4UGQA

Structure of bacillus subtilis nitric oxide synthase in complex with n,n''-(((2s)-3-aminopropane-1,2-diyl)bis(oxymethanediylbenzene-3,1- diyl))dithiophene-2-carboximidamide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 123
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugqA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugqA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugqA03
2NSIA 3NOSA 1DM7A 3B3MA 1D1YA 1Q2OA 1P6JA 3JTAA 3JT9A 3JWVA 4KCOA 4UGUA 5FVTA 5AGKA 4KCIA 5G6AA 2HX3A 1M9TA 1ED4A 3TYLA 4K5EA 4IMWA 3NLWA 3E65A 4UG9A 3JWZA 3EBFA 1DMJA 4D7JA 5AGNA 4K5HA 5FVWA 3RQJA 4D2YA 3JT8A 4K5DA 4UPMA 3PNHA 3EAHA 4UGCA 3JWSA 4JSLA 3NLMA 3N5QA 5AGPA 3N60A 3E68A 3N67A 2BHJA 4K5KA 1D1WA 3JX4A 3NLTA 4CAOA 5G6BA 3JT3A 1RS6A 5G0OA 3EAIA 3N6EA 4CTWA 4C3AA 4D3AA 4JSJA 3JWUA 1RS8A 4UPOA 5ADLA 1RS7A 4V3UA 3NSEA 1ZVLA 4CARA 1P6IA 3NLUA 5AD9A 4UHAA 4UH7A 5AD4A 1QOMA 1ZZSA 4KCQA 4UGVA 3E6LA 5ADCA 4D34A 1M8EA 3N6DA 2G6MA 4UGAA 5G6OA 4IMUA 5ADFA 5FVZA 4CTRA 1DWWA 4D7HA 4UPQA 3Q9AA 5ADEA 3NLZA 1ZZTA 4JSMA 4CWWA 5AGMA 3NLQA 5ADKA 2G6JA 3UFUA 2FLQA 2ORQA 1N2NA 3N6BA 4KCMA 4KCHA 4D3VA 4LUWA 1JWJA 4UGJA 3RQKA 3N2RA 4UGIA 4UG5A 3NW2A 3N63A 1ED5A 3NLPA 1QW4A 3JWYA 3SVPA 4KCSA 2FC1A 4UH6A 4JSGA 4UG8A 3SVQA 5AGOA 1M7VA 4JSFA 4D36A 4D3NA 3NLRA 5ADGA 4UGKA 4CX2A 1M9QA 1FOPA 5G6DA 5G69A 3N6AA 4KCJA 4CX6A 4UGWA 1FOOA 4UGPA 3NLHA 4JSHA 4CFTB 4UPNA 3N5SA 4D3BA 4UCHA 5FW0A 4JSIA 5ADJA 5G67A 3E7IA 4CULA 4CX4A 1MMWA 1P6NA 3TYNA 3N62A 4D3JA 5FVYA 3TYMA 4FVWA 1NSIA 4KCLA 4CX0A 4UGDA 1QWCA 3JX1A 3UFTA 1D0CA 4UGXA 3NLIA 3DQTA 4UH3A 4D33A 3NLDA 4UGQA 4UPPA 5G6MA 5FVRA 3RQMA 4CVGA 4UGNA 4UH5A 3UFSA 5G66A 5G6JA 4CAMA 3E7SA 1I83A 3JT7A 3HSNA 3N68A 1DMKA 4UGGA 2G6OA 4V3VA 3E7MA 4CAPA 3NLOA 4KCKA 5G6GA 4CU1A 3RQPA 1K2TA 1QW6A 4D3MA 1MMVA 4D2ZA 1JWKA 4UGSA 3JT6A 1DWXA 8NSEA 1D1VA 4FW0A 5ADAA 2FBZX 1M9MA 5ADBA 3UFQA 1DMIA 4D31A 1NOCA 4UH2A 2NODA 1K2RA 1K2UA 3N66A 1R35A 2G6NA 4CWZA 2G6HA 2NSEA 1M8IA 1DM8A 3JX6A 5G6IA 4EUXA 3NLYA 3JX3A 1LZZA 4D7IA 4UGTA 1DF1A 4D3OA 4CWVA 5ADIA 4CAQA 1FOIA 5FVSA 3UFPA 4JSKA 3RQOA 3E6NA 5FVQA 3E6TA 1LZXA 5G6EA 3JX2A 3N5WA 1NOSA 4CWXA 4D32A 4UH9A 5G6KA 4LWAA 1FOLA 3N5VA 3NLVA 4UH0A 5G68A 4JS9A 1MJTA 1NODA 3DQSA 2OROA 4UGLA 3NLXA 5FVXA 5FVOA 1NSEA 4D38A 5G6NA 4K5FA 2G6LA 4CX1A 4UG7A 4UQRA 1ZZUA 3NLEA 1OM4A 1P6KA 3TYOA 3UFRA 2G6IA 4UPTA 3N5PA 4UH8A 5G6PA 3E7GA 4UH4A 5G6LA 1DM6A 5AD5A 4UGEA 5G6QA 3N5TA 3B3OA 4K5JA 1D1XA 3N6GA 4GQEA 4CFTA 5FVVA 3EJ8A 3JX0A 1DWVA 4K5IA 4D3TA 4D1NA 5G6FA 4CX5A 3FC5A 4UGFA 3E7TA 4LUXA 2ORSA 2AN0A 3N5RA 4V3YA 3DQRA 1M9JA 3N6FA 4UGBA 3B3PA 4CTQA 4IMXA 3NLFA 2AN2A 4K5GA 4CTZA 5ADDA 5ADNA 4UGZA 4D37A 4CUNA 4JSEA 1OM5A 3N5YA 1VAFA 1VAGA 1M8DA 1RS9A 3EBDA 4UGRA 1ZZQA 3JWTA 3B3NA 3N65A 5G65A 4D7OA 5FVUA 3UFVA 4KCNA 4LWBA 5AD7A 3RQNA 5G0NA 4UPSA 4CWYA 3RQLA 1M8HA 3N6CA 4FVYA 3HSPA 4UGHA 1K2SA 1P6HA 3PNFA 1D0OA 2FC2A 3E7SB 4CX7A 4D39A 4CTTA 4FVZA 3NLJA 3N5XA 4IMSA 3NLNA 4FVXA 4CU1B 3N69A 3PNEA 3N64A 4KCRA 4V3WA 2ORRA 3JX5A 1P6MA 