4UHBA

Laboratory evolved variant r-c1 of potato epoxide hydrolase steh1
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
321
structure length
321
Chain Sequence
KKIEHKMVAVNGLNMHLAELGEGPTILFIHGFPELWYSWRHQMVYLAERGYRAVAPDLRGYGDTTGAPLNDPSKFSILHLVGDVVALLEAIAPNEEKVFVVAHDWGALIAWHLCLFRPDKVKALVNLSVHFSKRNPKMNKVEGLKAIYGEDHYVSRFQVPGEIEAEFAPIGAKSVLKKILTYRDPAPFYFPKGKGLEAIPDAPVALSSWLSEEELDYYANKFEQTGFTGAVNYYRALPINWELTAPWTGAQVKVPTKFIVGEFDLVYHIPGAKEYIHNGGFKKDVPLLEEVVVLEGAAHFVSQERPHEISKHIYDFIQKFT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords EPOXIDE HYDROLASE
publication title Laboratory Evolved Enzymes Provide Snapshots of the Development of Enantioconvergence in Enzyme-Catalyzed Epoxide Hydrolysis.
pubmed doi rcsb
source organism Solanum tuberosum
total genus 118
structure length 321
sequence length 321
chains with identical sequence B
ec nomenclature ec 3.3.2.3: Transferred entry: 3.3.2.9 and 3.3.2.10.
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhbA00
4Y2SA 3R3WA 4AX4A 2CMFA 2QVBA 3DOIA 4FWBA 3FCXA 3RLIA 4J7AA 1QLWA 1QTIA 1LPPA 4NVRA 2AJBA 5IVIA 3BF7A 3JYHA 3BE8A 4B85A 2X5XA 4FHZA 5JAOA 2B20A 1UWCA 2XUPA 1BEZA 3YASA 5CBKA 4PSCA 4AZ0A 4G4IA 4BE4A 2WHPA 4UFPA 1VJ5A 2OG1A 3DNMA 3MGAA 2VJDA 2RHTA 4XVCA 1UKAA 1EINA 5CH5A 3W04A 1QIJA 1R3DA 4CIBA 4PW0A 3H1AA 2WM2A 3ZPXA 1TCCA 2Y2VA 3O9MA 2WFMA 3KWJA 4DSZA 1D07A 2JGMA 4PO3X 3R40A 4BDSA 1H22A 1UOQA 5J3JA 1MAAA 1AKNA 1EK1A 5BOVA 3DL4A 1CUBA 4FLEA 2VF2A 2PUHA 3DOHA 1W76A 3I1IA 5EHXA 5CXUA 4G9EA 1R88A 4LYDA 2PM8A 4UHDA 3GA7A 2C7BA 3BJRA 4B84A 4GXNA 3PICA 4IHAA 4X97A 4EUSA 2PSEA 4A23A 2Y6UA 4OB7A 3DL7A 5AKGA 5AP9A 5HKAA 4UBIA 1HL7A 3FVRA 3E0XA 4E11A 4CCYA 4AB1A 3ESAA 5BWBA 1BCSA 3F96A 3M81A 2WHPB 4KYVA 1W4LA 1AMNA 1XZEA 3BL8A 5CRIA 1EDEA 3P2MA 1A8UA 4WDQA 5A7HA 1QIFA 1MPXA 4QDOA 2AJLI 2XE4A 3AINA 5AKJA 5DNWA 1AX9A 4KE9A 3IB3A 1FFDA 1WOMA 5LZ8A 1JKMA 2H9YA 1K5PA 4CFSA 4PSDA 3M82A 3BXPA 3PE6A 1WHTA 4H7IA 4AO6A 2ZJ7A 2JIDA 3BDVA 2YYSA 3T4UA 1XQWA 5E4JA 4Q3KA 1LLFA 4DMKA 4P08A 5ALMA 4UHHA 4X93A 3WL7A 3BIWA 3TJMA 2DQZA 2HRRA 3IIIA 5YASA 2Z5GA 4U2EA 4WY5A 4OU5A 5CT6A 5AI4A 4HS9A 1I6WA 2DCMA 3RK4A 4OYLA 4BVKA 1MTZA 2IX9A 3WKEA 1HQDA 3I2HA 4CCYB 2OPHA 4QEKA 2QTBA 4QDTA 4QWMA 3BIXA 1CUYA 3VDXA 4FLFA 4FTWA 5CH8A 3ZV7A 2K2QB 2Z8XA 4G8CA 4L3WA 4KAAA 2RONA 3QITA 1TCAA 1THTA 4BC0A 5AM0A 5ALVA 1ZD4A 5JALA 2HA5A 4H7KA 1DX6A 1MNAA 2WG0A 4LHEA 4N5HX 4K2AA 5IVHA 2CZQA 3HJUA 1YSCA 4F21A 2O7VA 1G5FA 4X6YA 1H2XA 3FWHA 1WB4A 5C8XA 3E4DA 4DNPA 5AM5A 2C5GA 2WKWA 5DLPA 3WIOA 1Y37A 1GQRA 3M3DA 2ZYSA 4B80A 4DLNA 5JD4A 5EHQA 5AI6A 5ESRA 4LXHA 3C70A 4MQMA 4OD0A 2JEZA 3HC7A 1DWPA 1VXOA 5HFNA 4MWTA 2X8BA 1XLVA 1WB5A 4U2DA 1UKBA 2QZPA 3WLAA 2G63A 3L1JA 3EQ7A 4AMYA 1VE6A 4Q82A 1FJ2A 5ALIA 1E8DA 3G9XA 5JIBA 4YASA 1QIMA 2WUDA 2XQJA 4YK7A 2G5PA 3LIIA 4N8DA 1JMYA 1HBJA 1WPXA 4HZGA 2PU7A 3VISA 2EDCA 3RARA 3C8HA 1DT3A 4CG1A 4Y2UA 3D2BA 5AI8A 4OYYA 3WA6A 1XZLA 3SK0A 3WK7A 3I1YA 1U4NA 5D3ZA 4L0CA 1VA4A 4GBGA 5AOBA 1HPLA 3C5WP 4NMWA 2VT7A 2W6CX 4TGLA 1GKKA 3HXKA 2NW6A 1ZD2P 3WI7A 1Q0RA 3B3QA 4J0DA 1G42A 3G0GA 4J0JA 4GECA 3U1TA 1SCIA 4GDMA 5CURA 3W9BA 1J2EA 2BKLA 5E4TA 4UBOA 2XMSA 3OTQA 3STVA 2RHWA 4C4XA 2XQKA 5AI0A 2WUGA 4OB8A 2Z3WA 2GZRA 4KEAA 5FPQA 4N8EA 4IH1A 3IUQA 1BRTA 3AFIA 3WKBA 3KWFA 4I3FA 4RE5A 2C0QA 1SC9A 4GWLA 4M0FA 3PUHA 1TK3A 2ACEA 4EZIA 1WPRA 3V1LA 1GKLA 1VKHA 3WWPA 5I9IA 4PNZA 2C5FA 4EY8A 2QMQA 2DFPA 4BYMA 4BRSA 1EI9A 2HA7A 4K6GA 1AURA 5AOAA 1TIBA 2BUCA 3WL6A 1CV2A 1QIEA 3C5VA 3DS8A 4I4CA 5AKIA 1B41A 2XMCA 5DTJA 4UBMA 4KAFA 5H3HA 3WWCA 4UHEA 4C4YA 1CUIA 5AIBA 2XLBA 4S0XA 1XZBA 5T4BA 5AM2A 3STXA 2QJRA 5EIEA 4J0IA 3V1NA 1XZKA 3WK4A 4Y2PA 2QUAA 5ALDA 3PF9A 5IKXA 2PSFA 2GYUA 4KRYA 1GXSA 2ZYHA 4K6KA 2XUJA 1XRNA 1XZGA 2XUFA 3FLBA 1L7RA 4MEAA 1EVEA 4ZGBA 1DQYA 3IA2A 3FAKA 4A16A 1ZGBA 4JUIA 2WJ4A 5AM3A 4EY6A 3W2TA 5JASA 3WA7A 3EBLA 5HK9A 5DNUA 3GZJA 1E66A 1LPSA 1DX4A 3D0KA 2WIKA 3FLEA 3R3VA 1N5MA 2AJCA 2OGZA 2WJ3A 2HHAA 4EA6A 3CN9A 2O7RA 4DTCA 1XZMA 1BE0A 5LYYA 3BF8A 2DHEA 1X2EA 4B9AA 5I7UA 5ALGA 2PL5A 1JI3A 1BS9A 1USWA 4J0HA 4X3CA 3A70A 3N0TA 4BVLA 2PSJA 2AJDA 3UUEA 3I2JA 4YPVA 1SCKA 2QS9A 1LZKA 5ALQA 2QM0A 4QA9A 3VJMA 5AI9A 1OXMA 2I78A 3H04A 4DNQA 2WSLA 3V1KA 4AO8A 2RIPA 4UFNA 2V97A 1XKLA 1IZ8A 3FNBA 4W1RA 5EFZA 3PFBA 5ALHA 2GYVA 3FYUA 3DKKA 1XRRA 2HFKA 4HTAA 4CI9A 3HACA 2Z3ZA 4UHFA 2H7XA 4CIAA 4EBBA 3H2KA 4Y2QA 4H77A 4ZWNA 1IVYA 1DWOA 2H7YA 1CUXA 1LPMA 4Y2RA 3WMRA 5HCUA 1QONA 4ZV7A 2XUQA 1DQZA 1XZAA 5K3AA 1X2BA 5FRDA 2WFZA 4FNMA 3IULA 3H1BA 4H7HA 1JU3A 3HABA 3DYVA 4G1FA 2HA4A 1M33A 5AICA 4FNGA 3MUNA 5ALTA 1LPNA 4U2BA 1QJ4A 1QE3A 2XMRA 2XQIA 3WL5A 3WKDA 4FMPA 3S8YA 3CCBA 1QIDA 5AO9A 1EXWA 4UHBA 2XB6A 4DSAA 1R4ZA 4LXGA 1AUOA 1XRLA 4FBLA 1UK7A 2JGKA 2ZSIA 3ESDA 1MJ5A 1XROA 3VVLA 5CT5A 3B5EA 1N1MA 4BAZA 1UK6A 2I03A 5IVKA 4Y2VA 2BGRA 3WYNA 1SOMA 3I6ZA 5ALEA 5SYMA 2V98A 1Q84A 2B4KA 5AJHA 4JNCA 5AH0A 3TRDA 3AIMA 4X90A 4X6XA 3BWXA 1CUWA 3G0BA 1ZJ4A 1NU6A 1EX9A 5FUMA 1BEEA 4BP9A 4U2GA 1B6GA 3FYUB 4ZRDA 2JBWA 3FYUC 4BCBA 3D4LA 3H2IA 4H7DA 3AIKA 4RE6A 3A2NA 1VOTA 2QOEA 5K5EA 