4UHDA

Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound)
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
274
structure length
274
Chain Sequence
AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHTEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
source organism Planctomycetes bacterium r1
molecule tags Hydrolase
molecule keywords ESTERASE
total genus 107
structure length 274
sequence length 274
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uhdA00
1ODTC 3WL5A 1XZDA 3OM8A 4N5IX 1H2ZA 4ARAA 3R3UA 4P92A 3M83A 1E5TA 1WHTA 3HI4A 1OILA 1KU0A 3ESCA 4W63A 4KACA 1N5MA 4BYMA 5C8ZA 1CEXA 4X6UA 1QIJA 3I2HA 1TCAA 4B9EA 3IULA 2WJ6A 3BL8A 4ZGBA 3WIOA 3M81A 5FPQA 4KJXA 3IUNA 4EY6A 1QLWA 1UOQA 1XQVA 4AO8A 3M82A 3E0XA 3H1BA 2YXPX 1AQLA 2BUBA 4FHZA 2DSNA 3PFCA 5HZGA 2CKMA 4JEIA 5FUMA 1CUEA 2QUBA 4N5HX 3T4UA 4DNQA 5SYNA 1GKKA 3DQZA 1VLQA 2XLBA 4GBGA 2EDCA 1AUOA 1C4XA 2WG0A 4AN1A 1A8SA 2ZYRA 3BJRA 4JH0A 5FRDA 1EA5A 3CN7A 1SCKA 4QEKA 2G63A 2X8BA 4AO6A 3BIXA 3PICA 3D59A 2G5PA 4J0KA 5AI4A 3A6ZA 1UK8A 4J7AA 4K6GA 4K5QA 1MX1A 4IH4A 4QLAA 4ZWNA 3CN9A 4BRSA 5JANA 4FFWA 3CCBA 1IZ8A 3IUQA 1WPRA 1JI3A 2XMBA 2OGTA 5A2GA 2DHEA 3GBSA 1BU8A 4N8EA 5LYYA 4BCCA 1QIHA 5K3DA 3QZUA 3ANTA 4OD0A 1YS1X 5AM3A 2Z3WA 2PSFA 5AKGA 4MXDA 2FX5A 5EHZA 4KYVA 2WM2A 4J0HA 4U2CA 3WA7A 3ESAA 3R41A 5AM5A 5C8VA 4HXFB 4BTLA 4N8DA 1DQYA 1C7IA 5ALOA 3STXA 2XUPA 2C5GA 3OC0A 5AK4A 4B84A 1XKTA 3HZOA 1K5PA 5JASA 2AXEA 2K2QB 4RE6A 5A7GA 3WQHA 1ORVA 3FVTA 1VXOA 4FFVA 4QDUA 2RGUA 2VTVA 1W1IA 5K3BA 3HYSA 3R40A 2VJAA 5DYYA 4AQDA 2WIGA 5ALPA 1NU8A 4MWTA 2B61A 1QTRA 4FNMA 5AH0A 2WG1A 2WSLA 2XMZA 4EHBA 3DKRA 5LZ4A 1QGED 3W05A 3ZLVA 5DYWA 3G0IA 5HKAA 1UK6A 5JD6A 4H7IA 1Y7HA 1CVLA 5CTAA 3GUUA 2BKLA 1YCDA 5AKEA 4Y2RA 1ZI9A 4Y2YA 2XQFA 1A7UA 3L1IA 1R1DA 1QTIA 