA 3RRBA 3BHMA 3HABA 1QH0A 5ALYA 2X0IA 3H84A 3QKIA 4DUGA 1ZM2A 2ZR7A 5HUQA 2IX3A 3E1KA 4Q01A 3G2LA 3MAJA 2FWIA 1KRWA 4L76A 3P0JA 4WX2B 1W25A 1ZGZA 3E5HA 1SFRA 1HETA 3CLTC 5CBPA 2UUBB 3TLMA 1W88B 1LTQA 1OI4A 1ODSA 2WHPA 3LWZA 2V54A 2HJWA 4QBKA 2PY6A 2HPAA 2POCA 4XD7D 1E4EA 4XOIA 4ZQGA 2CMFA 5FUVA 1YZNA 3Q1KA 2WKRA 4X6YA 1COWD 3OZXA 2B7CA 4BMZA 4ZEVA 4R1QA 3WQQA 1T9KA 2H2AA 3INNA 1O96B 4KPEC 3N0TA 1O97D 2F62A 4JUBA 3SMQA 2TS1A 5TQ2B 4FOOA 3RS2A 1R50A 2Y05A 3FNHA 4G8JA 4HXYA 2G1PA 1C2YA 1XDUA 4ZALA 3MD9A 2UZ3A 4QEZA 4AFNA 1BQ3A 3CSSA 3MS4A 3JCZA 5FA5A 3U1VA 3CVWA 1PL8A 5IBCA 1ENZA 1EFPA 4K8RB 2FDCA 3ZI4A 2IYFA 1E9DA 2B9EA 1JG3A 2IVFA 2O2JA 3F90A 4O08A 4PYKA 4Q1DA 3ZZ0A 2VH2A 3ILSA 1QQ6A 1PGJA 4DSAA 2SCUB 3I09A 3NEPX 5CAEA 1XRPA 3VX4A 5FTJA 3CRNA 4ECEA 5CDHA 4G5GA 1S0UA 3OFSA 3ROKA 2VZEA 2YQ4A 5D5QA 3L7BA 1N9GB 2D0OB 3GLRA 3BTSA 3KR1A 4MO2A 4RKQA 5ESWA 3WJ2A 2QSYA 2RHTA 2YDXA 1K4KA 4PZPA 4DV4B 4TMVA 4D0GA 3QEKA 2PQ2A 3NALA 4KMOA 4Y0NA 1KWGA 3H83A 3ZQ6A 4HDMB 4AS1A 2VLBA 1N78A 2ZJOA 5CLGA 5IC4A 1RI4A 1SXGA 4GOOD 2Z2ZA 3K4QA 5U1PA 1U99A 1ZH2A 2CJYA 1SG6A 3H0EA 4ENSA 3NHKA 1AZLA 2W6QA 3H1TA 1QJCA 4P0TA 3KQMA 1S7GA 4UPVA 1QS0B 4OQDA 5MDHA 3E82A 1I36A 1AS3A 3D6NB 1GY8A 2J08A 3NO4A 4RZSA 4KIUA 1SC1A 4CFZA 1Q16A 3MPOA 4DCOA 2GKSA 2ODAA 1YH3A 2BHRA 2BC9A 2Q3HA 4HADA 4UAGA 5EY5B 1TMYA 3P19A 1N5LA 4YO8A 5K1ZA 1CU1A 4Z49A 2J0UB 2GPAA 4L5YA 5IAKA 3E7PA 3PDUA 4PNHA 1YQWA 3PI7A 1CK4A 3VZSA 5K0SA 1ISGA 1QTRA 3EXFB 2VLIA 1YHYA 2C59A 2FYTA 3GGDA 4R1OA 2CL6X 3IHKA 5I4CA 1LZLA 1NJSA 3DW3X 1QRSA 3ZGOA 1CBUA 3N6XA 3CO5A 3NTUA 4Q12A 3HXQA 1CD5A 3ETJA 3MWGA 5AKKA 4L27A 2G63A 3LW8A 4XX0A 3ZZNA 2FX2A 1RYZA 3DC7A 2O05A 4X91A 2A1UB 3RUHA 4DT1A 4QKQA 1MAUA 5CEJA 2F3QA 1KAGA 3DF9A 3U6BA 4WXPA 4C22A 4DSOA 2X8LA 4JHLA 