4UGHA

Structure of bacillus subtilis nitric oxide synthase in complex with n1-(3-(2-(6-amino-4-methylpyridin-2-yl)ethyl)phenyl)-n1,n2- dimethylethane-1,2-diamine
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 123
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ughA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ughA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ughA03
5AGNA 4CWVA 4UPRA 4D7OA 5ADIA 3RQNA 7NSEA 3DQRA 4JSLA 3E7IA 5G6HA 4CU1B 3NLVA 5G6FA 5FVVA 4CTZA 5G6OA 3JX0A 4D3NA 4D3TA 4CFTA 4UH6A 1M9RA 4UGBA 3N62A 5ADMA 1ED4A 4CFTB 4D3BA 4CAPA 4UPSA 4KCPA 4V3ZA 1DM6A 3DQSA 1DD7A 3UFRA 4CX0A 1P6IA 1P6MA 1D1WA 1D0CA 1DM8A 3N65A 4D1PA 1ZZTA 3JT8A 3PNFA 2G6KA 5NSEA 1DWXA 1MJTA 3N64A 3NLXA 3NW2A 4JSEA 4KCKA 5G6DA 4JSGA 3NLZA 4UGTA 3JT3A 4LUWA 4KCQA 4KCJA 1JWJA 4V3XA 3N5YA 3N68A 1D1XA 2G6NA 3PNEA 3N6DA 3RQPA 5G6PA 5FVWA 3NLNA 1MMWA 3FC5A 1ZZSA 2HX3A 1DMKA 5ADNA 3NLKA 4KCMA 1R35A 3N61A 1FOPA 3B3MA 4K5GA 3SVQA 1M00A 1K2SA 5AD6A 3NLJA 4NSEA 4KCSA 1DMIA 2OROA 3UFPA 5G6NA 4UGFA 4CUNA 5FW0A 1FOIA 1ZVIA 3RQMA 4FVWA 3N60A 4CTXA 1D1YA 1D0OA 6NSEA 1K2RA 3TYNA 8NSEA 3HSNA 4JSMA 1FOLA 5FVRA 1DWWA 3N67A 5G6BA 3JT9A 5AGKA 5FVQA 3N6AA 3JWUA 2G6IA 5G0NA 2BHJA 4D34A 4IMSA 5G6CA 3JWYA 3RQLA 3UFQA 3E65A 5FVUA 4D7HA 3NLYA 1ZZUA 3E7SA 2G6HA 2NSIA 1M8HA 5FVPA 3NM0A 5FJ3A 4UGHA 4D1NA 4UGOA 4UH0A 4D38A 3E7GA 3B3PA 4UH5A 5G68A 4D2YA 4D32A 1P6JA 4D1OA 3NLHA 3EBFA 4FVYA 3EJ8A 4UH3A 4UGCA 1M8DA 4FW0A 3JX6A 3N5SA 4D7JA 4KCLA 4UQSA 4CAOA 4D30A 4D39A 3UFWA 2HX2A 4V3UA 4CTPA 5G67A 4CU1A 4CX3A 4UGWA 2ORPA 1M9TA 3UFSA 1M7ZA 1NSIA 4UH2A 4CX6A 1DF1A 3N5QA 3NLOA 2ORSA 3EBDA 3N5PA 3N6FA 3NOSA 4UPNA 4UPTA 3JWVA 1M7VA 3JX2A 3N66A 4D7IA 4CWZA 5G65A 4D3OA 1ZZRA 4UGRA 4JSFA 3JT7A 3E6TA 5G6EA 1M9QA 4K5JA 4KCHA 4CWWA 1ZVLA 3NLQA 5AD8A 4D3MA 5AD5A 3NLUA 4UGIA 4EUXA 3NLGA 1M8EA 4D3KA 5AD4A 1P6LA 1P6NA 3JT4A 3JWZA 1M8IA 3N63A 4KCNA 5FVOA 5ADAA 5G0PA 1DMJA 3N5RA 4UG7A 3NQSA 5G6IA 3RQOA 1N2NA 4KCRA 3SVPA 4CARA 4UGKA 5FVXA 4UCHA 4UGPA 3TYLA 4CAQA 4CWXA 4IMTA 4UGGA 4UGSA 1MMVA 4UG5A 1QW5A 3NLWA 1I83A 3UFUA 4CX5A 5FJ2A 1K2TA 2ORRA 3TYOA 4UGJA 4UPPA 4UGQA 1LZXA 1FOJA 4CVGA 3HSOA 5FVTA 4CTRA 4UGUA 4UGZA 1VAFA 5ADCA 4IMUA 3NLMA 4D37A 4GQEA 5G6GA 1QOMA 3JTAA 4K5EA 5G6MA 1ED6A 1ZZQA 5AGPA 4IMXA 3N5XA 4FVXA 4D3JA 2FC2A 3RQKA 2G6LA 5AGOA 1JWKA 1OM5A 5G6JA 3TYMA 3E6OA 4UPOA 3E7MA 4KCIA 4UGMA 3JWWA 3DQTA 4UG8A 5ADKA 3NLTA 2NOSA 4CX4A 5ADDA 5G6LA 4KCOA 4JS9A 3Q9AA 4FVZA 2FBZX 4D35A 3JWTA 5FVYA 3NLIA 3NNZA 1RS7A 2NODA 5ADFA 4CTVA 5ADJA 1OM4A 2FC1A 5G6AA 3N5VA 2ORQA 4K5HA 3N6CA 3JX1A 4UGEA 4K5DA 4UPQA 4CTTA 4D2ZA 3NLEA 3HSPA 4CX2A 3NSEA 4UH1A 3JWSA 5FVZA 5FVSA 3UFVA 1Q2OA 2AMOA 3E6LA 5G6QA 4D3IA 1M9JA 2FLQA 1DWVA 4UGLA 4CWYA 1P6KA 4C3AA 2Y37A 4CAMA 4UGDA 1QWCA 4UH9A 4UPMA 5G69A 4D36A 3EAHA 4IMWA 3N5TA 4CTQA 4LUXA 4V3YA 3JX3A 5ADGA 2HX4A 3EAIA 3UFOA 3E68A 1D1VA 2AN2A 3RQJA 5AGLA 2AN0A 3N69A 5AGMA 1DM7A 4K5IA 3PNGA 1QW4A 1NOSA 3N2RA 4CU0A 4D3AA 3N5ZA 4UH4A 4D3UA 3B3NA 4UGVA 3N6GA 4UGAA 3NLDA 4CTUA 1RS6A 