4UGTA

Structure of bacillus subtilis nitric oxide synthase in complex with n-(3-((pyrrolidin-3-yloxy)methyl)phenyl)thiophene-2-carboximidamide
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
361
structure length
361
Chain Sequence
EKEILWNEAKAFIAACYQELGKAAEVKDRLADIKSEIDLTGSYVHTKEELEHGAKMAWRNSNRCIGRLFWNSLNVIDRRDVRTKEEVRDALFHHIETATNNGKIRPTITIFPPEEKGEKQVEIWNHQLIRYAGYESDGERIGDPASCSLTAACEELGWRGERTDFDLLPLIFRMKGDEQPVWYELPRSLVIEVPITHPDIEAFSDLELKWYGVPIISDMKLEVGGIHYNAAPFNGWYMGTEIGARNLADEKRYDKLKKVASVIGIAADYNTDLWKDQALVELNKAVLHSYKKQGVSIVDHHTAASQFKRFEEQAEEAGRKLTGDWTWLIPPISPAATHIFHRSYDNSIVKPNYFYQDKPYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Inhibitor Bound Crystal Structures of Bacterial Nitric Oxide Synthase.
pubmed doi rcsb
molecule keywords NITRIC OXIDE SYNTHASE OXYGENASE
molecule tags Oxidoreductase
source organism Bacillus subtilis
total genus 118
structure length 361
sequence length 361
ec nomenclature ec 1.14.14.47: Nitric-oxide synthase (flavodoxin).
pdb deposition date 2015-03-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02898 NO_synthase Nitric oxide synthase, oxygenase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.340.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase; Chain A, domain 1 Nitric Oxide Synthase; Chain A, domain 1 4ugtA01
3.90.440.10 Alpha Beta Alpha-Beta Complex Nitric Oxide Synthase;Heme Domain; Chain A, domain 2 Nitric Oxide Synthase;Heme Domain;Chain A domain 2 4ugtA02
3.90.1230.10 Alpha Beta Alpha-Beta Complex Bovine Endothelial Nitric Oxide Synthase Heme Domain; Chain: A,domain 3 Nitric Oxide Synthase; Chain A, domain 3 4ugtA03
1ED5A 3N66A 1DMIA 5G66A 5FVVA 4UH8A 2BHJA 5G6EA 4UH9A 5FW0A 3RQPA 2FC2A 3B3MA 4UQRA 1M9QA 1OM4A 3E68A 5ADBA 1K2TA 3N6EA 4IMWA 3E7MA 4KCOA 4JSJA 2FC1A 1DWWA 1DF1A 3DQRA 3N63A 1FOOA 5G65A 4CTRA 1P6MA 5ADAA 4CWXA 4CAPA 3DQTA 2HX3A 3NOSA 3N5WA 5NSEA 2AMOA 4UH6A 5AGOA 3NW2A 5ADCA 3UFSA 3NLTA 4UCHA 4JSFA 4KCIA 1ZZTA 4D2YA 4CX7A 4FVYA 5G6QA 1R35A 4CAOA 4CDTA 3NLZA 8NSEA 2AN0A 3UFQA 3NLKA 4CTWA 3N5RA 3NLJA 4JSGA 1ZZQA 4D37A 1FOLA 2ORQA 3N2RA 3RQOA 3Q99A 1M7VA 3N5PA 3E6LA 1K2SA 3NLRA 5FJ3A 4KCMA 4UGIA 5G6HA 3NLDA 4KCNA 3E6TA 2AN2A 3HSNA 4UG6A 5AD4A 4D3TA 4CAMA 4UGWA 1M8IA 3NNZA 3JWWA 3EBDA 4UGAA 3NLGA 4UGKA 4CARA 4D34A 1M9MA 5G6OA 3N61A 1ZVLA 3N6GA 3NQSA 4UGXA 5FVWA 1QOMA 3NLOA 4D2ZA 5AD9A 3TYMA 3UFOA 3UFVA 3B3PA 1M9KA 5ADIA 4D1OA 1D1VA 4UGRA 4KCRA 4CWYA 2HX2A 1DMKA 1QW5A 2G6MA 5G6LA 4KCQA 4D3AA 4KCSA 4D7IA 4K5FA 5G0OA 1ZZUA 4D3JA 1QWCA 4UGDA 4UH2A 5G6BA 4JSHA 4K5HA 4C3AA 4CU0A 1DD7A 1MJTA 4D38A 4UGGA 3NLNA 1OM5A 3NLUA 1FOPA 1M9JA 3JWTA 1FOIA 2ORTA 4D3NA 5G6KA 3N5YA 1P6LA 3NLPA 3PNFA 3HSOA 3JTAA 3N69A 1M8HA 1P6KA 2G6KA 4D31A 3JWUA 4CTUA 6NSEA 1ZZRA 4UGTA 1D1YA 3NLEA 4UGMA 1D0OA 4CTXA 3N60A 1DM6A 1K2UA 1M9RA 1NSIA 4LUXA 4UPNA 3E65A 1VAGA 1ZVIA 5ADMA 4UGQA 4UGHA 4CTPA 3NSEA 1JWJA 1M8EA 5G0PA 4UGNA 4V3UA 3E6NA 4UGUA 1M00A 4D3KA 1QW6A 3N67A 2ORPA 3EBFA 4KCJA 1DM8A 2G6LA 2G6HA 3NLXA 3NLYA 9NSEA 3UFUA 5AGPA 4D3VA 2NSIA 3E7SB 3NM0A 1P6IA 5G6AA 4UPQA 4CTQA 3FC5A 4D3UA 1DWVA 4UPTA 3TYNA 5ADFA 2OROA 1P6HA 3UFWA 4FVXA 4UG5A 5G6JA 3JX2A 3N6CA 5G69A 