3USES 4BKQA 5TF0A 1XDSA 5JAZA 2C2OA 4NHEA 3SBOA 2Z8YM 4KMSA 2BGNA 3RYFB 5DEOA 5JQGA 2F1KA 5LMNB 3IEXA 4MQFB 3VX3A 3WZLA 1XTIA 5KKCA 2QAGB 2WAYA 1W59A 3I4LA 3LI2A 4YROA 1YQ9A 4HG2A 1KDYA 4Z6KA 2XGOA 4J0GA 1HTTA 3S55A 4TQAA 3PXXA 4B7UA 1ZWLA 5KYXA 5I3ZA 5BVGA 5J5VA 2YIVX 2FRDA 3DOFA 3MRTA 4CLXA 3HUTA 1ZMXA 3EWAA 3AR9A 3QPUA 3U9LA 3ZY2A 1M1ZA 3V1KA 2ZM5A 2I9KA 2QBYA 1B43A 4BFWA 1BOFA 4KXXA 2GUWA 2PHZA 3SVLA 3DXZA 4DA0A 5LZ5A 1S2IA 5C8ZA 5IH7A 5IKEA 1RCTE 2DHDA 4UTNA 4LE2A 3CZPA 3GJ3A 3VGPA 2AG1A 1ZFNA 1U63A 1EP1B 3KG2A 4UEKA 5H83A 1CG6A 4FYIA 2QRLA 4N7RA 4CF4A 5CB4B 3DBOB 1E1DA 2DJIA 1WF3A 4JKIA 1L1FA 5L3QA 3JRXA 2HH9A 3KQYA 3N2KA 2P9CA 4MKFA 2ZK7A 5FBRB 3NWBA 4FYPA 1Q83A 2VOEA 2ZVQX 1WPQA 3EFHA 2FZWA 2X5XA 2YZNA 4PX5A 3ZDYB 3ESBA 3QUCA 1BMDA 2VP4A 3VZBA 1VJ1A 5AWFC 1DO2A 1ZJ5A 4I8XA 3O8OB 4Q4DA 5IASA 1E7MA 3W5CA 1W96A 1AXEA 2PSSA 5ILGA 5J4LA 4TVKA 4JXXA 2ECOA 4H60A 1KDPA 4Y0VA 5JAIA 1A5TA 1W49A 1HDIA 1KVQA 2EJCA 1R18A 4R1MA 4HDRB 4EVSA 1T25A 4LDPA 3KM0A 2NXCA 3GNQA 3TRKA 2R60A 3OT4A 2WFAA 1PYOA 3GCGA 3IAUA 2YNMD 2QXYA 2QVBA 4J1QA 4QDZA 4P7GA 4U2FA 4W9RA 5HUHA 1LXCA 3X1YA 3K8OE 3T3NA 3FTQA 1PX2A 3N7UA 1LNSA 1W75A 2YKGA 3MM4A 3CT6A 1A1SA 2H4HA 4CLOA 5AR1A 1ZP6A 2W2TA 5AHWA 4JB0A 1SVSA 2DTEA 3K70B 3WZ2A 2Z2XA 3P0HA 2AC2A 5PGMA 4DIKA 4Y9SA 4M46A 4YAWA 4WK6A 3QMWA 1ZK2A 2O0LA 3F1LA 4D3DA 3IJPA 1N2CB 2Z6VA 4P08A 4BFSA 3NAZA 1ZBQA 1D2MA 2HIAA 1HG0A 3BCRA 1PZFA 1JQEA 4FHFA 3R3SA 4EL5A 1X77A 2V3CC 2AC7A 3WNCA 3V1MA 2JGJA 5CFNA 5B1SA 4HNSA 4PPNA 1ZJZA 3EX7C 2A5DA 3RG2A 4S12A 1P17A 3LX4A 4U1RA 1UBCA 1P29A 3JQFA 1S5PA 1UDRA 1VDMA 2X3FA 3T9AA 3ZDEA 3QEBZ 2ZYIA 1KY4A 3ESDA 3DOJA 2ZUBA 4IQ4A 4PRZA 3L4KA 1L5QA 4AJ2A 4J7XA 2REQB 3AJRA 3WDKA 3CR7A 2VDUE 4NSNA 1GAEO 4D41A 3G2NA 1FE8A 1V9SA 1TD9A 2JGKA 3D1LA 