4UG6A 1QW6A 3JT5A 4CULA 4UGXA 4UGNA 1K2UA 2NSEA 1FOOA 4UGYA 3JX5A 1RS9A 3N5WA 5G66A 4CX7A 2G6MA 4LWBA 4C39A 3JX4A 3E7TA 4LWAA 5AD9A 4UH7A 2ORTA 4V3VA 1NSEA 4JSJA 4CX1A 1VAGA 4UHAA 3B3OA 1LZZA 5G0OA 3N6BA 3NLRA 4CDTA 4D31A 5ADBA 1ED5A 5G6KA 4NOSA 3DWJA 4CTWA 2G6OA 5ADLA 5ADEA 3JT6A 2G6JA 1NODA 1RS8A 4K5FA 5AD7A 3NODA 3E7SB 4CTYA 4CANA 4D33A 4CUMA 4JSIA 1M9MA 4D3VA 4JSKA 4UH8A 4UG9A 4UQRA 3NLPA 3PNHA 1NOCA 4V3WA 3E67A 1P6HA 3N6EA 3NNYA 3Q99A 3NLFA 1M9KA 4K5KA 4JSHA 3UFTA 3JWXA 3E6NA 9NSEA
chains in the Genus database with same CATH superfamily
5AGNA 4CWVA 4UPRA 4D7OA 5ADIA 3RQNA 7NSEA 3DQRA 4JSLA 3E7IA 5G6HA 4CU1B 3NLVA 5G6FA 5FVVA 4CTZA 5G6OA 3JX0A 4D3NA 4D3TA 4CFTA 4UH6A 1M9RA 4UGBA 3N62A 5ADMA 1ED4A 4CFTB 4D3BA 4CAPA 4UPSA 4KCPA 4V3ZA 1DM6A 3DQSA 1DD7A 3UFRA 4CX0A 1P6IA 1P6MA 1D1WA 1D0CA 1DM8A 3N65A 4D1PA 1ZZTA 3JT8A 3PNFA 2G6KA 5NSEA 1DWXA 1MJTA 3N64A 3NLXA 3NW2A 4JSEA 4KCKA 5G6DA 4JSGA 3NLZA 4UGTA 3JT3A 4LUWA 4KCQA 4KCJA 1JWJA 4V3XA 3N5YA 3N68A 1D1XA 2G6NA 3PNEA 3N6DA 3RQPA 5G6PA 5FVWA 3NLNA 1MMWA 3FC5A 1ZZSA 2HX3A 1DMKA 5ADNA 3NLKA 4KCMA 1R35A 3N61A 1FOPA 3B3MA 4K5GA 3SVQA 1M00A 1K2SA 5AD6A 3NLJA 4NSEA 4KCSA 1DMIA 2OROA 3UFPA 5G6NA 4UGFA 4CUNA 5FW0A 1FOIA 1ZVIA 3RQMA 4FVWA 3N60A 4CTXA 1D1YA 1D0OA 6NSEA 1K2RA 3TYNA 8NSEA 3HSNA 4JSMA 1FOLA 5FVRA 1DWWA 3N67A 5G6BA 3JT9A 5AGKA 5FVQA 3N6AA 3JWUA 2G6IA 5G0NA 2BHJA 4D34A 4IMSA 5G6CA 3JWYA 3RQLA 3UFQA 3E65A 5FVUA 4D7HA 3NLYA 1ZZUA 3E7SA 2G6HA 2NSIA 1M8HA 5FVPA 3NM0A 5FJ3A 4UGHA 4D1NA 4UGOA 4UH0A 4D38A 3E7GA 3B3PA 4UH5A 5G68A 4D2YA 4D32A 1P6JA 4D1OA 3NLHA 3EBFA 4FVYA 3EJ8A 4UH3A 4UGCA 1M8DA 4FW0A 3JX6A 3N5SA 4D7JA 4KCLA 4UQSA 4CAOA 4D30A 4D39A 3UFWA 2HX2A 4V3UA 4CTPA 5G67A 4CU1A 4CX3A 4UGWA 2ORPA 1M9TA 3UFSA 1M7ZA 1NSIA 4UH2A 4CX6A 1DF1A 3N5QA 3NLOA 2ORSA 3EBDA 3N5PA 3N6FA 3NOSA 4UPNA 4UPTA 3JWVA 1M7VA 3JX2A 3N66A 4D7IA 4CWZA 5G65A 4D3OA 1ZZRA 4UGRA 4JSFA 3JT7A 3E6TA 5G6EA 1M9QA 4K5JA 4KCHA 4CWWA 1ZVLA 3NLQA 5AD8A 4D3MA 5AD5A 3NLUA 4UGIA 4EUXA 3NLGA 1M8EA 4D3KA 5AD4A 1P6LA 1P6NA 3JT4A 3JWZA 1M8IA 3N63A 4KCNA 5FVOA 5ADAA 5G0PA 1DMJA 3N5RA 4UG7A 3NQSA 5G6IA 3RQOA 1N2NA 4KCRA 3SVPA 4CARA 4UGKA 5FVXA 4UCHA 4UGPA 3TYLA 4CAQA 4CWXA 4IMTA 4UGGA 4UGSA 1MMVA 4UG5A 1QW5A 3NLWA 1I83A 3UFUA 4CX5A 5FJ2A 1K2TA 2ORRA 3TYOA 4UGJA 4UPPA 4UGQA 1LZXA 1FOJA 4CVGA 3HSOA 5FVTA 4CTRA 4UGUA 4UGZA 1VAFA 5ADCA 4IMUA 3NLMA 4D37A 4GQEA 5G6GA 1QOMA 3JTAA 4K5EA 5G6MA 1ED6A 1ZZQA 5AGPA 4IMXA 3N5XA 4FVXA 4D3JA 2FC2A 3RQKA 2G6LA 5AGOA 1JWKA 1OM5A 5G6JA 3TYMA 3E6OA 4UPOA 3E7MA 4KCIA 4UGMA 3JWWA 3DQTA 4UG8A 5ADKA 3NLTA 2NOSA 4CX4A 5ADDA 5G6LA 4KCOA 4JS9A 3Q9AA 4FVZA 2FBZX 4D35A 3JWTA 5FVYA 3NLIA 3NNZA 1RS7A 2NODA 5ADFA 4CTVA 5ADJA 1OM4A 2FC1A 5G6AA 3N5VA 2ORQA 4K5HA 3N6CA 3JX1A 4UGEA 4K5DA 4UPQA 4CTTA 4D2ZA 3NLEA 3HSPA 4CX2A 3NSEA 4UH1A 3JWSA 5FVZA 5FVSA 3UFVA 1Q2OA 2AMOA 3E6LA 5G6QA 4D3IA 1M9JA 2FLQA 1DWVA 4UGLA 4CWYA 1P6KA 4C3AA 2Y37A 4CAMA 4UGDA 1QWCA 4UH9A 4UPMA 5G69A 4D36A 3EAHA 4IMWA 3N5TA 4CTQA 4LUXA 4V3YA 3JX3A 5ADGA 2HX4A 3EAIA 3UFOA 