4UGSA

Structure of bacillus subtilis nitric oxide synthase in complex with n,n'-(ethane-1,2-diylbis(oxybenzene-3,1-diyl))dithiophene-2- carboximidamide
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
362
structure length
362
Chain Sequence
EEKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 123
structure length 362
sequence length 362
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugsA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugsA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugsA03
3PNFA 4CANA 1ED4A 4CTUA 5AGMA 5G6LA 3NLMA 3NODA 4FVYA 4UGSA 1P6JA 4UGKA 3E6OA 3EJ8A 1M9RA 1MMVA 3N69A 3RQJA 3N5QA 3N6GA 4UH7A 1MJTA 3E6NA 4UGJA 1DD7A 4CX2A 3N5SA 5G6NA 4UGDA 4K5GA 3UFRA 3NLIA 5G6PA 3NQSA 1JWJA 5G0NA 4UG7A 1D1XA 4UPPA 1ZZSA 2G6HA 4IMXA 5FJ3A 4UPTA 3JWTA 5ADCA 3JWVA 2HX3A 4CAPA 4UGGA 4UGBA 1ZVLA 3NNYA 4UGZA 4KCLA 1DM6A 4UH8A 4CAOA 4K5IA 3N2RA 4UPNA 5G6GA 2NOSA 4K5HA 3UFPA 2ORQA 4CX5A 1NSEA 3UFVA 3RQOA 4D36A 4D7HA 4K5JA 4K5EA 3E7TA 3NLVA 3N6BA 1QW6A 1M7VA 4FVWA 2NSIA 1JWKA 3B3MA 5ADIA 5ADKA 3N5TA 4UG9A 4CWXA 1QOMA 1M8HA 3HSNA 4UH6A 3E68A 5G66A 5G6FA 4UGIA 4D2ZA 4D2YA 5G6DA 2AMOA 5G68A 4JSFA 1M9MA 1P6MA 4D3MA 3JX6A 5AGKA 1M9QA 4UGQA 4UG8A 4JS9A 1OM5A 3NLOA 5AGLA 3NOSA 3EBDA 4CTVA 4CAMA 3N64A 3NLPA 3NSEA 4UH3A 1D1WA 1P6IA 5ADMA 3N67A 4KCQA 1M9KA 3JT5A 4CU0A 1K2RA 4CTXA 3Q9AA 1QWCA 1FOIA 3NLYA 4UPOA 2G6OA 3SVQA 3JWXA 2FC2A 5G0PA 3UFSA 3N68A 3N60A 4UH4A 5G65A 3JWWA 1DWVA 4IMTA 4C3AA 4LUWA 4D3AA 4UCHA 2FC1A 3N66A 3RQPA 4K5DA 4CULA 5FVYA 5G6OA 3JX2A 3JWSA 4NOSA 2FLQA 4CAQA 5FVVA 3JT8A 3EAIA 4CFTA 1K2TA 4CTWA 4D3IA 1NSIA 3N5ZA 4UQSA 3N6EA 4UPMA 4V3WA 3JX0A 4D35A 4V3UA 2G6NA 3N63A 3E7SB 3DQSA 4UPRA 5G6HA 3SVPA 3NLHA 4UGAA 1D0CA 4JSEA 1K2SA 5G6QA 4CTYA 4CVGA 4UG5A 3N5RA 2OROA 5ADNA 4CDTA 4D3BA 4CU1B 3E7IA 3JX1A 2G6JA 4D38A 4CWWA 3NLTA 3NLJA 1DF1A 3N5XA 2FBZX 3JT9A 4V3YA 4JSKA 4CX3A 1NOCA 3E7GA 1FOOA 1RS7A 4KCPA 1DWWA 3E7MA 5FVOA 3B3OA 3E6LA 4KCIA 4CTPA 4CTZA 3DQRA 5FVTA 3N6FA 4CX0A 5ADBA 1K2UA 5FVRA 4UGXA 1FOPA 3JTAA 3HSOA 1RS6A 4C39A 5G6JA 5G6MA 4KCHA 4UGCA 3DQTA 5AD7A 4UHAA 5G6BA 5AD6A 3Q99A 4FVZA 3N65A 4CARA 3PNGA 5NSEA 4CX4A 3NLDA 4D3KA 4UGUA 1N2NA 3NLRA 3NW2A 2G6KA 5FVZA 3B3PA 3UFTA 3RQNA 4UGLA 4UG6A 4UGRA 1DM7A 2Y37A 1ZVIA 2ORSA 3HSPA 4UGFA 4D3NA 4D33A 1ZZQA 4D3TA 4UGTA 1M9JA 2ORRA 3NLKA 2AN0A 4KCSA 4UQRA 5G6AA 1DMKA 4CTQA 5AD9A 4KCKA 5ADDA 3JT7A 4KCNA 4KCRA 1P6HA 1RS9A 5FVXA 4CX7A 1ED6A 5AGOA 5ADGA 3E67A 3NLFA 4D31A 4UH9A 4CUNA 4IMWA 3UFOA 1M8IA 3TYOA 3JWUA 4UPSA 2ORPA 2BHJA 4KCJA 2NSEA 5ADLA 1M7ZA 5FW0A 4D7JA 1ED5A 3PNHA 4CWYA 1RS8A 4UGPA 5ADEA 3UFUA 1DMIA 4KCMA 3TYMA 8NSEA 1QW4A 7NSEA 5FVWA 3DWJA 4UGYA 4GQEA 4D7IA 4UGWA 3E65A 4UGHA 1DWXA 4FVXA 3EBFA 4JSIA 4V3VA 3N5WA 3NLNA 3N6CA 3UFWA 5G69A 5AD5A 5ADAA 3NM0A 4JSMA 4D3OA 3N5VA 4K5FA 3JWYA 4JSGA 3TYNA 4D1PA 5AD8A 1VAFA 3JT3A 4UH1A 5G0OA 4D1OA 3NLGA 6NSEA 3RQLA 1OM4A 2G6LA 4UGOA 2G6MA 5G6EA 1VAGA 3JX4A 3N6DA 4EUXA 9NSEA 1NOSA 3NLUA 3EAHA 4D30A 4D3UA 3N6AA 3NLQA 4CTRA 1QW5A 4LWAA 4FW0A 3NLXA 1DM8A 