2HSZA 1XBTA 3VKVA 2VH5R 3U3XA 3AF4A 2BKXA 2C9YA 3GDGA 4HWRA 4YFVA 5EEHA 3T94A 2X5OA 1PO7A 2VP2A 5DK6A 3R3YA 1F1JA 1YF3A 3FYHA 4XEHA 7REQB 1OT5A 4FONA 1WXHA 5B3JA 3A70A 2PS3A 4I5IA 4BAZA 2SKEA 5BYJA 1I7PA 2F3TA 3B13B 2C7BA 4QGHA 4UXJA 3UWDA 4A15A 5COQA 1U7PA 1IJKA 4OK6A 4D3YA 1CETA 1MUUA 3L8HA 5JSHA 3OE1A 2YVLA 1BFKA 1KAMA 3JPWA 4LJYA 2PMCA 1GZ5A 5CHEA 4D8WA 3LOUA 2D4AA 2C9ZA 1Y9JA 1K7EB 3D3WB 1ZEMA 3FKJA 2HN9A 5C8DA 5ALXA 5KJ1A 5B1EA 3QA9A 2LDXA 2FWAA 1VLVA 4RSMA 4Q47A 2R47A 1E5QA 4L2IA 3V97A 2R00A 5IJ0A 3JQ7B 1Z5WA 2YASA 4ZCRA 3LUKA 1C41A 2SCUA 1Z5OA 2LE0A 4CM9A 4NMMA 3EOAI 3PQ5A 5CXUA 1OXKB 4QPJC 1E1NA 3UM9A 3VYSB 2FK8A 2H2HA 1M9NA 1Z39A 2WV7A 3Q6NA 1BQ4A 1FXWA 2JK1A 2Q8QA 4OX9B 3ISVA 4LXYA 3S44A 2RAUA 1M5UA 1FW6A 1DARA 2FG6C 4HUJA 5FB3A 3L2OB 3VJLA 4TZ0A 1IJBA 1SAYA 3FDIA 4QDXA 4NY1A 3B6EA 4PLGA 2YRFA 2XUPA 3RGGA 4CDMA 3FFAA 1WB6A 3FZQA 5JCPA 5CVUA 3K3PA 3RVMA 3T54A 3MUEA 5JISA 1BVHA 3OOJA 3VVMA 3TW4A 5KREA 3QVXA 2KWIA 4O25A 3AR5A 1DKRA 2KM1A 3OCZA 5IVHA 4N5IX 1N5OX 4LCEA 4ALLA 4BXOA 4Y98A 2N1MA 5KBYA 1SCQA 4RF4A 3N8NA 1XD8A 3IT3A 4LZZA 3NGMA 1XCBA 5F5XA 4AICA 2ATEA 2GBGA 1P72A 2GFHA 2OM6A 4ADSG 4AQDA 1H94A 3P9SA 1KI4A 5KHLB 2VSXA 1Z6XA 5KYWB 2QLBA 3G7SA 1G8KA 1RXCA 1C1YA 1X1SA 2JBHA 4RELA 4UDYX 3QSYA 3IQFA 1KP3A 2PL9A 1TD1A 1OXVA 5D8DA 5C5DA 2NT3A 3PVCA 1GZDA 4QPDA 2DSNA 2I8LA 5HGJA 4Q3KA 5CLLA 1DAIA 2FQ1A 1TZMA 1NTRA 1QOPB 4MP6A 4NU8X 1Q1EA 2BGKA 1NYRA 4N48A 2H8KA 4ZO6A 2IU0A 4LE0A 3U37A 2Q21A 4OK3A 3V4ZA 2GCGA 3IXLA 1ZZGA 1RRPA 3KYBA 5DHPA 5AW0A 4JYZA 6YASA 3S8EA 1PR0A 3K5IA 4N3CA 2J09A 3COWA 1E3LA 4PGMA 1GR1A 4RESA 5CLIA 2BEUB 3Q0IA 4GI7A 2QJOA 3KUDA 1E2JA 1SC9A 3ETDA 2A1UA 4B79A 1CSEE 2NGRA 3CYFA 2FWNA 3K0AB 3DZBA 1LSJA 4Y9TA 4DW8A 4OKSA 5DBEX 4KIWA 2VYCA 2RGWA 2XWQA 4GICA 