2VF2A 4EB0A 4IO0A 5K3FB 1XRLA 2PBLA 4UHFA 2XQKA 3AZQA 2BJHA 1UOPA 2QXUA 4C87A 3AIOA 2PU5A 5LZ5A 4HZGA 4DTCA 5ALWA 5ISMA 1XZGA 4OB7A 1VZ2A 3IB3A 1J06A 2B9VA 4H7JA 1LZLA 5HF5A 3C43A 2BFNA 2OCLA 4P9NA 1CUAA 3FYUB 4BCDA 2WUGA 1WB4A 3S8YA 2CUTA 2ECFA 2AJ8A 3JWEA 2ZYIA 5HFNA 2Z3ZA 3MUNA 4Q3OA 2GYVA 4X3CA 2DFPA 2HM7A 3H2GA 2RHTA 2CBGA 4RE5A 1O6GA 2WFLB 1BCSA 2V9ZA 4DMFA 1DX4A 5CW2A 4ZV9A 3H0CA 4C88A 1GGVA 2WUDA 1BN7A 4HS9A 3FLAA 3A2NA 3K9BA 1IZ7A 5JAPA 2OG1A 3SK0A 2ACEA 2OGZA 2DQZA 2DR0A 2ZJFA 5BOVA 1DINA 5AI5A 3FYTA 1GPKA 4GW3A 3WWPA 4B0PA 2XQGA 4XJVA 5ALYA 4KR0A 3I2JA 1ZIYA 2JIDA 4PF1A 5E2IA 4GEGA 3HRHA 5CT6A 3ILSA 3C6BA 3AILA 1DWQA 3B12A 2XUKA 4MQLA 1EH5A 5I7UA 5EHNA 4OUKX 1DWOA 3F67A 1T2NA 2WJ4A 4BP8A 1K8QA 5CT9A 1CUCA 5EGNA 2XMDA 2OCKA 2XUAA 5CT8A 4P93A 3F98A 1FFEA 2WFMA 4DNOA 4BP9A 4BVJA 1YAJA 4MQMA 2D0DA 1P0MA 1YS2X 4GWLA 3TEJA 4WCVA 4XX1A 3FSGD 4XWGA 2VAVA 3STVA 3BIWA 2RAUA 1F0PA 2I3DA 5ALRA 2G4LA 4MJ3A 5C8XA 3BDIA 4IH9A 1CUBA 4B83A 4LXHA 1N5RA 1K63A 3ZI7A 4LXGA 2HA5A 3G9TA 4J0IA 4GECA 4OB8A 4FOLA 1R9NA 3I6MA 5CT4A 1GKLA 5LZ9A 3KSRA 1JMKC 1EK1A 5JAUA 5AIBA 1DT5A 3H2KA 1ZD3A 5JARA 1UOOA 3AZPA 4WY5A 1TCCA 1ZI6A 5IVKA 4K6KA 5IVHA 3HEAA 3G0GA 3AUKA 3IBTA 4AO7A 4TPKA 4UFPA 3C5WP 2DHCA 2OLEA 2PUHA 1THTA 2JEYA 3L1HA 3HACA 3WL7A 4CCYB 4U2GA 2VT6A 1WPXA 2C0QA 3OURA 5ALKA 3KWFA 1LNSA 1AC5A 2AJLI 5IVIA 1YA4A 5K3AA 3HSSA 5ALFA 2ORYA 1R88A 5BV7A 1DU4A 3HABA 4X6XA 4L3WA 1CQZA 3NGMA 5AICA 3IURA 1K4YA 3WZMA 5HK9A 2H9YA 1LPAB 2BGNA 4X93A 4EZIA 4Y7DA 4J0DA 3X3HA 4DMHA 2GZSA 1JU3A 4TGLA 5D3KA 1XRNA 5AM2A 3WK4A 2C0PA 2WHQA 4HRYA 4Y2JA 1YB6A 3D2CA 3WYDA 4UPDA 4WDQA 3VKFA 3O9MA 3GFFA 1NU6A 1UT6A 4A23A 2I78A 1CUJA 4GDMA 1XZHA 4Q3KA 1QIIA 3QMWA 1VOTA 5FLKA 1EB8A 2QT9A 4Y2UA 4B80A 5H3HA 5A71A 4D9JA 2QKYA 2VSQA 1CUIA 2WKWA 2WHPA 2VA9A 3OPMA 