4UG7A

Structure of bacillus subtilis nitric oxide synthase in complex with 3,5-bis(2-(6-amino-4-methylpyridin-2-yl)ethyl)benzonitrile
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 120
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ug7A01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ug7A02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ug7A03
5FVUA 4CX2A 1M9RA 1DD7A 3NLYA 4K5IA 3UFTA 1NOCA 4UGDA 1MMVA 2G6JA 4UGOA 3E7TA 4CARA 1NODA 4CX1A 4JS9A 1DM8A 3RQLA 3PNEA 4UH3A 4CTXA 1DMKA 4UGVA 1FOLA 1ZZTA 5FVQA 4IMSA 3N5XA 4LUWA 5G6CA 3JWYA 4UGLA 2ORRA 5G65A 4UGAA 4D7HA 3DQRA 5G6PA 4D37A 5FVZA 5G6QA 1NOSA 4EUXA 4UGUA 4D3MA 3B3OA 3N6EA 4UQSA 3N5TA 1P6NA 4UH2A 4UGHA 3E6OA 5ADIA 5FVVA 4JSHA 3UFVA 2FLQA 1P6IA 4KCJA 4NOSA 3N2RA 4CTTA 4CU1B 5ADJA 4UPTA 3NODA 1VAGA 4JSGA 9NSEA 4CTQA 4KCHA 3E7SB 3RQPA 1DMJA 5AD8A 4UGWA 3N65A 3NLUA 3NLXA 3N69A 1DM6A 4UG9A 1D0CA 5G68A 5FVYA 1P6LA 4LWBA 3JWXA 3NLZA 3NLPA 3NLMA 3Q9AA 3NLIA 4V3XA 3UFSA 4UHAA 4D3JA 4CUNA 4CFTA 4CTUA 3TYOA 5AGOA 3TYNA 3N64A 4D7IA 3NM0A 1D1XA 3N6AA 1K2TA 3JX5A 1LZZA 5G6OA 1D1YA 4CX0A 1N2NA 3JWZA 1QW6A 3JX6A 2FC1A 1OM4A 2G6IA 3RQKA 4LWAA 2OROA 3HSNA 4D3AA 1ZVIA 2G6LA 4KCOA 5ADLA 3JX2A 4D31A 3RQMA 1M9QA 3JWSA 3E7GA 1JWJA 1M9MA 1QWCA 3JTAA 5FVPA 4IMXA 4UGGA 3E7MA 5AGNA 5AD9A 5FVWA 4CAPA 4D3NA 5FW0A 5AGKA 4UG6A 1RS8A 3B3PA 5G67A 3E6NA 2ORSA 5G6EA 4FVWA 3NNZA 4D2ZA 3NQSA 1M7ZA 1M9KA 3JWVA 4CTVA 2AN0A 2ORPA 4UPRA 4D1OA 4CWVA 2FBZX 1K2RA 4KCQA 3NLWA 3N6DA 1ED4A 4UH8A 4D3TA 3JX3A 3JT8A 4KCPA 4CDTA 1DWVA 3UFUA 4CAQA 2ORQA 4UGXA 3NLKA 3NLVA 5G6MA 4D3VA 1ZZRA 3NSEA 4D3BA 4K5JA 2AMOA 4D32A 1K2UA 3JX0A 2HX2A 4UH6A 3PNFA 3N66A 3JT9A 5ADGA 3UFQA 4JSJA 3NLOA 4CX5A 4D30A 3SVQA 3NLRA 5FVXA 4CWXA 3N62A 4KCLA 3PNGA 4UGBA 3E6TA 1ED6A 1FOPA 2AN2A 5G6DA 4D1PA 4D1NA 1P6JA 5AGLA 1RS9A 1R35A 4V3YA 4D7OA 4D3UA 2NSIA 3RQJA 3E67A 4IMTA 1M8HA 5G69A 3N5SA 4JSKA 1M8DA 4CTPA 3NLJA 4UG5A 1P6HA 3JT3A 4D7JA 5G6BA 5AD4A 1M8EA 4KCRA 3N6GA 1D1WA 3N5VA 4FVXA 4CANA 1D0OA 2G6OA 4UPNA 4CFTB 3HSOA 4V3UA 3RQNA 3N5WA 3N6CA 5G6LA 4UQRA 5G0OA 3JT4A 1LZXA 8NSEA 1RS7A 1ZZUA 3N5ZA 4JSFA 1QW4A 3E6LA 1DF1A 4UGPA 3N6BA 4CUMA 4D33A 4D2YA 4CU0A 4D39A 3N5QA 4UGFA 5AGMA 3NLNA 3NLEA 3EAHA 4UGQA 4CTRA 1ZZSA 1ZZQA 4CTZA 1ZVLA 4UG8A 4UGYA 2G6MA 3E68A 3JX4A 5FVRA 1M9JA 3UFRA 2G6HA 3JT7A 4FW0A 4CWYA 4CTWA 1K2SA 4K5DA 1M7VA 4CAMA 5NSEA 3EAIA 4CX4A 3JT6A 5ADBA 3B3NA 4JSMA 4UGNA 4UH5A 4CWZA 4FVZA 3DWJA 5AD6A 3HSPA 3DQSA 4K5KA 3JWUA 5AD5A 4UGRA 4GQEA 5G6FA 3UFOA 5G6HA 4CX6A 5FVTA 5G6AA 4D3IA 5FVOA 1MMWA 2HX4A 3NW2A 2HX3A 3B3MA 5AGPA 5ADNA 3EBFA 4D38A 2FC2A 4K5EA 4KCKA 3E7IA 1DWXA 4UH7A 2G6NA 2ORTA 1RS6A 3N5PA 4CAOA 3NLQA 3JWWA 3JT5A 1JWKA 5G6KA 3E65A 3FC5A 3N60A 1FOJA 4UH9A 4UPPA 2Y37A 3Q99A 1DWWA 3N63A 4CWWA 4D35A 4CX7A 3JWTA 4CX3A 1QOMA 1M00A 3PNHA 4K5HA 4UPSA 2NOSA 3NLHA 1DMIA 4FVYA 4UGIA 5G0PA 4C39A 4JSEA 5FVSA 3SVPA 1FOIA 4D34A 2BHJA 4KCIA 4KCMA 4UH0A 5ADEA 3N5RA 4UGZA 5G6IA 4C3AA 3EJ8A 3EBDA 2NSEA 4CU1A 5ADMA 4JSLA 1FOOA 3NNYA 1VAFA 3RQOA 4K5FA 