3E68A 1D1VA 2AN2A 3RQJA 5AGLA 2AN0A 3N69A 5AGMA 1DM7A 4K5IA 3PNGA 1QW4A 1NOSA 3N2RA 4CU0A 4D3AA 3N5ZA 4UH4A 4D3UA 3B3NA 4UGVA 3N6GA 4UGAA 3NLDA 4CTUA 1RS6A 4UG6A 1QW6A 3JT5A 4CULA 4UGXA 4UGNA 1K2UA 2NSEA 1FOOA 4UGYA 3JX5A 1RS9A 3N5WA 5G66A 4CX7A 2G6MA 4LWBA 4C39A 3JX4A 3E7TA 4LWAA 5AD9A 4UH7A 2ORTA 4V3VA 1NSEA 4JSJA 4CX1A 1VAGA 4UHAA 3B3OA 1LZZA 5G0OA 3N6BA 3NLRA 4CDTA 4D31A 5ADBA 1ED5A 5G6KA 4NOSA 3DWJA 4CTWA 2G6OA 5ADLA 5ADEA 3JT6A 2G6JA 1NODA 1RS8A 4K5FA 5AD7A 3NODA 3E7SB 4CTYA 4CANA 4D33A 4CUMA 4JSIA 1M9MA 4D3VA 4JSKA 4UH8A 4UG9A 4UQRA 3NLPA 3PNHA 1NOCA 4V3WA 3E67A 1P6HA 3N6EA 3NNYA 3Q99A 3NLFA 1M9KA 4K5KA 4JSHA 3UFTA 3JWXA 3E6NA 9NSEA
chains in the Genus database with same CATH topology
5AGNA 4CWVA 4UPRA 4D7OA 5ADIA 3RQNA 7NSEA 3DQRA 4JSLA 3E7IA 5G6HA 4CU1B 3NLVA 5G6FA 5FVVA 4CTZA 5G6OA 3JX0A 4D3NA 4D3TA 4CFTA 4UH6A 1M9RA 4UGBA 3N62A 5ADMA 1ED4A 4CFTB 4D3BA 4CAPA 4UPSA 4KCPA 4V3ZA 1DM6A 3DQSA 1DD7A 3UFRA 4CX0A 1P6IA 1P6MA 1D1WA 1D0CA 1DM8A 3N65A 4D1PA 1ZZTA 3JT8A 3PNFA 2G6KA 5NSEA 1DWXA 1MJTA 3N64A 3NLXA 3NW2A 4JSEA 4KCKA 5G6DA 4JSGA 3NLZA 4UGTA 3JT3A 4LUWA 4KCQA 4KCJA 1JWJA 4V3XA 3N5YA 3N68A 1D1XA 2G6NA 3PNEA 3N6DA 3RQPA 5G6PA 5FVWA 3NLNA 1MMWA 3FC5A 1ZZSA 2HX3A 1DMKA 5ADNA 3NLKA 4KCMA 1R35A 3N61A 1FOPA 3B3MA 4K5GA 3SVQA 1M00A 1K2SA 5AD6A 3NLJA 4NSEA 4KCSA 1DMIA 2OROA 3UFPA 5G6NA 4UGFA 4CUNA 5FW0A 1FOIA 1ZVIA 3RQMA 4FVWA 3N60A 4CTXA 1D1YA 1D0OA 6NSEA 1K2RA 3TYNA 8NSEA 3HSNA 4JSMA 1FOLA 5FVRA 1DWWA 3N67A 5G6BA 3JT9A 5AGKA 5FVQA 3N6AA 3JWUA 2G6IA 5G0NA 2BHJA 4D34A 4IMSA 5G6CA 3JWYA 3RQLA 3UFQA 3E65A 5FVUA 4D7HA 3NLYA 1ZZUA 3E7SA 2G6HA 2NSIA 1M8HA 5FVPA 3NM0A 5FJ3A 4UGHA 4D1NA 4UGOA 4UH0A 4D38A 3E7GA 3B3PA 4UH5A 5G68A 4D2YA 4D32A 1P6JA 4D1OA 3NLHA 3EBFA 4FVYA 3EJ8A 4UH3A 4UGCA 1M8DA 4FW0A 3JX6A 3N5SA 4D7JA 4KCLA 4UQSA 4CAOA 4D30A 4D39A 3UFWA 2HX2A 4V3UA 4CTPA 5G67A 4CU1A 4CX3A 4UGWA 2ORPA 1M9TA 3UFSA 1M7ZA 1NSIA 4UH2A 4CX6A 1DF1A 3N5QA 3NLOA 2ORSA 3EBDA 3N5PA 3N6FA 3NOSA 4UPNA 4UPTA 3JWVA 1M7VA 3JX2A 3N66A 4D7IA 4CWZA 5G65A 4D3OA 1ZZRA 4UGRA 4JSFA 3JT7A 3E6TA 5G6EA 1M9QA 4K5JA 4KCHA 4CWWA 1ZVLA 3NLQA 5AD8A 4D3MA 5AD5A 3NLUA 4UGIA 4EUXA 3NLGA 1M8EA 4D3KA 5AD4A 1P6LA 1P6NA 3JT4A 3JWZA 1M8IA 3N63A 4KCNA 5FVOA 5ADAA 5G0PA 1DMJA 3N5RA 4UG7A 3NQSA 5G6IA 3RQOA 1N2NA 4KCRA 3SVPA 4CARA 4UGKA 5FVXA 4UCHA 4UGPA 3TYLA 4CAQA 4CWXA 4IMTA 4UGGA 4UGSA 1MMVA 4UG5A 1QW5A 3NLWA 1I83A 3UFUA 4CX5A 5FJ2A 1K2TA 2ORRA 3TYOA 4UGJA 4UPPA 4UGQA 1LZXA 1FOJA 4CVGA 3HSOA 5FVTA 4CTRA 4UGUA 4UGZA 1VAFA 5ADCA 4IMUA 3NLMA 4D37A 4GQEA 5G6GA 1QOMA 3JTAA 4K5EA 5G6MA 1ED6A 1ZZQA 5AGPA 4IMXA 3N5XA 4FVXA 4D3JA 2FC2A 3RQKA 2G6LA 5AGOA 1JWKA 1OM5A 5G6JA 3TYMA 3E6OA 4UPOA 3E7MA 4KCIA 4UGMA 3JWWA 3DQTA 4UG8A 5ADKA 3NLTA 2NOSA 4CX4A 5ADDA 5G6LA 4KCOA 4JS9A 3Q9AA 4FVZA 2FBZX 4D35A 3JWTA 5FVYA 3NLIA 3NNZA 1RS7A 2NODA 5ADFA 4CTVA 5ADJA 1OM4A 2FC1A 5G6AA 3N5VA 2ORQA 4K5HA 3N6CA 3JX1A 4UGEA 4K5DA 4UPQA 4CTTA 4D2ZA 3NLEA 3HSPA 4CX2A 3NSEA 4UH1A 3JWSA 5FVZA 5FVSA 3UFVA 1Q2OA 2AMOA 3E6LA 5G6QA 4D3IA 1M9JA 