4PV7A 4TPKA 5HZGA 5HQ3A 3LP5A 3A2LA 3T52A 3ANSA 4DIUA 4EY4A 2BAGA 4KRXA 3GUUA 4X91A 1ORWA 1JFRA 3LLCA 1G4HA 1XLWA 5AI5A 1CUZA 3G9ZA 2CB9A 1E89A 3ZLTA 1ACLA 5AHXA 2WTMA 2WG2A 4DMCA 1XQYA 4BTLA 1UOOA 1YASA 4UPDA 1VLQA 5LIPA 2PKYX 4QWWA 2VAXA 4DNOA 4ZV9A 1E8MA 2GBGA 1AQLA 1W6RA 5LP1A 1UZAA 5EHNA 1A8SA 2HU7A 4Y7DA 2PUJA 1JJIA 3NGMA 3DKRA 5K3DA 2WUEA 2DR0A 1YB6A 3IDAA 1EHYA 3OG9A 5C8VA 1J07A 1THGA 1EK2A 3CN7A 5ALKA 1HKHA 2XQGA 3KDAA 4Y2TA 1T2NA 5LZ2A 1XZCA 4DYHA 3M83A 1CUEA 5HQ3B 4Q3OA 1AZWA 5D7BA 4QDZA 4Q34A 5AKKA 1RP1A 4PSUA 2ZSHA 2WLSA 1CLEA 1EDDA 5LKRA 1TAHA 3QYJA 1XKTA 4P9NA 2I3ZA 1EA5A 3IBTA 1MT3A 3NOXA 4H7JA 3I2FA 1YA4A 2IIVA 2XI4A 1AGYA 1YAJA 5AKHA 3N2ZB 4BDTA 5DTIA 3VKFA 5CT8A 4BTVA 3G02A 5T4FA 1QOZA 2EEPA 4WFKA 1RWQA 4KE7A 3V9AA 4MWSA 5ALLA 3QPCA 4E14A 3I28A 5ALOA 1T4MA 1Z68A 4QE3A 3AJAA 5A62A 1R9MA 3L1IA 4ZI5A 1ODTC 4DMFA 1XRMA 1H2YA 3OOSA 3F9CA 4V2IA 5EI5A 1DU4A 3D2AA 4BAUA 5EIHA 4G4JA 3BDIA 5EHZA 5JANA 5DYWA 3H2HA 1HLGA 2CEKA 5AOCA 3HI4A 2PSDA 2RAUA 2GBIA 4ARAA 4NZZA 1CQZA 1LZLA 4KR0A 3QVMA 4D9JA 4X92A 1ZI6A 5A71A 1XRQA 2WJ6A 2WTNA 5HF8A 1MNQA 3C6BA 2AJ8A 3IUJA 6YASA 3W06A 3LIPA 4BCCA 2XMZA 1O6FA 4X7BA 2ES4A 5LKAA 4X85A 2WILA 1LNSA 4HAIA 4AO7A 2OAEA 2CBGA 5ALSA 2OCIA 3ESBA 3QH4A 3VJLA 5IVDA 4B83A 3HEAA 2HRQA 1IUPA 4BRZA 4MQLA 3A6ZA 3MVEA 2OCKA 5JAUA 1FFEA 1R1DA 2XMDA 4WFIA 3F8SA 1QIHA 1QO9A 2OXEA 4G8BA 1JMKC 3TEJA 1CUCA 5KWIA 5AIAA 2PX6A 1ZI8A 3R3UA 3FSGA 2ECFA 3KOOA 1QZ3A 4W9RA 5DYTA 4H7FA 2J4CA 4Y2JA 2QR5A 2RGUA 2Y1KA 1QFSA 3FOBA 5K3FA 2AXEA 1MX5A 4HVTA 3DQZA 1BROA 1GGVA 5ALRA 1XQXA 3CXUA 4MYDA 4J0GA 4Z49A 1CR6A 1PFQA 3WL8A 2HA2A 2B9VA 1U8EA 2OGSA 3FSGD 1VE7A 3ZLVA 1GPLA 1J06A 3K6KA 2W22A 3ILSA 3H19A 5BV7A 3DD5A 3R41A 2Z8ZA 1JT2A 2HFJA 2XMGA 3WK6A 3D3NA 3O0DA 5ALYA 2OQIA 5FPPA 2I3DA 4GW3A 5C8ZA 4W63A 2XLCA 4BBZA 1H2WA 2VT6A 1W52X 5BWCA 3D59A 4G8DA 3AIOA 4H35A 4X71A 3WWEA 3UUFA 3SWWA 3AZOA 2OQVA 2XUOA 2BFNA 2PU5A 4OPMA 1CFJA 1N8SA 3F97A 4HXFB 4C88A 3NWOA 2HM7A 2BUAA 4Q3LA 3WKAA 1F0PA 5K3FB 2R8BA 4FKBA 3ESCA 5AKYA 1ACJA 1QIGA 1DWQA 3R3XA 1DINA 3DEAA 1KU0A 4Q1VA 4A5SA 2V96A 3DLTA 2XUHA 3QM1A 3RKSA 1QIIA 2VA9A 4Y2YA 4WJLA 5HKBA 1CPYA 3W05A 5ALJA 1QTRA 2WFLA 2FJPA 1ZGCA 5AK3A 3DYIA 3ANTA 1P0MA 4DMHA 2Y2UA 5ALPA 2O2IA 3WK8A 4TVKA 3KXPA 3K2IA 1IUNA 3L1HA 2D0DA 5JZBA 2JF0A 4KJXA 2PPLA 1VXRA 3UMJA 1DTEA 4U2FA 2J3QA 1XQVA 1SCQA 4E46A 1CUDA 1MN6A 3PI6A 3IUNA 3IVMA 2PVSA 2BGNA 7YASA 5CW2A 1A88A 2WUFA 4Q05A 1CUHA 5AKEA 2QT9A 3Q8WA 3QPDA 3OC0A 5AKXA 3WZLA 3S2ZA 3PUIA 4ZXFA 2XUGA 2FX5A 4FDMA 3D7RA 1EB8A 2JGFA 5CT9A 5KREA 2CKMA 1UFOA 4YX9A 5IH7A 2QJWA 4F0JA 3G9TA 4HXGA 1UKCA 1TCBA 5SYNA 4QLAA 3GFFA 2WIDA 4X95A 5AK5A 4IQ4A 4M0EA 5FXMA 2WFLB 3O4JA 1E5TA 1XFDA 3LS2A 2OGTA 5JD5A 4OB6A 2VAVA 5JARA 1ODSA 1ORVA 3WWDA 4L9AA 4OUKX 3HRHA 3O95A 5FLKA 3E3AA 4JEIA 1G66A 3C8DA 4GLBA 5AKZA 4LIPD 4E15A 4WDRA 5EGNA 4UUQA 5LZ4A 5D6OA 1P0QA 5HF6A 2O2GA 5DJ5A 5KWJA 5ALUA 1CIJA 3OURA 2JGIA 3AUKA 1XZJA 4FBMA 5ALFA 5ALWA 1KU6A 5LLSA 4MEBA 1VZ3A 5ALZA 2FUKA 4EHBA 3OM8A 4J03A 4CCWA 4XIIA 3FYTA 4MYSA 4BAGA 5C7YA 3QMMA 4N8SA 2XUKA 1YS2X 2Y6VA 3GROA 1CRLA 4OU4A 5C81A 1LGYA 4KE8A 4AQDA 1E8NA 4FFWA 4B82A 3WKCA 2UZ0A 4QDUA 4X94A 1GT6A 4P92A 3TGLA 1F8UA 1ISPA 1QFMA 4B7ZA 4BZWA 5JD6A 4XJVA 1OILA 4JYMA 1XZDA 3DCNA 4CG3A 4XX1A 3B12A 4X6UA 5ALNA 2HIHA 3O4HA 3F67A 1VA5A 1EB9A 2B61A 1U65A 4P93A 3I2IA 1C4XA 1GQSA 4DGQA 3DJYA 5D3KA 2E3JA 1R9NA 4OCZA 1ZICA 4UBJA 4BC1A 4BCDA 3VVMA 3C6YA 2HU5A 2VTVA 3G0DA 4WY8A 3R3YA 5AM1A 3E1GA 2HL6A 2D5LA 4IO0A 5K3EA 2ACKA 1Y7IA 1ODCA 4KACA 2XMBA 1XLUA 4C01A 3CCCA 3AZPA 3HZOA 1LPBB 2XUDA 4QLOA 4UBNA 4MXDA 5AM4A 1L7AA 3IURA 3FVTA 2JGEA 1YCDA 3ZLUA 3EQ9A 2DHCA 3WJ2A 1UK8A 3I2KA 3H2JA 1ZIYA 5DNVA 4HRXA 3PF8A 2OCLA 3JWEA 5CTAA 4J0CA 4EY7A 3WZMA 3ED1A 1F0NA 3X3HA 3VXKA 4O08A 5LZ7A 2GBCA 3WJ1A 2HADA 1F6WA 3QMVA 2EDAA 1CUVA 2QRUA 2VATA 3Q0TA 2WU3A 4G4GA 4B81A 2WHRA 1QO7A 3RM3A 5LZ9A 1K4YA 1XRPA 4B0PA 5CXXA 5JATA 2ZYIA 5LZ5A 3FBWA 4F5ZA 4B0OA 4K5QA 4C4ZA 1L7QA 2JGLA 4WCVA 3NUZA 3FLAA 4I19A 3ICWA 5HF9A 1Y7HA 1YB7A 4U2CA 2C58A 1MAHA 3WYDA 5T4HA 1CUSA 1WM1A 4J0KA 3HLKA 2DSNA 5FDFA 1LBSA 4JH0A 4LYEA 1SFRA 3HSSA 1CVLA 5DWDA 2J4FA 4DM7A 1P0IA 3U0VA 2VQ6A 3ICVA 4GI1A 4GHWA 5E2IA 4EY5A 1VZ2A 1K6EA 1K63A 2OCGA 4BATA 5JAHA 4AZ3A 4ROTA 3H0CA 3G8YA 1LBTA 4W1SA 4AXBA 1X70A 1KEZA 3I2GA 5HK8A 5A7FA 1ZJ5A 2H7CA 1XZHA 2ROQA 4WFJA 4ARBA 1NX9A 4QNNA 3EF3A 2VJCA 1ZD3A 2WHQA 3W9UA 2XQFA 3BJMA 2IITA 4KAJA 4HRYA 4UBKA 1DT5A 2HDWA 5A2GA 2CUTA 2GBFA 4J3JA 4EB0A 1HDEA 2G5TA 3EQ8A 3QZUA 3STYA 2YH2A 3WQHA 2BJHA 3G0CA 1WB6A 2GZSA 2WIJA 4C89A 2OLEA 4QZVA 4W1PA 3PFCA 1MX9A 4CG2A 4GEGA 2JEYA 2XUAA 5A6VA 1TRHA 5F4ZA 2QXUA 1A7UA 2DQYA 1PJAA 2XDWA 3WK9A 1N5RA 1S8OA 1YAHA 2XUIA 1BN6A 4BP8A 1IUOA 2ORYA 1U2EA 4H7EA 3WK5A 2HU8A 4Y9SA 3K9BA 4X00A 4UHCA 5T4EA 1RYYA 3JW8A 3KD2A 1O6GA 1BN7A 3G7NA 1EDBA 2Q0XA 3SX4A 3C45A 5CMLA 5ISMA 1YA8A 4LXIA 2C0PA 4C6HA 2J3DA 3O9VA 3SC2A 1CUJA 3HYSA 3G9UA 1GZ7A 4OSEA 5CT4A 1IZ7A 4BB0A 3I6YA 1QIKA 1H23A 5FKJA 4AMZA 1W1IA 2YASA 3ZWQA 3GBSA 1ZD5A 4MJ3A 2R11A 1IMJA 3R0VA 4Y2XA 4F60A 1W75A 2WIGA 5DYYA 4FLMA 1CEXA 