3UFWA 3N5YA 4D36A 3UFPA 3NLDA 4K5GA 3E7SA 4LUXA 4UPOA 5AD7A 3N6FA 5FJ3A 1M9TA 3JX1A 4KCNA 5FJ2A 4D3OA 4UGMA 1DM7A 3N61A 5ADFA 5G0NA 5G6GA 2G6KA 3DQTA 5ADCA 1MJTA 3TYLA 4KCSA 4UGJA 1ED5A 4UPQA 4V3ZA 1OM5A 3NOSA 4UGEA 1D1VA 1P6KA 5G6NA 4UH4A 4NSEA 3NLFA 3NLGA 3N67A 4CVGA 6NSEA 1I83A 2NODA 4UG7A 4UGCA 1NSEA 4UH1A 4UGSA 1NSIA 4UPMA 4CULA 1QW5A 7NSEA 1P6MA 4D3KA 3TYMA 4UCHA 4JSIA 5ADAA 4UGTA 5G6JA 4CTYA 3NLTA 1Q2OA 5ADDA 1M8IA 4IMWA 4IMUA 5ADKA 5G66A 3N68A 4V3VA 4V3WA 4UGKA
chains in the Genus database with same CATH superfamily
5FVUA 4CX2A 1M9RA 1DD7A 3NLYA 4K5IA 3UFTA 1NOCA 4UGDA 1MMVA 2G6JA 4UGOA 3E7TA 4CARA 1NODA 4CX1A 4JS9A 1DM8A 3RQLA 3PNEA 4UH3A 4CTXA 1DMKA 4UGVA 1FOLA 1ZZTA 5FVQA 4IMSA 3N5XA 4LUWA 5G6CA 3JWYA 4UGLA 2ORRA 5G65A 4UGAA 4D7HA 3DQRA 5G6PA 4D37A 5FVZA 5G6QA 1NOSA 4EUXA 4UGUA 4D3MA 3B3OA 3N6EA 4UQSA 3N5TA 1P6NA 4UH2A 4UGHA 3E6OA 5ADIA 5FVVA 4JSHA 3UFVA 2FLQA 1P6IA 4KCJA 4NOSA 3N2RA 4CTTA 4CU1B 5ADJA 4UPTA 3NODA 1VAGA 4JSGA 9NSEA 4CTQA 4KCHA 3E7SB 3RQPA 1DMJA 5AD8A 4UGWA 3N65A 3NLUA 3NLXA 3N69A 1DM6A 4UG9A 1D0CA 5G68A 5FVYA 1P6LA 4LWBA 3JWXA 3NLZA 3NLPA 3NLMA 3Q9AA 3NLIA 4V3XA 3UFSA 4UHAA 4D3JA 4CUNA 4CFTA 4CTUA 3TYOA 5AGOA 3TYNA 3N64A 4D7IA 3NM0A 1D1XA 3N6AA 1K2TA 3JX5A 1LZZA 5G6OA 1D1YA 4CX0A 1N2NA 3JWZA 1QW6A 3JX6A 2FC1A 1OM4A 2G6IA 3RQKA 4LWAA 2OROA 3HSNA 4D3AA 1ZVIA 2G6LA 4KCOA 5ADLA 3JX2A 4D31A 3RQMA 1M9QA 3JWSA 3E7GA 1JWJA 1M9MA 1QWCA 3JTAA 5FVPA 4IMXA 4UGGA 3E7MA 5AGNA 5AD9A 5FVWA 4CAPA 4D3NA 5FW0A 5AGKA 4UG6A 1RS8A 3B3PA 5G67A 3E6NA 2ORSA 5G6EA 4FVWA 3NNZA 4D2ZA 3NQSA 1M7ZA 1M9KA 3JWVA 4CTVA 2AN0A 2ORPA 4UPRA 4D1OA 4CWVA 2FBZX 1K2RA 4KCQA 3NLWA 3N6DA 1ED4A 4UH8A 4D3TA 3JX3A 3JT8A 4KCPA 4CDTA 1DWVA 3UFUA 4CAQA 2ORQA 4UGXA 3NLKA 3NLVA 5G6MA 4D3VA 1ZZRA 3NSEA 4D3BA 4K5JA 2AMOA 4D32A 1K2UA 3JX0A 2HX2A 4UH6A 3PNFA 3N66A 3JT9A 5ADGA 3UFQA 4JSJA 3NLOA 4CX5A 4D30A 3SVQA 3NLRA 5FVXA 4CWXA 3N62A 4KCLA 3PNGA 4UGBA 3E6TA 1ED6A 1FOPA 2AN2A 5G6DA 4D1PA 4D1NA 1P6JA 5AGLA 1RS9A 1R35A 4V3YA 4D7OA 4D3UA 2NSIA 3RQJA 3E67A 4IMTA 1M8HA 5G69A 3N5SA 4JSKA 1M8DA 4CTPA 3NLJA 4UG5A 1P6HA 3JT3A 4D7JA 5G6BA 5AD4A 1M8EA 4KCRA 3N6GA 1D1WA 3N5VA 4FVXA 4CANA 1D0OA 2G6OA 4UPNA 4CFTB 3HSOA 4V3UA 3RQNA 3N5WA 3N6CA 5G6LA 4UQRA 5G0OA 3JT4A 1LZXA 8NSEA 1RS7A 1ZZUA 3N5ZA 4JSFA 1QW4A 3E6LA 1DF1A 4UGPA 3N6BA 4CUMA 4D33A 4D2YA 4CU0A 4D39A 3N5QA 4UGFA 5AGMA 3NLNA 3NLEA 3EAHA 4UGQA 4CTRA 1ZZSA 1ZZQA 4CTZA 1ZVLA 4UG8A 4UGYA 2G6MA 3E68A 3JX4A 5FVRA 1M9JA 3UFRA 2G6HA 3JT7A 4FW0A 4CWYA 4CTWA 1K2SA 4K5DA 1M7VA 4CAMA 5NSEA 3EAIA 4CX4A 3JT6A 5ADBA 3B3NA 4JSMA 4UGNA 4UH5A 4CWZA 4FVZA 3DWJA 5AD6A 3HSPA 3DQSA 4K5KA 3JWUA 5AD5A 4UGRA 4GQEA 5G6FA 3UFOA 5G6HA 4CX6A 5FVTA 5G6AA 4D3IA 5FVOA 1MMWA 2HX4A 3NW2A 2HX3A 3B3MA 5AGPA 5ADNA 3EBFA 4D38A 2FC2A 4K5EA 4KCKA 3E7IA 1DWXA 4UH7A 2G6NA 2ORTA 1RS6A 3N5PA 4CAOA 3NLQA 3JWWA 3JT5A 1JWKA 5G6KA 3E65A 3FC5A 3N60A 1FOJA 4UH9A 4UPPA 2Y37A 3Q99A 1DWWA 3N63A 4CWWA 4D35A 4CX7A 3JWTA 4CX3A 1QOMA 1M00A 3PNHA 4K5HA 4UPSA 2NOSA 3NLHA 1DMIA 4FVYA 4UGIA 5G0PA 