2FLQA 1DWVA 4UGLA 4CWYA 1P6KA 4C3AA 2Y37A 4CAMA 4UGDA 1QWCA 4UH9A 4UPMA 5G69A 4D36A 3EAHA 4IMWA 3N5TA 4CTQA 4LUXA 4V3YA 3JX3A 5ADGA 2HX4A 3EAIA 3UFOA 3E68A 1D1VA 2AN2A 3RQJA 5AGLA 2AN0A 3N69A 5AGMA 1DM7A 4K5IA 3PNGA 1QW4A 1NOSA 3N2RA 4CU0A 4D3AA 3N5ZA 4UH4A 4D3UA 3B3NA 4UGVA 3N6GA 4UGAA 3NLDA 4CTUA 1RS6A 4UG6A 1QW6A 3JT5A 4CULA 4UGXA 4UGNA 1K2UA 2NSEA 1FOOA 4UGYA 3JX5A 1RS9A 3N5WA 5G66A 4CX7A 2G6MA 4LWBA 4C39A 3JX4A 3E7TA 4LWAA 5AD9A 4UH7A 2ORTA 4V3VA 1NSEA 4JSJA 4CX1A 1VAGA 4UHAA 3B3OA 1LZZA 5G0OA 3N6BA 3NLRA 4CDTA 4D31A 5ADBA 1ED5A 5G6KA 4NOSA 3DWJA 4CTWA 2G6OA 5ADLA 5ADEA 3JT6A 2G6JA 1NODA 1RS8A 4K5FA 5AD7A 3NODA 3E7SB 4CTYA 4CANA 4D33A 4CUMA 4JSIA 1M9MA 4D3VA 4JSKA 4UH8A 4UG9A 4UQRA 3NLPA 3PNHA 1NOCA 4V3WA 3E67A 1P6HA 3N6EA 3NNYA 3Q99A 3NLFA 1M9KA 4K5KA 4JSHA 3UFTA 3JWXA 3E6NA 9NSEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AGN A;  4CWV A;  4UPR A;  4D7O A;  5ADI A;  3RQN A;  7NSE A;  3DQR A;  4JSL A;  3E7I A;  5G6H A;  4CU1 B;  3NLV A;  5G6F A;  5FVV A;  4CTZ A;  5G6O A;  3JX0 A;  4D3N A;  4D3T A;  4CFT A;  4UH6 A;  1M9R A;  4UGB A;  3N62 A;  5ADM A;  1ED4 A;  4CFT B;  4D3B A;  4CAP A;  4UPS A;  4KCP A;  4V3Z A;  1DM6 A;  3DQS A;  1DD7 A;  3UFR A;  4CX0 A;  1P6I A;  1P6M A;  1D1W A;  1D0C A;  1DM8 A;  3N65 A;  4D1P A;  1ZZT A;  3JT8 A;  3PNF A;  2G6K A;  5NSE A;  1DWX A;  1MJT A;  3N64 A;  3NLX A;  3NW2 A;  4JSE A;  4KCK A;  5G6D A;  4JSG A;  3NLZ A;  4UGT A;  3JT3 A;  4LUW A;  4KCQ A;  4KCJ A;  1JWJ A;  4V3X A;  3N5Y A;  3N68 A;  1D1X A;  2G6N A;  3PNE A;  3N6D A;  3RQP A;  5G6P A;  5FVW A;  3NLN A;  1MMW A;  3FC5 A;  1ZZS A;  2HX3 A;  1DMK A;  5ADN A;  3NLK A;  4KCM A;  1R35 A;  3N61 A;  1FOP A;  3B3M A;  4K5G A;  3SVQ A;  1M00 A;  1K2S A;  5AD6 A;  3NLJ A;  4NSE A;  4KCS A;  1DMI A;  2ORO A;  3UFP A;  5G6N A;  4UGF A;  4CUN A;  5FW0 A;  1FOI A;  1ZVI A;  3RQM A;  4FVW A;  3N60 A;  4CTX A;  1D1Y A;  1D0O A;  6NSE A;  1K2R A;  3TYN A;  8NSE A;  3HSN A;  4JSM A;  1FOL A;  5FVR A;  1DWW A;  3N67 A;  5G6B A;  3JT9 A;  5AGK A;  5FVQ A;  3N6A A;  3JWU A;  2G6I A;  5G0N A;  2BHJ A;  4D34 A;  4IMS A;  5G6C A;  3JWY A;  3RQL A;  3UFQ A;  3E65 A;  5FVU A;  4D7H A;  3NLY A;  1ZZU A;  3E7S A;  2G6H A;  2NSI A;  1M8H A;  5FVP A;  3NM0 A;  5FJ3 A;  4UGH A;  4D1N A;  4UGO A;  4UH0 A;  4D38 A;  3E7G A;  3B3P A;  4UH5 A;  5G68 A;  4D2Y A;  4D32 A;  1P6J A;  4D1O A;  3NLH A;  3EBF A;  4FVY A;  3EJ8 A;  4UH3 A;  4UGC A;  1M8D A;  4FW0 A;  3JX6 A;  3N5S A;  4D7J A;  4KCL A;  4UQS A;  4CAO A;  4D30 A;  4D39 A;  3UFW A;  2HX2 A;  4V3U A;  4CTP A;  5G67 A;  4CU1 A;  4CX3 A;  4UGW A;  2ORP A;  1M9T A;  3UFS A;  1M7Z A;  1NSI A;  4UH2 A;  4CX6 A;  1DF1 A;  3N5Q A;  3NLO A;  2ORS A;  3EBD A;  3N5P A;  3N6F A;  3NOS A;  4UPN A;  4UPT A;  3JWV A;  1M7V A;  3JX2 A;  3N66 A;  4D7I A;  4CWZ A;  5G65 A;  4D3O A;  1ZZR A;  4UGR A;  4JSF A;  3JT7 A;  3E6T A;  5G6E A;  1M9Q A;  4K5J A;  4KCH A;  4CWW A;  1ZVL A;  3NLQ A;  5AD8 A;  4D3M A;  5AD5 A;  3NLU A;  4UGI A;  4EUX