4K5KA 3JX0A 4UH0A 1DM7A 1D0CA 3E7SA 4EUXA 5G68A 4D3MA 4JSMA 3SVQA 3Q9AA 4D1PA 4CFTA 3N5ZA 1M9TA 5FJ2A 3JX3A 4D39A 4CU1B 3RQLA 5FVPA 2G6OA 3UFTA 3JT9A 4UG7A 4CTZA 4CX1A 4UG9A 4GQEA 3E7IA 1P6JA 4CU1A 5FVOA 3JWYA 4UPRA 4C39A 1NODA 4K5DA 3N6DA 1RS8A 1VAFA 4IMUA 1MMVA 1M7ZA 3HSPA 5AD7A 1ZZSA 4IMXA 4CVGA 5G6DA 4D33A 5FVSA 3N6BA 2NOSA 5AGLA 4CULA 3NLWA 3N5SA 5G6CA 4D7OA 1DWXA 4JSIA 3JX4A 1M8DA 5AD5A 5G6GA 3JT3A 4UH5A 1NOCA 3E67A 4V3XA 4CTYA 1P6NA 1MMWA 2NODA 4CAQA 5AGNA 3NLQA 4CX5A 4CUMA 5G0NA 3NLMA 3N5VA 3EJ8A 4LWBA 3N5TA 4D3OA 5FVUA 1D1WA 4UH3A 3RQMA 4UGZA 4UH7A 5AD6A 3JX1A 5G67A 2FBZX 4UGYA 3TYLA 4FW0A 3JT6A 4KCLA 4NOSA 3PNHA 5AGMA 2Y37A 5AGKA 4D7HA 4V3VA 3NLFA 4CWZA 3EAIA 4UGSA 3RQKA 4UGFA 4FVWA 4LWAA 3JT5A 4UGBA 3N68A 3JWVA 2G6JA 3N6AA 1I83A 3NODA 5ADGA 4K5GA 4D35A 4CFTB 2G6IA 3B3OA 4CTVA 3NNYA 5G6NA 3JX5A 4CX0A 1LZXA 1NOSA 2ORRA 3DWJA 3UFRA 5ADLA 4UH1A 1QW4A 4CX3A 1RS9A 5AD8A 4KCHA 1NSEA 5FVQA 5G6PA 4UGOA 4NSEA 4UGPA 3PNEA 1K2RA 4UGJA 3NLHA 3NLIA 4K5JA 4CX4A 4UPSA 3UFPA 4CX2A 3RQNA 4JSEA 5G6IA 4D30A 4CWVA 4UGVA 5FVXA 4D36A 4UGLA 4D1NA 5ADDA 4UPOA 4K5EA 4IMSA 3B3NA 4FVZA 4UPMA 1Q2OA 1ED4A 3JT7A 3E6OA 5G6MA 1FOJA 5G6FA 2FLQA 4IMTA 4V3ZA 7NSEA 1LZZA 5FVTA 4JSLA 3DQSA 2NSEA 3JX6A 4UGEA 4UGCA 4D7JA 2HX4A 4KCKA 4UH4A 3E7TA 3N5QA 4D3IA 1ED6A 5ADKA 3EAHA 3PNGA 5ADJA 3JWZA 3TYOA 4CUNA 1N2NA 1D1XA 3JWXA 3RQJA 4CX6A 4UQSA 2ORSA 3JT8A 4CANA 2G6NA 1DMJA 3N6FA 4V3WA 3JT4A 4JSKA 3JWSA 3N64A 5FVZA 4KCPA 5ADEA 5FVYA 4LUWA 4D3BA 4CTTA 4UG8A 4JS9A 4UPPA 4K5IA 3N5XA 5FVRA 3N65A 1RS7A 3E7GA 4CWWA 3N62A 4V3YA 5ADNA 3NLVA 4UHAA 1RS6A 3SVPA 4D32A 1JWKA
chains in the Genus database with same CATH superfamily
1ED5A 3N66A 1DMIA 5G66A 5FVVA 4UH8A 2BHJA 5G6EA 4UH9A 5FW0A 3RQPA 2FC2A 3B3MA 4UQRA 1M9QA 1OM4A 3E68A 5ADBA 1K2TA 3N6EA 4IMWA 3E7MA 4KCOA 4JSJA 2FC1A 1DWWA 1DF1A 3DQRA 3N63A 1FOOA 5G65A 4CTRA 1P6MA 5ADAA 4CWXA 4CAPA 3DQTA 2HX3A 3NOSA 3N5WA 5NSEA 2AMOA 4UH6A 5AGOA 3NW2A 5ADCA 3UFSA 3NLTA 4UCHA 4JSFA 4KCIA 1ZZTA 4D2YA 4CX7A 4FVYA 5G6QA 1R35A 4CAOA 4CDTA 3NLZA 8NSEA 2AN0A 3UFQA 3NLKA 4CTWA 3N5RA 3NLJA 4JSGA 1ZZQA 4D37A 1FOLA 2ORQA 3N2RA 3RQOA 3Q99A 1M7VA 3N5PA 3E6LA 1K2SA 3NLRA 5FJ3A 4KCMA 4UGIA 5G6HA 3NLDA 4KCNA 3E6TA 2AN2A 3HSNA 4UG6A 5AD4A 4D3TA 4CAMA 4UGWA 1M8IA 3NNZA 3JWWA 3EBDA 4UGAA 3NLGA 4UGKA 4CARA 4D34A 1M9MA 5G6OA 3N61A 1ZVLA 3N6GA 3NQSA 4UGXA 5FVWA 1QOMA 3NLOA 4D2ZA 5AD9A 3TYMA 3UFOA 3UFVA 3B3PA 1M9KA 5ADIA 4D1OA 1D1VA 4UGRA 4KCRA 4CWYA 2HX2A 1DMKA 1QW5A 2G6MA 5G6LA 4KCQA 4D3AA 4KCSA 4D7IA 4K5FA 5G0OA 1ZZUA 4D3JA 1QWCA 4UGDA 4UH2A 5G6BA 4JSHA 4K5HA 4C3AA 4CU0A 1DD7A 1MJTA 4D38A 4UGGA 3NLNA 1OM5A 3NLUA 1FOPA 1M9JA 3JWTA 1FOIA 2ORTA 4D3NA 5G6KA 3N5YA 1P6LA 3NLPA 3PNFA 3HSOA 3JTAA 3N69A 1M8HA 1P6KA 2G6KA 4D31A 3JWUA 4CTUA 6NSEA 1ZZRA 4UGTA 1D1YA 3NLEA 4UGMA 1D0OA 4CTXA 3N60A 1DM6A 1K2UA 1M9RA 1NSIA 4LUXA 4UPNA 3E65A 1VAGA 1ZVIA 5ADMA 4UGQA 4UGHA 4CTPA 3NSEA 1JWJA 1M8EA 5G0PA 4UGNA 4V3UA 3E6NA 4UGUA 1M00A 4D3KA 1QW6A 3N67A 2ORPA 3EBFA 4KCJA 1DM8A 2G6LA 2G6HA 3NLXA 3NLYA 9NSEA 3UFUA 5AGPA 4D3VA 2NSIA 3E7SB 3NM0A 1P6IA 5G6AA 4UPQA 4CTQA 3FC5A 4D3UA 1DWVA 4UPTA 3TYNA 5ADFA 2OROA 1P6HA 3UFWA 4FVXA 4UG5A 5G6JA 3JX2A 3N6CA 