4C39A 4JSEA 5FVSA 3SVPA 1FOIA 4D34A 2BHJA 4KCIA 4KCMA 4UH0A 5ADEA 3N5RA 4UGZA 5G6IA 4C3AA 3EJ8A 3EBDA 2NSEA 4CU1A 5ADMA 4JSLA 1FOOA 3NNYA 1VAFA 3RQOA 4K5FA 3UFWA 3N5YA 4D36A 3UFPA 3NLDA 4K5GA 3E7SA 4LUXA 4UPOA 5AD7A 3N6FA 5FJ3A 1M9TA 3JX1A 4KCNA 5FJ2A 4D3OA 4UGMA 1DM7A 3N61A 5ADFA 5G0NA 5G6GA 2G6KA 3DQTA 5ADCA 1MJTA 3TYLA 4KCSA 4UGJA 1ED5A 4UPQA 4V3ZA 1OM5A 3NOSA 4UGEA 1D1VA 1P6KA 5G6NA 4UH4A 4NSEA 3NLFA 3NLGA 3N67A 4CVGA 6NSEA 1I83A 2NODA 4UG7A 4UGCA 1NSEA 4UH1A 4UGSA 1NSIA 4UPMA 4CULA 1QW5A 7NSEA 1P6MA 4D3KA 3TYMA 4UCHA 4JSIA 5ADAA 4UGTA 5G6JA 4CTYA 3NLTA 1Q2OA 5ADDA 1M8IA 4IMWA 4IMUA 5ADKA 5G66A 3N68A 4V3VA 4V3WA 4UGKA
chains in the Genus database with same CATH topology
5FVUA 4CX2A 1M9RA 1DD7A 3NLYA 4K5IA 3UFTA 1NOCA 4UGDA 1MMVA 2G6JA 4UGOA 3E7TA 4CARA 1NODA 4CX1A 4JS9A 1DM8A 3RQLA 3PNEA 4UH3A 4CTXA 1DMKA 4UGVA 1FOLA 1ZZTA 5FVQA 4IMSA 3N5XA 4LUWA 5G6CA 3JWYA 4UGLA 2ORRA 5G65A 4UGAA 4D7HA 3DQRA 5G6PA 4D37A 5FVZA 5G6QA 1NOSA 4EUXA 4UGUA 4D3MA 3B3OA 3N6EA 4UQSA 3N5TA 1P6NA 4UH2A 4UGHA 3E6OA 5ADIA 5FVVA 4JSHA 3UFVA 2FLQA 1P6IA 4KCJA 4NOSA 3N2RA 4CTTA 4CU1B 5ADJA 4UPTA 3NODA 1VAGA 4JSGA 9NSEA 4CTQA 4KCHA 3E7SB 3RQPA 1DMJA 5AD8A 4UGWA 3N65A 3NLUA 3NLXA 3N69A 1DM6A 4UG9A 1D0CA 5G68A 5FVYA 1P6LA 4LWBA 3JWXA 3NLZA 3NLPA 3NLMA 3Q9AA 3NLIA 4V3XA 3UFSA 4UHAA 4D3JA 4CUNA 4CFTA 4CTUA 3TYOA 5AGOA 3TYNA 3N64A 4D7IA 3NM0A 1D1XA 3N6AA 1K2TA 3JX5A 1LZZA 5G6OA 1D1YA 4CX0A 1N2NA 3JWZA 1QW6A 3JX6A 2FC1A 1OM4A 2G6IA 3RQKA 4LWAA 2OROA 3HSNA 4D3AA 1ZVIA 2G6LA 4KCOA 5ADLA 3JX2A 4D31A 3RQMA 1M9QA 3JWSA 3E7GA 1JWJA 1M9MA 1QWCA 3JTAA 5FVPA 4IMXA 4UGGA 3E7MA 5AGNA 5AD9A 5FVWA 4CAPA 4D3NA 5FW0A 5AGKA 4UG6A 1RS8A 3B3PA 5G67A 3E6NA 2ORSA 5G6EA 4FVWA 3NNZA 4D2ZA 3NQSA 1M7ZA 1M9KA 3JWVA 4CTVA 2AN0A 2ORPA 4UPRA 4D1OA 4CWVA 2FBZX 1K2RA 4KCQA 3NLWA 3N6DA 1ED4A 4UH8A 4D3TA 3JX3A 3JT8A 4KCPA 4CDTA 1DWVA 3UFUA 4CAQA 2ORQA 4UGXA 3NLKA 3NLVA 5G6MA 4D3VA 1ZZRA 3NSEA 4D3BA 4K5JA 2AMOA 4D32A 1K2UA 3JX0A 2HX2A 4UH6A 3PNFA 3N66A 3JT9A 5ADGA 3UFQA 4JSJA 3NLOA 4CX5A 4D30A 3SVQA 3NLRA 5FVXA 4CWXA 3N62A 4KCLA 3PNGA 4UGBA 3E6TA 1ED6A 1FOPA 2AN2A 5G6DA 4D1PA 4D1NA 1P6JA 5AGLA 1RS9A 1R35A 4V3YA 4D7OA 4D3UA 2NSIA 3RQJA 3E67A 4IMTA 1M8HA 5G69A 3N5SA 4JSKA 1M8DA 4CTPA 3NLJA 4UG5A 1P6HA 3JT3A 4D7JA 5G6BA 5AD4A 1M8EA 4KCRA 3N6GA 1D1WA 3N5VA 4FVXA 4CANA 1D0OA 2G6OA 4UPNA 4CFTB 3HSOA 4V3UA 3RQNA 3N5WA 3N6CA 5G6LA 4UQRA 5G0OA 3JT4A 1LZXA 8NSEA 1RS7A 1ZZUA 3N5ZA 4JSFA 1QW4A 3E6LA 1DF1A 4UGPA 3N6BA 4CUMA 4D33A 4D2YA 4CU0A 4D39A 3N5QA 4UGFA 5AGMA 3NLNA 3NLEA 3EAHA 4UGQA 4CTRA 1ZZSA 1ZZQA 4CTZA 1ZVLA 4UG8A 4UGYA 2G6MA 3E68A 3JX4A 5FVRA 1M9JA 3UFRA 2G6HA 3JT7A 4FW0A 4CWYA 4CTWA 1K2SA 4K5DA 1M7VA 4CAMA 5NSEA 3EAIA 4CX4A 3JT6A 5ADBA 3B3NA 4JSMA 4UGNA 4UH5A 4CWZA 4FVZA 3DWJA 5AD6A 3HSPA 3DQSA 4K5KA 3JWUA 5AD5A 4UGRA 4GQEA 5G6FA 3UFOA 5G6HA 4CX6A 5FVTA 5G6AA 4D3IA 5FVOA 1MMWA 2HX4A 3NW2A 2HX3A 3B3MA 5AGPA 5ADNA 3EBFA 4D38A 2FC2A 4K5EA 4KCKA 3E7IA 1DWXA 4UH7A 2G6NA 2ORTA 1RS6A 3N5PA 4CAOA 3NLQA 3JWWA 3JT5A 1JWKA 5G6KA 