1CUGA 2O2HA 4QDXA 2XT0A 3MUOA 1R50A 4K6HA 4IH4A 4ITVA 2BCEA 1MX1A 4RPCA 3AILA 3WIBA 2OAGA 2V9ZA 2H1IA 4FOLA 1Q83A 3F98A 3V48A 1UT6A 4IH9A 1ZI9A 2BUBA 3IUMA 4C87A 1C7JA 2PBLA 1ETHA 2YXPX 1QGED 4XWGA 2XMQA 1BCRA 4BZZA 2LIPA 2C4HA 4RNCA 2G4LA 5CH3A 1FFCA 5JADA 1XZFA 1MO2A 5FOQA 3VJKA 2VSQA 1H2ZA 5FP0A 2QKYA 5I8PA 1MU0A 1UK9A 1K8QA 1ZIXA 3R3ZA 2WG1A 1FSSA 1TKRA 2WU4A 3LCRA 1P0PA 3C6XA 3PDCA 5HFAA 1YS1X 4PF1A 1JJBA 1PV1A 4FFVA 1AC5A 4LKOA 1EH5A 5AK6A 5KBYA 1WCYA 2CJPA 4UBLA 1CQWA 4W1QA 2RI6A 2VJBA 4UFOA 1GPKA 1LPOA 3EIOA 5FV4A 4RGYA 1GPNA 2QXTA 5ALXA 1UXOA 1CUFA 2FJ0A 2ZYRA 2QUBA 4M0MA 4H0CA 3WWOA 1OCEA 4BVJA 4ZREA 4AN1A 1CUAA 4G5XA 3STTA 2ZJ6A 5K3BA 2ZVDA 1XZIA 4G9GA 3OPMA 3H18A 1CUUA 3G0IA 5JAPA 3C43A 3KSRA 1FFAA 5K3CA 4H18A 2VJAA 2X76A 1JU4A 1J1IA 4INZA 5JZ9A 4NS4A 3H17A 3O4GA 2JGJA 2PSHA 3O4IA 4ETWA 3C6ZA 3D5EA 4B6GA 3AZQA 2GYWA 4L72A 2DHDA 3STWA 3C87A 1C7IA 1E3QA 5EIAA 3QMWA 3H2GA 5AKLA 2P8SA 3QBJA 1A8QA 5HF5A 1EVQA 1UOPA 2HA0A 4BE9A 4DNFA 1FFBA 3GELA 1LPAB 1WHSA 5E4YA 1BU8A 2ZJFA 4AN0A 3A2MA 4JYPA 2ONCA 4B9EA 1Q0ZA 3FCYA 2HA3A 2HA6A 4HXEB 5A7GA 1TQHA 1NU8A 5AK4A 2WQZA 5JYCA 5JZSA 4KE6A 3DDUA 1JJFA 3V1MA 2VEOA 1ZOIA 1YR2A 3STUA 3ZI7A 2WIFA 3QPAA 3D2CA 3I6MA 4N5IX 4PQEA
chains in the Genus database with same CATH superfamily
2F59A 3ZWWA 1YMUA 5GPBA 4HB0A 3WSWA 3MJTA 1BA3A 1W19A 3B7GA 3DEFA 2CMFA 3VC3A 5IJXA 2QUHA 5JI3E 1VHTA 1HT2E 2VJYA 2XCIA 1IBCA 3DOIA 3TKAA 4FVTA 4BMOB 4ENSA 1J23A 2A0FA 2B1GA 2W2XA 1DKNA 3FCXA 4FWBA 4OFZA 4YJHB 5DB4A 2UZ1B 2I1LA 1G2IA 4PGMA 4J7AA 3RLIA 1BX1A 3B13B 2RBEA 4GBJA 3ZVMA 2HHJA 1TJNA 2FE4A 1U1DA 1W5AA 4QHTA 3FZEA 3SY8A 3AF3A 3FA2A 2GKGA 5E3HA 1PS8A 3VH1A 1EMDA 4RABA 4TMKA 3T7EA 3R5JA 2BC9A 4PAQA 1MVOA 2XCTB 1H2EA 2C8LA 2AJBA 2FMXA 1JPJA 3N7UA 4CDRA 3BF7A 2Y0CA 1P91A 5ETJA 4ZJPA 2D4HA 3AWIA 3KQOA 1S89A 1ZZEA 3UJBA 3E48A 3ZWXA 3X1YA 3DSRA 4RTMA 4B85A 1ZNQO 2G1KA 3LUHA 1XJ0A 2I4MA 4FE7A 4FHZA 2C04A 2IYUA 4WUVA 1KDOA 1UH5A 3V33A 3ZIAD 4DA6A 3T5AA 5I7SA 1IFXA 2YHUA 3T5GA 3WZ2A 5AFSA 3PDUA 3GG2A 1J21A 4P80A 4JR2A 3EGVA 1ZCBA 1O54A 1O97C 1WCXA 2XUPA 1CG6A 4KG7A 4CIWA 4D92A 3B1JA 3MWFA 3A8TA 3QBTA 4PG8A 4C2BA 1K97A 4BFWA 5KZMB 5I7RA 1C3OA 1L5KA 4MUNA 5CFRA 1N2JA 3P7MA 2EAUA 3T5MA 1A1SA 1N7JA 4LOKA 2DFLA 5DFAA 1KRXA 4G4IA 4BGIA 1WMDA 4FNOA 2X0DA 2ZITA 3FMIA 4LYAA 2AG1A 3GHHA 3ISJA 2VQDA 5EJ9A 5ICEA 3H1GA 3MINA 2ZIEA 1A4RA 5LQMA 1SC6A 3L6RA 4MKRA 2ZAYA 4NOJA 1A27A 4ZU1X 4ALIA 4CR7A 4UFPA 2BR5A 2ODEA 5I7FA 5CA1B 3FRHA 2ZKIA 5E7IA 1X1BA 4RLQA 2YS6A 3AHDA 3W9SA 5F2KA 4XDGA 1F4LA 3OF3A 3C97A 2NO1A 3TL6A 3EDMA 3F3YA 4GX5A 2W9XA 4ESEA 5GTDA 1FTGA 2G67A 1SK8A 3H9GA 4TWJA 4TWRA 3V1UA 1O9GA 1L4FA 2Z4TA 4PRKA 5DIFA 2WD8A 5CH5A 3U44A 3W4KA 3MBKA 5A0FA 3RG2A 1T6XA 2JEOA 1O8BA 2XNSA 4OH1A 4S24A 2PR7A 2IPOA 3OMXA 4F4FA 4S1PA 2V7QA 3AR8A 1ZMTA 2X0JA 5UKDA 1H0KA 2IYZA 4L50A 1DJOA 1GUZA 4KPYA 1FP6A 2V6GA 2EG9A 4JJ4A 3TIXB 3COJA 2WFMA 2H63A 1E1RD 2QD5A 3LBFA 4EKNB 1BU5A 1SXIA 3NFRA 4JIGA 3CBGA 1LRKA 2CDBA 4HDSB 2EKBA 5ECWA 3S1AA 3SFTA 4BQSA 4Z4FA 4RIFA 1Y4SA 1ORTA 1XEWY 2Q0SA 5EP3A 3OX4A 3RYCA 3W2IA 5J3JA 2PS9A 1KDRA 5BSFA 3OM1A 4YAWA 4EW3A 4BEWA 3KEOA 4N82A 2V45A 2Z30A 1CUBA 3EJWA 2QY9A 2VF2A 3PCXA 4NY1A 5F9FA 2PUHA 3DOHA 4BVAA 1U11A 1UBSB 2CMGA 1MO5A 3PKIA 4LZPA 2HC9A 4F93B 5E1OA 3LBYA 1AK9A 2HDNB 4FILA 2BKEA 4D3FA 1HE3A 4FEAA 4QPZA 4E6EA 5KNCH 4G9EA 2O19A 1B1AA 3S5UA 3X2EA 1O5IA 1BKDR 3D3JA 2ZATA 3FOAA 1W36D 1C9KA 3PP8A 1N36B 1CFZA 1P1CA 1M54A 1WXHA 5JZMA 3MMSA 2Z58A 3O1IC 4IYRA 3IJEB 3FETA 3HPRA 1G8JA 1BVRA 1NSYA 4GKBA 4D9FA 2JLWA 3AFHA 2OHIA 4HUJA 1IXSB 4Q19A 3ZE1B 3BSFA 1M34E 1T1JA 4A23A 1GNSA 4F06A 1I36A 2W93A 5AKGA 3MRTA 2GDZA 2VPXA 4GH5A 1E2KA 3SBEA 1C3OB 3M1IA 4AFNA 1ILWA 1JXOA 3ABOB 2BGMA 2RDMA 4CCYA 3S99A 3SQMA 5B6PA 3VI3B 3MSCA 1N5OX 1EDOA 3ZHQA 2JW5A 3MINB 1BCSA 3F96A 4HDQB 2FK8A 2VUSA 3D6FA 1XN1A 4DKXA 5KDOA 2VDNB 1XZEA 3BL8A 2DLCX 3KR1A 5JDIC 3PPYA 3ESXA 5AVYA 1OOEA 1MJNA 1MXHA 4RTJA 2YRWA 1Y89A 3AP1A 1JEYA 3AUYA 4AWAA 4WDQA 3O4RA 4RK5A 4KGVA 4OQ4A 4YJGA 1AJEA 1MPXA 3FPHA 1TFUA 5EMHA 3UENA 1FSFA 2YN0A 4HFJA 4EKYA 2Q29A 5C18A 1Z0FA 1PKEA 5AKJA 2G09A 1E79D 3U44B 4ND1A 4C0HA 3SF0A 2ZUEA 3TSWA 3X2FA 2J0UB 1SHUX 4PR0A 3KLPX 3IB3A 5KNBD 4XI9A 5KVVA 4EA7A 1MQAA 1ZVKA 2ZJ3A 3Q40A 1BVUA 2F1OA 2C5EA 4OHMA 2WWVD 3I0NA 3I3SR 4MTCA 3ST7A 1H5UA 2FF7A 2GN2A 2H9YA 2NO9A 4F11A 4YCAA 1JFSA 4H6WA 2NTVA 5TB5A 4F4JA 2BN4A 4IIJB 3V8NA 3L4KA 3ELBA 3MJ4A 4Q3DA 1J9EA 3M82A 3F6YA 3BXPA 3PE6A 3INGA 3HV2A 1NW9B 2PKRA 5IANA 5K05A 1D1PA 3C3JA 3LY5A 1N5LA 2HMVA 3PFWO 3DTYA 5GMOA 3RYCB 2JDID 3QBEA 3OY2A 5CVDA 4OFBA 2PTHA 2PAFA 2IYOA 1U7PA 2ZJ7A 4INAA 3P0EA 4NNOA 4LRSB 5F3WB 3W6OA 2O8FA 5CCDA 4UAUA 5JAZA 3E5RA 4CMBA 3RASA 1XQWA 3RVLA 3TQRA 2LR0A 2HTEA 4UE6A 1ZBQA 1Q0QA 1EAMA 4FFOA 1I01A 3RSCA 5BUSA 3ZWAA 4P08A 5JCJA 1OZ0A 1O96A 1GNTA 1Y4AE 2A0WA 2XAUA 1TQ8A 4GGMX 4R1LA 4DZRA 3SDZA 3VSDA 2HRRA 3OE7D 4P32A 4QM7A 3N2NA 4QJ3A 5KJEA 4M9SA 1JQKA 4WPGA 1S01A 4RTRA 1J9ZA 3WGHA 1BGXT 1NNEA 1V0JA 2FQYA 3FFAA 2BZ1A 1E2PA 3LC1O 3QMPA 3VR6D 2J9RA 1MJGM 4NV0A 1ONPA 1HDYA 3T4PA 4N3GA 1WKBA 1EJBA 4PHTA 2E4WA 