4D37A 5AD4A 4UH2A 3PNEA 1ZZUA 4D3JA 1MMWA 3N61A 4CX1A 5AGNA 5FJ2A 5FVPA 1I83A 4CFTB 2NODA 3RQKA 1P6KA 1D0OA 2G6IA 2HX2A 4UGEA 5G6IA 4CWVA 2HX4A 3NNZA 3FC5A 4LWBA 5AGPA 4V3ZA 1LZXA 1FOLA 4CX6A 3E7SA 3UFQA 1R35A 5ADFA 4V3XA 1P6NA 3N62A 4CTTA 4UPQA 1FOJA 3JX5A 4NSEA 1LZZA 1ZZRA 5G67A 3N5YA 4UGMA 3RQMA 4JSHA 4K5KA 1P6LA 4IMUA 5ADJA 4CU1A 1Q2OA 1M8DA 4JSLA 1NODA 4KCOA 4CUMA 4UGVA 1ZZTA 4D1NA 2AN2A 3JWZA 5G6KA 2ORTA 5G6CA 4UH5A 4UGNA 3TYLA 3N5PA 3B3NA 3NLZA 1D1YA 3NLWA 1DMJA 3JX3A 5FVSA 3E6TA 4D34A 3NLEA 1M8EA 5FVQA 4D39A 4D3VA 4LUXA 4UH0A 4IMSA 4D32A 1D1VA 5FVUA 1M9TA 4CWZA 4D7OA 3JT6A 1M00A 4JSJA 3JT4A
chains in the Genus database with same CATH superfamily
3PNFA 4CANA 1ED4A 4CTUA 5AGMA 5G6LA 3NLMA 3NODA 4FVYA 4UGSA 1P6JA 4UGKA 3E6OA 3EJ8A 1M9RA 1MMVA 3N69A 3RQJA 3N5QA 3N6GA 4UH7A 1MJTA 3E6NA 4UGJA 1DD7A 4CX2A 3N5SA 5G6NA 4UGDA 4K5GA 3UFRA 3NLIA 5G6PA 3NQSA 1JWJA 5G0NA 4UG7A 1D1XA 4UPPA 1ZZSA 2G6HA 4IMXA 5FJ3A 4UPTA 3JWTA 5ADCA 3JWVA 2HX3A 4CAPA 4UGGA 4UGBA 1ZVLA 3NNYA 4UGZA 4KCLA 1DM6A 4UH8A 4CAOA 4K5IA 3N2RA 4UPNA 5G6GA 2NOSA 4K5HA 3UFPA 2ORQA 4CX5A 1NSEA 3UFVA 3RQOA 4D36A 4D7HA 4K5JA 4K5EA 3E7TA 3NLVA 3N6BA 1QW6A 1M7VA 4FVWA 2NSIA 1JWKA 3B3MA 5ADIA 5ADKA 3N5TA 4UG9A 4CWXA 1QOMA 1M8HA 3HSNA 4UH6A 3E68A 5G66A 5G6FA 4UGIA 4D2ZA 4D2YA 5G6DA 2AMOA 5G68A 4JSFA 1M9MA 1P6MA 4D3MA 3JX6A 5AGKA 1M9QA 4UGQA 4UG8A 4JS9A 1OM5A 3NLOA 5AGLA 3NOSA 3EBDA 4CTVA 4CAMA 3N64A 3NLPA 3NSEA 4UH3A 1D1WA 1P6IA 5ADMA 3N67A 4KCQA 1M9KA 3JT5A 4CU0A 1K2RA 4CTXA 3Q9AA 1QWCA 1FOIA 3NLYA 4UPOA 2G6OA 3SVQA 3JWXA 2FC2A 5G0PA 3UFSA 3N68A 3N60A 4UH4A 5G65A 3JWWA 1DWVA 4IMTA 4C3AA 4LUWA 4D3AA 4UCHA 2FC1A 3N66A 3RQPA 4K5DA 4CULA 5FVYA 5G6OA 3JX2A 3JWSA 4NOSA 2FLQA 4CAQA 5FVVA 3JT8A 3EAIA 4CFTA 1K2TA 4CTWA 4D3IA 1NSIA 3N5ZA 4UQSA 3N6EA 4UPMA 4V3WA 3JX0A 4D35A 4V3UA 2G6NA 3N63A 3E7SB 3DQSA 4UPRA 5G6HA 3SVPA 3NLHA 4UGAA 1D0CA 4JSEA 1K2SA 5G6QA 4CTYA 4CVGA 4UG5A 3N5RA 2OROA 5ADNA 4CDTA 4D3BA 4CU1B 3E7IA 3JX1A 2G6JA 4D38A 4CWWA 3NLTA 3NLJA 1DF1A 3N5XA 2FBZX 3JT9A 4V3YA 4JSKA 4CX3A 1NOCA 3E7GA 1FOOA 1RS7A 4KCPA 1DWWA 3E7MA 5FVOA 3B3OA 3E6LA 4KCIA 4CTPA 4CTZA 3DQRA 5FVTA 3N6FA 4CX0A 5ADBA 1K2UA 5FVRA 4UGXA 1FOPA 3JTAA 3HSOA 1RS6A 4C39A 5G6JA 5G6MA 4KCHA 4UGCA 3DQTA 5AD7A 4UHAA 5G6BA 5AD6A 3Q99A 4FVZA 3N65A 4CARA 3PNGA 5NSEA 4CX4A 3NLDA 4D3KA 4UGUA 1N2NA 3NLRA 3NW2A 2G6KA 5FVZA 3B3PA 3UFTA 3RQNA 4UGLA 4UG6A 4UGRA 1DM7A 2Y37A 1ZVIA 2ORSA 3HSPA 4UGFA 4D3NA 4D33A 1ZZQA 4D3TA 4UGTA 1M9JA 2ORRA 3NLKA 2AN0A 4KCSA 4UQRA 5G6AA 1DMKA 4CTQA 5AD9A 4KCKA 5ADDA 3JT7A 4KCNA 4KCRA 1P6HA 1RS9A 5FVXA 4CX7A 1ED6A 5AGOA 5ADGA 3E67A 3NLFA 4D31A 4UH9A 4CUNA 4IMWA 3UFOA 1M8IA 3TYOA 3JWUA 4UPSA 2ORPA 2BHJA 4KCJA 2NSEA 5ADLA 1M7ZA 5FW0A 4D7JA 1ED5A 3PNHA 4CWYA 1RS8A 4UGPA 5ADEA 3UFUA 1DMIA 4KCMA 3TYMA 8NSEA 1QW4A 7NSEA 5FVWA 3DWJA 4UGYA 4GQEA 4D7IA 4UGWA 3E65A 4UGHA 1DWXA 4FVXA 3EBFA 4JSIA 4V3VA 3N5WA 3NLNA 3N6CA 3UFWA 5G69A 5AD5A 5ADAA 3NM0A 4JSMA 4D3OA 3N5VA 4K5FA 3JWYA 4JSGA 3TYNA 4D1PA 5AD8A 1VAFA 3JT3A 4UH1A 5G0OA 4D1OA 3NLGA 6NSEA 3RQLA 