3NNYA 3JT5A 1M9KA 5G0PA 4CTUA 4CTYA 3UFWA 4CTPA 3DWJA 3NM0A 4D35A 9NSEA 4CU0A 5FJ2A 4UH1A 4CX3A 1M7ZA 3NLGA 4UGYA 2Y37A 4CUMA 4D3UA 4UGMA 1FOJA 1ED6A 1ZZRA 2AMOA 5FVPA 3UFOA 4UG6A 4CDTA 5AGLA 3JT4A 4NSEA 4V3XA 1M00A 7NSEA 5G6HA 4NOSA 4CTVA 3E67A 4D3IA 3N5ZA 2NOSA 4D30A 2HX2A 1DD7A 5NSEA 2G6KA 5AD8A 3NLKA 4D3KA 3NQSA 3JWWA 4CTXA 4D1PA 1QW5A 2HX4A 4KCPA 5AD6A 5FJ3A 3E6OA 3NODA 3HSOA 4IMTA 3JWXA 5G6CA 6NSEA 3NNZA 4UQSA 2ORTA 1ZVIA 4UGOA 4D1OA 4CANA 2ORPA 3N61A 4V3ZA 3PNGA 4C39A 1P6LA 3Q99A 5ADMA 1M9RA 4UPRA
chains in the Genus database with same CATH superfamily
2NSIA 3NOSA 1DM7A 3B3MA 1D1YA 1Q2OA 1P6JA 3JTAA 3JT9A 3JWVA 4KCOA 4UGUA 5FVTA 5AGKA 4KCIA 5G6AA 2HX3A 1M9TA 1ED4A 3TYLA 4K5EA 4IMWA 3NLWA 3E65A 4UG9A 3JWZA 3EBFA 1DMJA 4D7JA 5AGNA 4K5HA 5FVWA 3RQJA 4D2YA 3JT8A 4K5DA 4UPMA 3PNHA 3EAHA 4UGCA 3JWSA 4JSLA 3NLMA 3N5QA 5AGPA 3N60A 3E68A 3N67A 2BHJA 4K5KA 1D1WA 3JX4A 3NLTA 4CAOA 5G6BA 3JT3A 1RS6A 5G0OA 3EAIA 3N6EA 4CTWA 4C3AA 4D3AA 4JSJA 3JWUA 1RS8A 4UPOA 5ADLA 1RS7A 4V3UA 3NSEA 1ZVLA 4CARA 1P6IA 3NLUA 5AD9A 4UHAA 4UH7A 5AD4A 1QOMA 1ZZSA 4KCQA 4UGVA 3E6LA 5ADCA 4D34A 1M8EA 3N6DA 2G6MA 4UGAA 5G6OA 4IMUA 5ADFA 5FVZA 4CTRA 1DWWA 4D7HA 4UPQA 3Q9AA 5ADEA 3NLZA 1ZZTA 4JSMA 4CWWA 5AGMA 3NLQA 5ADKA 2G6JA 3UFUA 2FLQA 2ORQA 1N2NA 3N6BA 4KCMA 4KCHA 4D3VA 4LUWA 1JWJA 4UGJA 3RQKA 3N2RA 4UGIA 4UG5A 3NW2A 3N63A 1ED5A 3NLPA 1QW4A 3JWYA 3SVPA 4KCSA 2FC1A 4UH6A 4JSGA 4UG8A 3SVQA 5AGOA 1M7VA 4JSFA 4D36A 4D3NA 3NLRA 5ADGA 4UGKA 4CX2A 1M9QA 1FOPA 5G6DA 5G69A 3N6AA 4KCJA 4CX6A 4UGWA 1FOOA 4UGPA 3NLHA 4JSHA 4CFTB 4UPNA 3N5SA 4D3BA 4UCHA 5FW0A 4JSIA 5ADJA 5G67A 3E7IA 4CULA 4CX4A 1MMWA 1P6NA 3TYNA 3N62A 4D3JA 5FVYA 3TYMA 4FVWA 1NSIA 4KCLA 4CX0A 4UGDA 1QWCA 3JX1A 3UFTA 1D0CA 4UGXA 3NLIA 3DQTA 4UH3A 4D33A 3NLDA 4UGQA 4UPPA 5G6MA 5FVRA 3RQMA 4CVGA 4UGNA 4UH5A 3UFSA 5G66A 5G6JA 4CAMA 3E7SA 1I83A 3JT7A 3HSNA 3N68A 1DMKA 4UGGA 2G6OA 4V3VA 3E7MA 4CAPA 3NLOA 4KCKA 5G6GA 4CU1A 3RQPA 1K2TA 1QW6A 4D3MA 1MMVA 4D2ZA 1JWKA 4UGSA 3JT6A 1DWXA 8NSEA 1D1VA 4FW0A 5ADAA 2FBZX 1M9MA 5ADBA 3UFQA 1DMIA 4D31A 1NOCA 4UH2A 2NODA 1K2RA 1K2UA 3N66A 1R35A 2G6NA 4CWZA 2G6HA 2NSEA 1M8IA 1DM8A 3JX6A 5G6IA 4EUXA 3NLYA 3JX3A 1LZZA 4D7IA 4UGTA 1DF1A 4D3OA 4CWVA 5ADIA 4CAQA 1FOIA 5FVSA 3UFPA 4JSKA 3RQOA 3E6NA 5FVQA 3E6TA 1LZXA 5G6EA 3JX2A 3N5WA 1NOSA 4CWXA 4D32A 4UH9A 5G6KA 4LWAA 1FOLA 3N5VA 3NLVA 4UH0A 5G68A 4JS9A 1MJTA 1NODA 3DQSA 2OROA 4UGLA 3NLXA 5FVXA 5FVOA 1NSEA 4D38A 5G6NA 4K5FA 2G6LA 4CX1A 4UG7A 4UQRA 1ZZUA 3NLEA 1OM4A 1P6KA 3TYOA 3UFRA 2G6IA 4UPTA 3N5PA 4UH8A 5G6PA 3E7GA 4UH4A 5G6LA 1DM6A 5AD5A 4UGEA 5G6QA 3N5TA 3B3OA 4K5JA 1D1XA 3N6GA 4GQEA 4CFTA 5FVVA 3EJ8A 3JX0A 1DWVA 4K5IA 4D3TA 4D1NA 5G6FA 4CX5A 3FC5A 4UGFA 3E7TA 4LUXA 2ORSA 2AN0A 3N5RA 4V3YA 3DQRA 1M9JA 3N6FA 4UGBA 3B3PA 4CTQA 4IMXA 3NLFA 2AN2A 4K5GA 4CTZA 5ADDA 5ADNA 4UGZA 4D37A 4CUNA 4JSEA 1OM5A 3N5YA 1VAFA 1VAGA 1M8DA 1RS9A 3EBDA 4UGRA 1ZZQA 3JWTA 3B3NA 3N65A 5G65A 4D7OA 5FVUA 3UFVA 4KCNA 4LWBA 5AD7A 3RQNA 5G0NA 4UPSA 4CWYA 3RQLA 1M8HA 3N6CA 4FVYA 3HSPA 