4EG7A 1ZVQA 1P7ZA 4XUCA 2GDJA 3ZHZA 3WLPA 3DKPA 1XALA 1A9XA 1NSTA 1DI0A 3I01M 1Y1SA 4NBVA 3V34A 5EJEA 4LF9B 5JVDF 1R4NB 4PRLA 4ZDWA 4P93A 3TINA 1FUKA 9ATCA 3MC1A 4IUBS 2C4WA 1PU2A 2FG5A 1U4SA 1XZIA 1CS0A 2G1UA 2XWJI 2QRVB 4HC4A 4TV8A 3ZKWB 3T15A 1CRPA 3AEQA 2ZATA 1O6GA 2DGDA 4IDBA 4I6EA 3LQQA 3NKVA 4M54A 1E1LA 1ZC4A 4YQZA 3O2QB 3M0EA 1Q77A 3PPYA 2NUTB 5E6UB 5MN5A 3TSAA 4B85A 5CU7A 4UTXA 2H48A 1ZW6A 2PRIA 3E7XA 4XUDA 2XRYA 2WKQA 3A1WA 1JFLA 3OSUA 2X0DA 1ISFA 4C4ZA 3RU7A 3GC6A 1N1DA 1RLIA 3JQEA 5I7HA 3S29A 4BFYA 2OO3A 3Q88A 4YQFA 1QBGA 2DCMA 2A86A 4KXQA 1E3EA 1OV6A 3EMDA 4M0UA 3ZS9A 1H1TA 5HMLA 4ZV4A 1HMYA 4JI7B 1F8YA 3ETCA 3DM5A 5CUQA 2FGJA 4CCYA 2VFAA 2ZSAA 4Q15A 3EPJA 2QAGA 3N2NA 4L7QA 4AJJA 5IU6A 1CR6A 2VJKA 1SIOA 3UA4A 4NESA 4C3ZA 4UQLA 4HH0A 2WJWA 1LS6A 2M6SA 3CCCA 3DHEA 3DEZA 2PX3A 3EVZA 2QRZA 2YVAA 1DTSA 2ZJAA 3BFVA 5BUQA 3ON5A 4FMBB 3RF7A 3I5AA 1F2VA 2ZJYA 3PF9A 1F48A 1ZBDA 2N9UA 4YJFB 4UFPA 4DIFA 4IUYA 3W5JA 5D5PA 3A6JA 1EVIA 1Q3KA 3FPGA 1FVXA 1I6WA 3UHJA 4C2AA 5LQRA 4KRYA 1FOEB 4ZCIA 1ZK0A 4I36A 4B6PA 3E9DA 7MHTA 4XJVA 4QX6A 1KI2A 5LB4A 2Q1XA 1ZD5A 2G4CA 5EGSA 4GPAA 5T6MA 4G5OA 1N8NA 1TZJA 2C84A 2H2WA 4ZPJA 2B92A 2RC5A 3TQQA 4Q3NA 5C3UA 4CT5A 4RDXA 1A3CA 2G0NA 3RWOA 4E1AA 5KNDH 2ZUWA 5HMMA 3V3TA 2Y3IA 4EA7A 2QN3A 5BMVA 4V38A 4L8VA 1J8VA 2VAMA 2VTEA 4WN9B 3SIPA 3I9LA 1KYQA 4ESEA 3S1SA 1WEKA 2XB8A 2I7CA 1BDJA 5EVCA 1KI1A 1F14A 2F9MA 3H75A 3PA8A 1KJQA 3TRJA 4ETMA 1ZJYA 2FV8A 4JEMA 4E0BA 1WB4A 3CZAA 1XKLA 5ELMA 1Q5PA 4JI0B 4F6LA 2PUBA 1FY2A 1AGNA 3AB3A 4PGHA 2I7DA 4M0FA 3FRHA 4OREX 1C4OA 3IP8A 2RJOA 4J4BA 4ZDKA 1FDVA 3HL4A 1EE2A 1PW5A 3MSXA 4EBBA 1XUOA 2XD9A 2F59A 1KNQA 3U5ZB 5KS2A 3LQKA 3VPDA 1NNSA 1Y7PA 5IAEA 2WR8A 4DEXA 1E96A 1VGRA 4HEA6 2D7DA 3UKDA 1Z0AA 3B8HA 4J3FA 1FP6A 