3E65A 3FC5A 3N60A 1FOJA 4UH9A 4UPPA 2Y37A 3Q99A 1DWWA 3N63A 4CWWA 4D35A 4CX7A 3JWTA 4CX3A 1QOMA 1M00A 3PNHA 4K5HA 4UPSA 2NOSA 3NLHA 1DMIA 4FVYA 4UGIA 5G0PA 4C39A 4JSEA 5FVSA 3SVPA 1FOIA 4D34A 2BHJA 4KCIA 4KCMA 4UH0A 5ADEA 3N5RA 4UGZA 5G6IA 4C3AA 3EJ8A 3EBDA 2NSEA 4CU1A 5ADMA 4JSLA 1FOOA 3NNYA 1VAFA 3RQOA 4K5FA 3UFWA 3N5YA 4D36A 3UFPA 3NLDA 4K5GA 3E7SA 4LUXA 4UPOA 5AD7A 3N6FA 5FJ3A 1M9TA 3JX1A 4KCNA 5FJ2A 4D3OA 4UGMA 1DM7A 3N61A 5ADFA 5G0NA 5G6GA 2G6KA 3DQTA 5ADCA 1MJTA 3TYLA 4KCSA 4UGJA 1ED5A 4UPQA 4V3ZA 1OM5A 3NOSA 4UGEA 1D1VA 1P6KA 5G6NA 4UH4A 4NSEA 3NLFA 3NLGA 3N67A 4CVGA 6NSEA 1I83A 2NODA 4UG7A 4UGCA 1NSEA 4UH1A 4UGSA 1NSIA 4UPMA 4CULA 1QW5A 7NSEA 1P6MA 4D3KA 3TYMA 4UCHA 4JSIA 5ADAA 4UGTA 5G6JA 4CTYA 3NLTA 1Q2OA 5ADDA 1M8IA 4IMWA 4IMUA 5ADKA 5G66A 3N68A 4V3VA 4V3WA 4UGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FVU A;  4CX2 A;  1M9R A;  1DD7 A;  3NLY A;  4K5I A;  3UFT A;  1NOC A;  4UGD A;  1MMV A;  2G6J A;  4UGO A;  3E7T A;  4CAR A;  1NOD A;  4CX1 A;  4JS9 A;  1DM8 A;  3RQL A;  3PNE A;  4UH3 A;  4CTX A;  1DMK A;  4UGV A;  1FOL A;  1ZZT A;  5FVQ A;  4IMS A;  3N5X A;  4LUW A;  5G6C A;  3JWY A;  4UGL A;  2ORR A;  5G65 A;  4UGA A;  4D7H A;  3DQR A;  5G6P A;  4D37 A;  5FVZ A;  5G6Q A;  1NOS A;  4EUX A;  4UGU A;  4D3M A;  3B3O A;  3N6E A;  4UQS A;  3N5T A;  1P6N A;  4UH2 A;  4UGH A;  3E6O A;  5ADI A;  5FVV A;  4JSH A;  3UFV A;  2FLQ A;  1P6I A;  4KCJ A;  4NOS A;  3N2R A;  4CTT A;  4CU1 B;  5ADJ A;  4UPT A;  3NOD A;  1VAG A;  4JSG A;  9NSE A;  4CTQ A;  4KCH A;  3E7S B;  3RQP A;  1DMJ A;  5AD8 A;  4UGW A;  3N65 A;  3NLU A;  3NLX A;  3N69 A;  1DM6 A;  4UG9 A;  1D0C A;  5G68 A;  5FVY A;  1P6L A;  4LWB A;  3JWX A;  3NLZ A;  3NLP A;  3NLM A;  3Q9A A;  3NLI A;  4V3X A;  3UFS A;  4UHA A;  4D3J A;  4CUN A;  4CFT A;  4CTU A;  3TYO A;  5AGO A;  3TYN A;  3N64 A;  4D7I A;  3NM0 A;  1D1X A;  3N6A A;  1K2T A;  3JX5 A;  1LZZ A;  5G6O A;  1D1Y A;  4CX0 A;  1N2N A;  3JWZ A;  1QW6 A;  3JX6 A;  2FC1 A;  1OM4 A;  2G6I A;  3RQK A;  4LWA A;  2ORO A;  3HSN A;  4D3A A;  1ZVI A;  2G6L A;  4KCO A;  5ADL A;  3JX2 A;  4D31 A;  3RQM A;  1M9Q A;  3JWS A;  3E7G A;  1JWJ A;  1M9M A;  1QWC A;  3JTA A;  5FVP A;  4IMX A;  4UGG A;  3E7M A;  5AGN A;  5AD9 A;  5FVW A;  4CAP A;  4D3N A;  5FW0 A;  5AGK A;  4UG6 A;  1RS8 A;  3B3P A;  5G67 A;  3E6N A;  2ORS A;  5G6E A;  4FVW A;  3NNZ A;  4D2Z A;  3NQS A;  1M7Z A;  1M9K A;  3JWV A;  4CTV A;  2AN0 A;  2ORP A;  4UPR A;  4D1O A;  4CWV A;  2FBZ X;  1K2R A;  4KCQ A;  3NLW A;  3N6D A;  1ED4 A;  4UH8 A;  4D3T A;  3JX3 A;  3JT8 A;  4KCP A;  4CDT A;  1DWV A;  3UFU A;  4CAQ A;  2ORQ A;  4UGX A;  3NLK A;  3NLV A;  5G6M A;  4D3V A;  1ZZR A;  3NSE A;  4D3B A;  4K5J A;  2AMO A;  4D32 A;  1K2U A;  3JX0 A;  2HX2 A;  4UH6 A;  3PNF A;  3N66 A;  3JT9 A;  5ADG A;  3UFQ A;  4JSJ A;  3NLO A;  4CX5 A;  4D30 A;  3SVQ A;  3NLR A;  5FVX A;  4CWX A;  3N62 A;  4KCL A;  3PNG A;  4UGB A;  3E6T A;  1ED6 A;  1FOP A;  2AN2 A;  5G6D A;  4D1P A;  4D1N A;  1P6J A;  5AGL A;  