5G69A 4K5KA 3JX0A 4UH0A 1DM7A 1D0CA 3E7SA 4EUXA 5G68A 4D3MA 4JSMA 3SVQA 3Q9AA 4D1PA 4CFTA 3N5ZA 1M9TA 5FJ2A 3JX3A 4D39A 4CU1B 3RQLA 5FVPA 2G6OA 3UFTA 3JT9A 4UG7A 4CTZA 4CX1A 4UG9A 4GQEA 3E7IA 1P6JA 4CU1A 5FVOA 3JWYA 4UPRA 4C39A 1NODA 4K5DA 3N6DA 1RS8A 1VAFA 4IMUA 1MMVA 1M7ZA 3HSPA 5AD7A 1ZZSA 4IMXA 4CVGA 5G6DA 4D33A 5FVSA 3N6BA 2NOSA 5AGLA 4CULA 3NLWA 3N5SA 5G6CA 4D7OA 1DWXA 4JSIA 3JX4A 1M8DA 5AD5A 5G6GA 3JT3A 4UH5A 1NOCA 3E67A 4V3XA 4CTYA 1P6NA 1MMWA 2NODA 4CAQA 5AGNA 3NLQA 4CX5A 4CUMA 5G0NA 3NLMA 3N5VA 3EJ8A 4LWBA 3N5TA 4D3OA 5FVUA 1D1WA 4UH3A 3RQMA 4UGZA 4UH7A 5AD6A 3JX1A 5G67A 2FBZX 4UGYA 3TYLA 4FW0A 3JT6A 4KCLA 4NOSA 3PNHA 5AGMA 2Y37A 5AGKA 4D7HA 4V3VA 3NLFA 4CWZA 3EAIA 4UGSA 3RQKA 4UGFA 4FVWA 4LWAA 3JT5A 4UGBA 3N68A 3JWVA 2G6JA 3N6AA 1I83A 3NODA 5ADGA 4K5GA 4D35A 4CFTB 2G6IA 3B3OA 4CTVA 3NNYA 5G6NA 3JX5A 4CX0A 1LZXA 1NOSA 2ORRA 3DWJA 3UFRA 5ADLA 4UH1A 1QW4A 4CX3A 1RS9A 5AD8A 4KCHA 1NSEA 5FVQA 5G6PA 4UGOA 4NSEA 4UGPA 3PNEA 1K2RA 4UGJA 3NLHA 3NLIA 4K5JA 4CX4A 4UPSA 3UFPA 4CX2A 3RQNA 4JSEA 5G6IA 4D30A 4CWVA 4UGVA 5FVXA 4D36A 4UGLA 4D1NA 5ADDA 4UPOA 4K5EA 4IMSA 3B3NA 4FVZA 4UPMA 1Q2OA 1ED4A 3JT7A 3E6OA 5G6MA 1FOJA 5G6FA 2FLQA 4IMTA 4V3ZA 7NSEA 1LZZA 5FVTA 4JSLA 3DQSA 2NSEA 3JX6A 4UGEA 4UGCA 4D7JA 2HX4A 4KCKA 4UH4A 3E7TA 3N5QA 4D3IA 1ED6A 5ADKA 3EAHA 3PNGA 5ADJA 3JWZA 3TYOA 4CUNA 1N2NA 1D1XA 3JWXA 3RQJA 4CX6A 4UQSA 2ORSA 3JT8A 4CANA 2G6NA 1DMJA 3N6FA 4V3WA 3JT4A 4JSKA 3JWSA 3N64A 5FVZA 4KCPA 5ADEA 5FVYA 4LUWA 4D3BA 4CTTA 4UG8A 4JS9A 4UPPA 4K5IA 3N5XA 5FVRA 3N65A 1RS7A 3E7GA 4CWWA 3N62A 4V3YA 5ADNA 3NLVA 4UHAA 1RS6A 3SVPA 4D32A 1JWKA
chains in the Genus database with same CATH topology
1ED5A 3N66A 1DMIA 5G66A 5FVVA 4UH8A 2BHJA 5G6EA 4UH9A 5FW0A 3RQPA 2FC2A 3B3MA 4UQRA 1M9QA 1OM4A 3E68A 5ADBA 1K2TA 3N6EA 4IMWA 3E7MA 4KCOA 4JSJA 2FC1A 1DWWA 1DF1A 3DQRA 3N63A 1FOOA 5G65A 4CTRA 1P6MA 5ADAA 4CWXA 4CAPA 3DQTA 2HX3A 3NOSA 3N5WA 5NSEA 2AMOA 4UH6A 5AGOA 3NW2A 5ADCA 3UFSA 3NLTA 4UCHA 4JSFA 4KCIA 1ZZTA 4D2YA 4CX7A 4FVYA 5G6QA 1R35A 4CAOA 4CDTA 3NLZA 8NSEA 2AN0A 3UFQA 3NLKA 4CTWA 3N5RA 3NLJA 4JSGA 1ZZQA 4D37A 1FOLA 2ORQA 3N2RA 3RQOA 3Q99A 1M7VA 3N5PA 3E6LA 1K2SA 3NLRA 5FJ3A 4KCMA 4UGIA 5G6HA 3NLDA 4KCNA 3E6TA 2AN2A 3HSNA 4UG6A 5AD4A 4D3TA 4CAMA 4UGWA 1M8IA 3NNZA 3JWWA 3EBDA 4UGAA 3NLGA 4UGKA 4CARA 4D34A 1M9MA 5G6OA 3N61A 1ZVLA 3N6GA 3NQSA 4UGXA 5FVWA 1QOMA 3NLOA 4D2ZA 5AD9A 3TYMA 3UFOA 3UFVA 3B3PA 1M9KA 5ADIA 4D1OA 1D1VA 4UGRA 4KCRA 4CWYA 2HX2A 1DMKA 1QW5A 2G6MA 5G6LA 4KCQA 4D3AA 4KCSA 4D7IA 4K5FA 5G0OA 1ZZUA 4D3JA 1QWCA 4UGDA 4UH2A 5G6BA 4JSHA 4K5HA 4C3AA 4CU0A 1DD7A 1MJTA 4D38A 4UGGA 3NLNA 1OM5A 3NLUA 1FOPA 1M9JA 3JWTA 1FOIA 2ORTA 4D3NA 5G6KA 3N5YA 1P6LA 3NLPA 3PNFA 3HSOA 3JTAA 3N69A 1M8HA 1P6KA 2G6KA 4D31A 3JWUA 4CTUA 6NSEA 1ZZRA 4UGTA 1D1YA 3NLEA 4UGMA 1D0OA 4CTXA 3N60A 1DM6A 1K2UA 1M9RA 1NSIA 4LUXA 4UPNA 3E65A 1VAGA 1ZVIA 5ADMA 4UGQA 4UGHA 4CTPA 3NSEA 1JWJA 1M8EA 5G0PA 4UGNA 4V3UA 3E6NA 4UGUA 1M00A 4D3KA 1QW6A 3N67A 2ORPA 3EBFA 4KCJA 1DM8A 2G6LA 2G6HA 3NLXA 3NLYA 9NSEA 3UFUA 5AGPA 4D3VA 2NSIA 3E7SB 3NM0A 1P6IA 5G6AA 4UPQA 4CTQA 3FC5A 4D3UA 1DWVA 4UPTA 3TYNA 5ADFA 2OROA 1P6HA 3UFWA 4FVXA 4UG5A 5G6JA 3JX2A 3N6CA 