4HD8A 2AOUB 1Y9DA 1BXZA 1XELA 4IX1A 4Q19A 3RAGA 3T7TA 5AIAA 4ER0A 4DLZA 1QHXA 3NYIA 2RB5A 1UKYA 4HY3A 5IANA 1V1MA 1GGHA 1LRJA 3GH1A 3T7CA 5BPHA 4OHRA 1WP4A 3QVSA 2BFEB 3KELA 1DHTA 1TW3A 3NUZA 5DN6A 4N12A 5BQFA 1BXRB 2AR7A 2H06A 3TKLA 2ZXFA 2E5WA 2XUJA 1HEIA 2B1QA 1K68A 2WDZA 5D00A 1UR5A 4RANA 4X9XA 5EQJB 5K8VA 2D1YA 3ZLBA 1L7VC 1ZCAA 4INAA 5K2MA 8GPBA 2P8SA 4RNDB 6AT1A 4BRSA 1W7AA 1I9GA 821PA 2B1RA 4X90A 3M6UA 1CP2A 4RD6A 5LBIA 3HBFA 3KOUA 1F0YA 1GKKA 2A5GA 1YFLA 1OYWA 3IQWA 2IOHA 3EIUA 2A3NA 4XTRA 3BPSA 4DLYA 3C6KA 3AXTA 3BD9A 3EGOA 4CLRB 2G70A 4IW3B 5CA1B 2IQIA 3QIVA 1L7QA 4PU0A 4Q18A 5E4YA 1Q19A 3U4CA 5ECGC 4ARZB 1YXMA 4UM8B 3JVDA 5DM1A 1KY3A 4IDOA 4TUYB 4YALA 4EKEA 1OPXA 2P65A 4EKIA 1J33A 3PDIB 2QP4A 1W5EA 1UFQA 2GEFA 3BD8A 1U7XA 1C9NA 4J1SA 4KE6A 1JI0A 1FDTA 4B4DA 4YRIA 5AVRA 4JLMA 3X1ZA 3B3FA 3DHVA 3DXXA 1FTWA 4A23A 1IM2A 4YP9A 3ZPXA 1GLVA 1R0LA 4LIPD 4JKOA 4UBJA 2G0AA 4LOLA 4E5SA 5BYAA 2XNSA 4IM7A 2PUVA 5EWMA 5TEWA 3WXBA 5HOQA 4QA9A 3D8NA 2QN1A 1LWOA 5C34B 1KZHA 1VHDA 2R65A 3NEAA 3V7YA 4WGFA 2QPOA 3IRUA 4J2TA 4PHHA 5AOCA 1IUKA 5AXCA 4BATA 4BBZA 2Z09A 4RKEA 1MT3A 2EGHA 3BWDD 4CGZA 3AUSA 4BNLA 4CIYA 3EFOB 4IEIA 3A7EA 1OXBB 3AIOA 4DV1B 2H17A 2DR2A 4F7DA 3UG6A 1X1BA 2WKWA 4AWBA 4B7CA 2IOQA 3B7PA 1QVAA 3OEEA 2C7VA 4BQPA 1A5SB 3Q40A 5BR4A 4Q9NA 2BBOA 1G20A 2ES4A 2NU9A 1MIOB 3RIXA 3V8RA 5HA5A 3VR2A 3DC2A 4B6RA 4WBNB 1G2IA 1Z7EA 3B2NA 3TX2A 1JA1A 3OEHA 1Y7LA 1NX6A 2J6BA 2W4IA 1M2EA 1Y63A 2G88A 1U0TA 3F74A 4NABA 2QD5A 4HATA 5DHFA 4CMEC 4X8OA 1DBQA 2VRWA 4IEFB 3K0HA 1OGYA 4YMWA 2XOKD 5ALWA 4ZAYA 1DJMA 5KHAA 1TFRA 3ZLTA 1CJKC 3VVLA 2CYBA 3KU1A 3N8KA 2GHIA 3HA2A 2FEOA 2EWVA 2CEKA 1DXQA 3QA3E 5BWBA 1SY7A 4PV7A 3K1TA 4FC7A 3GZNB 3MBKA 1ZNYA 3ELYA 3KOXA 1ONBA 2GCOB 5G40A 4UZSA 4CNBA 4LK3A 1BW9B 