2PX8A 2FPUA 2D1SA 3D0RA 3EPJA 2PCJA 4LJ5A 3WKEA 1HYBA 4CDMA 5IT4A 3AB8A 4O5AA 4EUKA 3I2HA 2OB1A 1KEEB 2A9QA 3RSHA 4JEMA 4CCYB 4BE7B 3GPLA 2QTBA 4X62B 3AJEA 5A02A 4NXNB 5C4MA 1BCSB 2JFXA 5K8JB 3ZHCA 5K2OA 2EFJA 3BIXA 3DAYA 4ZICA 1Z56C 2J9FA 3KU4A 3PHCA 4IYJA 4WNYA 3HUUA 1CR0A 1YA6A 3ZV7A 1WEKA 3TWOA 3LLSA 4RHXA 3GWZA 4EG8A 3L2OB 4L3WA 4KSBA 2GEFA 1RQNA 4YJGB 1J8QA 3QITA 1TCAA 1C8BA 1GNQA 4CM3A 3LZDA 3D64A 4JEUA 3LQFA 1P81A 2HA5A 5JALA 2HJWA 2QRNA 4HX9A 4MVJD 5FBZA 3VU9B 2IYAA 4TLMB 1KHHA 3VOTA 4F46A 4CEJA 1UEIA 4E5MA 5L3ZA 2E37A 4Z0NA 4E22A 3NETA 3LKBA 1Q11A 2B9EA 2CZQA 3O38A 2DTXA 4FONA 2C2OA 4HNHA 4OBXA 4YMSA 2A0XA 3DBIA 3QVLA 5G4KA 4RPLA 1NBOA 1DUVG 2X1LA 2GD2A 1OI4A 3AGQA 4TTTS 4GKJB 3HCCA 4LYHA 3WDMA 1WB4A 2H51A 4YFVA 2DFDA 1T5TA 1VPWA 3K9QO 2QZ9A 5KMGA 3G5AA 1T8RA 3DV2A 4DNPA 1Z3CA 2DUUA 4F91B 5DGXA 4GUDA 1SQFA 1KK1A 4EZBA 3GLUA 5KVSA 2YRXA 5JAIA 2C5GA 4HJXA 1D0VA 4QQ8A 2EX0A 5KYUA 1EEXB 2X3UA 4EQZA 5JSZA 2O8FB 2M6RA 4YECA 2HD4A 3WDSA 1G5IA 2HNAA 1TAUA 3HZHA 3SFVA 3PA8A 2VFAA 2V7PA 4BGUA 4MITA 2OK8A 4X61A 3EIQA 4E88A 1Y9AA 2B1QA 2Q5JA 3N2KA 4LXHA 4R3NA 2I99A 4QOIA 1O96B 3PIDA 3CKKA 4D4LA 1JT9A 1RFLA 1L5VA 3HC7A 1D6NA 2HYDA 4Y18A 3WGGA 2V0CA 1WWKA 3ZBQA 3PRJA 1NXPA 1WKVA 2WT9A 4HQKA 3EOZA 3DOFA 4LY6A 5HFNA 3BMXA 2B2CA 3AR4A 4A73A 4Z7QB 2QTCA 1P6QA 1S8AA 4MWTA 3VR0A 4G81A 3ER8A 2X8BA 2FV8A 5F7ZA 1DBIA 3HCBA 3TEMA 1WB5A 1Z2AA 1P77A 2QAGB 1W581 1UKBA 2DERA 3WLAA 2GNOA 2M1ZA 1RI4A 4RTOA 3NBQA 4G23A 3TJZA 1DSSG 3T1HB 1I30A 4QC2A 4RZHA 3EW7A 3OKPA 4LYYA 4CHGA 2HK6A 1T2AA 4RZSA 5K1ZA 2OWDA 5K0LA 3EQ7A 2QX9A 2A0YA 3ABSB 4XFDA 2GJSA 2O4CA 3M4NA 4KIJA 4AMYA 1VE6A 1YOVA 1DC6A 3TTYA 4ZYUA 4BGVA 4YAUA 2MSLA 4UOEA 1Y98A 3IIJA 1DTSA 1T5DX 2OUIA 3RKRA 2KHZA 3IUEA 3RSGA 2WA2A 4AY4A 3VTAA 1PNRA 2WAOA 3PI7A 4NAUA 1NT4A 4KDRA 3OJXA 4YCLA 1BJKA 1MB3A 1GPUA 3LIIA 3TLJA 3EIHA 4MV3A 2Z2KA 1ZUNA 2GO7A 4ZDKA 1BMQA 1TJ3A 4J49A 1Q12A 4UNNA 4RCYA 4EKGA 1Q0PA 2ECPA 3CGWA 1A72A 3N2YA 3IV6A 1QH0A 2H54A 1SXQA 4FX5A 4RSHA 4GM0A 4EGQA 3GNLA 1GA6A 1JA0A 2EDCA 4CV3A 4LCJA 1GUDA 2RHDA 2OORA 5G4KB 4ZYXA 3OKCA 4NZYA 4CGYA 5I7EA 3C24A 1FZQA 3OTHA 1N5DA 3QVTA 3SK0A 4FXPA 3DKIA 2X9NA 2NG1A 4KTTE 3N59A 4D9BA 2D7JA 3BMNA 3LUJA 4RLHA 3PJDA 1SKYB 1Z6TA 4CE6A 1SQ5A 2H4JA 5GZ6A 2R1UA 3F5SA 2XBMA 3MHPA 2XYQA 1GL3A 3NHBA 5AOBA 5SZJA 1HPLA 3DOUA 4M0CA 4Z4CA 2OYRA 1NYTA 1GQOA 1G3RA 3FBGA 5KMGB 2P6RA 1T0PA 2GMWA 2NU7A 1PHPA 2VT7A 1EP2B 3FPJA 3JSXA 5KYUB 3HO1A 1GKKA 4D6XA 5JSZB 2EQ5A 2NW6A 3AUSA 2YWHA 2ZLBA 4IINA 4OJNA 4ZVTA 4ZMSA 1R8SA 1Z4LA 3HPQA 2OXRA 4XOIA 2C82A 1G42A 2ETVA 3LLMA 4MRAA 4PTLA 1Q0TA 4J0JA 4TMWA 4MGKR 2DM6A 2ZCVA 3OPYA 4US2R 2GCNA 1XAGA 3U1TA 2X41A 3UK1A 3N2KB 3MLBA 1DCFA 3UWPA 5E1MA 1IHXA 3OE4A 1C7ZA 4EKEA 1FNMA 2YR0A 4N9WA 3W9BA 1JFFA 3AW9A 2AD5A 2EIHA 2PL1A 1XR3A 3MD9A 1FFXA 1GG2A 2OYSA 2RGCA 1IXRC 3C3MA 4NS1A 1NXWA 2AKYA 2FDXA 2TECE 1RHKA 3F78A 1M8FA 3H9QA 4RK7A 2HIAA 4YN3A 2Q1UA 1XA4A 3KNZA 3VH2A 1N77A 4O2BF 4OB8A 3ILXA 1COWA 3WWYA 2P9QA 3W6PA 4OK3A 1CZLA 1MBZA 4TKMA 3PIRA 4IH1A 3IUQA 2X13A 3OQBA 4L8LA 4ASUD 1HURA 2AS0A 3EXAA 4D3ZA 1YU9A 3GCZA 1ZNZA 1WXXA 3U7GA 2Y1DA 1X1DA 4S3MA 4H27A 4XM1A 2G4VA 2ILVA 2J30A 2O3UA 2HCTA 3F8WA 3R09A 1JSCA 4GKVA 4IDQA 4QTZA 4U5XA 3TJRA 2V0NA 1SC9A 1TM7E 3AEUA 3IPYA 3IAHA 1C0EA 1WNTA 821PA 1GNRA 2ZRBA 3JQ8A 1GL9B 1NUUA 1WQ1R 1LWNA 4D26A 4HWSA 2HREA 2X3FA 5AJVB 4BN5A 1JIUA 3V1LA 2JAOA 4MIYA 1AU9A 2PUCA 4KOEC 5FI5A 4K9SA 1AD2A 4EY8A 1IBRA 1ZUNB 2YFYA 1A69A 1E69A 2HA7A 1K98A 1GILA 3SBXA 3SVTA 2AA3A 1GR1A 5EJ6A 1SVKA 1ZHOA 4BLTA 3LI2A 1TIBA 3TG2A 2O50A 4UEOA 1PJ8A 4KQCA 2HUNA 4Q9JA 4CL8A 5IJ9A 3LCUA 3JS5A 1QG0A 3W1EA 2D1RA 1JAZA 1H2RS 1U2TA 5BMVA 1SXJA 3WL6A 1VTKA 1G8MA 5CB4A 3DMYA 5L3SA 4FCVA 3ZZNA 2HCBA 4BNFA 1NLUA 4F86A 4QOJA 1QZUA 2XD9A 3SQLA 4YT8A 4OLBA 1ECBA 3U56A 3HUDA 4I4CA 1PL7A 5AKIA 4EHDA 2WYVA 1B41A 1ZDMA 4C7JA 3OPNA 4OBWA 4XARA 4BJ3A 2O8CA 1UOEA 4ZALA 5AUOB 1QDEA 2YV4A 4EHAA 3PQ7A 5KX5A 1GZDA 2NU7B 5EVCA 2VNHA 4KAFA 1V4BA 4NABA 2VTBA 3WWCA 2FZGA 1PZMA 1RSZA 4UHEA 3P52A 1NYLA 5JYBA 1CZOA 2XCRB 1GHTA 1SHKA 4H08A 4LHYA 1KI2A 2G1UA 1CUIA 2QLTA 4MWBA 4ZMRA 3HSKA 3MMPA 1H4TA 2XTZA 4YT2A 2XLBA 1X14A 1IPFA 5AHKA 1E59A 1VKJA 1KNQA 4MP6A 1F51E 4ROSA 3N8NA 5T4BA 3UH1A 1WS6A 3D0OA 4E2ZA 3STXA 2QJRA 3CPJB 4M88A 1XZKA 4Y30A 3QX9A 4Y2PA 4MS4A 5HIIA 1JFFB 1BMFD 2VAWA 3UMBA 2QUAA 5ALDA 4EVRA 4FKMA 3SS7X 5BN3A 1FFXB 3KR9A 4Y6PA 3RK0A 1XAJA 2NYVA 4EG3A 5LP6F 2QAIA 3RK1A 2CJYA 4LJAA 2PSFA 3DDZX 2GYUA 2X6QA 1GXSA 2QEQA 2FETA 1K7YA 1WXWA 3M0EA 4QQRA 2Q4DA 3FYSA 4C3UA 3WY9A 2WW8A 2QRPA 1BGWA 3LFTA 2PRJA 4G0MA 3VKVA 3WDKA 2XUJA 1E2HA 2XUFA 1FE8A 1U7UA 3CUUA 4EF6A 4IW3B 1OA1A 2H08A 3OFSA 4FX2A 1EFHA 3TQOA 2VJLA 4HVAA 2IZ7A 4JLUA 4UCWA 3L77A 4XGRA 4JUIA 2IYLD 5AM3A 3LDAA 3O47A 3EK2A 3FWYA 2REQA 5DNUA 3AEUB 3ZGXA 3U39A 1PFUA 1QHNA 2QNRA 4O3FA 2QTHA 2IFTA 1OBFO 1GKUB 1UP7A 3JQ8B 1DX4A 3KKMA 4WX2B 3OSUA 1Q1BA 3FLEA 1IZZA 4YCDA 3FRIA 4J1SA 2ZAMA 1C3XA 2AJCA 3OEED 4UMVA 5AUNB 4A1OA 2DPXA 4IX9A 1Z8HA 3CNOA 2R8PA 2ZETA 2XITA 1S96A 4HF7A 4B9AA 1L8LA 1EVKA 1M1YE 2GYYA 3M49A 1ST3A 4BDTA 4EHJA 2B82A 