1OM4A 2G6LA 4UGOA 2G6MA 5G6EA 1VAGA 3JX4A 3N6DA 4EUXA 9NSEA 1NOSA 3NLUA 3EAHA 4D30A 4D3UA 3N6AA 3NLQA 4CTRA 1QW5A 4LWAA 4FW0A 3NLXA 1DM8A 4D37A 5AD4A 4UH2A 3PNEA 1ZZUA 4D3JA 1MMWA 3N61A 4CX1A 5AGNA 5FJ2A 5FVPA 1I83A 4CFTB 2NODA 3RQKA 1P6KA 1D0OA 2G6IA 2HX2A 4UGEA 5G6IA 4CWVA 2HX4A 3NNZA 3FC5A 4LWBA 5AGPA 4V3ZA 1LZXA 1FOLA 4CX6A 3E7SA 3UFQA 1R35A 5ADFA 4V3XA 1P6NA 3N62A 4CTTA 4UPQA 1FOJA 3JX5A 4NSEA 1LZZA 1ZZRA 5G67A 3N5YA 4UGMA 3RQMA 4JSHA 4K5KA 1P6LA 4IMUA 5ADJA 4CU1A 1Q2OA 1M8DA 4JSLA 1NODA 4KCOA 4CUMA 4UGVA 1ZZTA 4D1NA 2AN2A 3JWZA 5G6KA 2ORTA 5G6CA 4UH5A 4UGNA 3TYLA 3N5PA 3B3NA 3NLZA 1D1YA 3NLWA 1DMJA 3JX3A 5FVSA 3E6TA 4D34A 3NLEA 1M8EA 5FVQA 4D39A 4D3VA 4LUXA 4UH0A 4IMSA 4D32A 1D1VA 5FVUA 1M9TA 4CWZA 4D7OA 3JT6A 1M00A 4JSJA 3JT4A
chains in the Genus database with same CATH topology
3PNFA 4CANA 1ED4A 4CTUA 5AGMA 5G6LA 3NLMA 3NODA 4FVYA 4UGSA 1P6JA 4UGKA 3E6OA 3EJ8A 1M9RA 1MMVA 3N69A 3RQJA 3N5QA 3N6GA 4UH7A 1MJTA 3E6NA 4UGJA 1DD7A 4CX2A 3N5SA 5G6NA 4UGDA 4K5GA 3UFRA 3NLIA 5G6PA 3NQSA 1JWJA 5G0NA 4UG7A 1D1XA 4UPPA 1ZZSA 2G6HA 4IMXA 5FJ3A 4UPTA 3JWTA 5ADCA 3JWVA 2HX3A 4CAPA 4UGGA 4UGBA 1ZVLA 3NNYA 4UGZA 4KCLA 1DM6A 4UH8A 4CAOA 4K5IA 3N2RA 4UPNA 5G6GA 2NOSA 4K5HA 3UFPA 2ORQA 4CX5A 1NSEA 3UFVA 3RQOA 4D36A 4D7HA 4K5JA 4K5EA 3E7TA 3NLVA 3N6BA 1QW6A 1M7VA 4FVWA 2NSIA 1JWKA 3B3MA 5ADIA 5ADKA 3N5TA 4UG9A 4CWXA 1QOMA 1M8HA 3HSNA 4UH6A 3E68A 5G66A 5G6FA 4UGIA 4D2ZA 4D2YA 5G6DA 2AMOA 5G68A 4JSFA 1M9MA 1P6MA 4D3MA 3JX6A 5AGKA 1M9QA 4UGQA 4UG8A 4JS9A 1OM5A 3NLOA 5AGLA 3NOSA 3EBDA 4CTVA 4CAMA 3N64A 3NLPA 3NSEA 4UH3A 1D1WA 1P6IA 5ADMA 3N67A 4KCQA 1M9KA 3JT5A 4CU0A 1K2RA 4CTXA 3Q9AA 1QWCA 1FOIA 3NLYA 4UPOA 2G6OA 3SVQA 3JWXA 2FC2A 5G0PA 3UFSA 3N68A 3N60A 4UH4A 5G65A 3JWWA 1DWVA 4IMTA 4C3AA 4LUWA 4D3AA 4UCHA 2FC1A 3N66A 3RQPA 4K5DA 4CULA 5FVYA 5G6OA 3JX2A 3JWSA 4NOSA 2FLQA 4CAQA 5FVVA 3JT8A 3EAIA 4CFTA 1K2TA 4CTWA 4D3IA 1NSIA 3N5ZA 4UQSA 3N6EA 4UPMA 4V3WA 3JX0A 4D35A 4V3UA 2G6NA 3N63A 3E7SB 3DQSA 4UPRA 5G6HA 3SVPA 3NLHA 4UGAA 1D0CA 4JSEA 1K2SA 5G6QA 4CTYA 4CVGA 4UG5A 3N5RA 2OROA 5ADNA 4CDTA 4D3BA 4CU1B 3E7IA 3JX1A 2G6JA 4D38A 4CWWA 3NLTA 3NLJA 1DF1A 3N5XA 2FBZX 3JT9A 4V3YA 4JSKA 4CX3A 1NOCA 3E7GA 1FOOA 1RS7A 4KCPA 1DWWA 3E7MA 5FVOA 3B3OA 3E6LA 4KCIA 4CTPA 4CTZA 3DQRA 5FVTA 3N6FA 4CX0A 5ADBA 1K2UA 5FVRA 4UGXA 1FOPA 3JTAA 3HSOA 1RS6A 4C39A 5G6JA 5G6MA 4KCHA 4UGCA 3DQTA 5AD7A 4UHAA 5G6BA 5AD6A 3Q99A 4FVZA 3N65A 4CARA 3PNGA 5NSEA 4CX4A 3NLDA 4D3KA 4UGUA 1N2NA 3NLRA 3NW2A 2G6KA 5FVZA 3B3PA 3UFTA 3RQNA 4UGLA 4UG6A 4UGRA 1DM7A 2Y37A 1ZVIA 2ORSA 3HSPA 4UGFA 4D3NA 4D33A 1ZZQA 4D3TA 4UGTA 1M9JA 2ORRA 3NLKA 2AN0A 4KCSA 4UQRA 5G6AA 1DMKA 4CTQA 5AD9A 4KCKA 5ADDA 3JT7A 4KCNA 4KCRA 1P6HA 1RS9A 5FVXA 4CX7A 1ED6A 5AGOA 5ADGA 3E67A 3NLFA 4D31A 4UH9A 4CUNA 4IMWA 3UFOA 1M8IA 3TYOA 3JWUA 4UPSA 2ORPA 2BHJA 4KCJA 2NSEA 5ADLA 1M7ZA 5FW0A 4D7JA 1ED5A 3PNHA 4CWYA 1RS8A 4UGPA 5ADEA 3UFUA 1DMIA 4KCMA 3TYMA 8NSEA 1QW4A 7NSEA 5FVWA 3DWJA 4UGYA 4GQEA 4D7IA 4UGWA 3E65A 4UGHA 1DWXA 4FVXA 3EBFA 4JSIA 4V3VA 3N5WA 3NLNA 