5G69A 4K5KA 3JX0A 4UH0A 1DM7A 1D0CA 3E7SA 4EUXA 5G68A 4D3MA 4JSMA 3SVQA 3Q9AA 4D1PA 4CFTA 3N5ZA 1M9TA 5FJ2A 3JX3A 4D39A 4CU1B 3RQLA 5FVPA 2G6OA 3UFTA 3JT9A 4UG7A 4CTZA 4CX1A 4UG9A 4GQEA 3E7IA 1P6JA 4CU1A 5FVOA 3JWYA 4UPRA 4C39A 1NODA 4K5DA 3N6DA 1RS8A 1VAFA 4IMUA 1MMVA 1M7ZA 3HSPA 5AD7A 1ZZSA 4IMXA 4CVGA 5G6DA 4D33A 5FVSA 3N6BA 2NOSA 5AGLA 4CULA 3NLWA 3N5SA 5G6CA 4D7OA 1DWXA 4JSIA 3JX4A 1M8DA 5AD5A 5G6GA 3JT3A 4UH5A 1NOCA 3E67A 4V3XA 4CTYA 1P6NA 1MMWA 2NODA 4CAQA 5AGNA 3NLQA 4CX5A 4CUMA 5G0NA 3NLMA 3N5VA 3EJ8A 4LWBA 3N5TA 4D3OA 5FVUA 1D1WA 4UH3A 3RQMA 4UGZA 4UH7A 5AD6A 3JX1A 5G67A 2FBZX 4UGYA 3TYLA 4FW0A 3JT6A 4KCLA 4NOSA 3PNHA 5AGMA 2Y37A 5AGKA 4D7HA 4V3VA 3NLFA 4CWZA 3EAIA 4UGSA 3RQKA 4UGFA 4FVWA 4LWAA 3JT5A 4UGBA 3N68A 3JWVA 2G6JA 3N6AA 1I83A 3NODA 5ADGA 4K5GA 4D35A 4CFTB 2G6IA 3B3OA 4CTVA 3NNYA 5G6NA 3JX5A 4CX0A 1LZXA 1NOSA 2ORRA 3DWJA 3UFRA 5ADLA 4UH1A 1QW4A 4CX3A 1RS9A 5AD8A 4KCHA 1NSEA 5FVQA 5G6PA 4UGOA 4NSEA 4UGPA 3PNEA 1K2RA 4UGJA 3NLHA 3NLIA 4K5JA 4CX4A 4UPSA 3UFPA 4CX2A 3RQNA 4JSEA 5G6IA 4D30A 4CWVA 4UGVA 5FVXA 4D36A 4UGLA 4D1NA 5ADDA 4UPOA 4K5EA 4IMSA 3B3NA 4FVZA 4UPMA 1Q2OA 1ED4A 3JT7A 3E6OA 5G6MA 1FOJA 5G6FA 2FLQA 4IMTA 4V3ZA 7NSEA 1LZZA 5FVTA 4JSLA 3DQSA 2NSEA 3JX6A 4UGEA 4UGCA 4D7JA 2HX4A 4KCKA 4UH4A 3E7TA 3N5QA 4D3IA 1ED6A 5ADKA 3EAHA 3PNGA 5ADJA 3JWZA 3TYOA 4CUNA 1N2NA 1D1XA 3JWXA 3RQJA 4CX6A 4UQSA 2ORSA 3JT8A 4CANA 2G6NA 1DMJA 3N6FA 4V3WA 3JT4A 4JSKA 3JWSA 3N64A 5FVZA 4KCPA 5ADEA 5FVYA 4LUWA 4D3BA 4CTTA 4UG8A 4JS9A 4UPPA 4K5IA 3N5XA 5FVRA 3N65A 1RS7A 3E7GA 4CWWA 3N62A 4V3YA 5ADNA 3NLVA 4UHAA 1RS6A 3SVPA 4D32A 1JWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ED5 A;  3N66 A;  1DMI A;  5G66 A;  5FVV A;  4UH8 A;  2BHJ A;  5G6E A;  4UH9 A;  5FW0 A;  3RQP A;  2FC2 A;  3B3M A;  4UQR A;  1M9Q A;  1OM4 A;  3E68 A;  5ADB A;  1K2T A;  3N6E A;  4IMW A;  3E7M A;  4KCO A;  4JSJ A;  2FC1 A;  1DWW A;  1DF1 A;  3DQR A;  3N63 A;  1FOO A;  5G65 A;  4CTR A;  1P6M A;  5ADA A;  4CWX A;  4CAP A;  3DQT A;  2HX3 A;  3NOS A;  3N5W A;  5NSE A;  2AMO A;  4UH6 A;  5AGO A;  3NW2 A;  5ADC A;  3UFS A;  3NLT A;  4UCH A;  4JSF A;  4KCI A;  1ZZT A;  4D2Y A;  4CX7 A;  4FVY A;  5G6Q A;  1R35 A;  4CAO A;  4CDT A;  3NLZ A;  8NSE A;  2AN0 A;  3UFQ A;  3NLK A;  4CTW A;  3N5R A;  3NLJ A;  4JSG A;  1ZZQ A;  4D37 A;  1FOL A;  2ORQ A;  3N2R A;  3RQO A;  3Q99 A;  1M7V A;  3N5P A;  3E6L A;  1K2S A;  3NLR A;  5FJ3 A;  4KCM A;  4UGI A;  5G6H A;  3NLD A;  4KCN A;  3E6T A;  2AN2 A;  3HSN A;  4UG6 A;  5AD4 A;  4D3T A;  4CAM A;  4UGW A;  1M8I A;  3NNZ A;  3JWW A;  3EBD A;  4UGA A;  3NLG A;  4UGK A;  4CAR A;  4D34 A;  1M9M A;  5G6O A;  3N61 A;  1ZVL A;  3N6G A;  3NQS A;  4UGX A;  5FVW A;  1QOM A;  3NLO A;  4D2Z A;  5AD9 A;  3TYM A;  3UFO A;  3UFV A;  3B3P A;  1M9K A;  5ADI A;  4D1O A;  1D1V A;  4UGR A;  4KCR A;  4CWY A;  2HX2 A;  1DMK A;  1QW5 A;  2G6M A;  5G6L A;  4KCQ A;  4D3A A;  4KCS A;  4D7I A;  4K5F A;  5G0O A;  1ZZU A;  4D3J A;  1QWC A;  4UGD A;  4UH2 A;  5G6B A;  4JSH A;  4K5H A;  4C3A A;  4CU0 A;  1DD7 A;  1MJT A;  4D38 A;  4UGG A;  3NLN A;  1OM5 A;  3NLU A;  1FOP A;  1M9J A;  3JWT A;  1FOI A;  2ORT A;  4D3N A;  5G6K A;  3N5Y