2R85A 2F3SA 3M6LA 5IJ9B 1HF3A 1MF7A 3SGLA 5CDTA 5D1HA 2R5NA 5HILA 3N0TA 5BMVB 1SXJB 2CXHA 1GQQA 2LCFA 3EASA 4BVLA 1C7EA 1TF7A 5TVGA 1C9MA 1SAYA 1NUHA 5DKFA 5CB4B 5L3SB 2B98A 2WSSA 1CYEA 3U37A 2ZUBA 4CQMD 1ZIPA 3HR8A 3DV0A 3I2JA 4QU8A 4CKYA 1C1DB 1SGWA 4KFTA 4RFVA 5G1PA 2JVKA 1SNYA 4OP2A 1UEJA 4QASA 2ORVA 3FNRA 4KN6A 4JROA 1RRPA 2UUPA 4ZI2A 3SYTA 2J07A 3DZHA 1O95D 1OYVA 2A94A 4UPVA 1UUFA 1MJGA 3DM9B 2PBZA 3SPXA 1C1XA 1RT9A 4KBYA 5CA0A 4QT4A 1DMSA 1KI1A 3M6IA 1MB0A 1HYQA 1BJTA 2I78A 3RS7A 1TYEB 1HE4A 4RADA 1NW8A 3USCS 4UU7A 4IGKA 4DNQA 2NVBA 4E5UA 3O93A 5A5VA 3OX2A 3VPBA 1WMEA 2ZTVA 4LN1A 4PEVA 4DBZA 4F3TA 1P33A 5FFNA 3DP7A 4M8LA 5CW1A 2RIPA 4EFLA 1II9A 4K40A 4E2FA 3WAJA 1HQYE 2VO1A 3ISTA 3TTSA 4DWVA 4FQ8A 4C06A 3ICEA 2GLTA 2AN5A 4RM2A 4EK9A 5EFZA 1B16A 4MS4B 3KZCA 3I04M 1UDBA 2C29D 4XVRA 1JR3D 1KJWA 1M8PA 1ZAKA 4TM7A 4U0KA 4Z9XA 5J40A 4Z2YA 3WQRA 2FYTA 2OENG 3ZV6A 5BN3B 2RG7A 5JJBA 4RTPA 2ZUSA 1JIJA 1XRRA 3L6OO 2HFKA 3BRWD 4HTAA 1GXSB 3VU3A 1KY2A 3GEIA 4BFCA 2Z5VA 4HH3C 4U63A 3T38A 4OHFA 5B7PA 2V7WA 4B6OA 1POXA 2X8JA 3HM2A 3UK0A 4PYQA 4LBWA 4JSYA 5IXYA 3TTXA 1O7JA 3CIFA 3Q7PA 4R9NA 4EARA 4NBSA 2JGAA 2FN3A 2ET6A 2FN8A 2XRFA 3HGQA 4ZAYA 3ZVRA 1CUXA 1LPMA 2BF7A 2FRDA 2R62A 3MRVA 3PG5A 2PANA 1JSLA 5HCUA 2AIRA 1QONA 3L9XA 1IAQA 2YV3A 1AM4D 2AXNA 2REQB 3T7KA 4RS3A 2ERXA 1DQSA 2W2LA 1J2UA 4EO4A 4PLGA 1UADA 1RIIA 3KOUA 5FRDA 4YWHA 4FNMA 1IYZA 2PZLA 2ZVJA 4EHHA 5HE8A 1JQJC 4I1UA 4I9GA 2AW3A 4PCUA 1R0SA 3H1BA 3ROKA 2AKAB 4OHPA 3VVBA 3HABA 4JR0A 5HFJA 2PGAA 4GOJA 1M5TA 3UAVA 3K09A 5IDWA 1OFUA 3SXJA 3K9LA 3NS7A 5DCUA 1YKSA 3S8EA 2HA4A 1WRBA 2J5XA 1C7FA 2QRJA 1TUGA 5LYJF 2GBLC 2E21A 1LPNA 5IHPA 1D6JA 3HUFA 1TK9A 4Q24A 1J1ZA 4DANA 4CPDA 3EXG2 1QE3A 2ZXEA 5IF3A 3KQLA 1EM6A 1GG5A 1V6CA 1KMQA 4EGFA 4DCUA 3ADOA 4FCTA 4WMLA 4FMPA 3S8YA 3ADPA 3CCBA 1RQ2A 1ZG3A 4KIFA 5AO9A 4ZJYA 4UHBA 2XB6A 3DV0B 3VSAA 5HYVA 3BWYA 3VHLB 3ZDAA 3FGOA 3UMGA 5ITVA 1Z82A 5J2UF 1I4EB 4TS1A 1SG6A 4LE1A 3ELUA 4M49A 3VVLA 1YUBA 3ZTTA 4BMXA 1TIKA 1XV5A 1N1MA 1C1XB 3B5EA 4LQLA 4UCXA 5CA0B 2MMGA 3FCUB 1UK6A 3WJAA 4BVHA 3EGCA 3ORQA 1SUDA 4JVMA 3TDMA 5ABPA 3WISA 3Q12A 4J4BA 4PICA 4XCXA 1J8DA 3WYNA 3WMGA 1C0IA 3V7WA 3EXHA 1PTKA 2ZI3A 3U9LA 3F47A 5ALEA 3QFFA 5CBPA 1T2CA 2QVCA 2WM3A 1PR9A 2KI5A 5JWOA 3M3PA 1WSDA 1YE5A 1PGNA 4YJFA 3JVIA 5C5DA 5JROA 2PGIA 5FUXA 5AJHA 1V8FA 3DVAA 4MCIA 4RH3A 4K6CA 5GONF 1QNLA 2JFZA 1ATIA 2I80A 3BWVA 1CUWA 4QPCA 1ESZA 4G5GA 3LDHA 4KXQA 1TLLA 1FLNA 1ZJZA 5CUQA 1MLDA 3DBHB 2XA1A 3L7MA 4IZHA 3QFSA 2Y27A 1C1HA 1MEJA 2VS1A 4C43A 2W6OA 3OJLA 3PGA1 1ZQ1A 4WGGA 3D4LA 3Q7SA 4H7DA 4NU5A 3U81A 5GIOE 3OMWA 2X8JB 4IDOA 1RM0A 4YAJA 4LX8A 4RZUA 3DOEA 4MGZR 4NG4A 2JIZA 1IQRA 2X15A 1U7TA 2AUNA 2WAXA 3ITEA 3W9YA 3OFJA 3T5BA 2QOEA 1CQXA 4PV7A 4RIIA 1XTZA 3RVSA 2W42A 1L7XA 3NM6B 3KL4A 4ML3A 4KSYA 4FR2A 3A2LA 3ZGYA 3LVBA 2AE2A 2HIMA 2IUUA 2I62A 3PQ4A 4DIUA 5TQ2A 4JLOA 4R69A 3ZNQA 2VYNA 4EY4A 5CU7A 1ODIA 3WGVA 3K1JA 5AHOA 4X91A 4RGVA 5CYFA 1KI6A 4HPJB 2CGEA 2YX1A 1DOAA 3EGWA 1EWTA 3ID6C 4MA4A 2EERA 1R0WA 4QHYA 2I8CA 2MCFA 3PU6A 4TMYA 2HF2A 2YC4C 3Q0EA 1G4HA 1Y42X 4FB5A 5AI5A 1UJ2A 5DHPA 4EY3A 4CKBA 1CUZA 1Y8QA 1USGA 3DDCA 2SBTA 3K05A 3L0IB 5BN1A 5KHLB 3ZHSA 5KNCD 1W7AA 4ZVSA 2Z6QA 3C3YA 2CB9A 2IX3A 3PZBA 3AESA 2Q28A 2V5UA 3ZDDA 4LDRA 1E89A 1ZK2A 1MAVA 2YXEA 1AF4A 5DTQA 3SAJA 2UXCB 4P1ZA 1QLJA 4YFYA 1DHRA 3L7CA 3FYDA 1NVWQ 1NBWB 5LMUB 2GT1A 1NOJA 5E7QA 5T41A 3SEZA 1XQYA 1QKKA 4KXMA 1ZHHA 5DBGA 4UPDA 4XAQA 1N0UA 2JCGA 3LHFA 3L0OA 1XF1A 2JCVA 3T5PA 5DM4A 1F48A 2VAXA 5I5GA 2A7XA 4ZV9A 1ECCA 1E8MA 3EXHB 1T9BA 2JATA 3LPCA 5JAMA 2D1TA 4KYTA 5CBPB 5KOJA 1PCXA 1Z12A 3BJZA 3N5KA 3K2QA 3ZQJA 2QUKA 1UZAA 3R7DA 3U17A 3JR7A 3U4HA 4DLRA 1A8SA 2FE1A 2NZ8A 1FMCA 1GIAA 2HEGA 2FW8A 2WWXA 1C29B 3EB9A 3PQ2A 4YJFB 3PKJA 1X87A 1VQ1A 5GIPE 3DVAB 3QX7A 1TM1E 2PUJA 3T94A 2ZAGA 4CQLA 2F90A 4M8SA 2PPVA 4QGGA 2X1VA 4UU8A 4BVGA 3EMKA 3NHMA 4Z51A 3ESYA 3U6BA 2A67A 2NVUB 3KJEA 1KXJA 4C03A 1Z2OX 4L75A 1UINA 4KQMA 4TLAA 1QGOA 1J07A 1AGXA 2WKPA 2Z09A 5FBWB 2EJTA 3IPRA 5FFFA 1MT0A 3CN7A 2HGZA 4YJ3F 2Q5CA 2TSYB 4OXYA 1P44A 3BE5A 3ZGLA 2XQGA 1XU9A 2CDCA 2ZEJA 4H1TA 5TEWA 5J43A 4BO7A 1T29A 3M83A 2O2SA 1QPGA 3LQRA 5DO9A 1ZISA 3GT4A 4YHHB 4DV2B 4O8CA 3UQZA 4R0MA 3QHQA 2AX3A 4KWEA 5D7BA 4Z6KA 5TQ2B 2G82A 1E6CA 2LDXA 3N3AC 3OMLA 3PFFA 1VI6A 1RJFA 5B2EA 5AKKA 1RP1A 4PSUA 3UK7A 2IYRA 1GTRA 1W59A 2IYSA 5HHTA 1KI6B 2QWXA 5BQ5A 2AFVA 1DFIA 4RJJA 3ZOKA 4MQ4A 5A3RA 3GRPA 3V4SA 4DUPA 1X7XA 3QLTA 1A9ZA 2I3ZA 3U0BA 1Q3HA 1W9HA 3PUWA 1DP4A 1MT3A 4IFBA 3WO0A 5M04A 3B3FA 4RMIA 3PJFA 3V9PA 2AMYA 3KZOA 1Z0UA 2IELA 3B6ZA 3HMQA 1Y8QB 1W5BA 1TUBA 1YA4A 3C3PA 1KBQA 3OLCX 2IIVA 5C5EA 4IJKA 4G89A 4F1WA 2KS6A 4W9NA 4IIGA 2FPLA 3MLEA 5EJ8A 2M9MA 3AESB 3I45A 5AKHA 2QMHA 3VOSA 2CXNA 4YS6A 3V8PA 5C9ZA 3RIYA 4NL4H 4WSOA 2O7QA 2P69A 3KJHA 3TRKA 3U3MA 1NVBA 2C94A 4LF7B 4BQFA 1QAQA 4MCJA 4BTVA 5BO5A 4ARSA 4TTQA 5L9AA 4B7XA 2EEPA 4V0ME 2VBFA 3DAHA 2VK2A 3FNGA 1A9PA 3GEMA 4CM9A 4E4YA 5JR3A 3TB4A 2JIMA 5ALLA 1MJHA 4E14A 3ZU4A 3I28A 3OPYI 5ALOA 3SZUA 2CV1A 5KYKA 1PUIA 1W8IA 1KP9A 4FN5A 4TQAA 5D1NA 1D2HA 