3N6CA 3UFWA 5G69A 5AD5A 5ADAA 3NM0A 4JSMA 4D3OA 3N5VA 4K5FA 3JWYA 4JSGA 3TYNA 4D1PA 5AD8A 1VAFA 3JT3A 4UH1A 5G0OA 4D1OA 3NLGA 6NSEA 3RQLA 1OM4A 2G6LA 4UGOA 2G6MA 5G6EA 1VAGA 3JX4A 3N6DA 4EUXA 9NSEA 1NOSA 3NLUA 3EAHA 4D30A 4D3UA 3N6AA 3NLQA 4CTRA 1QW5A 4LWAA 4FW0A 3NLXA 1DM8A 4D37A 5AD4A 4UH2A 3PNEA 1ZZUA 4D3JA 1MMWA 3N61A 4CX1A 5AGNA 5FJ2A 5FVPA 1I83A 4CFTB 2NODA 3RQKA 1P6KA 1D0OA 2G6IA 2HX2A 4UGEA 5G6IA 4CWVA 2HX4A 3NNZA 3FC5A 4LWBA 5AGPA 4V3ZA 1LZXA 1FOLA 4CX6A 3E7SA 3UFQA 1R35A 5ADFA 4V3XA 1P6NA 3N62A 4CTTA 4UPQA 1FOJA 3JX5A 4NSEA 1LZZA 1ZZRA 5G67A 3N5YA 4UGMA 3RQMA 4JSHA 4K5KA 1P6LA 4IMUA 5ADJA 4CU1A 1Q2OA 1M8DA 4JSLA 1NODA 4KCOA 4CUMA 4UGVA 1ZZTA 4D1NA 2AN2A 3JWZA 5G6KA 2ORTA 5G6CA 4UH5A 4UGNA 3TYLA 3N5PA 3B3NA 3NLZA 1D1YA 3NLWA 1DMJA 3JX3A 5FVSA 3E6TA 4D34A 3NLEA 1M8EA 5FVQA 4D39A 4D3VA 4LUXA 4UH0A 4IMSA 4D32A 1D1VA 5FVUA 1M9TA 4CWZA 4D7OA 3JT6A 1M00A 4JSJA 3JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PNF A;  4CAN A;  1ED4 A;  4CTU A;  5AGM A;  5G6L A;  3NLM A;  3NOD A;  4FVY A;  4UGS A;  1P6J A;  4UGK A;  3E6O A;  3EJ8 A;  1M9R A;  1MMV A;  3N69 A;  3RQJ A;  3N5Q A;  3N6G A;  4UH7 A;  1MJT A;  3E6N A;  4UGJ A;  1DD7 A;  4CX2 A;  3N5S A;  5G6N A;  4UGD A;  4K5G A;  3UFR A;  3NLI A;  5G6P A;  3NQS A;  1JWJ A;  5G0N A;  4UG7 A;  1D1X A;  4UPP A;  1ZZS A;  2G6H A;  4IMX A;  5FJ3 A;  4UPT A;  3JWT A;  5ADC A;  3JWV A;  2HX3 A;  4CAP A;  4UGG A;  4UGB A;  1ZVL A;  3NNY A;  4UGZ A;  4KCL A;  1DM6 A;  4UH8 A;  4CAO A;  4K5I A;  3N2R A;  4UPN A;  5G6G A;  2NOS A;  4K5H A;  3UFP A;  2ORQ A;  4CX5 A;  1NSE A;  3UFV A;  3RQO A;  4D36 A;  4D7H A;  4K5J A;  4K5E A;  3E7T A;  3NLV A;  3N6B A;  1QW6 A;  1M7V A;  4FVW A;  2NSI A;  1JWK A;  3B3M A;  5ADI A;  5ADK A;  3N5T A;  4UG9 A;  4CWX A;  1QOM A;  1M8H A;  3HSN A;  4UH6 A;  3E68 A;  5G66 A;  5G6F A;  4UGI A;  4D2Z A;  4D2Y A;  5G6D A;  2AMO A;  5G68 A;  4JSF A;  1M9M A;  1P6M A;  4D3M A;  3JX6 A;  5AGK A;  1M9Q A;  4UGQ A;  4UG8 A;  4JS9 A;  1OM5 A;  3NLO A;  5AGL A;  3NOS A;  3EBD A;  4CTV A;  4CAM A;  3N64 A;  3NLP A;  3NSE A;  4UH3 A;  1D1W A;  1P6I A;  5ADM A;  3N67 A;  4KCQ A;  1M9K A;  3JT5 A;  4CU0 A;  1K2R A;  4CTX A;  3Q9A A;  1QWC A;  1FOI A;  3NLY A;  4UPO A;  2G6O A;  3SVQ A;  3JWX A;  2FC2 A;  5G0P A;  3UFS A;  3N68 A;  3N60 A;  4UH4 A;  5G65 A;  3JWW A;  1DWV A;  4IMT A;  4C3A A;  4LUW A;  4D3A A;  4UCH A;  2FC1 A;  3N66 A;  3RQP A;  4K5D A;  4CUL A;  5FVY A;  5G6O A;  3JX2 A;  3JWS A;  4NOS A;  2FLQ A;  4CAQ A;  5FVV A;  3JT8 A;  3EAI A;  4CFT A;  1K2T A;  4CTW A;  4D3I A;  1NSI A;  3N5Z A;  4UQS A;  3N6E A;  4UPM A;  4V3W A;  3JX0 A;  4D35 A;  4V3U A;  2G6N A;  3N63 A;  3E7S B;  3DQS A;  4UPR A;  5G6H A;  3SVP A;  3NLH A;  4UGA A;  1D0C A;  4JSE A;  1K2S A;  5G6Q A;  4CTY A;  4CVG A;  4UG5 A;  3N5R A;  2ORO A;  5ADN A;  4CDT A;  4D3B A;  4CU1 B;  3E7I A;  3JX1 A;  2G6J A;  4D38 A;  4CWW A;  3NLT A;  3NLJ A;  1DF1 A;  3N5X A;  2FBZ X;  3JT9 A;  4V3Y A;  4JSK A;  4CX3 A;  1NOC A;  3E7G A;  1FOO A;  1RS7 