4UGHA 1K2SA 1P6HA 3PNFA 1D0OA 2FC2A 3E7SB 4CX7A 4D39A 4CTTA 4FVZA 3NLJA 3N5XA 4IMSA 3NLNA 4FVXA 4CU1B 3N69A 3PNEA 3N64A 4KCRA 4V3WA 2ORRA 3JX5A 1P6MA 3NNYA 3JT5A 1M9KA 5G0PA 4CTUA 4CTYA 3UFWA 4CTPA 3DWJA 3NM0A 4D35A 9NSEA 4CU0A 5FJ2A 4UH1A 4CX3A 1M7ZA 3NLGA 4UGYA 2Y37A 4CUMA 4D3UA 4UGMA 1FOJA 1ED6A 1ZZRA 2AMOA 5FVPA 3UFOA 4UG6A 4CDTA 5AGLA 3JT4A 4NSEA 4V3XA 1M00A 7NSEA 5G6HA 4NOSA 4CTVA 3E67A 4D3IA 3N5ZA 2NOSA 4D30A 2HX2A 1DD7A 5NSEA 2G6KA 5AD8A 3NLKA 4D3KA 3NQSA 3JWWA 4CTXA 4D1PA 1QW5A 2HX4A 4KCPA 5AD6A 5FJ3A 3E6OA 3NODA 3HSOA 4IMTA 3JWXA 5G6CA 6NSEA 3NNZA 4UQSA 2ORTA 1ZVIA 4UGOA 4D1OA 4CANA 2ORPA 3N61A 4V3ZA 3PNGA 4C39A 1P6LA 3Q99A 5ADMA 1M9RA 4UPRA
chains in the Genus database with same CATH topology
2NSIA 3NOSA 1DM7A 3B3MA 1D1YA 1Q2OA 1P6JA 3JTAA 3JT9A 3JWVA 4KCOA 4UGUA 5FVTA 5AGKA 4KCIA 5G6AA 2HX3A 1M9TA 1ED4A 3TYLA 4K5EA 4IMWA 3NLWA 3E65A 4UG9A 3JWZA 3EBFA 1DMJA 4D7JA 5AGNA 4K5HA 5FVWA 3RQJA 4D2YA 3JT8A 4K5DA 4UPMA 3PNHA 3EAHA 4UGCA 3JWSA 4JSLA 3NLMA 3N5QA 5AGPA 3N60A 3E68A 3N67A 2BHJA 4K5KA 1D1WA 3JX4A 3NLTA 4CAOA 5G6BA 3JT3A 1RS6A 5G0OA 3EAIA 3N6EA 4CTWA 4C3AA 4D3AA 4JSJA 3JWUA 1RS8A 4UPOA 5ADLA 1RS7A 4V3UA 3NSEA 1ZVLA 4CARA 1P6IA 3NLUA 5AD9A 4UHAA 4UH7A 5AD4A 1QOMA 1ZZSA 4KCQA 4UGVA 3E6LA 5ADCA 4D34A 1M8EA 3N6DA 2G6MA 4UGAA 5G6OA 4IMUA 5ADFA 5FVZA 4CTRA 1DWWA 4D7HA 4UPQA 3Q9AA 5ADEA 3NLZA 1ZZTA 4JSMA 4CWWA 5AGMA 3NLQA 5ADKA 2G6JA 3UFUA 2FLQA 2ORQA 1N2NA 3N6BA 4KCMA 4KCHA 4D3VA 4LUWA 1JWJA 4UGJA 3RQKA 3N2RA 4UGIA 4UG5A 3NW2A 3N63A 1ED5A 3NLPA 1QW4A 3JWYA 3SVPA 4KCSA 2FC1A 4UH6A 4JSGA 4UG8A 3SVQA 5AGOA 1M7VA 4JSFA 4D36A 4D3NA 3NLRA 5ADGA 4UGKA 4CX2A 1M9QA 1FOPA 5G6DA 5G69A 3N6AA 4KCJA 4CX6A 4UGWA 1FOOA 4UGPA 3NLHA 4JSHA 4CFTB 4UPNA 3N5SA 4D3BA 4UCHA 5FW0A 4JSIA 5ADJA 5G67A 3E7IA 4CULA 4CX4A 1MMWA 1P6NA 3TYNA 3N62A 4D3JA 5FVYA 3TYMA 4FVWA 1NSIA 4KCLA 4CX0A 4UGDA 1QWCA 3JX1A 3UFTA 1D0CA 4UGXA 3NLIA 3DQTA 4UH3A 4D33A 3NLDA 4UGQA 4UPPA 5G6MA 5FVRA 3RQMA 4CVGA 4UGNA 4UH5A 3UFSA 5G66A 5G6JA 4CAMA 3E7SA 1I83A 3JT7A 3HSNA 3N68A 1DMKA 4UGGA 2G6OA 4V3VA 3E7MA 4CAPA 3NLOA 4KCKA 5G6GA 4CU1A 3RQPA 1K2TA 1QW6A 4D3MA 1MMVA 4D2ZA 1JWKA 4UGSA 3JT6A 1DWXA 8NSEA 1D1VA 4FW0A 5ADAA 2FBZX 1M9MA 5ADBA 3UFQA 1DMIA 4D31A 1NOCA 4UH2A 2NODA 1K2RA 1K2UA 3N66A 1R35A 2G6NA 4CWZA 2G6HA 2NSEA 1M8IA 1DM8A 3JX6A 5G6IA 4EUXA 3NLYA 3JX3A 1LZZA 4D7IA 4UGTA 1DF1A 4D3OA 4CWVA 5ADIA 4CAQA 1FOIA 5FVSA 3UFPA 4JSKA 3RQOA 3E6NA 5FVQA 3E6TA 1LZXA 5G6EA 3JX2A 3N5WA 1NOSA 4CWXA 4D32A 4UH9A 5G6KA 4LWAA 1FOLA 3N5VA 3NLVA 4UH0A 5G68A 4JS9A 1MJTA 1NODA 3DQSA 2OROA 4UGLA 3NLXA 5FVXA 5FVOA 1NSEA 4D38A 5G6NA 4K5FA 2G6LA 4CX1A 4UG7A 4UQRA 1ZZUA 3NLEA 1OM4A 1P6KA 3TYOA 3UFRA 2G6IA 4UPTA 3N5PA 4UH8A 5G6PA 3E7GA 4UH4A 5G6LA 1DM6A 5AD5A 4UGEA 5G6QA 3N5TA 3B3OA 4K5JA 1D1XA 3N6GA 4GQEA 4CFTA 5FVVA 3EJ8A 3JX0A 1DWVA 4K5IA 4D3TA 4D1NA 5G6FA 4CX5A 3FC5A 4UGFA 3E7TA 4LUXA 2ORSA 2AN0A 3N5RA 4V3YA 3DQRA 1M9JA 3N6FA 4UGBA 3B3PA 4CTQA 4IMXA 3NLFA 2AN2A 4K5GA 4CTZA 5ADDA 5ADNA 4UGZA 4D37A 4CUNA 4JSEA 1OM5A 3N5YA 1VAFA 