1RS9 A;  1R35 A;  4V3Y A;  4D7O A;  4D3U A;  2NSI A;  3RQJ A;  3E67 A;  4IMT A;  1M8H A;  5G69 A;  3N5S A;  4JSK A;  1M8D A;  4CTP A;  3NLJ A;  4UG5 A;  1P6H A;  3JT3 A;  4D7J A;  5G6B A;  5AD4 A;  1M8E A;  4KCR A;  3N6G A;  1D1W A;  3N5V A;  4FVX A;  4CAN A;  1D0O A;  2G6O A;  4UPN A;  4CFT B;  3HSO A;  4V3U A;  3RQN A;  3N5W A;  3N6C A;  5G6L A;  4UQR A;  5G0O A;  3JT4 A;  1LZX A;  8NSE A;  1RS7 A;  1ZZU A;  3N5Z A;  4JSF A;  1QW4 A;  3E6L A;  1DF1 A;  4UGP A;  3N6B A;  4CUM A;  4D33 A;  4D2Y A;  4CU0 A;  4D39 A;  3N5Q A;  4UGF A;  5AGM A;  3NLN A;  3NLE A;  3EAH A;  4UGQ A;  4CTR A;  1ZZS A;  1ZZQ A;  4CTZ A;  1ZVL A;  4UG8 A;  4UGY A;  2G6M A;  3E68 A;  3JX4 A;  5FVR A;  1M9J A;  3UFR A;  2G6H A;  3JT7 A;  4FW0 A;  4CWY A;  4CTW A;  1K2S A;  4K5D A;  1M7V A;  4CAM A;  5NSE A;  3EAI A;  4CX4 A;  3JT6 A;  5ADB A;  3B3N A;  4JSM A;  4UGN A;  4UH5 A;  4CWZ A;  4FVZ A;  3DWJ A;  5AD6 A;  3HSP A;  3DQS A;  4K5K A;  3JWU A;  5AD5 A;  4UGR A;  4GQE A;  5G6F A;  3UFO A;  5G6H A;  4CX6 A;  5FVT A;  5G6A A;  4D3I A;  5FVO A;  1MMW A;  2HX4 A;  3NW2 A;  2HX3 A;  3B3M A;  5AGP A;  5ADN A;  3EBF A;  4D38 A;  2FC2 A;  4K5E A;  4KCK A;  3E7I A;  1DWX A;  4UH7 A;  2G6N A;  2ORT A;  1RS6 A;  3N5P A;  4CAO A;  3NLQ A;  3JWW A;  3JT5 A;  1JWK A;  5G6K A;  3E65 A;  3FC5 A;  3N60 A;  1FOJ A;  4UH9 A;  4UPP A;  2Y37 A;  3Q99 A;  1DWW A;  3N63 A;  4CWW A;  4D35 A;  4CX7 A;  3JWT A;  4CX3 A;  1QOM A;  1M00 A;  3PNH A;  4K5H A;  4UPS A;  2NOS A;  3NLH A;  1DMI A;  4FVY A;  4UGI A;  5G0P A;  4C39 A;  4JSE A;  5FVS A;  3SVP A;  1FOI A;  4D34 A;  2BHJ A;  4KCI A;  4KCM A;  4UH0 A;  5ADE A;  3N5R A;  4UGZ A;  5G6I A;  4C3A A;  3EJ8 A;  3EBD A;  2NSE A;  4CU1 A;  5ADM A;  4JSL A;  1FOO A;  3NNY A;  1VAF A;  3RQO A;  4K5F A;  3UFW A;  3N5Y A;  4D36 A;  3UFP A;  3NLD A;  4K5G A;  3E7S A;  4LUX A;  4UPO A;  5AD7 A;  3N6F A;  5FJ3 A;  1M9T A;  3JX1 A;  4KCN A;  5FJ2 A;  4D3O A;  4UGM A;  1DM7 A;  3N61 A;  5ADF A;  5G0N A;  5G6G A;  2G6K A;  3DQT A;  5ADC A;  1MJT A;  3TYL A;  4KCS A;  4UGJ A;  1ED5 A;  4UPQ A;  4V3Z A;  1OM5 A;  3NOS A;  4UGE A;  1D1V A;  1P6K A;  5G6N A;  4UH4 A;  4NSE A;  3NLF A;  3NLG A;  3N67 A;  4CVG A;  6NSE A;  1I83 A;  2NOD A;  4UG7 A;  4UGC A;  1NSE A;  4UH1 A;  4UGS A;  1NSI A;  4UPM A;  4CUL A;  1QW5 A;  7NSE A;  1P6M A;  4D3K A;  3TYM A;  4UCH A;  4JSI A;  5ADA A;  4UGT A;  5G6J A;  4CTY A;  3NLT A;  1Q2O A;  5ADD A;  1M8I A;  4IMW A;  4IMU A;  5ADK A;  5G66 A;  3N68 A;  4V3V A;  4V3W A;  4UGK A; 
#chains in the Genus database with same CATH topology