1KI3A 1QE5A 4RJKA 1L9XA 3AJAA 3ZWMA 5A62A 1FFGA 3T3PB 3UVEA 4PSKA 4MPPA 5F73A 1HDXA 1Y4UA 1PSWA 1WJGA 4ES6A 1SJ9A 1IWBB 4FGLA 1RWPA 3LT0A 2HT1A 1TYDE 3ZDBA 4UC0A 3UHFA 1O0CA 1PK7A 1DAOA 3ND9A 1DU4A 3VR1A 5DTEA 1Y7PA 2HUPA 4G4JA 4CQLB 3HZZA 3B78A 1CD5A 2WAAA 4JX9A 2TMGA 2AXPA 5DYNA 4YUVA 4RJTA 5JANA 4G9BA 5B55A 1EZ4A 4RVNA 3H2HA 5DYWA 1HLGA 4HEJA 5AOCA 4OP1A 5JQGA 3PRKE 1DV2A 3ROFA 3GYBA 4M9RA 3IEIA 4WFQA 2GBIA 2JNWA 2QGNA 5DHUA 5ECGC 1YO6A 3ER6A 1WNFA 1P31A 1TYAE 3A3YA 4A6DA 2AOXA 1C3EA 1MEEA 2J31A 2Y0EA 4GR4A 3EEBA 2G80A 2WTNA 4PFJA 5F4BA 4RQTA 4XQGA 4F4IA 4RKWA 1CT9A 1NW4A 6YASA 3PENA 1D6MA 3EG9A 3NHKA 3EN0A 4EQ6A 4F9FA 3E23A 1WDKA 2C31A 4E12A 3VUEA 2VKTA 1ICIA 4JGBA 1JVSA 3UGQA 2PUAA 5FYDA 4I36A 4TQ9A 2C78A 3EWAA 2WILA 2IBMA 2IK8A 4AQYB 4WXMA 1T3ZA 2A1TR 5BSMA 2Q5EA 1CX9B 3GK3A 3ED5A 4N7RA 2QQEA 4O6VA 5E1BA 1LLCA 1O6ZA 2D2FA 3T7RA 4ZVOA 3ZE6A 2BHLA 4BZXA 2NT4A 4Y7CA 2RD2A 1TDJA 1X7XB 3B48A 1FBNA 2NV2B 3BFJA 5ALSA 1SG0A 1ULUA 1WP4A 2OCIA 2QZSA 3AUFA 3W78A 3QPUA 4B32A 5G53C 4BO8A 2RGYA 1KERA 1S1MA 1TUBB 4JGIA 1YRHA 4HLCA 4D42A 1OASA 1YZKA 5IVDA 2F00A 3WADA 1UBKS 1JWAB 4N76A 1X38A 2IDZA 3L6UA 3DLPX 3TOCA 3RV4A 1JHQA 3G82C 1WZIA 1I9CA 1E1MA 1U6KA 1PQWA 3MVEA 2OCKA 2BMWA 3NDIA 3WAKA 3CVVA 4DR4B 3SNKA 4S0ZA 1FFEA 1KJ8A 1R1DA 4WFIA 4JC0A 3QVJA 5TMBA 1PEDA 4B2PA 5EE5B 1G9TA 3NTQA 4JBHA 4DVJA 4OHKA 5H9WA 2ZBUA 4MIOA 5KWIA 3BA6A 5FWYA 5AIAA 3WLMA 5MGBA 2BH2A 1FNBA 1ZI8A 4N5MA 1V16A 4QVGA 1U7HA 4B4KA 1N2BA 3FSGA 5TARA 3H2YA 1QZ3A 4L4XA 4W9RA 5IP5A 1MQ9A 4LQ4A 2J4CA 2PR2A 1ZMXA 2A58A 3OEHD 5DCLA 1E2DA 4B3CA 3BZUA 3CH5A 3OJOA 4AKIA 1EQUA 5J1TB 3CUYA 1GFZA 3W8RA 4S1WA 5BW8A 1QHHA 1RPAA 3ACDA 2JJ2A 4M37A 3QOYA 2Y1KA 3OZXA 4YAIA 4DM3A 3FOBA 1K8RA 3DQZA 3JRXA 2Y66A 3LUFA 2O8DA 5L4LA 1JUDA 4EF4A 4IDFA 2RHOA 1BROA 4YGXB 4ND5A 4BIIA 5ITZB 5ENDA 2FU5C 1HE8B 2GI4A 2Q49A 3CXUA 1ORRA 2PKQO 3WNZA 4J0GA 4HGZA 3H97A 4NJMA 3UJDA 4Z49A 2MYUA 1CR6A 1QR6A 2DY1A 3GBPA 4O29A 4U7WA 4OHXA 2HA2A 2B99A 4MCAA 4WKBA 2VJNA 4Y9DA 3EGIA 4TTVA 2VP0A 1F17A 4I9NA 3NTVA 1XNGA 4GQIA 2J5RA 2Y1OA 2H9IA 1GPLA 2QTTA 4P5PA 3UT0A 1MGPA 1OB2A 3EJ6A 4JYBA 3UXEA 2P6UA 4US1R 1T26A 1DRVA 3NPAA 4JBLA 2CLCX 3F6RA 2MSWA 4ZRMA 3ILSA 3R3SA 3EG9B 1Y7TA 1LJ8A 4CLEA 2A3RA 4E5NA 4EQ6B 4RTLA 3H19A 4OV6B 3TFQA 3VKUA 2IUFA 2IVFA 3DD5A 3ES9A 2IYVA 3QVGA 2Z8ZA 3R41A 3ZU2A 3ZYZA 1Y1RA 1FBTA 1H3NA 1HUQA 2WEKA 2WF8A 3LBIA 3LNTA 1R8JA 1LV8A 2HFJA 1NBME 4NATA 1Y80A 1Q17A 4Z9AA 3DZFA 4UEWA 1PNVA 2XMGA 3ABQB 3RJZA 4AL4A 4QG3A 3U26A 3MB5A 2ECOA 2VP9A 1ZSNA 2M98A 5ALYA 4C4TA 2PQMA 1Y6GA 2EZUA 2MYTA 1B8UA 3KT3A 3RODA 5BQXA 3AETA 1TZJA 4GW3A 4JQOA 4B4DA 5JTTA 1XBTA 2IHTA 3W8NA 3EVEA 1XWFA 4TTSA 2NSJA 4L78A 4AWBA 1SKAA 2BHNA 1FMFA 4G5SA 4BBZA 3KFXA 2J6IA 4QYSA 1WUTA 1W52X 1Y9ZA 1KYIA 3PHIA 1SG9A 3TI9A 2O5CA 3KJXA 4GRAA 4JLDA 5JSFA 4ZN6A 4IIJF 4JWTA 4JXKA 5EJ4A 1JQDA 2X5OA 2ZI6A 5DPMA 4WCFC 3CF2A 2O07A 2YHIA 4QBFA 2Q1WA 4QXPA 4X71A 2ZUTA 4B2YA 3SWWA 4RFLA 1PHRA 2QLFA 1VLHA 1S2DA 1YD7A 4RA6A 4D4KA 4WBNA 1UP6A 2WKSA 4BNXA 3DO6A 5FWYB 1H3EA 3L8FA 5CEJA 1C80A 1V16B 1WCV1 5H82A 5THXA 3RTAA 1VLVA 4D4MA 4B7AA 1FUUA 3KPJA 3JQBA 1OVMA 4UXHA 4XOUA 3ELWA 1N8SA 1UM8A 1Q0UA 3C15C 3REQA 1WSBA 4Y6RA 3NWOA 4IG9A 2BUAA 4CMEA 1RXSA 3GJTA 1HEIA 1QHHB 2VLIA 5DEIA 2VBIA 4U7HA 1E64A 3JD3A 3LXMA 5LUAA 1F0PA 2BT4A 3X2SA 1G63A 2L42A 4TVOA 2VRNA 3A9UA 1FTWA 3TECE 1ISRA 3ESCA 4EG6A 2O8DB 4NTZA 2DPGA 1NNLA 1QPZA 3F7OA 2M6LA 1ACJA 1DQRA 4UJ3A 4OGLA 4BX8A 4JC8A 1P6UA 3C7KA 3HXLA 1X7ZA 2CN1A 3M6UA 5J4LA 4NJMB 5TE9A 1HE2A 4P4GA 2GM3A 1DINA 2I7CA 2C9MA 3Q2OA 2A5LA 5CFQA 4UQLA 5J2TA 3GRZA 3Q11A 3DE4X 2YCBA 3NLLA 1DAHA 1PT9A 3UK6A 5A5EA 1BS1A 1SUBA 4QECA 1OH6A 4LFBB 4YI3A 2Q5QA 3QM1A 2OL4A 3RKSA 4DREA 4HLQB 3BYZA 5EXEA 3WYAA 4Y2YA 4L8GA 4PIMA 3HU1A 2GR9A 5HDBB 4WJLA 2QX6A 4RZIA 3QVGB 4LSZA 1EFKA 3PTZA 4II2A 2UUBB 3PYLA 3GO4A 3W05A 1XCJA 3H7IA 5TJHA 3PQ5A 1U0NA 1THZA 2EJVA 4BB6A 3W7BA 3DHWC 2XKJE 1N1GA 2FEAA 1JDJA 1MPTA 1R10A 3QU5A 3TD6A 1G4UR 1XUOA 4HMQA 3CA8A 4OYRA 1XC7A 1SQGA 2GKSA 4MI3A 3TRHA 2I91A 1P0MA 3GB9A 1INLA 3OJWA 5ALPA 2H4XA 2E5FA 2O2IA 4S35A 2DKNA 3D02A 1K06A 1NATA 1G7SA 3GZ4A 2VZ8A 1PT5A 1X0VA 2XNJA 3V80A 5AW6A 5I4CA 3DTTA 4JX8A 1IUNA 1PNTA 2UZ3A 2F1HA 3F7MA 4KI0A 3VR5A 4BVEA 1A5BB 2FUNB 5KNCA 3TRFA 3VSCA 2O1SA 2QTLA 5JZBA 1Y1PA 5LDDC 2PPLA 1RZRA 1JQLB 3NYWA 4F5WA 3CKMA 1EAYA 2YHIB 4RSRA 1L5NA 3TZCA 4W6ZA 3X0DA 3ET4A 1SBTA 3SG0A 1SCQA 3BJEA 3PEFA 2XNDD 3CFYA 1L5FA 2EFEB 2P0YA 4WBNB 4C4AA 2V1UA 2QUIA 3HYNA 4FD3A 3NMUF 1Y6ZA 2G0NA 3GUHA 3PI6A 2P1RA 2UZIR 3NU1A 4JKOA 1XIVA 4EI9A 3CZ9A 4DILA 4URXR 1MQSA 4Z7NB 3T3GA 1JFTA 2IEYA 2OBBA 2IU0A 4B09A 5T7BA 2P7IA 1XQ6A 3L43A 3REQB 3WMFA 1G3IA 3IAXA 4I6JA 1VCHA 2YY5A 3G88A 3BBLA 3T3HA 1O2DA 3OAAA 4GSLA 4YB8A 2YJ4A 1KTVA 1UIMA 4PNPA 5L7YA 4IUYA 1WIWA 4QJ4A 4V24A 3LC2O 3MT9A 5IWCA 1VBKA 3Q8WA 2QT0A 1F8XA 1NXOA 4OKNA 3QPDA 4Q01A 3VPAA 1L7DA 5B36A 2X5NA 4KN8A 5E9QA 2ZRLA 3U1VA 3WZLA 2PUWA 4DEVA 1I24A 2A9RA 3OD5A 3S2ZA 2AZMA 1U9YA 1X7ZB 3LVQE 1R74A 2EJCA 3UJNA 4CLDA 4K6FA 3L4BA 4ZXFA 3GRKA 2JJQA 4AJ1A 3MIZA 5J2TB 1KK3A 4JZYA 1PR3A 4NHOA 4B6SA 1C9YA 