1VAGA 1M8DA 1RS9A 3EBDA 4UGRA 1ZZQA 3JWTA 3B3NA 3N65A 5G65A 4D7OA 5FVUA 3UFVA 4KCNA 4LWBA 5AD7A 3RQNA 5G0NA 4UPSA 4CWYA 3RQLA 1M8HA 3N6CA 4FVYA 3HSPA 4UGHA 1K2SA 1P6HA 3PNFA 1D0OA 2FC2A 3E7SB 4CX7A 4D39A 4CTTA 4FVZA 3NLJA 3N5XA 4IMSA 3NLNA 4FVXA 4CU1B 3N69A 3PNEA 3N64A 4KCRA 4V3WA 2ORRA 3JX5A 1P6MA 3NNYA 3JT5A 1M9KA 5G0PA 4CTUA 4CTYA 3UFWA 4CTPA 3DWJA 3NM0A 4D35A 9NSEA 4CU0A 5FJ2A 4UH1A 4CX3A 1M7ZA 3NLGA 4UGYA 2Y37A 4CUMA 4D3UA 4UGMA 1FOJA 1ED6A 1ZZRA 2AMOA 5FVPA 3UFOA 4UG6A 4CDTA 5AGLA 3JT4A 4NSEA 4V3XA 1M00A 7NSEA 5G6HA 4NOSA 4CTVA 3E67A 4D3IA 3N5ZA 2NOSA 4D30A 2HX2A 1DD7A 5NSEA 2G6KA 5AD8A 3NLKA 4D3KA 3NQSA 3JWWA 4CTXA 4D1PA 1QW5A 2HX4A 4KCPA 5AD6A 5FJ3A 3E6OA 3NODA 3HSOA 4IMTA 3JWXA 5G6CA 6NSEA 3NNZA 4UQSA 2ORTA 1ZVIA 4UGOA 4D1OA 4CANA 2ORPA 3N61A 4V3ZA 3PNGA 4C39A 1P6LA 3Q99A 5ADMA 1M9RA 4UPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NSI A;  3NOS A;  1DM7 A;  3B3M A;  1D1Y A;  1Q2O A;  1P6J A;  3JTA A;  3JT9 A;  3JWV A;  4KCO A;  4UGU A;  5FVT A;  5AGK A;  4KCI A;  5G6A A;  2HX3 A;  1M9T A;  1ED4 A;  3TYL A;  4K5E A;  4IMW A;  3NLW A;  3E65 A;  4UG9 A;  3JWZ A;  3EBF A;  1DMJ A;  4D7J A;  5AGN A;  4K5H A;  5FVW A;  3RQJ A;  4D2Y A;  3JT8 A;  4K5D A;  4UPM A;  3PNH A;  3EAH A;  4UGC A;  3JWS A;  4JSL A;  3NLM A;  3N5Q A;  5AGP A;  3N60 A;  3E68 A;  3N67 A;  2BHJ A;  4K5K A;  1D1W A;  3JX4 A;  3NLT A;  4CAO A;  5G6B A;  3JT3 A;  1RS6 A;  5G0O A;  3EAI A;  3N6E A;  4CTW A;  4C3A A;  4D3A A;  4JSJ A;  3JWU A;  1RS8 A;  4UPO A;  5ADL A;  1RS7 A;  4V3U A;  3NSE A;  1ZVL A;  4CAR A;  1P6I A;  3NLU A;  5AD9 A;  4UHA A;  4UH7 A;  5AD4 A;  1QOM A;  1ZZS A;  4KCQ A;  4UGV A;  3E6L A;  5ADC A;  4D34 A;  1M8E A;  3N6D A;  2G6M A;  4UGA A;  5G6O A;  4IMU A;  5ADF A;  5FVZ A;  4CTR A;  1DWW A;  4D7H A;  4UPQ A;  3Q9A A;  5ADE A;  3NLZ A;  1ZZT A;  4JSM A;  4CWW A;  5AGM A;  3NLQ A;  5ADK A;  2G6J A;  3UFU A;  2FLQ A;  2ORQ A;  1N2N A;  3N6B A;  4KCM A;  4KCH A;  4D3V A;  4LUW A;  1JWJ A;  4UGJ A;  3RQK A;  3N2R A;  4UGI A;  4UG5 A;  3NW2 A;  3N63 A;  1ED5 A;  3NLP A;  1QW4 A;  3JWY A;  3SVP A;  4KCS A;  2FC1 A;  4UH6 A;  4JSG A;  4UG8 A;  3SVQ A;  5AGO A;  1M7V A;  4JSF A;  4D36 A;  4D3N A;  3NLR A;  5ADG A;  4UGK A;  4CX2 A;  1M9Q A;  1FOP A;  5G6D A;  5G69 A;  3N6A A;  4KCJ A;  4CX6 A;  4UGW A;  1FOO A;  4UGP A;  3NLH A;  4JSH A;  4CFT B;  4UPN A;  3N5S A;  4D3B A;  4UCH A;  5FW0 A;  4JSI A;  5ADJ A;  5G67 A;  3E7I A;  4CUL A;  4CX4 A;  1MMW A;  1P6N A;  3TYN A;  3N62 A;  4D3J A;  5FVY A;  3TYM A;  4FVW A;  1NSI A;  4KCL A;  4CX0 A;  4UGD A;  1QWC A;  3JX1 A;  3UFT A;  1D0C A;  4UGX A;  3NLI A;  3DQT A;  4UH3 A;  4D33 A;  3NLD A;  4UGQ A;  4UPP A;  5G6M A;  5FVR A;  3RQM A;  4CVG A;  4UGN A;  4UH5 A;  3UFS A;  5G66 A;  5G6J A;  4CAM A;  3E7S A;  1I83 A;  3JT7 A;  3HSN A;  3N68 A;  1DMK A;  4UGG A;  2G6O A;  4V3V A;  3E7M A;  4CAP A;  3NLO A;  4KCK A;  5G6G A;  4CU1 A;  3RQP A;  1K2T A;  1QW6 A;  4D3M A;  1MMV A;  4D2Z A;  1JWK A;  4UGS A;  3JT6 A;  1DWX