A;  4KCP A;  1DWW A;  3E7M A;  5FVO A;  3B3O A;  3E6L A;  4KCI A;  4CTP A;  4CTZ A;  3DQR A;  5FVT A;  3N6F A;  4CX0 A;  5ADB A;  1K2U A;  5FVR A;  4UGX A;  1FOP A;  3JTA A;  3HSO A;  1RS6 A;  4C39 A;  5G6J A;  5G6M A;  4KCH A;  4UGC A;  3DQT A;  5AD7 A;  4UHA A;  5G6B A;  5AD6 A;  3Q99 A;  4FVZ A;  3N65 A;  4CAR A;  3PNG A;  5NSE A;  4CX4 A;  3NLD A;  4D3K A;  4UGU A;  1N2N A;  3NLR A;  3NW2 A;  2G6K A;  5FVZ A;  3B3P A;  3UFT A;  3RQN A;  4UGL A;  4UG6 A;  4UGR A;  1DM7 A;  2Y37 A;  1ZVI A;  2ORS A;  3HSP A;  4UGF A;  4D3N A;  4D33 A;  1ZZQ A;  4D3T A;  4UGT A;  1M9J A;  2ORR A;  3NLK A;  2AN0 A;  4KCS A;  4UQR A;  5G6A A;  1DMK A;  4CTQ A;  5AD9 A;  4KCK A;  5ADD A;  3JT7 A;  4KCN A;  4KCR A;  1P6H A;  1RS9 A;  5FVX A;  4CX7 A;  1ED6 A;  5AGO A;  5ADG A;  3E67 A;  3NLF A;  4D31 A;  4UH9 A;  4CUN A;  4IMW A;  3UFO A;  1M8I A;  3TYO A;  3JWU A;  4UPS A;  2ORP A;  2BHJ A;  4KCJ A;  2NSE A;  5ADL A;  1M7Z A;  5FW0 A;  4D7J A;  1ED5 A;  3PNH A;  4CWY A;  1RS8 A;  4UGP A;  5ADE A;  3UFU A;  1DMI A;  4KCM A;  3TYM A;  8NSE A;  1QW4 A;  7NSE A;  5FVW A;  3DWJ A;  4UGY A;  4GQE A;  4D7I A;  4UGW A;  3E65 A;  4UGH A;  1DWX A;  4FVX A;  3EBF A;  4JSI A;  4V3V A;  3N5W A;  3NLN A;  3N6C A;  3UFW A;  5G69 A;  5AD5 A;  5ADA A;  3NM0 A;  4JSM A;  4D3O A;  3N5V A;  4K5F A;  3JWY A;  4JSG A;  3TYN A;  4D1P A;  5AD8 A;  1VAF A;  3JT3 A;  4UH1 A;  5G0O A;  4D1O A;  3NLG A;  6NSE A;  3RQL A;  1OM4 A;  2G6L A;  4UGO A;  2G6M A;  5G6E A;  1VAG A;  3JX4 A;  3N6D A;  4EUX A;  9NSE A;  1NOS A;  3NLU A;  3EAH A;  4D30 A;  4D3U A;  3N6A A;  3NLQ A;  4CTR A;  1QW5 A;  4LWA A;  4FW0 A;  3NLX A;  1DM8 A;  4D37 A;  5AD4 A;  4UH2 A;  3PNE A;  1ZZU A;  4D3J A;  1MMW A;  3N61 A;  4CX1 A;  5AGN A;  5FJ2 A;  5FVP A;  1I83 A;  4CFT B;  2NOD A;  3RQK A;  1P6K A;  1D0O A;  2G6I A;  2HX2 A;  4UGE A;  5G6I A;  4CWV A;  2HX4 A;  3NNZ A;  3FC5 A;  4LWB A;  5AGP A;  4V3Z A;  1LZX A;  1FOL A;  4CX6 A;  3E7S A;  3UFQ A;  1R35 A;  5ADF A;  4V3X A;  1P6N A;  3N62 A;  4CTT A;  4UPQ A;  1FOJ A;  3JX5 A;  4NSE A;  1LZZ A;  1ZZR A;  5G67 A;  3N5Y A;  4UGM A;  3RQM A;  4JSH A;  4K5K A;  1P6L A;  4IMU A;  5ADJ A;  4CU1 A;  1Q2O A;  1M8D A;  4JSL A;  1NOD A;  4KCO A;  4CUM A;  4UGV A;  1ZZT A;  4D1N A;  2AN2 A;  3JWZ A;  5G6K A;  2ORT A;  5G6C A;  4UH5 A;  4UGN A;  3TYL A;  3N5P A;  3B3N A;  3NLZ A;  1D1Y A;  3NLW A;  1DMJ A;  3JX3 A;  5FVS A;  3E6T A;  4D34 A;  3NLE A;  1M8E A;  5FVQ A;  4D39 A;  4D3V A;  4LUX A;  4UH0 A;  4IMS A;  4D32 A;  1D1V A;  5FVU A;  1M9T A;  4CWZ A;  4D7O A;  3JT6 A;  1M00 A;  4JSJ A;  3JT4 A; 
#chains in the Genus database with same CATH topology