A;  1P6L A;  3NLP A;  3PNF A;  3HSO A;  3JTA A;  3N69 A;  1M8H A;  1P6K A;  2G6K A;  4D31 A;  3JWU A;  4CTU A;  6NSE A;  1ZZR A;  4UGT A;  1D1Y A;  3NLE A;  4UGM A;  1D0O A;  4CTX A;  3N60 A;  1DM6 A;  1K2U A;  1M9R A;  1NSI A;  4LUX A;  4UPN A;  3E65 A;  1VAG A;  1ZVI A;  5ADM A;  4UGQ A;  4UGH A;  4CTP A;  3NSE A;  1JWJ A;  1M8E A;  5G0P A;  4UGN A;  4V3U A;  3E6N A;  4UGU A;  1M00 A;  4D3K A;  1QW6 A;  3N67 A;  2ORP A;  3EBF A;  4KCJ A;  1DM8 A;  2G6L A;  2G6H A;  3NLX A;  3NLY A;  9NSE A;  3UFU A;  5AGP A;  4D3V A;  2NSI A;  3E7S B;  3NM0 A;  1P6I A;  5G6A A;  4UPQ A;  4CTQ A;  3FC5 A;  4D3U A;  1DWV A;  4UPT A;  3TYN A;  5ADF A;  2ORO A;  1P6H A;  3UFW A;  4FVX A;  4UG5 A;  5G6J A;  3JX2 A;  3N6C A;  5G69 A;  4K5K A;  3JX0 A;  4UH0 A;  1DM7 A;  1D0C A;  3E7S A;  4EUX A;  5G68 A;  4D3M A;  4JSM A;  3SVQ A;  3Q9A A;  4D1P A;  4CFT A;  3N5Z A;  1M9T A;  5FJ2 A;  3JX3 A;  4D39 A;  4CU1 B;  3RQL A;  5FVP A;  2G6O A;  3UFT A;  3JT9 A;  4UG7 A;  4CTZ A;  4CX1 A;  4UG9 A;  4GQE A;  3E7I A;  1P6J A;  4CU1 A;  5FVO A;  3JWY A;  4UPR A;  4C39 A;  1NOD A;  4K5D A;  3N6D A;  1RS8 A;  1VAF A;  4IMU A;  1MMV A;  1M7Z A;  3HSP A;  5AD7 A;  1ZZS A;  4IMX A;  4CVG A;  5G6D A;  4D33 A;  5FVS A;  3N6B A;  2NOS A;  5AGL A;  4CUL A;  3NLW A;  3N5S A;  5G6C A;  4D7O A;  1DWX A;  4JSI A;  3JX4 A;  1M8D A;  5AD5 A;  5G6G A;  3JT3 A;  4UH5 A;  1NOC A;  3E67 A;  4V3X A;  4CTY A;  1P6N A;  1MMW A;  2NOD A;  4CAQ A;  5AGN A;  3NLQ A;  4CX5 A;  4CUM A;  5G0N A;  3NLM A;  3N5V A;  3EJ8 A;  4LWB A;  3N5T A;  4D3O A;  5FVU A;  1D1W A;  4UH3 A;  3RQM A;  4UGZ A;  4UH7 A;  5AD6 A;  3JX1 A;  5G67 A;  2FBZ X;  4UGY A;  3TYL A;  4FW0 A;  3JT6 A;  4KCL A;  4NOS A;  3PNH A;  5AGM A;  2Y37 A;  5AGK A;  4D7H A;  4V3V A;  3NLF A;  4CWZ A;  3EAI A;  4UGS A;  3RQK A;  4UGF A;  4FVW A;  4LWA A;  3JT5 A;  4UGB A;  3N68 A;  3JWV A;  2G6J A;  3N6A A;  1I83 A;  3NOD A;  5ADG A;  4K5G A;  4D35 A;  4CFT B;  2G6I A;  3B3O A;  4CTV A;  3NNY A;  5G6N A;  3JX5 A;  4CX0 A;  1LZX A;  1NOS A;  2ORR A;  3DWJ A;  3UFR A;  5ADL A;  4UH1 A;  1QW4 A;  4CX3 A;  1RS9 A;  5AD8 A;  4KCH A;  1NSE A;  5FVQ A;  5G6P A;  4UGO A;  4NSE A;  4UGP A;  3PNE A;  1K2R A;  4UGJ A;  3NLH A;  3NLI A;  4K5J A;  4CX4 A;  4UPS A;  3UFP A;  4CX2 A;  3RQN A;  4JSE A;  5G6I A;  4D30 A;  4CWV A;  4UGV A;  5FVX A;  4D36 A;  4UGL A;  4D1N A;  5ADD A;  4UPO A;  4K5E A;  4IMS A;  3B3N A;  4FVZ A;  4UPM A;  1Q2O A;  1ED4 A;  3JT7 A;  3E6O A;  5G6M A;  1FOJ A;  5G6F A;  2FLQ A;  4IMT A;  4V3Z A;  7NSE A;  1LZZ A;  5FVT A;  4JSL A;  3DQS A;  2NSE A;  3JX6 A;  4UGE A;  4UGC A;  4D7J A;  2HX4 A;  4KCK A;  4UH4 A;  3E7T A;  3N5Q A;  4D3I A;  1ED6 A;  5ADK A;  3EAH A;  3PNG A;  5ADJ A;  3JWZ A;  3TYO A;  4CUN A;  1N2N A;  1D1X A;  3JWX A;  3RQJ A;  4CX6 A;  4UQS A;  2ORS A;  3JT8 A;  4CAN A;  2G6N A;  1DMJ A;  3N6F A;  4V3W A;  3JT4 A;  4JSK A;  3JWS A;  3N64 A;  5FVZ A;  4KCP A;  5ADE A;  5FVY A;  4LUW A;  4D3B A;  4CTT A;  4UG8 A;  4JS9 A;  4UPP A;  4K5I A;  3N5X A;  5FVR A;  3N65 A;  1RS7 A;  3E7G A;  4CWW A;  3N62 A;  4V3Y A;  5ADN A;  3NLV A;  4UHA A;  1RS6 A;  3SVP A;  4D32 A;  1JWK A; 