A;  8NSE A;  1D1V A;  4FW0 A;  5ADA A;  2FBZ X;  1M9M A;  5ADB A;  3UFQ A;  1DMI A;  4D31 A;  1NOC A;  4UH2 A;  2NOD A;  1K2R A;  1K2U A;  3N66 A;  1R35 A;  2G6N A;  4CWZ A;  2G6H A;  2NSE A;  1M8I A;  1DM8 A;  3JX6 A;  5G6I A;  4EUX A;  3NLY A;  3JX3 A;  1LZZ A;  4D7I A;  4UGT A;  1DF1 A;  4D3O A;  4CWV A;  5ADI A;  4CAQ A;  1FOI A;  5FVS A;  3UFP A;  4JSK A;  3RQO A;  3E6N A;  5FVQ A;  3E6T A;  1LZX A;  5G6E A;  3JX2 A;  3N5W A;  1NOS A;  4CWX A;  4D32 A;  4UH9 A;  5G6K A;  4LWA A;  1FOL A;  3N5V A;  3NLV A;  4UH0 A;  5G68 A;  4JS9 A;  1MJT A;  1NOD A;  3DQS A;  2ORO A;  4UGL A;  3NLX A;  5FVX A;  5FVO A;  1NSE A;  4D38 A;  5G6N A;  4K5F A;  2G6L A;  4CX1 A;  4UG7 A;  4UQR A;  1ZZU A;  3NLE A;  1OM4 A;  1P6K A;  3TYO A;  3UFR A;  2G6I A;  4UPT A;  3N5P A;  4UH8 A;  5G6P A;  3E7G A;  4UH4 A;  5G6L A;  1DM6 A;  5AD5 A;  4UGE A;  5G6Q A;  3N5T A;  3B3O A;  4K5J A;  1D1X A;  3N6G A;  4GQE A;  4CFT A;  5FVV A;  3EJ8 A;  3JX0 A;  1DWV A;  4K5I A;  4D3T A;  4D1N A;  5G6F A;  4CX5 A;  3FC5 A;  4UGF A;  3E7T A;  4LUX A;  2ORS A;  2AN0 A;  3N5R A;  4V3Y A;  3DQR A;  1M9J A;  3N6F A;  4UGB A;  3B3P A;  4CTQ A;  4IMX A;  3NLF A;  2AN2 A;  4K5G A;  4CTZ A;  5ADD A;  5ADN A;  4UGZ A;  4D37 A;  4CUN A;  4JSE A;  1OM5 A;  3N5Y A;  1VAF A;  1VAG A;  1M8D A;  1RS9 A;  3EBD A;  4UGR A;  1ZZQ A;  3JWT A;  3B3N A;  3N65 A;  5G65 A;  4D7O A;  5FVU A;  3UFV A;  4KCN A;  4LWB A;  5AD7 A;  3RQN A;  5G0N A;  4UPS A;  4CWY A;  3RQL A;  1M8H A;  3N6C A;  4FVY A;  3HSP A;  4UGH A;  1K2S A;  1P6H A;  3PNF A;  1D0O A;  2FC2 A;  3E7S B;  4CX7 A;  4D39 A;  4CTT A;  4FVZ A;  3NLJ A;  3N5X A;  4IMS A;  3NLN A;  4FVX A;  4CU1 B;  3N69 A;  3PNE A;  3N64 A;  4KCR A;  4V3W A;  2ORR A;  3JX5 A;  1P6M A;  3NNY A;  3JT5 A;  1M9K A;  5G0P A;  4CTU A;  4CTY A;  3UFW A;  4CTP A;  3DWJ A;  3NM0 A;  4D35 A;  9NSE A;  4CU0 A;  5FJ2 A;  4UH1 A;  4CX3 A;  1M7Z A;  3NLG A;  4UGY A;  2Y37 A;  4CUM A;  4D3U A;  4UGM A;  1FOJ A;  1ED6 A;  1ZZR A;  2AMO A;  5FVP A;  3UFO A;  4UG6 A;  4CDT A;  5AGL A;  3JT4 A;  4NSE A;  4V3X A;  1M00 A;  7NSE A;  5G6H A;  4NOS A;  4CTV A;  3E67 A;  4D3I A;  3N5Z A;  2NOS A;  4D30 A;  2HX2 A;  1DD7 A;  5NSE A;  2G6K A;  5AD8 A;  3NLK A;  4D3K A;  3NQS A;  3JWW A;  4CTX A;  4D1P A;  1QW5 A;  2HX4 A;  4KCP A;  5AD6 A;  5FJ3 A;  3E6O A;  3NOD A;  3HSO A;  4IMT A;  3JWX A;  5G6C A;  6NSE A;  3NNZ A;  4UQS A;  2ORT A;  1ZVI A;  4UGO A;  4D1O A;  4CAN A;  2ORP A;  3N61 A;  4V3Z A;  3PNG A;  4C39 A;  1P6L A;  3Q99 A;  5ADM A;  1M9R A;  4UPR A; 
#chains in the Genus database with same CATH topology