 3PNF A;  4CAN A;  1ED4 A;  4CTU A;  5AGM A;  5G6L A;  3NLM A;  3NOD A;  4FVY A;  4UGS A;  1P6J A;  4UGK A;  3E6O A;  3EJ8 A;  1M9R A;  1MMV A;  3N69 A;  3RQJ A;  3N5Q A;  3N6G A;  4UH7 A;  1MJT A;  3E6N A;  4UGJ A;  1DD7 A;  4CX2 A;  3N5S A;  5G6N A;  4UGD A;  4K5G A;  3UFR A;  3NLI A;  5G6P A;  3NQS A;  1JWJ A;  5G0N A;  4UG7 A;  1D1X A;  4UPP A;  1ZZS A;  2G6H A;  4IMX A;  5FJ3 A;  4UPT A;  3JWT A;  5ADC A;  3JWV A;  2HX3 A;  4CAP A;  4UGG A;  4UGB A;  1ZVL A;  3NNY A;  4UGZ A;  4KCL A;  1DM6 A;  4UH8 A;  4CAO A;  4K5I A;  3N2R A;  4UPN A;  5G6G A;  2NOS A;  4K5H A;  3UFP A;  2ORQ A;  4CX5 A;  1NSE A;  3UFV A;  3RQO A;  4D36 A;  4D7H A;  4K5J A;  4K5E A;  3E7T A;  3NLV A;  3N6B A;  1QW6 A;  1M7V A;  4FVW A;  2NSI A;  1JWK A;  3B3M A;  5ADI A;  5ADK A;  3N5T A;  4UG9 A;  4CWX A;  1QOM A;  1M8H A;  3HSN A;  4UH6 A;  3E68 A;  5G66 A;  5G6F A;  4UGI A;  4D2Z A;  4D2Y A;  5G6D A;  2AMO A;  5G68 A;  4JSF A;  1M9M A;  1P6M A;  4D3M A;  3JX6 A;  5AGK A;  1M9Q A;  4UGQ A;  4UG8 A;  4JS9 A;  1OM5 A;  3NLO A;  5AGL A;  3NOS A;  3EBD A;  4CTV A;  4CAM A;  3N64 A;  3NLP A;  3NSE A;  4UH3 A;  1D1W A;  1P6I A;  5ADM A;  3N67 A;  4KCQ A;  1M9K A;  3JT5 A;  4CU0 A;  1K2R A;  4CTX A;  3Q9A A;  1QWC A;  1FOI A;  3NLY A;  4UPO A;  2G6O A;  3SVQ A;  3JWX A;  2FC2 A;  5G0P A;  3UFS A;  3N68 A;  3N60 A;  4UH4 A;  5G65 A;  3JWW A;  1DWV A;  4IMT A;  4C3A A;  4LUW A;  4D3A A;  4UCH A;  2FC1 A;  3N66 A;  3RQP A;  4K5D A;  4CUL A;  5FVY A;  5G6O A;  3JX2 A;  3JWS A;  4NOS A;  2FLQ A;  4CAQ A;  5FVV A;  3JT8 A;  3EAI A;  4CFT A;  1K2T A;  4CTW A;  4D3I A;  1NSI A;  3N5Z A;  4UQS A;  3N6E A;  4UPM A;  4V3W A;  3JX0 A;  4D35 A;  4V3U A;  2G6N A;  3N63 A;  3E7S B;  3DQS A;  4UPR A;  5G6H A;  3SVP A;  3NLH A;  4UGA A;  1D0C A;  4JSE A;  1K2S A;  5G6Q A;  4CTY A;  4CVG A;  4UG5 A;  3N5R A;  2ORO A;  5ADN A;  4CDT A;  4D3B A;  4CU1 B;  3E7I A;  3JX1 A;  2G6J A;  4D38 A;  4CWW A;  3NLT A;  3NLJ A;  1DF1 A;  3N5X A;  2FBZ X;  3JT9 A;  4V3Y A;  4JSK A;  4CX3 A;  1NOC A;  3E7G A;  1FOO A;  1RS7 A;  4KCP A;  1DWW A;  3E7M A;  5FVO A;  3B3O A;  3E6L A;  4KCI A;  4CTP A;  4CTZ A;  3DQR A;  5FVT A;  3N6F A;  4CX0 A;  5ADB A;  1K2U A;  5FVR A;  4UGX A;  1FOP A;  3JTA A;  3HSO A;  1RS6 A;  4C39 A;  5G6J A;  5G6M A;  4KCH A;  4UGC A;  3DQT A;  5AD7 A;  4UHA A;  5G6B A;  5AD6 A;  3Q99 A;  4FVZ A;  3N65 A;  4CAR A;  3PNG A;  5NSE A;  4CX4 A;  3NLD A;  4D3K A;  4UGU A;  1N2N A;  3NLR A;  3NW2 A;  2G6K A;  5FVZ A;  3B3P A;  3UFT A;  3RQN A;  4UGL A;  4UG6 A;  4UGR A;  1DM7 A;  2Y37 A;  1ZVI A;  2ORS A;  3HSP A;  4UGF A;  4D3N A;  4D33 A;  1ZZQ A;  4D3T A;  4UGT A;  1M9J A;  2ORR A;  3NLK A;  2AN0 A;  4KCS A;  4UQR A;  5G6A A;  1DMK A;  4CTQ A;  5AD9 A;  4KCK A;  5ADD A;  3JT7 A;  4KCN A;  4KCR A;  1P6H A;  1RS9 A;  5FVX A;  4CX7 A;  1ED6 A;  5AGO A;  5ADG A;  3E67 A;  3NLF A;  4D31 A;  4UH9 A;  4CUN A;  4IMW A;  3UFO A;  1M8I A;  3TYO A;  3JWU A;  4UPS A;  2ORP A;  2BHJ A;  4KCJ A;  2NSE A;  5ADL A;  1M7Z A;  5FW0 A;  4D7J A;  1ED5 A;  3PNH A;  4CWY A;  1RS8 A;  4UGP A;  5ADE A;  3UFU A;  1DMI A;  4KCM A;  3TYM A;  8NSE A;  1QW4 A;  7NSE A;  5FVW A;  3DWJ A;  4UGY A;  4GQE A;  4D7I A;  4UGW A;  3E65 A;  4UGH A;  1DWX A;  4FVX A;  3EBF A;  4JSI A;  4V3V A;  3N5W A;  3NLN A;  3N6C A;  3UFW A;  5G69 A;  5AD5 A;  5ADA A;  3NM0 A;  4JSM A;  4D3O A;  3N5V A;  4K5F A;  