2FFHA 3C7TA 4K3VA 5AI8A 4E09A 4UM9B 3FHJA 2EC5A 2X2EA 2W98A 3LP5A 3QVGA 4S2EA 4XZ3A 3A1SA 1MQSA 2XIQA 2V7XA 5HF8A 3ND6A 2I66A 4Z4GA 2Y2VA 4RQTA 4IF6A 1REQB 1UZLA 5TEVA 2RMKA 3LTEA 3GU3A 1T1JA 3HWX1 1EIWA 3OO1A 2CD9A 2P1ZA 3L5OA 3BTUA 5TC4A 3FYCA 4RZXA 4LFBB 2ZROA 5C5CA 1J2YA 5CYGA 2OZLB 5FULA 1NVFA 4CMEA 1JEJA 1ZUIA 2GAOA 2BCJQ 1NVEA 1IQUA 3GGSA 1T5TA 3WYDA 1MFPA 4FGSA 1TCCA 2AFIE 3ICVA 3GL9A 4TN1A 1AJEA 3KZVA 3SC4A 4LQLA 4RCZA 5JJIA 1FUEA 3HCDA 4AYTA 1OLSB 2V7VA 5LC1A 4DLAA 3TF5A 3ANMA 2WPDA 5T7BA 2WHXA 1TFUA 2O3QA 5EOVA 2QE7A 3KEQA 1TLFA 3LBIA 3CLRD 3IESA 3QOXA 2ZOSA 3QPBA 4HLDA 2DHQA 1TM2A 1VHLA 4W1QA 1E0DA 3LBYA 3K0FB 2BKVA 4CEHB 4DL9A 5A6VA 1R6UA 4HNAA 1NU8A 4BV9A 3PSHA 2IF2A 1ZOOA 4NZOA 4D9EA 2CYCA 1NURA 4DCSA 4Z4HA 2DFKB 4AVYA 3TSOA 1C0KA 4FMDB 3AY6A 2F55A 5EN4A 4UMDA 3VZCA 2MSDB 3CSDA 3DZJA 2GAFA 3CF0A 4HQRA 3JPYA 1Z13A 2ST1A 3OJFA 3CCBA 3JYPA 3M5PA 4YMHA 4D8XA 2FWRA 1EZ1A 2J41A 3LPDA 4LJ5A 3RF6A 3MOIA 4JV5B 2Q5QA 3KAPA 5DBIA 2X6TA 2AX4A 4H3SA 2JEZA 1NUHA 1NT2A 1P1BA 3QITA 2GJ4A 4KQ9A 1DBRA 1I2MA 3CF2A 4MZDA 1WD5A 5EZQA 1TM5E 1JDTA 1UKVY 1XA4A 2AGVA 5EVJA 2XDQA 5B1HA 3G2HA 4HEHA 3TQOA 4EB0A 1Y1LA 3GT7A 4OSOA 4BCCA 4CG2A 2JLVA 1II9A 2DOKA 1E5VA 4AKEA 4J6FA 2FPSA 4UQPA 1I2BA 1SELA 2UXBB 1W1WA 2D3WA 2X8WA 4GOND 2O2DA 2F48A 3ADOA 3LVRE 1JYFA 2CUNA 2DYKA 1MNAA 3AWDA 3NHFA 3PYMA 3NKFA 3R5FA 4HMOA 4BP1A 4B3HA 4KQFA 4BCDA 4QBGB 3UMMA 4U7DA 3ZGVA 2CBXA 1B42A 3IAXA 4DBLE 1GEGA 3AUKA 4MUBA 1QFJA 2YBEA 2BDEA 4NI5A 4TXJA 1NA5A 3DE7X 4N40A 4TS3A 1H9AA 4UVDA 5IDQA 2IHZA 5BWNA 1J06A 3WS7A 5DM60 3D6UA 4RTQA 1V8FA 3GCZA 5A5VA 1EWRA 1LQUA 1M7BA 2WKPA 2R87A 2X5JO 3AINA 2BEVB 5H1YA 3KSRA 4ZCSA 2J3KA 3GO4A 4N7JA 5BO5A 2J4FA 3CKYA 4BNYA 1KDTA 2LIVA 4DHEA 7ABPA 2IPOA 2UZ1A 5D1HA 2LR0A 2P2LA 1KO5A 