#chains in the Genus database with same CATH topology
 1ED5 A;  3N66 A;  1DMI A;  5G66 A;  5FVV A;  4UH8 A;  2BHJ A;  5G6E A;  4UH9 A;  5FW0 A;  3RQP A;  2FC2 A;  3B3M A;  4UQR A;  1M9Q A;  1OM4 A;  3E68 A;  5ADB A;  1K2T A;  3N6E A;  4IMW A;  3E7M A;  4KCO A;  4JSJ A;  2FC1 A;  1DWW A;  1DF1 A;  3DQR A;  3N63 A;  1FOO A;  5G65 A;  4CTR A;  1P6M A;  5ADA A;  4CWX A;  4CAP A;  3DQT A;  2HX3 A;  3NOS A;  3N5W A;  5NSE A;  2AMO A;  4UH6 A;  5AGO A;  3NW2 A;  5ADC A;  3UFS A;  3NLT A;  4UCH A;  4JSF A;  4KCI A;  1ZZT A;  4D2Y A;  4CX7 A;  4FVY A;  5G6Q A;  1R35 A;  4CAO A;  4CDT A;  3NLZ A;  8NSE A;  2AN0 A;  3UFQ A;  3NLK A;  4CTW A;  3N5R A;  3NLJ A;  4JSG A;  1ZZQ A;  4D37 A;  1FOL A;  2ORQ A;  3N2R A;  3RQO A;  3Q99 A;  1M7V A;  3N5P A;  3E6L A;  1K2S A;  3NLR A;  5FJ3 A;  4KCM A;  4UGI A;  5G6H A;  3NLD A;  4KCN A;  3E6T A;  2AN2 A;  3HSN A;  4UG6 A;  5AD4 A;  4D3T A;  4CAM A;  4UGW A;  1M8I A;  3NNZ A;  3JWW A;  3EBD A;  4UGA A;  3NLG A;  4UGK A;  4CAR A;  4D34 A;  1M9M A;  5G6O A;  3N61 A;  1ZVL A;  3N6G A;  3NQS A;  4UGX A;  5FVW A;  1QOM A;  3NLO A;  4D2Z A;  5AD9 A;  3TYM A;  3UFO A;  3UFV A;  3B3P A;  1M9K A;  5ADI A;  4D1O A;  1D1V A;  4UGR A;  4KCR A;  4CWY A;  2HX2 A;  1DMK A;  1QW5 A;  2G6M A;  5G6L A;  4KCQ A;  4D3A A;  4KCS A;  4D7I A;  4K5F A;  5G0O A;  1ZZU A;  4D3J A;  1QWC A;  4UGD A;  4UH2 A;  5G6B A;  4JSH A;  4K5H A;  4C3A A;  4CU0 A;  1DD7 A;  1MJT A;  4D38 A;  4UGG A;  3NLN A;  1OM5 A;  3NLU A;  1FOP A;  1M9J A;  3JWT A;  1FOI A;  2ORT A;  4D3N A;  5G6K A;  3N5Y A;  1P6L A;  3NLP A;  3PNF A;  3HSO A;  3JTA A;  3N69 A;  1M8H A;  1P6K A;  2G6K A;  4D31 A;  3JWU A;  4CTU A;  6NSE A;  1ZZR A;  4UGT A;  1D1Y A;  3NLE A;  4UGM A;  1D0O A;  4CTX A;  3N60 A;  1DM6 A;  1K2U A;  1M9R A;  1NSI A;  4LUX A;  4UPN A;  3E65 A;  1VAG A;  1ZVI A;  5ADM A;  4UGQ A;  4UGH A;  4CTP A;  3NSE A;  1JWJ A;  1M8E A;  5G0P A;  4UGN A;  4V3U A;  3E6N A;  4UGU A;  1M00 A;  4D3K A;  1QW6 A;  3N67 A;  2ORP A;  3EBF A;  4KCJ A;  1DM8 A;  2G6L A;  2G6H A;  3NLX A;  3NLY A;  9NSE A;  3UFU A;  5AGP A;  4D3V A;  2NSI A;  3E7S B;  3NM0 A;  1P6I A;  5G6A A;  4UPQ A;  4CTQ A;  3FC5 A;  4D3U A;  1DWV A;  4UPT A;  3TYN A;  5ADF A;  2ORO A;  1P6H A;  3UFW A;  4FVX A;  4UG5 A;  5G6J A;  3JX2 A;  3N6C A;  5G69 A;  4K5K A;  3JX0 A;  4UH0 A;  1DM7 A;  1D0C A;  3E7S A;  4EUX A;  5G68 A;  4D3M A;  4JSM A;  3SVQ A;  3Q9A A;  4D1P A;  4CFT A;  3N5Z A;  1M9T A;  5FJ2 A;  3JX3 A;  4D39 A;  4CU1 B;  3RQL A;  5FVP A;  2G6O A;  3UFT A;  3JT9 A;  4UG7 A;  4CTZ A;  4CX1 A;  4UG9 A;  4GQE A;  3E7I A;  1P6J A;  4CU1 A;  5FVO A;  3JWY A;  4UPR A;  4C39 A;  1NOD A;  4K5D A;  3N6D A;  1RS8 A;  1VAF A;  4IMU A;  1MMV A;  1M7Z A;  3HSP A;  5AD7 A;  1ZZS A;  4IMX A;  4CVG A;  5G6D A;  4D33 A;  5FVS A;  3N6B A;  2NOS A;  5AGL A;  4CUL A;  3NLW A;  3N5S A;  5G6C A;  4D7O A;  1DWX A;  4JSI A;  3JX4 A;  1M8D A;  5AD5 A;  5G6G A;  3JT3 A;  4UH5 A;  1NOC A;  3E67 A;  4V3X A;  4CTY A;  1P6N A;  1MMW A;  2NOD A;  4CAQ A;  5AGN A;  3NLQ A;  4CX5 A;  4CUM A;  5G0N A;  3NLM A;  3N5V A;  3EJ8 A;  4LWB A;  3N5T A;  4D3O A;  5FVU A;  1D1W A;  4UH3 A;  3RQM A;  