3JWY A;  4JSG A;  3TYN A;  4D1P A;  5AD8 A;  1VAF A;  3JT3 A;  4UH1 A;  5G0O A;  4D1O A;  3NLG A;  6NSE A;  3RQL A;  1OM4 A;  2G6L A;  4UGO A;  2G6M A;  5G6E A;  1VAG A;  3JX4 A;  3N6D A;  4EUX A;  9NSE A;  1NOS A;  3NLU A;  3EAH A;  4D30 A;  4D3U A;  3N6A A;  3NLQ A;  4CTR A;  1QW5 A;  4LWA A;  4FW0 A;  3NLX A;  1DM8 A;  4D37 A;  5AD4 A;  4UH2 A;  3PNE A;  1ZZU A;  4D3J A;  1MMW A;  3N61 A;  4CX1 A;  5AGN A;  5FJ2 A;  5FVP A;  1I83 A;  4CFT B;  2NOD A;  3RQK A;  1P6K A;  1D0O A;  2G6I A;  2HX2 A;  4UGE A;  5G6I A;  4CWV A;  2HX4 A;  3NNZ A;  3FC5 A;  4LWB A;  5AGP A;  4V3Z A;  1LZX A;  1FOL A;  4CX6 A;  3E7S A;  3UFQ A;  1R35 A;  5ADF A;  4V3X A;  1P6N A;  3N62 A;  4CTT A;  4UPQ A;  1FOJ A;  3JX5 A;  4NSE A;  1LZZ A;  1ZZR A;  5G67 A;  3N5Y A;  4UGM A;  3RQM A;  4JSH A;  4K5K A;  1P6L A;  4IMU A;  5ADJ A;  4CU1 A;  1Q2O A;  1M8D A;  4JSL A;  1NOD A;  4KCO A;  4CUM A;  4UGV A;  1ZZT A;  4D1N A;  2AN2 A;  3JWZ A;  5G6K A;  2ORT A;  5G6C A;  4UH5 A;  4UGN A;  3TYL A;  3N5P A;  3B3N A;  3NLZ A;  1D1Y A;  3NLW A;  1DMJ A;  3JX3 A;  5FVS A;  3E6T A;  4D34 A;  3NLE A;  1M8E A;  5FVQ A;  4D39 A;  4D3V A;  4LUX A;  4UH0 A;  4IMS A;  4D32 A;  1D1V A;  5FVU A;  1M9T A;  4CWZ A;  4D7O A;  3JT6 A;  1M00 A;  4JSJ A;  3JT4 A; 
#chains in the Genus database with same CATH homology
 3PNF A;  4CAN A;  1ED4 A;  4CTU A;  5AGM A;  5G6L A;  3NLM A;  3NOD A;  4FVY A;  4UGS A;  1P6J A;  4UGK A;  3E6O A;  3EJ8 A;  1M9R A;  1MMV A;  3N69 A;  3RQJ A;  3N5Q A;  3N6G A;  4UH7 A;  1MJT A;  3E6N A;  4UGJ A;  1DD7 A;  4CX2 A;  3N5S A;  5G6N A;  4UGD A;  4K5G A;  3UFR A;  3NLI A;  5G6P A;  3NQS A;  1JWJ A;  5G0N A;  4UG7 A;  1D1X A;  4UPP A;  1ZZS A;  2G6H A;  4IMX A;  5FJ3 A;  4UPT A;  3JWT A;  5ADC A;  3JWV A;  2HX3 A;  4CAP A;  4UGG A;  4UGB A;  1ZVL A;  3NNY A;  4UGZ A;  4KCL A;  1DM6 A;  4UH8 A;  4CAO A;  4K5I A;  3N2R A;  4UPN A;  5G6G A;  2NOS A;  4K5H A;  3UFP A;  2ORQ A;  4CX5 A;  1NSE A;  3UFV A;  3RQO A;  4D36 A;  4D7H A;  4K5J A;  4K5E A;  3E7T A;  3NLV A;  3N6B A;  1QW6 A;  1M7V A;  4FVW A;  2NSI A;  1JWK A;  3B3M A;  5ADI A;  5ADK A;  3N5T A;  4UG9 A;  4CWX A;  1QOM A;  1M8H A;  3HSN A;  4UH6 A;  3E68 A;  5G66 A;  5G6F A;  4UGI A;  4D2Z A;  4D2Y A;  5G6D A;  2AMO A;  5G68 A;  4JSF A;  1M9M A;  1P6M A;  4D3M A;  3JX6 A;  5AGK A;  1M9Q A;  4UGQ A;  4UG8 A;  4JS9 A;  1OM5 A;  3NLO A;  5AGL A;  3NOS A;  3EBD A;  4CTV A;  4CAM A;  3N64 A;  3NLP A;  3NSE A;  4UH3 A;  1D1W A;  1P6I A;  5ADM A;  3N67 A;  4KCQ A;  1M9K A;  3JT5 A;  4CU0 A;  1K2R A;  4CTX A;  3Q9A A;  1QWC A;  1FOI A;  3NLY A;  4UPO A;  2G6O A;  3SVQ A;  3JWX A;  2FC2 A;  5G0P A;  3UFS A;  3N68 A;  3N60 A;  4UH4 A;  5G65 A;  3JWW A;  1DWV A;  4IMT A;  4C3A A;  4LUW A;  4D3A A;  4UCH A;  2FC1 A;  3N66 A;  3RQP A;  4K5D A;  4CUL A;  5FVY A;  5G6O A;  3JX2 A;  3JWS A;  4NOS A;  2FLQ A;  4CAQ A;  5FVV A;  3JT8 A;  3EAI A;  4CFT A;  1K2T A;  4CTW A;  4D3I A;  1NSI A;  3N5Z A;  4UQS A;  3N6E A;  4UPM A;  4V3W A;  3JX0 A;  4D35 A;  4V3U