A;  3NLG A;  1M8E A;  4D3K A;  5AD4 A;  1P6L A;  1P6N A;  3JT4 A;  3JWZ A;  1M8I A;  3N63 A;  4KCN A;  5FVO A;  5ADA A;  5G0P A;  1DMJ A;  3N5R A;  4UG7 A;  3NQS A;  5G6I A;  3RQO A;  1N2N A;  4KCR A;  3SVP A;  4CAR A;  4UGK A;  5FVX A;  4UCH A;  4UGP A;  3TYL A;  4CAQ A;  4CWX A;  4IMT A;  4UGG A;  4UGS A;  1MMV A;  4UG5 A;  1QW5 A;  3NLW A;  1I83 A;  3UFU A;  4CX5 A;  5FJ2 A;  1K2T A;  2ORR A;  3TYO A;  4UGJ A;  4UPP A;  4UGQ A;  1LZX A;  1FOJ A;  4CVG A;  3HSO A;  5FVT A;  4CTR A;  4UGU A;  4UGZ A;  1VAF A;  5ADC A;  4IMU A;  3NLM A;  4D37 A;  4GQE A;  5G6G A;  1QOM A;  3JTA A;  4K5E A;  5G6M A;  1ED6 A;  1ZZQ A;  5AGP A;  4IMX A;  3N5X A;  4FVX A;  4D3J A;  2FC2 A;  3RQK A;  2G6L A;  5AGO A;  1JWK A;  1OM5 A;  5G6J A;  3TYM A;  3E6O A;  4UPO A;  3E7M A;  4KCI A;  4UGM A;  3JWW A;  3DQT A;  4UG8 A;  5ADK A;  3NLT A;  2NOS A;  4CX4 A;  5ADD A;  5G6L A;  4KCO A;  4JS9 A;  3Q9A A;  4FVZ A;  2FBZ X;  4D35 A;  3JWT A;  5FVY A;  3NLI A;  3NNZ A;  1RS7 A;  2NOD A;  5ADF A;  4CTV A;  5ADJ A;  1OM4 A;  2FC1 A;  5G6A A;  3N5V A;  2ORQ A;  4K5H A;  3N6C A;  3JX1 A;  4UGE A;  4K5D A;  4UPQ A;  4CTT A;  4D2Z A;  3NLE A;  3HSP A;  4CX2 A;  3NSE A;  4UH1 A;  3JWS A;  5FVZ A;  5FVS A;  3UFV A;  1Q2O A;  2AMO A;  3E6L A;  5G6Q A;  4D3I A;  1M9J A;  2FLQ A;  1DWV A;  4UGL A;  4CWY A;  1P6K A;  4C3A A;  2Y37 A;  4CAM A;  4UGD A;  1QWC A;  4UH9 A;  4UPM A;  5G69 A;  4D36 A;  3EAH A;  4IMW A;  3N5T A;  4CTQ A;  4LUX A;  4V3Y A;  3JX3 A;  5ADG A;  2HX4 A;  3EAI A;  3UFO A;  3E68 A;  1D1V A;  2AN2 A;  3RQJ A;  5AGL A;  2AN0 A;  3N69 A;  5AGM A;  1DM7 A;  4K5I A;  3PNG A;  1QW4 A;  1NOS A;  3N2R A;  4CU0 A;  4D3A A;  3N5Z A;  4UH4 A;  4D3U A;  3B3N A;  4UGV A;  3N6G A;  4UGA A;  3NLD A;  4CTU A;  1RS6 A;  4UG6 A;  1QW6 A;  3JT5 A;  4CUL A;  4UGX A;  4UGN A;  1K2U A;  2NSE A;  1FOO A;  4UGY A;  3JX5 A;  1RS9 A;  3N5W A;  5G66 A;  4CX7 A;  2G6M A;  4LWB A;  4C39 A;  3JX4 A;  3E7T A;  4LWA A;  5AD9 A;  4UH7 A;  2ORT A;  4V3V A;  1NSE A;  4JSJ A;  4CX1 A;  1VAG A;  4UHA A;  3B3O A;  1LZZ A;  5G0O A;  3N6B A;  3NLR A;  4CDT A;  4D31 A;  5ADB A;  1ED5 A;  5G6K A;  4NOS A;  3DWJ A;  4CTW A;  2G6O A;  5ADL A;  5ADE A;  3JT6 A;  2G6J A;  1NOD A;  1RS8 A;  4K5F A;  5AD7 A;  3NOD A;  3E7S B;  4CTY A;  4CAN A;  4D33 A;  4CUM A;  4JSI A;  1M9M A;  4D3V A;  4JSK A;  4UH8 A;  4UG9 A;  4UQR A;  3NLP A;  3PNH A;  1NOC A;  4V3W A;  3E67 A;  1P6H A;  3N6E A;  3NNY A;  3Q99 A;  3NLF A;  1M9K A;  4K5K A;  4JSH A;  3UFT A;  3JWX A;  3E6N A;  9NSE A; 
#chains in the Genus database with same CATH topology