5FORA 1XTPA 5AK5A 4EKGA 5I8PA 2E4AA 5F5LA 4XVUA 4BJ1A 2HRQA 1NFRA 1SUCA 5BN5A 5I9NA 4QOGA 3TLAA 4QUAA 3WSVA 1PEAA 1GU1A 2R8XA 3U7HB 4JXZA 1YS1X 2NTJA 3LLCA 4A0FA 4BNKA 3IXMA 3OM0A 1T4MA 1MAWA 4R05A 2W2MA 4TYWA 1E3MA 1UWKA 1U2TA 1PGQA 2Q27A 5IZCA 5EKUA 1XCMA 4HB2A 1CYDA 4TMFA 1KP9A 1CY4A 5T41A 3RRFA 2QNBA 1EM6A 1KZ6A 3F6RA 1KFEB 1GUFA 3PIIA 1I8TA 1Q57A 4PLTA 4HJRA 4PSDA 4YRCA 5KQPA 4Z4EA 1BXRA 2G04A 5HTKA 2E4VA 4BMCA 1BVRA 2QNRA 2Q28A 2ORED 4BZWA 2NAPA 1U3TA 5AM4A 3MT8A 4HWTA 1WMEA 3TTUA 5CFMA 2HUNA 2VYQA 2Y1DA 3DUFA 1ORWA 4GHWA 2B4AA 5UKDA 2OXRA 2R5NA 2PD4A 4PX2A 4FWIB 3ZW9A 2QZ9A 3DXYA 4FQ7A 2R8ZA 2JLYA 2ESRA 5T67A 1VA5A 1VP9A 4FOLA 1U2EA 3I9NA 3LUDA 3QVGB 3P26A 2UV8A 1EVYA 4YJ3F 1TKCA 3MB5A 4OQMA 5CVTA 3UFBA 3A2NA 1QHGA 3TZEA 1V41E 1DLJA 1LDBA 1C30A 1KHTA 3NVAA 4M37A 1ADYA 4OGFA 1XK6A 5DX1A 3UATA 1SUEA 1QF6A 1W5SA 1OC2A 4ZRDA 1LQ2A 2AJ8A 3A6KA 5K0LA 4C07A 4XM0A 1RE1A 4HLCA 1US8A 3OBIA 5B4UA 4KSBA 1XHFA 3U60B 4NH0A 4B43A 4DDHA 1K9VF 1DKNA 1GDDA 5JQGF 1JHAA 1TYDE 3KETA 1OFVA 1UOQA 1JEDA 2QV7A 1VSTA 1N0HA 4NYIR 2CXTA 3GARA 3M1AA 3MQ2A 4ZVKA 3TIIA 4YV7A 1M2VB 2H9YA 2PGDA 5U9CA 1U2RA 2AVDA 1SCAA 2JIZD 3DDNA 3MHPA 3O93A 4JJEA 4WIAA 3ZHOA 4A03A 3EAFA 3WBJA 1EFUA 5FP0A 2ANBA 1V7ZA 1JSXA 1PNQA 2QPAA 1UPAA 2IUSA 1IN5A 4IO0A 4REOA 5D7NA 1OXMA 4INPA 5IKOA 3KEOA 2FWBA 4RS4A 3GRYA 4ETIA 4KO3S 3RREA 2D06A 3KOMA 4U2EA 5B2FA 3IULA 1DIGA 3UMVA 2DB3A 3CUSA 2RIPA 4M49A 4NZZA 2MCFA 3EZ6A 5AVYA 3PYLA 3PHJA 5G3YA 2I7TA 1QP7A 5TQ2A 3AHHA 2FW8A 5DOZA 3OAAA 5KNCD 1RS0A 1CY0A 4QRIA 2FUEA 1F06A 5FBVB 2BPOA 3NTRA 1NZFA 4KUGA 3LUPA 5LU8A 3RBAA 3NDPA 1THGA 1ONOA 3KR2A 4DNFA 1TYAE 3VNAA 2YNMC 2DLNA 1JR2A 1USWA 1L1EA 2X9GA 1R8XA 3H97A 1O94A 1P8JA 4YP6A 1J0DA 1ODTC 2B2CA 2PX4A 4NH4A 3OUUA 4JODA 4XX1A 1H4TA 4KGDA 2VDJA