 2NSI A;  3NOS A;  1DM7 A;  3B3M A;  1D1Y A;  1Q2O A;  1P6J A;  3JTA A;  3JT9 A;  3JWV A;  4KCO A;  4UGU A;  5FVT A;  5AGK A;  4KCI A;  5G6A A;  2HX3 A;  1M9T A;  1ED4 A;  3TYL A;  4K5E A;  4IMW A;  3NLW A;  3E65 A;  4UG9 A;  3JWZ A;  3EBF A;  1DMJ A;  4D7J A;  5AGN A;  4K5H A;  5FVW A;  3RQJ A;  4D2Y A;  3JT8 A;  4K5D A;  4UPM A;  3PNH A;  3EAH A;  4UGC A;  3JWS A;  4JSL A;  3NLM A;  3N5Q A;  5AGP A;  3N60 A;  3E68 A;  3N67 A;  2BHJ A;  4K5K A;  1D1W A;  3JX4 A;  3NLT A;  4CAO A;  5G6B A;  3JT3 A;  1RS6 A;  5G0O A;  3EAI A;  3N6E A;  4CTW A;  4C3A A;  4D3A A;  4JSJ A;  3JWU A;  1RS8 A;  4UPO A;  5ADL A;  1RS7 A;  4V3U A;  3NSE A;  1ZVL A;  4CAR A;  1P6I A;  3NLU A;  5AD9 A;  4UHA A;  4UH7 A;  5AD4 A;  1QOM A;  1ZZS A;  4KCQ A;  4UGV A;  3E6L A;  5ADC A;  4D34 A;  1M8E A;  3N6D A;  2G6M A;  4UGA A;  5G6O A;  4IMU A;  5ADF A;  5FVZ A;  4CTR A;  1DWW A;  4D7H A;  4UPQ A;  3Q9A A;  5ADE A;  3NLZ A;  1ZZT A;  4JSM A;  4CWW A;  5AGM A;  3NLQ A;  5ADK A;  2G6J A;  3UFU A;  2FLQ A;  2ORQ A;  1N2N A;  3N6B A;  4KCM A;  4KCH A;  4D3V A;  4LUW A;  1JWJ A;  4UGJ A;  3RQK A;  3N2R A;  4UGI A;  4UG5 A;  3NW2 A;  3N63 A;  1ED5 A;  3NLP A;  1QW4 A;  3JWY A;  3SVP A;  4KCS A;  2FC1 A;  4UH6 A;  4JSG A;  4UG8 A;  3SVQ A;  5AGO A;  1M7V A;  4JSF A;  4D36 A;  4D3N A;  3NLR A;  5ADG A;  4UGK A;  4CX2 A;  1M9Q A;  1FOP A;  5G6D A;  5G69 A;  3N6A A;  4KCJ A;  4CX6 A;  4UGW A;  1FOO A;  4UGP A;  3NLH A;  4JSH A;  4CFT B;  4UPN A;  3N5S A;  4D3B A;  4UCH A;  5FW0 A;  4JSI A;  5ADJ A;  5G67 A;  3E7I A;  4CUL A;  4CX4 A;  1MMW A;  1P6N A;  3TYN A;  3N62 A;  4D3J A;  5FVY A;  3TYM A;  4FVW A;  1NSI A;  4KCL A;  4CX0 A;  4UGD A;  1QWC A;  3JX1 A;  3UFT A;  1D0C A;  4UGX A;  3NLI A;  3DQT A;  4UH3 A;  4D33 A;  3NLD A;  4UGQ A;  4UPP A;  5G6M A;  5FVR A;  3RQM A;  4CVG A;  4UGN A;  4UH5 A;  3UFS A;  5G66 A;  5G6J A;  4CAM A;  3E7S A;  1I83 A;  3JT7 A;  3HSN A;  3N68 A;  1DMK A;  4UGG A;  2G6O A;  4V3V A;  3E7M A;  4CAP A;  3NLO A;  4KCK A;  5G6G A;  4CU1 A;  3RQP A;  1K2T A;  1QW6 A;  4D3M A;  1MMV A;  4D2Z A;  1JWK A;  4UGS A;  3JT6 A;  1DWX A;  8NSE A;  1D1V A;  4FW0 A;  5ADA A;  2FBZ X;  1M9M A;  5ADB A;  3UFQ A;  1DMI A;  4D31 A;  1NOC A;  4UH2 A;  2NOD A;  1K2R A;  1K2U A;  3N66 A;  1R35 A;  2G6N A;  4CWZ A;  2G6H A;  2NSE A;  1M8I A;  1DM8 A;  3JX6 A;  5G6I A;  4EUX A;  3NLY A;  3JX3 A;  1LZZ A;  4D7I A;  4UGT A;  1DF1 A;  4D3O A;  4CWV A;  5ADI A;  4CAQ A;  1FOI A;  5FVS A;  3UFP A;  4JSK A;  3RQO A;  3E6N A;  5FVQ A;  3E6T A;  1LZX A;  5G6E A;  3JX2 A;  3N5W A;  1NOS A;  4CWX A;  4D32 A;  4UH9 A;  5G6K A;  4LWA A;  1FOL A;  3N5V A;  3NLV A;  4UH0 A;  5G68 A;  4JS9 A;  1MJT A;  1NOD A;  3DQS A;  2ORO A;  4UGL A;  3NLX A;  5FVX A;  5FVO A;  1NSE A;  4D38 A;  5G6N A;  4K5F A;  2G6L A;  4CX1 A;  4UG7 A;  4UQR A;  1ZZU A;  3NLE A;  1OM4 A;  1P6K A;  3TYO A;  3UFR A;  2G6I A;  4UPT A;  3N5P A;  4UH8 A;  5G6P A;  3E7G A;  4UH4 A;  5G6L A;  1DM6 A;  5AD5 A;  4UGE A;  5G6Q A;  3N5T A;  3B3O A;  4K5J A;  1D1X A;  3N6G A;  4GQE A;  4CFT A;  5FVV A;  3EJ8 A;  3JX0 A;  1DWV A;  4K5I A;  4D3T A;  4D1N A;  5G6F A;  4CX5 A;  3FC5 A;  4UGF A;  3E7T A;  4LUX A;  2ORS A;  2AN0 A;  3N5R A;  4V3Y A;  3DQR A;  1M9J A;  3N6F A;  4UGB A;  3B3P A;  4CTQ A;  4IMX A;  3NLF A;  2AN2 A;  4K5G A;  4CTZ A;  5ADD A;  5ADN A;  4UGZ A;  4D37 A;  4CUN A;  4JSE A;  1OM5 A;  3N5Y A;  1VAF A;  1VAG A;  