 5FVU A;  4CX2 A;  1M9R A;  1DD7 A;  3NLY A;  4K5I A;  3UFT A;  1NOC A;  4UGD A;  1MMV A;  2G6J A;  4UGO A;  3E7T A;  4CAR A;  1NOD A;  4CX1 A;  4JS9 A;  1DM8 A;  3RQL A;  3PNE A;  4UH3 A;  4CTX A;  1DMK A;  4UGV A;  1FOL A;  1ZZT A;  5FVQ A;  4IMS A;  3N5X A;  4LUW A;  5G6C A;  3JWY A;  4UGL A;  2ORR A;  5G65 A;  4UGA A;  4D7H A;  3DQR A;  5G6P A;  4D37 A;  5FVZ A;  5G6Q A;  1NOS A;  4EUX A;  4UGU A;  4D3M A;  3B3O A;  3N6E A;  4UQS A;  3N5T A;  1P6N A;  4UH2 A;  4UGH A;  3E6O A;  5ADI A;  5FVV A;  4JSH A;  3UFV A;  2FLQ A;  1P6I A;  4KCJ A;  4NOS A;  3N2R A;  4CTT A;  4CU1 B;  5ADJ A;  4UPT A;  3NOD A;  1VAG A;  4JSG A;  9NSE A;  4CTQ A;  4KCH A;  3E7S B;  3RQP A;  1DMJ A;  5AD8 A;  4UGW A;  3N65 A;  3NLU A;  3NLX A;  3N69 A;  1DM6 A;  4UG9 A;  1D0C A;  5G68 A;  5FVY A;  1P6L A;  4LWB A;  3JWX A;  3NLZ A;  3NLP A;  3NLM A;  3Q9A A;  3NLI A;  4V3X A;  3UFS A;  4UHA A;  4D3J A;  4CUN A;  4CFT A;  4CTU A;  3TYO A;  5AGO A;  3TYN A;  3N64 A;  4D7I A;  3NM0 A;  1D1X A;  3N6A A;  1K2T A;  3JX5 A;  1LZZ A;  5G6O A;  1D1Y A;  4CX0 A;  1N2N A;  3JWZ A;  1QW6 A;  3JX6 A;  2FC1 A;  1OM4 A;  2G6I A;  3RQK A;  4LWA A;  2ORO A;  3HSN A;  4D3A A;  1ZVI A;  2G6L A;  4KCO A;  5ADL A;  3JX2 A;  4D31 A;  3RQM A;  1M9Q A;  3JWS A;  3E7G A;  1JWJ A;  1M9M A;  1QWC A;  3JTA A;  5FVP A;  4IMX A;  4UGG A;  3E7M A;  5AGN A;  5AD9 A;  5FVW A;  4CAP A;  4D3N A;  5FW0 A;  5AGK A;  4UG6 A;  1RS8 A;  3B3P A;  5G67 A;  3E6N A;  2ORS A;  5G6E A;  4FVW A;  3NNZ A;  4D2Z A;  3NQS A;  1M7Z A;  1M9K A;  3JWV A;  4CTV A;  2AN0 A;  2ORP A;  4UPR A;  4D1O A;  4CWV A;  2FBZ X;  1K2R A;  4KCQ A;  3NLW A;  3N6D A;  1ED4 A;  4UH8 A;  4D3T A;  3JX3 A;  3JT8 A;  4KCP A;  4CDT A;  1DWV A;  3UFU A;  4CAQ A;  2ORQ A;  4UGX A;  3NLK A;  3NLV A;  5G6M A;  4D3V A;  1ZZR A;  3NSE A;  4D3B A;  4K5J A;  2AMO A;  4D32 A;  1K2U A;  3JX0 A;  2HX2 A;  4UH6 A;  3PNF A;  3N66 A;  3JT9 A;  5ADG A;  3UFQ A;  4JSJ A;  3NLO A;  4CX5 A;  4D30 A;  3SVQ A;  3NLR A;  5FVX A;  4CWX A;  3N62 A;  4KCL A;  3PNG A;  4UGB A;  3E6T A;  1ED6 A;  1FOP A;  2AN2 A;  5G6D A;  4D1P A;  4D1N A;  1P6J A;  5AGL A;  1RS9 A;  1R35 A;  4V3Y A;  4D7O A;  4D3U A;  2NSI A;  3RQJ A;  3E67 A;  4IMT A;  1M8H A;  5G69 A;  3N5S A;  4JSK A;  1M8D A;  4CTP A;  3NLJ A;  4UG5 A;  1P6H A;  3JT3 A;  4D7J A;  5G6B A;  5AD4 A;  1M8E A;  4KCR A;  3N6G A;  1D1W A;  3N5V A;  4FVX A;  4CAN A;  1D0O A;  2G6O A;  4UPN A;  4CFT B;  3HSO A;  4V3U A;  3RQN A;  3N5W A;  3N6C A;  5G6L A;  4UQR A;  5G0O A;  3JT4 A;  1LZX A;  8NSE A;  1RS7 A;  1ZZU A;  3N5Z A;  4JSF A;  1QW4 A;  3E6L A;  1DF1 A;  4UGP A;  3N6B A;  4CUM A;  4D33 A;  4D2Y A;  4CU0 A;  4D39 A;  3N5Q A;  4UGF A;  5AGM A;  3NLN A;  3NLE A;  3EAH A;  4UGQ A;  4CTR A;  1ZZS A;  1ZZQ A;  4CTZ A;  1ZVL A;  4UG8 A;  4UGY A;  2G6M A;  3E68 A;  3JX4 A;  5FVR A;  1M9J A;  3UFR A;  2G6H A;  3JT7 A;  4FW0 A;  4CWY A;  4CTW A;  1K2S A;  4K5D A;  1M7V A;  4CAM A;  5NSE A;  3EAI A;  4CX4 A;  3JT6 A;  5ADB A;  3B3N A;  4JSM A;  4UGN A;  4UH5 A;  4CWZ A;  4FVZ A;  3DWJ A;  5AD6 A;  3HSP A;  3DQS A;  4K5K A;  3JWU A;  5AD5 A;  4UGR A;  4GQE A;  5G6F A;  3UFO A;  5G6H A;  4CX6 A;  5FVT A;  5G6A A;  4D3I A;  5FVO A;  1MMW A;  2HX4 A;  3NW2 A;  2HX3 A;  3B3M A;  5AGP A;  5ADN A;  3EBF A;  4D38 A;  2FC2 A;  4K5E A;  4KCK A;  3E7I A;  1DWX A;  4UH7 A;  2G6N A;  2ORT A;  1RS6 A;  3N5P A;  4CAO A;  3NLQ A;  3JWW A;  3JT5 A;  