4UGZ A;  4UH7 A;  5AD6 A;  3JX1 A;  5G67 A;  2FBZ X;  4UGY A;  3TYL A;  4FW0 A;  3JT6 A;  4KCL A;  4NOS A;  3PNH A;  5AGM A;  2Y37 A;  5AGK A;  4D7H A;  4V3V A;  3NLF A;  4CWZ A;  3EAI A;  4UGS A;  3RQK A;  4UGF A;  4FVW A;  4LWA A;  3JT5 A;  4UGB A;  3N68 A;  3JWV A;  2G6J A;  3N6A A;  1I83 A;  3NOD A;  5ADG A;  4K5G A;  4D35 A;  4CFT B;  2G6I A;  3B3O A;  4CTV A;  3NNY A;  5G6N A;  3JX5 A;  4CX0 A;  1LZX A;  1NOS A;  2ORR A;  3DWJ A;  3UFR A;  5ADL A;  4UH1 A;  1QW4 A;  4CX3 A;  1RS9 A;  5AD8 A;  4KCH A;  1NSE A;  5FVQ A;  5G6P A;  4UGO A;  4NSE A;  4UGP A;  3PNE A;  1K2R A;  4UGJ A;  3NLH A;  3NLI A;  4K5J A;  4CX4 A;  4UPS A;  3UFP A;  4CX2 A;  3RQN A;  4JSE A;  5G6I A;  4D30 A;  4CWV A;  4UGV A;  5FVX A;  4D36 A;  4UGL A;  4D1N A;  5ADD A;  4UPO A;  4K5E A;  4IMS A;  3B3N A;  4FVZ A;  4UPM A;  1Q2O A;  1ED4 A;  3JT7 A;  3E6O A;  5G6M A;  1FOJ A;  5G6F A;  2FLQ A;  4IMT A;  4V3Z A;  7NSE A;  1LZZ A;  5FVT A;  4JSL A;  3DQS A;  2NSE A;  3JX6 A;  4UGE A;  4UGC A;  4D7J A;  2HX4 A;  4KCK A;  4UH4 A;  3E7T A;  3N5Q A;  4D3I A;  1ED6 A;  5ADK A;  3EAH A;  3PNG A;  5ADJ A;  3JWZ A;  3TYO A;  4CUN A;  1N2N A;  1D1X A;  3JWX A;  3RQJ A;  4CX6 A;  4UQS A;  2ORS A;  3JT8 A;  4CAN A;  2G6N A;  1DMJ A;  3N6F A;  4V3W A;  3JT4 A;  4JSK A;  3JWS A;  3N64 A;  5FVZ A;  4KCP A;  5ADE A;  5FVY A;  4LUW A;  4D3B A;  4CTT A;  4UG8 A;  4JS9 A;  4UPP A;  4K5I A;  3N5X A;  5FVR A;  3N65 A;  1RS7 A;  3E7G A;  4CWW A;  3N62 A;  4V3Y A;  5ADN A;  3NLV A;  4UHA A;  1RS6 A;  3SVP A;  4D32 A;  1JWK A; 
#chains in the Genus database with same CATH homology
 1ED5 A;  3N66 A;  1DMI A;  5G66 A;  5FVV A;  4UH8 A;  2BHJ A;  5G6E A;  4UH9 A;  5FW0 A;  3RQP A;  2FC2 A;  3B3M A;  4UQR A;  1M9Q A;  1OM4 A;  3E68 A;  5ADB A;  1K2T A;  3N6E A;  4IMW A;  3E7M A;  4KCO A;  4JSJ A;  2FC1 A;  1DWW A;  1DF1 A;  3DQR A;  3N63 A;  1FOO A;  5G65 A;  4CTR A;  1P6M A;  5ADA A;  4CWX A;  4CAP A;  3DQT A;  2HX3 A;  3NOS A;  3N5W A;  5NSE A;  2AMO A;  4UH6 A;  5AGO A;  3NW2 A;  5ADC A;  3UFS A;  3NLT A;  4UCH A;  4JSF A;  4KCI A;  1ZZT A;  4D2Y A;  4CX7 A;  4FVY A;  5G6Q A;  1R35 A;  4CAO A;  4CDT A;  3NLZ A;  8NSE A;  2AN0 A;  3UFQ A;  3NLK A;  4CTW A;  3N5R A;  3NLJ A;  4JSG A;  1ZZQ A;  4D37 A;  1FOL A;  2ORQ A;  3N2R A;  3RQO A;  3Q99 A;  1M7V A;  3N5P A;  3E6L A;  1K2S A;  3NLR A;  5FJ3 A;  4KCM A;  4UGI A;  5G6H A;  3NLD A;  4KCN A;  3E6T A;  2AN2 A;  3HSN A;  4UG6 A;  5AD4 A;  4D3T A;  4CAM A;  4UGW A;  1M8I A;  3NNZ A;  3JWW A;  3EBD A;  4UGA A;  3NLG A;  4UGK A;  4CAR A;  4D34 A;  1M9M A;  5G6O A;  3N61 A;  1ZVL A;  3N6G A;  3NQS A;  4UGX A;  5FVW A;  1QOM A;  3NLO A;  4D2Z A;  5AD9 A;  3TYM A;  3UFO A;  3UFV A;  3B3P A;  1M9K A;  5ADI A;  4D1O A;  1D1V A;  4UGR A;  4KCR A;  4CWY A;  2HX2 A;  1DMK A;  1QW5 A;  2G6M A;  5G6L A;  4KCQ A;  4D3A A;  4KCS A;  4D7I A;  4K5F A;  5G0O A;  1ZZU A;  4D3J A;  1QWC A;  4UGD A;  4UH2 A;  5G6B A;  4JSH A;  4K5H A;  4C3A A;  4CU0 A;  1DD7 A;  1MJT A;  4D38 A;  4UGG A;  3NLN A;  1OM5 A;  3NLU A;  1FOP A;  1M9J A;  3JWT A;  1FOI A;  2ORT A;  4D3N A;  5G6K A;  3N5Y A;  1P6L A;  3NLP A;  3PNF A;  3HSO A;  3JTA