2YZKA 3NNSA 2PKXA 4DQ0A 4UPEA 4ZHQA 1GZUA 1KYYA 2GRJA 2JGFA 4IWXA 3KCNA 5CT9A 1SCBA 2CKMA 1Y5IA 4X8LA 1IJFA 1HFWA 2TS1A 2NZ2A 1XKXA 2QJWA 3PNSA 3S27A 1R0KA 4F0JA 3T4EA 5HGJA 1SHTX 3WFZA 1E1LA 1NQTA 1NVFA 1T0JB 1E62A 3B6EA 2GESA 3K4QA 3Q98A 3Q3EA 3WLIA 3P0JA 4UDXX 5SYNA 2WIDA 2H16A 4DBLE 4IQ4A 3BSSA 1JI0A 4PWYA 1B2RA 1QVWA 1VE3A 5H70A 4BQIA 3EXIA 4EHLA 2MR6A 4MI1A 4D9KA 5JCPA 5ECYA 1TO6A 3H2SA 2BTEA 1L4EA 5BPFA 1Y4ZA 3O4JA 2F43A 4B3RB 1E5TA 3M3HA 1X8JA 5DI3A 1DUIA 1FP1D 2V5VA 4ZU6X 1HG0A 3JWIA 4BNZA 1JPVA 3KLBA 2Z56A 4LVNA 3OTWA 1JN0A 4BO4A 5HIKA 3FUWA 3OQHA 5IBQA 2VAVA 1U2ZA 1TW3A 4D44A 4ZO6A 4JB8A 1MV5A 1TC1A 2X4DA 1HNZB 5JARA 1J6UA 5JJKA 1DADA 4R1TA 2XTAA 3KTAA 4YIKA 4B74A 3H9EO 1AQIA 1QYXA 1E2BA 2E5WA 3WWDA 3DE5X 1JXAA 1XP5A 1NG9A 3IHTA 3CLRC 4PC7A 1XOIA 1PTJC 1AO0A 2V74B 3UV6A 3AJ8A 4ISBA 1YE8A 2VJQA 1BMDA 1SUAA 3TR0A 4C30A 3UAXA 1G66A 4YMLA 2CZGA 3G17A 3RIHA 3MERA 1S7CA 2GJ4A 1JEEA 3SKVA 5AKZA 4COOA 3BGWA 4FEGA 2JFNA 1I4DD 2H6EA 2A59A 3D1VA 3N8DA 4WDRA 4Y98A 4ZODA 4ETIA 5LQDA 3WP0A 1Q7GA 3EH1A 3RAPR 2HMSA 5F35A 2EQBA 2PFSA 4Y0NA 1CE8A 3VM6A 4MMYB 3UHJA 1UDWA 2XEXA 2XDQA 3V42A 3HXTA 4TWZA 4O2AF 2EQAA 3OCVA 3LK6A 4P3PA 3SMVA 5BR8B 3HWRA 3UMFA 1L5YA 3OZFA 4KDFA 4RETA 4Y8VA 5FT9A 1TCUA 2R8OA 3L82B 3LO8A 4M1WA 5CEFA 2AOUA 1WDLA 4P38A 5CLFA 2QMEA 3SOZA 2W2KA 4CQNA 2MYPA 4J3FA 1J8FA 1ZMOA 3FVVA 1TTPB 3A3KA 4LAFA 5ALWA 5E8JA 4B5KA 2CW5A 2Q3EA 3K9NA 4KWHA 4LVOA 1MABA 3SYKA 5L7WA 1TU0A 2Q27A 2Q5LA 4MEBA 3UC9A 1YJBA 2J9ZB 5IAKA 2FUKA 4EHBA 1LV7A 3OM8A 4IGFA 2NP6A 3UPTA 2IQIA 1QG2A 1WSAA 3FYTA 3HEMA 3V4FA 3IVXA 3ZCPA 2GTHA 2FR1A 3C7TA 1ZBDA 3C5HA 5F98A 1SVIA 4M9QA 4WOKA 4IDBA 3MELA 1ABFA 1HDGO 1OKKD 5JDCC 5NULA 1YBFA 4BKOA 5C7YA 4Y2GA 4EUFA 3ENQA 1AS3A 1Q7BA 4GYKA 5KJFA 3TIIA 3ETDA 4ZHQB 1YS2X 4FOTA 5L7TA 4AWXA 1T2EA 3F46A 1GTMA 2W2MA 2ZP1A 5E1DA 1GSAA 3BM5A 5DBOA 2OCPA 3PDIB 3R5XA 4L8WB 1LGYA 4KE8A 4EVSA 3DLCA 2IP2A 4NH0A 3OZIA 3QUBA 3WKCA 2O8CB 3CWZA 3EZFA 1HLFA 2UZ0A 1FTYA 4MUHA 1B0ZA 3DF9A 1KJNA 5IM4A 3BS4A 4DCGA 4P92A 3BAZA 3EXIB 1GGFA 3JZDA 3P5SA 4GL2A 2EW8A 2FW7A 2QPTA 3IP5A 3IRVA 3PSAA 2EGGA 3LW8A 4IRXA 2YDXA 2INGX 2YUIA 2WY2D 5HKKA 4B6JA 5DI3B 1M3SA 1OFHA 3UUGA 4B3FX 1RJWA 1OILA 3G7UA 3AI3A 3EHEA 3I61A 2D3WA 1DL5A 1M72A 4XX1A 5DNEA 8AT1A 5IKPA 4N3CA 1E1DA 1D0IA 3CB2A 2CXUA 3N58A 1SZCA 3KTAB 4JBGA 1KDZA 3U16A 3G0HA 4MUXA 3T3EA 4PN7A 4X6UA 1CZKA 3QSYA 1K68A 2UUAB 3ZCTA 2QE7A 5JCXA 2VVTA 1HORA 2RE8A 1AZSC 5LJLA 1ISGA 2HIHA 2DFTA 5I9NA 2HEIA 2Z83A 3Q3CA 4I5EA 4MWCA 5JPCA 5JS8A 3WJ7A 5FL7D 4JYAB 5ITSA 1MC5A 5HJEA 4JOCA 1CHDA 2BGUA 2FZKA 1LLDA 1P0CA 3UZUA 1TMGE 1MHTA 1VA5A 1E63A 3HL0A 2VF7A 2ZSBA 1WUJS 2B61A 3BWMA 1NJ2A 1U04A 1CE8B 2SKEA 4RVFA 4UM9B 2J3JA 5JO0A 4OMCA 1GCGA 1K9SA 4LE0A 2AZDA 2XDQB 3I2IA 1C4XA 4CF4A 1MVNA 1NMYA 3W3AH 3M4XA 3KYDA 2ZRHA 2P2DA 5B3AA 1BE1A 1L4LA 1FUKA 1N8NA 1HYHA 3OVMA 5AQ1A 3MTAA 2AOUB 4FYXA 4G4SO 4QARA 2C97A 4LV6A 1R9NA 2HCJB 4OI1A 1LDYA 1QVRA 2JLUA 2W2KB 4IJWA 3FPBA 4PM4A 6Q21A 3SD7A 2D2EA 5BSGA 1HFJA 3WTCA 1N9KA 1E18A 3W1WA 3KKLA 4PSVA 3L8ZA 1V9CA 1ADJA 5JXHA 3FHOA 1V2HE 3OHSX 3C6YA 4EGJA 2REOA 4PXSA 3MQ2A 2WJHA 5L95A 2OT3B 1R66A 3PNMA 3GWGA 1AO3A 1ESDA 2ALJA 3A1EA 1T0BA 1G7TA 4MI9A 4H2DA 2C4KA 4M0UA 1KF0A 4ALMA 1YDFA 4CMJA 2HL6A 4B3HA 4IJQA 1BMTA 1C2YA 2VDWA 4R8LA 3AB3A 1RI2A 1YZHA 2Q2WA 3U61B 1H9BA 2PLNA 3N3BC 2VHCA 3AR5A 4AMUA 2AHRA 4PHCA 4AYWA 2DRIA 1LA2A 1STOA 1JQ3A 2ACKA 5IG2A 4RPJA 4PRYA 2R6AA 2I71A 3SHOA 2C57A 2YBDA 1B76A 2FXIA 2WWWA 4HDAA 3W5VA 4G01B 3MRSA 3NWPA 4DZZA 3I9KA 1II8B 4X8OA 3ROPA 1L5HA 4Q7JB 2FH5B 1Z4QA 2XUDA 3GJ0A 2B3DA 1E2UA 2PZAA 1U5BA 3TM4A 4UBNA 5AM4A 3NAZA 2Q1SA 4M99A 1R8XA 2ZJ1A 1NVEA 1NE2A 3FVTA 3FM9A 1GGHA 4XZ3A 5EMJA 3I5UA 1AS2A 1Z2DA 1GCUA 3V7UA 3NORA 1YCDA 3LUDA 1XAIA 3EXFA 1L5ZA 2G6BA 1UMBA 1CNFA 2XGJA 3PJGA 3WJ2A 1FU4A 2WYWA 3HB9A 1KEPA 4C21A 4DJFC 4MW7A 4I5FA 2W8BA 5K0TA 2YOFA 2FEOA 1SQSA 4YH1A 4D41A 2JJ8A 5BMVF 3BIOA 5A05A 4DQDA 3T7SA 5FPKA 3ED1A 5CB4F 4S04A 4PZDA 1ETUA 3X3HA 2BKVA 2AKEA 2I6QA 3VXKA 3SC6A 5LZ7A 2BR4A 2ZBVA 2ONJA 2HADA 3N74A 1A2KC 3SXPA 3T9EA 3AL0C 1D8AA 2AFRA 1KARA 1MOZA 3E15A 3GXBA 1CUVA 3QVKA 5ES4B 2WZDA 4R84A 5JUWA 2A7QA 1GP2A 3MAAC 2VATA 3TR6A 4ERXA 2WZQA 5F5NA 2PS1A 3RTBA 1F4PA 1KZ7B 3GDWA 1KAHA 3J81A 1PZNA 4E5VA 4KPFC 5KTOA 1QHGA 2ZI9A 5FOVA 2ZBEA 1BC5A 3ZY4A 4BWVA 1NE7A 2RBKA 3HLYA 4WLUA 2VWHA 3L1UA 2AXQA 4TRJA 3UN1A 3ZOZA 4B7CA 3UTDA 3AVVA 4K3UA 3O8CA 4UTZA 1H1DA 2WABA 1XRPA 4B0PA 2Z2IA 1C41A 2RAPA 3MS4A 1TMOA 3KYDB 4AS2A 3A4TA 2OHGA 1E58A 1YCHA 3N2LA 3H8JA 4WLNA 1P73A 2B8JA 4LJ6A 4RENA 2GZ3A 2I3AA 2JS7A 4BVBA 1J33A 1PNQA 4PG7A 3BGIA 3INYA 2IODA 3OM9A 4B0OA 1GTSA 2ZVQX 4K5QA 1JHDA 2HNBA 3LPAA 2KLBA 5JPDA 2GRUA 3GLHA 2CE7A 3RTEA 4ZMBA 2GX6A 4A8JC 3NR2A 2PLAA 2AQIA 1A4XA 5E6UA 2Y1EA 3KZXA 4H1VA 1OGYA 5ED0A 1ZPDA 2I3GA 1TJ4A 4J2OA 3C8MA 3PS9A 1TD9A 5EMKA 5F76A 2CEAA 3RBAA 3RS0A 1TZBA 1CUSA 1QGDA 1YUNA 1CJBA 4BUCA 4MMZB 1NVMB 1DUSA 1PR5A 1WM1A 3FTPA 2WPDA 2VDWB 4LUCA 2F7SA 3CR7A 4QFDA 3S7ZA 2G17A 2DSNA 2PZMA 3EW9A 5EXTA 1Z73A 1TQDA 3F90A 1OXUA 3BHMA 3NIBA 1FMTA 3MT8A 4LYEA 1JBQA 1FS4A 1WZUA 