 5AGN A;  4CWV A;  4UPR A;  4D7O A;  5ADI A;  3RQN A;  7NSE A;  3DQR A;  4JSL A;  3E7I A;  5G6H A;  4CU1 B;  3NLV A;  5G6F A;  5FVV A;  4CTZ A;  5G6O A;  3JX0 A;  4D3N A;  4D3T A;  4CFT A;  4UH6 A;  1M9R A;  4UGB A;  3N62 A;  5ADM A;  1ED4 A;  4CFT B;  4D3B A;  4CAP A;  4UPS A;  4KCP A;  4V3Z A;  1DM6 A;  3DQS A;  1DD7 A;  3UFR A;  4CX0 A;  1P6I A;  1P6M A;  1D1W A;  1D0C A;  1DM8 A;  3N65 A;  4D1P A;  1ZZT A;  3JT8 A;  3PNF A;  2G6K A;  5NSE A;  1DWX A;  1MJT A;  3N64 A;  3NLX A;  3NW2 A;  4JSE A;  4KCK A;  5G6D A;  4JSG A;  3NLZ A;  4UGT A;  3JT3 A;  4LUW A;  4KCQ A;  4KCJ A;  1JWJ A;  4V3X A;  3N5Y A;  3N68 A;  1D1X A;  2G6N A;  3PNE A;  3N6D A;  3RQP A;  5G6P A;  5FVW A;  3NLN A;  1MMW A;  3FC5 A;  1ZZS A;  2HX3 A;  1DMK A;  5ADN A;  3NLK A;  4KCM A;  1R35 A;  3N61 A;  1FOP A;  3B3M A;  4K5G A;  3SVQ A;  1M00 A;  1K2S A;  5AD6 A;  3NLJ A;  4NSE A;  4KCS A;  1DMI A;  2ORO A;  3UFP A;  5G6N A;  4UGF A;  4CUN A;  5FW0 A;  1FOI A;  1ZVI A;  3RQM A;  4FVW A;  3N60 A;  4CTX A;  1D1Y A;  1D0O A;  6NSE A;  1K2R A;  3TYN A;  8NSE A;  3HSN A;  4JSM A;  1FOL A;  5FVR A;  1DWW A;  3N67 A;  5G6B A;  3JT9 A;  5AGK A;  5FVQ A;  3N6A A;  3JWU A;  2G6I A;  5G0N A;  2BHJ A;  4D34 A;  4IMS A;  5G6C A;  3JWY A;  3RQL A;  3UFQ A;  3E65 A;  5FVU A;  4D7H A;  3NLY A;  1ZZU A;  3E7S A;  2G6H A;  2NSI A;  1M8H A;  5FVP A;  3NM0 A;  5FJ3 A;  4UGH A;  4D1N A;  4UGO A;  4UH0 A;  4D38 A;  3E7G A;  3B3P A;  4UH5 A;  5G68 A;  4D2Y A;  4D32 A;  1P6J A;  4D1O A;  3NLH A;  3EBF A;  4FVY A;  3EJ8 A;  4UH3 A;  4UGC A;  1M8D A;  4FW0 A;  3JX6 A;  3N5S A;  4D7J A;  4KCL A;  4UQS A;  4CAO A;  4D30 A;  4D39 A;  3UFW A;  2HX2 A;  4V3U A;  4CTP A;  5G67 A;  4CU1 A;  4CX3 A;  4UGW A;  2ORP A;  1M9T A;  3UFS A;  1M7Z A;  1NSI A;  4UH2 A;  4CX6 A;  1DF1 A;  3N5Q A;  3NLO A;  2ORS A;  3EBD A;  3N5P A;  3N6F A;  3NOS A;  4UPN A;  4UPT A;  3JWV A;  1M7V A;  3JX2 A;  3N66 A;  4D7I A;  4CWZ A;  5G65 A;  4D3O A;  1ZZR A;  4UGR A;  4JSF A;  3JT7 A;  3E6T A;  5G6E A;  1M9Q A;  4K5J A;  4KCH A;  4CWW A;  1ZVL A;  3NLQ A;  5AD8 A;  4D3M A;  5AD5 A;  3NLU A;  4UGI A;  4EUX A;  3NLG A;  1M8E A;  4D3K A;  5AD4 A;  1P6L A;  1P6N A;  3JT4 A;  3JWZ A;  1M8I A;  3N63 A;  4KCN A;  5FVO A;  5ADA A;  5G0P A;  1DMJ A;  3N5R A;  4UG7 A;  3NQS A;  5G6I A;  3RQO A;  1N2N A;  4KCR A;  3SVP A;  4CAR A;  4UGK A;  5FVX A;  4UCH A;  4UGP A;  3TYL A;  4CAQ A;  4CWX A;  4IMT A;  4UGG A;  4UGS A;  1MMV A;  4UG5 A;  1QW5 A;  3NLW A;  1I83 A;  3UFU A;  4CX5 A;  5FJ2 A;  1K2T A;  2ORR A;  3TYO A;  4UGJ A;  4UPP A;  4UGQ A;  1LZX A;  1FOJ A;  4CVG A;  3HSO A;  5FVT A;  4CTR A;  4UGU A;  4UGZ A;  1VAF A;  5ADC A;  4IMU A;  3NLM A;  4D37 A;  4GQE A;  5G6G A;  1QOM A;  3JTA A;  4K5E A;  5G6M A;  1ED6 A;  1ZZQ A;  5AGP A;  4IMX A;  3N5X A;  4FVX A;  4D3J A;  2FC2 A;  3RQK A;  2G6L A;  5AGO A;  1JWK A;  1OM5 A;  5G6J A;  3TYM A;  3E6O A;  4UPO A;  3E7M A;  4KCI A;  4UGM A;  3JWW A;  3DQT A;  4UG8 A;  5ADK A;  3NLT A;  2NOS A;  4CX4 A;  5ADD A;  5G6L A;  4KCO A;  4JS9 A;  3Q9A A;  4FVZ A;  2FBZ X;  4D35 A;  3JWT A;  5FVY A;  3NLI A;  3NNZ A;  1RS7 A;  2NOD A;  5ADF A;  4CTV A;  5ADJ A;  1OM4 A;  2FC1 A;  5G6A A;  3N5V A;  2ORQ A;  4K5H A;  3N6C A;  3JX1 A;  4UGE A;  4K5D A;  4UPQ A;  4CTT A;  4D2Z A;  3NLE A;  3HSP A;  4CX2 A;  3NSE A;  4UH1 A;  3JWS A;  5FVZ A;  5FVS A;  3UFV A;  1Q2O A;  2AMO A;  3E6L A;  5G6Q A;  4D3I A;  1M9J