1M8D A;  1RS9 A;  3EBD A;  4UGR A;  1ZZQ A;  3JWT A;  3B3N A;  3N65 A;  5G65 A;  4D7O A;  5FVU A;  3UFV A;  4KCN A;  4LWB A;  5AD7 A;  3RQN A;  5G0N A;  4UPS A;  4CWY A;  3RQL A;  1M8H A;  3N6C A;  4FVY A;  3HSP A;  4UGH A;  1K2S A;  1P6H A;  3PNF A;  1D0O A;  2FC2 A;  3E7S B;  4CX7 A;  4D39 A;  4CTT A;  4FVZ A;  3NLJ A;  3N5X A;  4IMS A;  3NLN A;  4FVX A;  4CU1 B;  3N69 A;  3PNE A;  3N64 A;  4KCR A;  4V3W A;  2ORR A;  3JX5 A;  1P6M A;  3NNY A;  3JT5 A;  1M9K A;  5G0P A;  4CTU A;  4CTY A;  3UFW A;  4CTP A;  3DWJ A;  3NM0 A;  4D35 A;  9NSE A;  4CU0 A;  5FJ2 A;  4UH1 A;  4CX3 A;  1M7Z A;  3NLG A;  4UGY A;  2Y37 A;  4CUM A;  4D3U A;  4UGM A;  1FOJ A;  1ED6 A;  1ZZR A;  2AMO A;  5FVP A;  3UFO A;  4UG6 A;  4CDT A;  5AGL A;  3JT4 A;  4NSE A;  4V3X A;  1M00 A;  7NSE A;  5G6H A;  4NOS A;  4CTV A;  3E67 A;  4D3I A;  3N5Z A;  2NOS A;  4D30 A;  2HX2 A;  1DD7 A;  5NSE A;  2G6K A;  5AD8 A;  3NLK A;  4D3K A;  3NQS A;  3JWW A;  4CTX A;  4D1P A;  1QW5 A;  2HX4 A;  4KCP A;  5AD6 A;  5FJ3 A;  3E6O A;  3NOD A;  3HSO A;  4IMT A;  3JWX A;  5G6C A;  6NSE A;  3NNZ A;  4UQS A;  2ORT A;  1ZVI A;  4UGO A;  4D1O A;  4CAN A;  2ORP A;  3N61 A;  4V3Z A;  3PNG A;  4C39 A;  1P6L A;  3Q99 A;  5ADM A;  1M9R A;  4UPR A; 
#chains in the Genus database with same CATH homology
 2NSI A;  3NOS A;  1DM7 A;  3B3M A;  1D1Y A;  1Q2O A;  1P6J A;  3JTA A;  3JT9 A;  3JWV A;  4KCO A;  4UGU A;  5FVT A;  5AGK A;  4KCI A;  5G6A A;  2HX3 A;  1M9T A;  1ED4 A;  3TYL A;  4K5E A;  4IMW A;  3NLW A;  3E65 A;  4UG9 A;  3JWZ A;  3EBF A;  1DMJ A;  4D7J A;  5AGN A;  4K5H A;  5FVW A;  3RQJ A;  4D2Y A;  3JT8 A;  4K5D A;  4UPM A;  3PNH A;  3EAH A;  4UGC A;  3JWS A;  4JSL A;  3NLM A;  3N5Q A;  5AGP A;  3N60 A;  3E68 A;  3N67 A;  2BHJ A;  4K5K A;  1D1W A;  3JX4 A;  3NLT A;  4CAO A;  5G6B A;  3JT3 A;  1RS6 A;  5G0O A;  3EAI A;  3N6E A;  4CTW A;  4C3A A;  4D3A A;  4JSJ A;  3JWU A;  1RS8 A;  4UPO A;  5ADL A;  1RS7 A;  4V3U A;  3NSE A;  1ZVL A;  4CAR A;  1P6I A;  3NLU A;  5AD9 A;  4UHA A;  4UH7 A;  5AD4 A;  1QOM A;  1ZZS A;  4KCQ A;  4UGV A;  3E6L A;  5ADC A;  4D34 A;  1M8E A;  3N6D A;  2G6M A;  4UGA A;  5G6O A;  4IMU A;  5ADF A;  5FVZ A;  4CTR A;  1DWW A;  4D7H A;  4UPQ A;  3Q9A A;  5ADE A;  3NLZ A;  1ZZT A;  4JSM A;  4CWW A;  5AGM A;  3NLQ A;  5ADK A;  2G6J A;  3UFU A;  2FLQ A;  2ORQ A;  1N2N A;  3N6B A;  4KCM A;  4KCH A;  4D3V A;  4LUW A;  1JWJ A;  4UGJ A;  3RQK A;  3N2R A;  4UGI A;  4UG5 A;  3NW2 A;  3N63 A;  1ED5 A;  3NLP A;  1QW4 A;  3JWY A;  3SVP A;  4KCS A;  2FC1 A;  4UH6 A;  4JSG A;  4UG8 A;  3SVQ A;  5AGO A;  1M7V A;  4JSF A;  4D36 A;  4D3N A;  3NLR A;  5ADG A;  4UGK A;  4CX2 A;  1M9Q A;  1FOP A;  5G6D A;  5G69 A;  3N6A A;  4KCJ A;  4CX6 A;  4UGW A;  1FOO A;  4UGP A;  3NLH A;  4JSH A;  4CFT B;  4UPN A;  3N5S A;  4D3B A;  4UCH A;  5FW0 A;  4JSI A;  5ADJ A;  5G67 A;  3E7I A;  4CUL A;  4CX4 A;  1MMW A;  1P6N A;  3TYN A;  3N62 A;  4D3J A;  5FVY A;  3TYM A;  4FVW A;  1NSI A;  4KCL A;  4CX0 A;  4UGD A;  1QWC A;  3JX1 A;  3UFT