4X0EA 3VZSA 4BMCA 4NCBA 3ONVA 5DWDA 4RS4A 3CLVA 3GMTA 3ANYB 3OFND 1L5HB 4FUTA 4IUCS 3F7TA 4CUZA 1U5BB 3EXEA 4RH1A 4GHWA 2R79A 4D25A 4JEHA 2HRDA 3LTEA 4I1VA 5FTKA 3S3TA 2YNMC 3VNAA 1K63A 3ENVA 4PYOA 1VHQA 4QGAA 3TUJC 1XCBA 1BZYA 3SJBA 5JAHA 1BAPA 4AMGA 4JYZA 1AQUA 2PVCA 4OFWA 4AZ3A 4CU5A 3DCJA 2PYIA 5KS2A 2M1XA 1HFKA 2JLYA 3EXFB 3FGPA 1U9ZA 1L5MA 1NSTA 2QR3A 3OZBA 1D2NA 4EUEA 3IDZA 3EY9A 5EWMB 3F3MA 5K9ZA 1X70A 3I2GA 1IM2A 2Q3CA 2W8BB 1M1XB 1V35A 1QOQB 3IIMA 2P6NA 1G1MA 4KMSA 3IT1A 4Y1FA 2ROQA 1KOJA 4QVKA 4BBPA 3ADKA 1KWKA 1GGJA 2CUZA 5JXJA 4FNAA 2C99A 2HJHA 3PX2A 4R1SA 1T5BA 3IUYA 1OXKB 5JISA 2PNFA 4LMBA 2WHQA 2G76A 2GASA 2XQFA 4HI0E 2IEDA 2VHTA 3L6BA 1Y6FA 3OZ7A 5EVJA 2X5KO 3ABRB 4I8IA 1PR1A 4K05A 1RDFA 3ORHA 3VPCA 1KVTA 3CT4A 2P2GA 4X6LA 1JA9A 5FI3A 4E0BA 5IKMA 4MVJP 3QYFA 5JTUA 5D51S 3B38A 2HDWA 1S8FA 2OCAA 3D7SA 3R0XA 5CM8B 2BMJA 2QYSA 3JYPA 3GD7A 4D43A 4J3JA 3TLGA 1W5TA 4EB0A 3I76A 2EBHX 4I9UA 1ATZA 4OKSA 4NBRA 4TLCA 2ICAA 4WNIA 1WB9A 3KUCA 3STYA 5EMLA 1YNSA 2J41A 3KJGA 4POOA 2QN7A 3ZKAA 2XB2A 5D6NA 4CR8A 2PX0A 2Q45A 2GZSA 3FB4A 2I2WA 2VPWA 2BFEA 4M1TA 3N7TA 4OUDA 4W1PA 3L8HA 3TMYA 3LFHA 1WTCA 1W49A 2P75A 1RQGA 4LHZA 3S1SA 2A0KA 2WVHA 3W2HA 3Q85A 4IEIA 1FNNA 4P4SA 5FI0B 2I29A 4I2NA 4XWOA 3WRXA 3C7AA 1LBQA 2E48A 4GLJA 4MV5A 4GEGA 2CFRA 1QX4A 2JEYA 3FJ1A 3Q7IA 3QHAA 4FXOA 4QUAA 5EIWA 3I52A 4DMGA 4TYNA 3GLHB 3MS2A 3CMMA 5A6VA 2NZVG 5F4ZA 2ZAOA 1FYWA 3HCPA 1DE0A 5AJUA 5E6UB 1JKXA 3LBNA 1NOKA 5EP1A 3LQKA 5EZYA 3MEQA 2ENUA 2QXUA 3QWBA 5D87A 4EEXA 5M34A 1A7UA 2AOVA 4RKRA 3AEXA 2DQYA 1PJAA 3JASA 3T35A 4JASB 2YYYA 5BQFA 1KYQA 4LA4A 4X1KA 1JG1A 1ZKDA 4YDSA 1MCZA 1KYTA 4I3HA 2XUIA 4B6FA 4BP8A 1IBMB 5F1KA 1RWNA 2QRKA 4HGOA 2J08A 1L5GB 4JDPA 4I2VA 1U2EA 1J2JA 1NNI1 3BMCA 4M9CA 1KI8A 4MUGA 5IZCA 4BV8A 1J0CA 4AJEA 3OFVA 4X00A 4WZAA 4Q7QA 3KAJA 3GJ6A 2P2CA 5JVDF 3QEAZ 1VLZA 4UHCA 4O4HA 3EXEB 1M74A 3DBOB 4K9PA 3VV3A 4MUYA 2HNKA 3S4YA 3RRNA 3JW8A 1ZR4A 3INNA 4G1BA 1ODJA 2FGJA 3SX4A 5BR7A 4AZ3B 5C5IA 5B2ZA 3UGTA 4BXOA 2XE6A 3O90A 4AUMA 2FPKA 2QQGA 1O57A 3KT8A 5F64A 2A57A 5TQJA 3O3NB 4DC9A 3MTJA 1T9KA 2RGBA 3U7FB 2RAFA 4M9XA 1T1GA 2OAP1 2ZSUA 3HHEA 3X1DA 1VJRA 1EG2A 1U2QA 4AJNA 4E08A 1IU9A 2IIBA 5F3DA 2BR3A 3K9GA 3L7AA 1JEJA 1SM4A 1LCIA 2P9GA 3BERA 1GZ7A 1SKYE 1EP3B 3C8UA 1IZ7A 1A77A 3H75A 1RAIA 4OSEA 5CT4A 2Z6UA 2F3RA 2JI9A 2O20A 4LEIA 3TXYA 3EDYA 3S70A 3D1JA 4CL2A 3NATA 3JQCA 3DOOA 1H23A 2PWBA 3DBLA 3KOYA 4EW2A 5JSHA 2C7PA 3HCAA 3UMSA 3CLUD 2GK6A 3PUYA 3QPBA 3IOEA 1OH7A 3TUZC 1WU7A 1OYWA 1UL1X 2P27A 1YUMA 1AKMA 3TLGB 3CF6R 3LYHA 4AY2A 3HBFA 4LXTA 2KLHA 2BZ0A 1D3AA 1FTSA 5B1YA 2OKGA 3DMRA 3ZDRA 4MJ3A 2KW5A 2QVZX 5JYEA 4UVEA 3PQEA 2CNLA 4KYIB 4O1MA 4MDHA 3LY8A 3R0VA 1RCTE 4IIEA 1FW8A 2YW2A 1ZX1A 2BFEB 4PLHA 4UMEA 3UJ6A 4OUDB 4F60A 1ZU4A 1PUXA 4JBYA 3AVXA 2EKLA 1EKXA 2ZBPA 1RQXA 3TNLA 1FSZA 4L0DA 1XLTC 4XR4A 2FXVA 1JS1X 4P4SB 1O0SA 1TOAA 3CHYA 2HBQA 3MTIA 5FPYA 2O2HA 1V43A 4FT2A 4KRGA 4QDXA 5HTOA 1ODKA 2JKVA 4LOHA 2XT0A 3I2YX 1VPEA 1COZA 2HV8A 3FNIA 3OIGA 4FQ7A 3P2OA 2N0SA 2GAFA 4IFTA 2Q6VA 1XGKA 2ZRFA 4EVIA 1P6XA 1WMFA 3VR3D 5CXSA 3NONA 2WIAA 3JQ7B 4ZO8A 1JYFA 3EODA 3GLGA 4I55A 5TLSA 2G72A 1YJAA 3C1UA 4KX3A 3HJRA 2Y05A 4J29A 3ZVKA 3AILA 2BFCA 1RRCA 1DDIA 3T9AA 1UFRA 2QXYA 4R8SA 4TKLA 4X1KB 3ZR4B 1XDZA 1VCOA 2H4WA 4FOLA 1PSDA 1ZLXA 4IPTA 1P39A 5A9SA 4MARA 3AJDA 3NBFA 5EZQA 2Q9BA 3BMCB 1YF3A 1NPTO 5LBIA 3IUMA 4CLOA 1H8HD 3A06A 1UJBA 1QF9A 4CW7A 2RH8A 4WZAB 1C7JA 1I3NA 4JKIA 4O4HB 3S40A 3DB2A 4J6EA 4BFTA 3OCWA 4CUJA 1KVUA 3KTOA 1N6RA 4BMNA 1EESA 3EDCA 3GLFB 5K0JA 4DTIA 2ORED 4JMLA 4BXOB 1Y3FE 3L02A 1V9LA 1XTKA 2C4HA 2FX2A 2RC5A 4N5DA 4Q7LA 4RNCA 3JYNA 2PLWA 5AOVA 4L5IA 3O2JA 1OPXA 5FOQA 4NE2A 4KFUA 5CDHA 2VSQA 2O05A 3CVJA 1XD9A 2WU8A 1J22A 5KTPA 2QKYA 4MULA 5K03A 1FP7A 4NBUA 2H1LA 3M6XA 4GZ3A 3A32A 1EGQA 4OQZA 1XL1A 4RK6A 4CTKA 4INOA 4UMDA 4WNCA 2LCIA 3E7FA 4X7MA 1GAXA 2FLWA 3FNQA 4MGIR 2EVWX 4R7TA 4NMMA 5CCXA 1A9OA 1Z45A 2EX4A 2VP3A 1SHLA 4GICA 4V0LA 3RVNA 3UAOA 3V2UA 6AT1A 2OM2A 3C6XA 5JNLA 1Y0BA 2AR7A 2EHDA 2VHQA 3EF1A 3KAKA 3NGXA 1JJBA 3PDCA 4XQ0A 1PV1A 4A6XA 1RWXA 4DQUA 1AC5A 4DA0A 3ZXSA 2JK1A 4H1HA 4K6OA 4Q37A 2E55A 1Q0SA 3MUFA 1W5EA 3GN1A 3H16A 2CJPA 4UBLA 4DUGA 4MVJM 3ILHA 3CISA 3E82A 4W1QA 5LL6P 1DOHA 4GYWA 4QNRA 1XEXA 5K0NA 5LN1A 2EBFX 3CUKA 1GPKA 1KBZA 4V02A 1LPOA 2WJGA 5MN4A 4XM0A 4RHTA 3G2HA 4IICA 3DAPA 1PBTA 3M8KA 3LVFO 1DLJA 3AHFA 3ZQUA 2IYNA 4LF9B 2BONA 1EGAA 2PIAA 4DA7A 1ISSA 1RQ7A 1MDFA 1JGTA 1XCMA 2ZYRA 3I6BA 1AS0A 1DQPA 1O3YA 1A04A 3OZGA 3VNRA 4M0MA 4H0CA 3VNBA 1ZN9A 1OCEA 4IF4A 2X77A 3JQPA 4YQZA 4OAPA 1CUAA 1RPTA 1VL6A 2NYAA 4ZREA 3EDOA 1LSOA 3GLGB 2BL4A 4I55B 4XJSA 4WZBA 5EGSA 1HEUA 2J5QA 2PMWB 2BFCB 3C3KA 1XZIA 2D59A 4LJ7A 4OY3A 4FDVA 1W0CA 4JMPA 2V9PA 2YJZA 121PA 3EFHA 2RI1A 3VC1A 1P2GA 3RWOA 2HQRA 1H4QA 3QLUA 1OZFA 3OZEA 5A9SB 4BX0A 1TVEA 1NJSA 2YFHA 3KSRA 1Z0ZA 2K2WA 4R9VA 1UC5B 4D96A 1L4NA 1NXQA 2VSYA 3H1EA 1NP7A 4CLOB 1TLTA 2XPCA 2VJAA 2X76A 4H18A 4LFCB 1IXKA 2GB4A 3KJQA 4D5EA 1Z39A 4KUEA 4DCMA 5JZ9A 3IE1A 3H17A 1TO1E 3HCNA 3O4GA 3KQSA 1H1TA 1I2BA 2JGJA 4OM7A 4YXWA 3RUPA