A;  2FLQ A;  1DWV A;  4UGL A;  4CWY A;  1P6K A;  4C3A A;  2Y37 A;  4CAM A;  4UGD A;  1QWC A;  4UH9 A;  4UPM A;  5G69 A;  4D36 A;  3EAH A;  4IMW A;  3N5T A;  4CTQ A;  4LUX A;  4V3Y A;  3JX3 A;  5ADG A;  2HX4 A;  3EAI A;  3UFO A;  3E68 A;  1D1V A;  2AN2 A;  3RQJ A;  5AGL A;  2AN0 A;  3N69 A;  5AGM A;  1DM7 A;  4K5I A;  3PNG A;  1QW4 A;  1NOS A;  3N2R A;  4CU0 A;  4D3A A;  3N5Z A;  4UH4 A;  4D3U A;  3B3N A;  4UGV A;  3N6G A;  4UGA A;  3NLD A;  4CTU A;  1RS6 A;  4UG6 A;  1QW6 A;  3JT5 A;  4CUL A;  4UGX A;  4UGN A;  1K2U A;  2NSE A;  1FOO A;  4UGY A;  3JX5 A;  1RS9 A;  3N5W A;  5G66 A;  4CX7 A;  2G6M A;  4LWB A;  4C39 A;  3JX4 A;  3E7T A;  4LWA A;  5AD9 A;  4UH7 A;  2ORT A;  4V3V A;  1NSE A;  4JSJ A;  4CX1 A;  1VAG A;  4UHA A;  3B3O A;  1LZZ A;  5G0O A;  3N6B A;  3NLR A;  4CDT A;  4D31 A;  5ADB A;  1ED5 A;  5G6K A;  4NOS A;  3DWJ A;  4CTW A;  2G6O A;  5ADL A;  5ADE A;  3JT6 A;  2G6J A;  1NOD A;  1RS8 A;  4K5F A;  5AD7 A;  3NOD A;  3E7S B;  4CTY A;  4CAN A;  4D33 A;  4CUM A;  4JSI A;  1M9M A;  4D3V A;  4JSK A;  4UH8 A;  4UG9 A;  4UQR A;  3NLP A;  3PNH A;  1NOC A;  4V3W A;  3E67 A;  1P6H A;  3N6E A;  3NNY A;  3Q99 A;  3NLF A;  1M9K A;  4K5K A;  4JSH A;  3UFT A;  3JWX A;  3E6N A;  9NSE A; 
#chains in the Genus database with same CATH homology
 5AGN A;  4CWV A;  4UPR A;  4D7O A;  5ADI A;  3RQN A;  7NSE A;  3DQR A;  4JSL A;  3E7I A;  5G6H A;  4CU1 B;  3NLV A;  5G6F A;  5FVV A;  4CTZ A;  5G6O A;  3JX0 A;  4D3N A;  4D3T A;  4CFT A;  4UH6 A;  1M9R A;  4UGB A;  3N62 A;  5ADM A;  1ED4 A;  4CFT B;  4D3B A;  4CAP A;  4UPS A;  4KCP A;  4V3Z A;  1DM6 A;  3DQS A;  1DD7 A;  3UFR A;  4CX0 A;  1P6I A;  1P6M A;  1D1W A;  1D0C A;  1DM8 A;  3N65 A;  4D1P A;  1ZZT A;  3JT8 A;  3PNF A;  2G6K A;  5NSE A;  1DWX A;  1MJT A;  3N64 A;  3NLX A;  3NW2 A;  4JSE A;  4KCK A;  5G6D A;  4JSG A;  3NLZ A;  4UGT A;  3JT3 A;  4LUW A;  4KCQ A;  4KCJ A;  1JWJ A;  4V3X A;  3N5Y A;  3N68 A;  1D1X A;  2G6N A;  3PNE A;  3N6D A;  3RQP A;  5G6P A;  5FVW A;  3NLN A;  1MMW A;  3FC5 A;  1ZZS A;  2HX3 A;  1DMK A;  5ADN A;  3NLK A;  4KCM A;  1R35 A;  3N61 A;  1FOP A;  3B3M A;  4K5G A;  3SVQ A;  1M00 A;  1K2S A;  5AD6 A;  3NLJ A;  4NSE A;  4KCS A;  1DMI A;  2ORO A;  3UFP A;  5G6N A;  4UGF A;  4CUN A;  5FW0 A;  1FOI A;  1ZVI A;  3RQM A;  4FVW A;  3N60 A;  4CTX A;  1D1Y A;  1D0O A;  6NSE A;  1K2R A;  3TYN A;  8NSE A;  3HSN A;  4JSM A;  1FOL A;  5FVR A;  1DWW A;  3N67 A;  5G6B A;  3JT9 A;  5AGK A;  5FVQ A;  3N6A A;  3JWU A;  2G6I A;  5G0N A;  2BHJ A;  4D34 A;  4IMS A;  5G6C A;  3JWY A;  3RQL A;  3UFQ A;  3E65 A;  5FVU A;  4D7H A;  3NLY A;  1ZZU A;  3E7S A;  2G6H A;  2NSI A;  1M8H A;  5FVP A;  3NM0 A;  5FJ3 A;  4UGH A;  4D1N A;  4UGO A;  4UH0 A;  4D38 A;  3E7G A;  3B3P A;  4UH5 A;  5G68 A;  4D2Y A;  4D32 A;  1P6J A;  4D1O A;  3NLH A;  3EBF A;  4FVY A;  3EJ8 A;  4UH3 A;  4UGC A;  1M8D A;  4FW0 A;  3JX6 A;  3N5S A;  4D7J A;  4KCL A;  4UQS A;  4CAO A;  4D30 A;  4D39 A;  3UFW A;  2HX2 A;  4V3U A;  4CTP A;  5G67 A;  4CU1 