A;  1D0C A;  4UGX A;  3NLI A;  3DQT A;  4UH3 A;  4D33 A;  3NLD A;  4UGQ A;  4UPP A;  5G6M A;  5FVR A;  3RQM A;  4CVG A;  4UGN A;  4UH5 A;  3UFS A;  5G66 A;  5G6J A;  4CAM A;  3E7S A;  1I83 A;  3JT7 A;  3HSN A;  3N68 A;  1DMK A;  4UGG A;  2G6O A;  4V3V A;  3E7M A;  4CAP A;  3NLO A;  4KCK A;  5G6G A;  4CU1 A;  3RQP A;  1K2T A;  1QW6 A;  4D3M A;  1MMV A;  4D2Z A;  1JWK A;  4UGS A;  3JT6 A;  1DWX A;  8NSE A;  1D1V A;  4FW0 A;  5ADA A;  2FBZ X;  1M9M A;  5ADB A;  3UFQ A;  1DMI A;  4D31 A;  1NOC A;  4UH2 A;  2NOD A;  1K2R A;  1K2U A;  3N66 A;  1R35 A;  2G6N A;  4CWZ A;  2G6H A;  2NSE A;  1M8I A;  1DM8 A;  3JX6 A;  5G6I A;  4EUX A;  3NLY A;  3JX3 A;  1LZZ A;  4D7I A;  4UGT A;  1DF1 A;  4D3O A;  4CWV A;  5ADI A;  4CAQ A;  1FOI A;  5FVS A;  3UFP A;  4JSK A;  3RQO A;  3E6N A;  5FVQ A;  3E6T A;  1LZX A;  5G6E A;  3JX2 A;  3N5W A;  1NOS A;  4CWX A;  4D32 A;  4UH9 A;  5G6K A;  4LWA A;  1FOL A;  3N5V A;  3NLV A;  4UH0 A;  5G68 A;  4JS9 A;  1MJT A;  1NOD A;  3DQS A;  2ORO A;  4UGL A;  3NLX A;  5FVX A;  5FVO A;  1NSE A;  4D38 A;  5G6N A;  4K5F A;  2G6L A;  4CX1 A;  4UG7 A;  4UQR A;  1ZZU A;  3NLE A;  1OM4 A;  1P6K A;  3TYO A;  3UFR A;  2G6I A;  4UPT A;  3N5P A;  4UH8 A;  5G6P A;  3E7G A;  4UH4 A;  5G6L A;  1DM6 A;  5AD5 A;  4UGE A;  5G6Q A;  3N5T A;  3B3O A;  4K5J A;  1D1X A;  3N6G A;  4GQE A;  4CFT A;  5FVV A;  3EJ8 A;  3JX0 A;  1DWV A;  4K5I A;  4D3T A;  4D1N A;  5G6F A;  4CX5 A;  3FC5 A;  4UGF A;  3E7T A;  4LUX A;  2ORS A;  2AN0 A;  3N5R A;  4V3Y A;  3DQR A;  1M9J A;  3N6F A;  4UGB A;  3B3P A;  4CTQ A;  4IMX A;  3NLF A;  2AN2 A;  4K5G A;  4CTZ A;  5ADD A;  5ADN A;  4UGZ A;  4D37 A;  4CUN A;  4JSE A;  1OM5 A;  3N5Y A;  1VAF A;  1VAG A;  1M8D A;  1RS9 A;  3EBD A;  4UGR A;  1ZZQ A;  3JWT A;  3B3N A;  3N65 A;  5G65 A;  4D7O A;  5FVU A;  3UFV A;  4KCN A;  4LWB A;  5AD7 A;  3RQN A;  5G0N A;  4UPS A;  4CWY A;  3RQL A;  1M8H A;  3N6C A;  4FVY A;  3HSP A;  4UGH A;  1K2S A;  1P6H A;  3PNF A;  1D0O A;  2FC2 A;  3E7S B;  4CX7 A;  4D39 A;  4CTT A;  4FVZ A;  3NLJ A;  3N5X A;  4IMS A;  3NLN A;  4FVX A;  4CU1 B;  3N69 A;  3PNE A;  3N64 A;  4KCR A;  4V3W A;  2ORR A;  3JX5 A;  1P6M A;  3NNY A;  3JT5 A;  1M9K A;  5G0P A;  4CTU A;  4CTY A;  3UFW A;  4CTP A;  3DWJ A;  3NM0 A;  4D35 A;  9NSE A;  4CU0 A;  5FJ2 A;  4UH1 A;  4CX3 A;  1M7Z A;  3NLG A;  4UGY A;  2Y37 A;  4CUM A;  4D3U A;  4UGM A;  1FOJ A;  1ED6 A;  1ZZR A;  2AMO A;  5FVP A;  3UFO A;  4UG6 A;  4CDT A;  5AGL A;  3JT4 A;  4NSE A;  4V3X A;  1M00 A;  7NSE A;  5G6H A;  4NOS A;  4CTV A;  3E67 A;  4D3I A;  3N5Z A;  2NOS A;  4D30 A;  2HX2 A;  1DD7 A;  5NSE A;  2G6K A;  5AD8 A;  3NLK A;  4D3K A;  3NQS A;  3JWW A;  4CTX A;  4D1P A;  1QW5 A;  2HX4 A;  4KCP A;  5AD6 A;  5FJ3 A;  3E6O A;  3NOD A;  3HSO A;  4IMT A;  3JWX A;  5G6C A;  6NSE A;  3NNZ A;  4UQS A;  2ORT A;  1ZVI A;  4UGO A;  4D1O A;  4CAN A;  2ORP A;  3N61 A;  4V3Z A;  3PNG A;  4C39 A;  1P6L A;  3Q99 A;  5ADM A;  1M9R A;  4UPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...