1JWK A;  5G6K A;  3E65 A;  3FC5 A;  3N60 A;  1FOJ A;  4UH9 A;  4UPP A;  2Y37 A;  3Q99 A;  1DWW A;  3N63 A;  4CWW A;  4D35 A;  4CX7 A;  3JWT A;  4CX3 A;  1QOM A;  1M00 A;  3PNH A;  4K5H A;  4UPS A;  2NOS A;  3NLH A;  1DMI A;  4FVY A;  4UGI A;  5G0P A;  4C39 A;  4JSE A;  5FVS A;  3SVP A;  1FOI A;  4D34 A;  2BHJ A;  4KCI A;  4KCM A;  4UH0 A;  5ADE A;  3N5R A;  4UGZ A;  5G6I A;  4C3A A;  3EJ8 A;  3EBD A;  2NSE A;  4CU1 A;  5ADM A;  4JSL A;  1FOO A;  3NNY A;  1VAF A;  3RQO A;  4K5F A;  3UFW A;  3N5Y A;  4D36 A;  3UFP A;  3NLD A;  4K5G A;  3E7S A;  4LUX A;  4UPO A;  5AD7 A;  3N6F A;  5FJ3 A;  1M9T A;  3JX1 A;  4KCN A;  5FJ2 A;  4D3O A;  4UGM A;  1DM7 A;  3N61 A;  5ADF A;  5G0N A;  5G6G A;  2G6K A;  3DQT A;  5ADC A;  1MJT A;  3TYL A;  4KCS A;  4UGJ A;  1ED5 A;  4UPQ A;  4V3Z A;  1OM5 A;  3NOS A;  4UGE A;  1D1V A;  1P6K A;  5G6N A;  4UH4 A;  4NSE A;  3NLF A;  3NLG A;  3N67 A;  4CVG A;  6NSE A;  1I83 A;  2NOD A;  4UG7 A;  4UGC A;  1NSE A;  4UH1 A;  4UGS A;  1NSI A;  4UPM A;  4CUL A;  1QW5 A;  7NSE A;  1P6M A;  4D3K A;  3TYM A;  4UCH A;  4JSI A;  5ADA A;  4UGT A;  5G6J A;  4CTY A;  3NLT A;  1Q2O A;  5ADD A;  1M8I A;  4IMW A;  4IMU A;  5ADK A;  5G66 A;  3N68 A;  4V3V A;  4V3W A;  4UGK A; 
#chains in the Genus database with same CATH homology
 5FVU A;  4CX2 A;  1M9R A;  1DD7 A;  3NLY A;  4K5I A;  3UFT A;  1NOC A;  4UGD A;  1MMV A;  2G6J A;  4UGO A;  3E7T A;  4CAR A;  1NOD A;  4CX1 A;  4JS9 A;  1DM8 A;  3RQL A;  3PNE A;  4UH3 A;  4CTX A;  1DMK A;  4UGV A;  1FOL A;  1ZZT A;  5FVQ A;  4IMS A;  3N5X A;  4LUW A;  5G6C A;  3JWY A;  4UGL A;  2ORR A;  5G65 A;  4UGA A;  4D7H A;  3DQR A;  5G6P A;  4D37 A;  5FVZ A;  5G6Q A;  1NOS A;  4EUX A;  4UGU A;  4D3M A;  3B3O A;  3N6E A;  4UQS A;  3N5T A;  1P6N A;  4UH2 A;  4UGH A;  3E6O A;  5ADI A;  5FVV A;  4JSH A;  3UFV A;  2FLQ A;  1P6I A;  4KCJ A;  4NOS A;  3N2R A;  4CTT A;  4CU1 B;  5ADJ A;  4UPT A;  3NOD A;  1VAG A;  4JSG A;  9NSE A;  4CTQ A;  4KCH A;  3E7S B;  3RQP A;  1DMJ A;  5AD8 A;  4UGW A;  3N65 A;  3NLU A;  3NLX A;  3N69 A;  1DM6 A;  4UG9 A;  1D0C A;  5G68 A;  5FVY A;  1P6L A;  4LWB A;  3JWX A;  3NLZ A;  3NLP A;  3NLM A;  3Q9A A;  3NLI A;  4V3X A;  3UFS A;  4UHA A;  4D3J A;  4CUN A;  4CFT A;  4CTU A;  3TYO A;  5AGO A;  3TYN A;  3N64 A;  4D7I A;  3NM0 A;  1D1X A;  3N6A A;  1K2T A;  3JX5 A;  1LZZ A;  5G6O A;  1D1Y A;  4CX0 A;  1N2N A;  3JWZ A;  1QW6 A;  3JX6 A;  2FC1 A;  1OM4 A;  2G6I A;  3RQK A;  4LWA A;  2ORO A;  3HSN A;  4D3A A;  1ZVI A;  2G6L A;  4KCO A;  5ADL A;  3JX2 A;  4D31 A;  3RQM A;  1M9Q A;  3JWS A;  3E7G A;  1JWJ A;  1M9M A;  1QWC A;  3JTA A;  5FVP A;  4IMX A;  4UGG A;  3E7M A;  5AGN A;  5AD9 A;  5FVW A;  4CAP A;  4D3N A;  5FW0 A;  5AGK A;  4UG6 A;  1RS8 A;  3B3P A;  5G67 A;  3E6N A;  2ORS A;  5G6E A;  4FVW A;  3NNZ A;  4D2Z A;  3NQS A;  1M7Z A;  1M9K A;  3JWV A;  4CTV A;  2AN0 A;  2ORP A;  4UPR A;  4D1O A;  4CWV A;  2FBZ X;  1K2R A;  4KCQ A;  3NLW A;  3N6D A;  1ED4 A;  4UH8 A;  4D3T A;  3JX3 A;  3JT8 A;  4KCP A;  