A;  3N69 A;  1M8H A;  1P6K A;  2G6K A;  4D31 A;  3JWU A;  4CTU A;  6NSE A;  1ZZR A;  4UGT A;  1D1Y A;  3NLE A;  4UGM A;  1D0O A;  4CTX A;  3N60 A;  1DM6 A;  1K2U A;  1M9R A;  1NSI A;  4LUX A;  4UPN A;  3E65 A;  1VAG A;  1ZVI A;  5ADM A;  4UGQ A;  4UGH A;  4CTP A;  3NSE A;  1JWJ A;  1M8E A;  5G0P A;  4UGN A;  4V3U A;  3E6N A;  4UGU A;  1M00 A;  4D3K A;  1QW6 A;  3N67 A;  2ORP A;  3EBF A;  4KCJ A;  1DM8 A;  2G6L A;  2G6H A;  3NLX A;  3NLY A;  9NSE A;  3UFU A;  5AGP A;  4D3V A;  2NSI A;  3E7S B;  3NM0 A;  1P6I A;  5G6A A;  4UPQ A;  4CTQ A;  3FC5 A;  4D3U A;  1DWV A;  4UPT A;  3TYN A;  5ADF A;  2ORO A;  1P6H A;  3UFW A;  4FVX A;  4UG5 A;  5G6J A;  3JX2 A;  3N6C A;  5G69 A;  4K5K A;  3JX0 A;  4UH0 A;  1DM7 A;  1D0C A;  3E7S A;  4EUX A;  5G68 A;  4D3M A;  4JSM A;  3SVQ A;  3Q9A A;  4D1P A;  4CFT A;  3N5Z A;  1M9T A;  5FJ2 A;  3JX3 A;  4D39 A;  4CU1 B;  3RQL A;  5FVP A;  2G6O A;  3UFT A;  3JT9 A;  4UG7 A;  4CTZ A;  4CX1 A;  4UG9 A;  4GQE A;  3E7I A;  1P6J A;  4CU1 A;  5FVO A;  3JWY A;  4UPR A;  4C39 A;  1NOD A;  4K5D A;  3N6D A;  1RS8 A;  1VAF A;  4IMU A;  1MMV A;  1M7Z A;  3HSP A;  5AD7 A;  1ZZS A;  4IMX A;  4CVG A;  5G6D A;  4D33 A;  5FVS A;  3N6B A;  2NOS A;  5AGL A;  4CUL A;  3NLW A;  3N5S A;  5G6C A;  4D7O A;  1DWX A;  4JSI A;  3JX4 A;  1M8D A;  5AD5 A;  5G6G A;  3JT3 A;  4UH5 A;  1NOC A;  3E67 A;  4V3X A;  4CTY A;  1P6N A;  1MMW A;  2NOD A;  4CAQ A;  5AGN A;  3NLQ A;  4CX5 A;  4CUM A;  5G0N A;  3NLM A;  3N5V A;  3EJ8 A;  4LWB A;  3N5T A;  4D3O A;  5FVU A;  1D1W A;  4UH3 A;  3RQM A;  4UGZ A;  4UH7 A;  5AD6 A;  3JX1 A;  5G67 A;  2FBZ X;  4UGY A;  3TYL A;  4FW0 A;  3JT6 A;  4KCL A;  4NOS A;  3PNH A;  5AGM A;  2Y37 A;  5AGK A;  4D7H A;  4V3V A;  3NLF A;  4CWZ A;  3EAI A;  4UGS A;  3RQK A;  4UGF A;  4FVW A;  4LWA A;  3JT5 A;  4UGB A;  3N68 A;  3JWV A;  2G6J A;  3N6A A;  1I83 A;  3NOD A;  5ADG A;  4K5G A;  4D35 A;  4CFT B;  2G6I A;  3B3O A;  4CTV A;  3NNY A;  5G6N A;  3JX5 A;  4CX0 A;  1LZX A;  1NOS A;  2ORR A;  3DWJ A;  3UFR A;  5ADL A;  4UH1 A;  1QW4 A;  4CX3 A;  1RS9 A;  5AD8 A;  4KCH A;  1NSE A;  5FVQ A;  5G6P A;  4UGO A;  4NSE A;  4UGP A;  3PNE A;  1K2R A;  4UGJ A;  3NLH A;  3NLI A;  4K5J A;  4CX4 A;  4UPS A;  3UFP A;  4CX2 A;  3RQN A;  4JSE A;  5G6I A;  4D30 A;  4CWV A;  4UGV A;  5FVX A;  4D36 A;  4UGL A;  4D1N A;  5ADD A;  4UPO A;  4K5E A;  4IMS A;  3B3N A;  4FVZ A;  4UPM A;  1Q2O A;  1ED4 A;  3JT7 A;  3E6O A;  5G6M A;  1FOJ A;  5G6F A;  2FLQ A;  4IMT A;  4V3Z A;  7NSE A;  1LZZ A;  5FVT A;  4JSL A;  3DQS A;  2NSE A;  3JX6 A;  4UGE A;  4UGC A;  4D7J A;  2HX4 A;  4KCK A;  4UH4 A;  3E7T A;  3N5Q A;  4D3I A;  1ED6 A;  5ADK A;  3EAH A;  3PNG A;  5ADJ A;  3JWZ A;  3TYO A;  4CUN A;  1N2N A;  1D1X A;  3JWX A;  3RQJ A;  4CX6 A;  4UQS A;  2ORS A;  3JT8 A;  4CAN A;  2G6N A;  1DMJ A;  3N6F A;  4V3W A;  3JT4 A;  4JSK A;  3JWS A;  3N64 A;  5FVZ A;  4KCP A;  5ADE A;  5FVY A;  4LUW A;  4D3B A;  4CTT A;  4UG8 A;  4JS9 A;  4UPP A;  4K5I A;  3N5X A;  5FVR A;  3N65 A;  1RS7 A;  3E7G A;  4CWW A;  3N62 A;  4V3Y A;  5ADN A;  3NLV A;  4UHA A;  1RS6 A;  3SVP A;  4D32 A;  1JWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...