A;  4CX3 A;  4UGW A;  2ORP A;  1M9T A;  3UFS A;  1M7Z A;  1NSI A;  4UH2 A;  4CX6 A;  1DF1 A;  3N5Q A;  3NLO A;  2ORS A;  3EBD A;  3N5P A;  3N6F A;  3NOS A;  4UPN A;  4UPT A;  3JWV A;  1M7V A;  3JX2 A;  3N66 A;  4D7I A;  4CWZ A;  5G65 A;  4D3O A;  1ZZR A;  4UGR A;  4JSF A;  3JT7 A;  3E6T A;  5G6E A;  1M9Q A;  4K5J A;  4KCH A;  4CWW A;  1ZVL A;  3NLQ A;  5AD8 A;  4D3M A;  5AD5 A;  3NLU A;  4UGI A;  4EUX A;  3NLG A;  1M8E A;  4D3K A;  5AD4 A;  1P6L A;  1P6N A;  3JT4 A;  3JWZ A;  1M8I A;  3N63 A;  4KCN A;  5FVO A;  5ADA A;  5G0P A;  1DMJ A;  3N5R A;  4UG7 A;  3NQS A;  5G6I A;  3RQO A;  1N2N A;  4KCR A;  3SVP A;  4CAR A;  4UGK A;  5FVX A;  4UCH A;  4UGP A;  3TYL A;  4CAQ A;  4CWX A;  4IMT A;  4UGG A;  4UGS A;  1MMV A;  4UG5 A;  1QW5 A;  3NLW A;  1I83 A;  3UFU A;  4CX5 A;  5FJ2 A;  1K2T A;  2ORR A;  3TYO A;  4UGJ A;  4UPP A;  4UGQ A;  1LZX A;  1FOJ A;  4CVG A;  3HSO A;  5FVT A;  4CTR A;  4UGU A;  4UGZ A;  1VAF A;  5ADC A;  4IMU A;  3NLM A;  4D37 A;  4GQE A;  5G6G A;  1QOM A;  3JTA A;  4K5E A;  5G6M A;  1ED6 A;  1ZZQ A;  5AGP A;  4IMX A;  3N5X A;  4FVX A;  4D3J A;  2FC2 A;  3RQK A;  2G6L A;  5AGO A;  1JWK A;  1OM5 A;  5G6J A;  3TYM A;  3E6O A;  4UPO A;  3E7M A;  4KCI A;  4UGM A;  3JWW A;  3DQT A;  4UG8 A;  5ADK A;  3NLT A;  2NOS A;  4CX4 A;  5ADD A;  5G6L A;  4KCO A;  4JS9 A;  3Q9A A;  4FVZ A;  2FBZ X;  4D35 A;  3JWT A;  5FVY A;  3NLI A;  3NNZ A;  1RS7 A;  2NOD A;  5ADF A;  4CTV A;  5ADJ A;  1OM4 A;  2FC1 A;  5G6A A;  3N5V A;  2ORQ A;  4K5H A;  3N6C A;  3JX1 A;  4UGE A;  4K5D A;  4UPQ A;  4CTT A;  4D2Z A;  3NLE A;  3HSP A;  4CX2 A;  3NSE A;  4UH1 A;  3JWS A;  5FVZ A;  5FVS A;  3UFV A;  1Q2O A;  2AMO A;  3E6L A;  5G6Q A;  4D3I A;  1M9J A;  2FLQ A;  1DWV A;  4UGL A;  4CWY A;  1P6K A;  4C3A A;  2Y37 A;  4CAM A;  4UGD A;  1QWC A;  4UH9 A;  4UPM A;  5G69 A;  4D36 A;  3EAH A;  4IMW A;  3N5T A;  4CTQ A;  4LUX A;  4V3Y A;  3JX3 A;  5ADG A;  2HX4 A;  3EAI A;  3UFO A;  3E68 A;  1D1V A;  2AN2 A;  3RQJ A;  5AGL A;  2AN0 A;  3N69 A;  5AGM A;  1DM7 A;  4K5I A;  3PNG A;  1QW4 A;  1NOS A;  3N2R A;  4CU0 A;  4D3A A;  3N5Z A;  4UH4 A;  4D3U A;  3B3N A;  4UGV A;  3N6G A;  4UGA A;  3NLD A;  4CTU A;  1RS6 A;  4UG6 A;  1QW6 A;  3JT5 A;  4CUL A;  4UGX A;  4UGN A;  1K2U A;  2NSE A;  1FOO A;  4UGY A;  3JX5 A;  1RS9 A;  3N5W A;  5G66 A;  4CX7 A;  2G6M A;  4LWB A;  4C39 A;  3JX4 A;  3E7T A;  4LWA A;  5AD9 A;  4UH7 A;  2ORT A;  4V3V A;  1NSE A;  4JSJ A;  4CX1 A;  1VAG A;  4UHA A;  3B3O A;  1LZZ A;  5G0O A;  3N6B A;  3NLR A;  4CDT A;  4D31 A;  5ADB A;  1ED5 A;  5G6K A;  4NOS A;  3DWJ A;  4CTW A;  2G6O A;  5ADL A;  5ADE A;  3JT6 A;  2G6J A;  1NOD A;  1RS8 A;  4K5F A;  5AD7 A;  3NOD A;  3E7S B;  4CTY A;  4CAN A;  4D33 A;  4CUM A;  4JSI A;  1M9M A;  4D3V A;  4JSK A;  4UH8 A;  4UG9 A;  4UQR A;  3NLP A;  3PNH A;  1NOC A;  4V3W A;  3E67 A;  1P6H A;  3N6E A;  3NNY A;  3Q99 A;  3NLF A;  1M9K A;  4K5K A;  4JSH A;  3UFT A;  3JWX A;  3E6N A;  9NSE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...