4CDT A;  1DWV A;  3UFU A;  4CAQ A;  2ORQ A;  4UGX A;  3NLK A;  3NLV A;  5G6M A;  4D3V A;  1ZZR A;  3NSE A;  4D3B A;  4K5J A;  2AMO A;  4D32 A;  1K2U A;  3JX0 A;  2HX2 A;  4UH6 A;  3PNF A;  3N66 A;  3JT9 A;  5ADG A;  3UFQ A;  4JSJ A;  3NLO A;  4CX5 A;  4D30 A;  3SVQ A;  3NLR A;  5FVX A;  4CWX A;  3N62 A;  4KCL A;  3PNG A;  4UGB A;  3E6T A;  1ED6 A;  1FOP A;  2AN2 A;  5G6D A;  4D1P A;  4D1N A;  1P6J A;  5AGL A;  1RS9 A;  1R35 A;  4V3Y A;  4D7O A;  4D3U A;  2NSI A;  3RQJ A;  3E67 A;  4IMT A;  1M8H A;  5G69 A;  3N5S A;  4JSK A;  1M8D A;  4CTP A;  3NLJ A;  4UG5 A;  1P6H A;  3JT3 A;  4D7J A;  5G6B A;  5AD4 A;  1M8E A;  4KCR A;  3N6G A;  1D1W A;  3N5V A;  4FVX A;  4CAN A;  1D0O A;  2G6O A;  4UPN A;  4CFT B;  3HSO A;  4V3U A;  3RQN A;  3N5W A;  3N6C A;  5G6L A;  4UQR A;  5G0O A;  3JT4 A;  1LZX A;  8NSE A;  1RS7 A;  1ZZU A;  3N5Z A;  4JSF A;  1QW4 A;  3E6L A;  1DF1 A;  4UGP A;  3N6B A;  4CUM A;  4D33 A;  4D2Y A;  4CU0 A;  4D39 A;  3N5Q A;  4UGF A;  5AGM A;  3NLN A;  3NLE A;  3EAH A;  4UGQ A;  4CTR A;  1ZZS A;  1ZZQ A;  4CTZ A;  1ZVL A;  4UG8 A;  4UGY A;  2G6M A;  3E68 A;  3JX4 A;  5FVR A;  1M9J A;  3UFR A;  2G6H A;  3JT7 A;  4FW0 A;  4CWY A;  4CTW A;  1K2S A;  4K5D A;  1M7V A;  4CAM A;  5NSE A;  3EAI A;  4CX4 A;  3JT6 A;  5ADB A;  3B3N A;  4JSM A;  4UGN A;  4UH5 A;  4CWZ A;  4FVZ A;  3DWJ A;  5AD6 A;  3HSP A;  3DQS A;  4K5K A;  3JWU A;  5AD5 A;  4UGR A;  4GQE A;  5G6F A;  3UFO A;  5G6H A;  4CX6 A;  5FVT A;  5G6A A;  4D3I A;  5FVO A;  1MMW A;  2HX4 A;  3NW2 A;  2HX3 A;  3B3M A;  5AGP A;  5ADN A;  3EBF A;  4D38 A;  2FC2 A;  4K5E A;  4KCK A;  3E7I A;  1DWX A;  4UH7 A;  2G6N A;  2ORT A;  1RS6 A;  3N5P A;  4CAO A;  3NLQ A;  3JWW A;  3JT5 A;  1JWK A;  5G6K A;  3E65 A;  3FC5 A;  3N60 A;  1FOJ A;  4UH9 A;  4UPP A;  2Y37 A;  3Q99 A;  1DWW A;  3N63 A;  4CWW A;  4D35 A;  4CX7 A;  3JWT A;  4CX3 A;  1QOM A;  1M00 A;  3PNH A;  4K5H A;  4UPS A;  2NOS A;  3NLH A;  1DMI A;  4FVY A;  4UGI A;  5G0P A;  4C39 A;  4JSE A;  5FVS A;  3SVP A;  1FOI A;  4D34 A;  2BHJ A;  4KCI A;  4KCM A;  4UH0 A;  5ADE A;  3N5R A;  4UGZ A;  5G6I A;  4C3A A;  3EJ8 A;  3EBD A;  2NSE A;  4CU1 A;  5ADM A;  4JSL A;  1FOO A;  3NNY A;  1VAF A;  3RQO A;  4K5F A;  3UFW A;  3N5Y A;  4D36 A;  3UFP A;  3NLD A;  4K5G A;  3E7S A;  4LUX A;  4UPO A;  5AD7 A;  3N6F A;  5FJ3 A;  1M9T A;  3JX1 A;  4KCN A;  5FJ2 A;  4D3O A;  4UGM A;  1DM7 A;  3N61 A;  5ADF A;  5G0N A;  5G6G A;  2G6K A;  3DQT A;  5ADC A;  1MJT A;  3TYL A;  4KCS A;  4UGJ A;  1ED5 A;  4UPQ A;  4V3Z A;  1OM5 A;  3NOS A;  4UGE A;  1D1V A;  1P6K A;  5G6N A;  4UH4 A;  4NSE A;  3NLF A;  3NLG A;  3N67 A;  4CVG A;  6NSE A;  1I83 A;  2NOD A;  4UG7 A;  4UGC A;  1NSE A;  4UH1 A;  4UGS A;  1NSI A;  4UPM A;  4CUL A;  1QW5 A;  7NSE A;  1P6M A;  4D3K A;  3TYM A;  4UCH A;  4JSI A;  5ADA A;  4UGT A;  5G6J A;  4CTY A;  3NLT A;  1Q2O A;  5ADD A;  1M8I A;  4IMW A;  4IMU A;  5ADK A;  5G66 A;  3N68 A;  4V3V A;  4V3W A;  4UGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...