A;  2G6N A;  3N63 A;  3E7S B;  3DQS A;  4UPR A;  5G6H A;  3SVP A;  3NLH A;  4UGA A;  1D0C A;  4JSE A;  1K2S A;  5G6Q A;  4CTY A;  4CVG A;  4UG5 A;  3N5R A;  2ORO A;  5ADN A;  4CDT A;  4D3B A;  4CU1 B;  3E7I A;  3JX1 A;  2G6J A;  4D38 A;  4CWW A;  3NLT A;  3NLJ A;  1DF1 A;  3N5X A;  2FBZ X;  3JT9 A;  4V3Y A;  4JSK A;  4CX3 A;  1NOC A;  3E7G A;  1FOO A;  1RS7 A;  4KCP A;  1DWW A;  3E7M A;  5FVO A;  3B3O A;  3E6L A;  4KCI A;  4CTP A;  4CTZ A;  3DQR A;  5FVT A;  3N6F A;  4CX0 A;  5ADB A;  1K2U A;  5FVR A;  4UGX A;  1FOP A;  3JTA A;  3HSO A;  1RS6 A;  4C39 A;  5G6J A;  5G6M A;  4KCH A;  4UGC A;  3DQT A;  5AD7 A;  4UHA A;  5G6B A;  5AD6 A;  3Q99 A;  4FVZ A;  3N65 A;  4CAR A;  3PNG A;  5NSE A;  4CX4 A;  3NLD A;  4D3K A;  4UGU A;  1N2N A;  3NLR A;  3NW2 A;  2G6K A;  5FVZ A;  3B3P A;  3UFT A;  3RQN A;  4UGL A;  4UG6 A;  4UGR A;  1DM7 A;  2Y37 A;  1ZVI A;  2ORS A;  3HSP A;  4UGF A;  4D3N A;  4D33 A;  1ZZQ A;  4D3T A;  4UGT A;  1M9J A;  2ORR A;  3NLK A;  2AN0 A;  4KCS A;  4UQR A;  5G6A A;  1DMK A;  4CTQ A;  5AD9 A;  4KCK A;  5ADD A;  3JT7 A;  4KCN A;  4KCR A;  1P6H A;  1RS9 A;  5FVX A;  4CX7 A;  1ED6 A;  5AGO A;  5ADG A;  3E67 A;  3NLF A;  4D31 A;  4UH9 A;  4CUN A;  4IMW A;  3UFO A;  1M8I A;  3TYO A;  3JWU A;  4UPS A;  2ORP A;  2BHJ A;  4KCJ A;  2NSE A;  5ADL A;  1M7Z A;  5FW0 A;  4D7J A;  1ED5 A;  3PNH A;  4CWY A;  1RS8 A;  4UGP A;  5ADE A;  3UFU A;  1DMI A;  4KCM A;  3TYM A;  8NSE A;  1QW4 A;  7NSE A;  5FVW A;  3DWJ A;  4UGY A;  4GQE A;  4D7I A;  4UGW A;  3E65 A;  4UGH A;  1DWX A;  4FVX A;  3EBF A;  4JSI A;  4V3V A;  3N5W A;  3NLN A;  3N6C A;  3UFW A;  5G69 A;  5AD5 A;  5ADA A;  3NM0 A;  4JSM A;  4D3O A;  3N5V A;  4K5F A;  3JWY A;  4JSG A;  3TYN A;  4D1P A;  5AD8 A;  1VAF A;  3JT3 A;  4UH1 A;  5G0O A;  4D1O A;  3NLG A;  6NSE A;  3RQL A;  1OM4 A;  2G6L A;  4UGO A;  2G6M A;  5G6E A;  1VAG A;  3JX4 A;  3N6D A;  4EUX A;  9NSE A;  1NOS A;  3NLU A;  3EAH A;  4D30 A;  4D3U A;  3N6A A;  3NLQ A;  4CTR A;  1QW5 A;  4LWA A;  4FW0 A;  3NLX A;  1DM8 A;  4D37 A;  5AD4 A;  4UH2 A;  3PNE A;  1ZZU A;  4D3J A;  1MMW A;  3N61 A;  4CX1 A;  5AGN A;  5FJ2 A;  5FVP A;  1I83 A;  4CFT B;  2NOD A;  3RQK A;  1P6K A;  1D0O A;  2G6I A;  2HX2 A;  4UGE A;  5G6I A;  4CWV A;  2HX4 A;  3NNZ A;  3FC5 A;  4LWB A;  5AGP A;  4V3Z A;  1LZX A;  1FOL A;  4CX6 A;  3E7S A;  3UFQ A;  1R35 A;  5ADF A;  4V3X A;  1P6N A;  3N62 A;  4CTT A;  4UPQ A;  1FOJ A;  3JX5 A;  4NSE A;  1LZZ A;  1ZZR A;  5G67 A;  3N5Y A;  4UGM A;  3RQM A;  4JSH A;  4K5K A;  1P6L A;  4IMU A;  5ADJ A;  4CU1 A;  1Q2O A;  1M8D A;  4JSL A;  1NOD A;  4KCO A;  4CUM A;  4UGV A;  1ZZT A;  4D1N A;  2AN2 A;  3JWZ A;  5G6K A;  2ORT A;  5G6C A;  4UH5 A;  4UGN A;  3TYL A;  3N5P A;  3B3N A;  3NLZ A;  1D1Y A;  3NLW A;  1DMJ A;  3JX3 A;  5FVS A;  3E6T A;  4D34 A;  3NLE A;  1M8E A;  5FVQ A;  4D39 A;  4D3V A;  4LUX A;  4UH0 A;  4IMS A;  4D32 A;  1D1V A;  5FVU A;  1M9T A;  4CWZ A;  4D7O A;  3JT6 A;  1M00 A;  4JSJ A;  3JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...