3FCYA 3BDVA 1H2XA 5CXXA 1W52X 2B4KA 3H2HA 4UBMA 3HLKA 4F5ZA 4AN0A 5DTJA 2O7RA 3DYIA 4ZXFA 1MN6A 2EDAA 3LLCA 2ACKA 3BF7A 4QDZA 1THGA 4HXGA 1OXMA 3ICVA 4P08A 3STTA 2WILA 3FLBA 4WY8A 5ESRA 2HHAA 5ALJA 1QIKA 4H35A 1QO7A 3DLTA 4JUIA 1MT3A 5E4TA 1CUFA 4BZWA 3U0VA 1E89A 1QIFA 2PSDA 3O9VA 5CMLA 3VXKA 5HFAA 4X95A 3HXKA 4BC0A 2IIVA 1HL7A 4Z49A 4OCZA 2J3QA 5EFZA 5ALLA 1X70A 4BVKA 1ODCA 1I6WA 1W6RA 4J0CA 5AKZA 4BAGA 1H2YA 3WJ1A 1QFMA 5LKAA 2HU5A 2WFZA 4Y9SA 3AFIA 1B41A 1RWQA 4YASA 7YASA 1WHSA 4Y2QA 1Y37A 3V1KA 2HA6A 3R0VA 1VKHA 1XFDA 5ALUA 4YX9A 3T52A 2FUKA 1IMJA 4AZ3A 3D5EA 1ZGCA 1CV2A 3H04A 3VJMA 4KE6A 4I19A 3O4JA 2VJDA 3D2AA 1SC9A 4BCBA 4H7FA 5AK3A 1UKBA 1QOZA 4Q82A 1VXRA 1CUDA 1AZWA 2BUAA 1BEZA 3WKCA 4BTVA 1ZICA 5AOBA 4H7DA 5AM4A 3ICWA 4MWSA 2I03A 4QE3A 1XZAA 1A8QA 3D0KA 3G9UA 3D2BA 5AOAA 1EDDA 4WJLA 4EUSA 5LIPA 4K2AA 2PU7A 1EXWA 3BJMA 3WK8A 5JIBA 3C6ZA 4XVCA 4E15A 3STYA 1A8UA 1EVQA 4E46A 1HPLA 4H7KA 2OCIA 2B20A 1EI9A 3WWDA 4AX4A 5AM1A 2BCEA 5JALA 1W75A 5D7BA 2NW6A 1IUNA 1EX9A 3ANSA 3NOXA 4DMKA 1E66A 2JGIA 4LYDA 4AB1A 3I1YA 2XUQA 3ZPXA 2OGSA 4Q34A 1F0NA 3ESDA 3DOHA 4YK7A 4O08A 2PPLA 3AIMA 4DMCA 5ALVA 1MNQA 4U2BA 3UUEA 5AKLA 5AKIA 1XQYA 3DOIA 3OTQA 3RM3A 1GZ7A 2X76A 4Y2SA 1CUHA 2GYWA 2Z8XA 3DYVA 3O0DA 3NUZA 3QH4A 4PQEA 3NWOA 3WL6A 5CBKA 4A5SA 4J03A 5ALXA 1HKHA 1XRRA 2WIKA 4LXIA 1LPPA 4FDMA 2ZSHA 2WTMA 4LHEA 2HIHA 1AKNA 4UUQA 5AKYA 4IQ4A 2RONA 3WKEA 2XUDA 1SOMA 2YASA 2WUFA 5T4HA 3WL8A 3QMVA 1U4NA 2HU7A 1X2BA 3SX4A 4X7BA 1DX6A 3I28A 5AI0A 3FCXA 4PSUA 4KE8A 5JADA 3QITA 4KAAA 4X00A 3I2FA 5CH8A 4MEAA 3W06A 2Y6VA 5HCUA 4B81A 1P0PA 5AIAA 4C4YA 2BUCA 1LPOA 2WQZA 4FWBA 5E4YA 1IVYA 3MUOA 4B9AA 5DTIA 3EQ9A 2JEZA 5JAHA 4C89A 2XUFA 5AHXA 3DL4A 2G5TA 3STWA 1BE0A 1BEEA 3LCRA 5FXMA 2R8BA 1Q0RA 5ALHA 4PV7A 5LP1A 4H18A 3PUHA 4UHEA 2ES4A 5ALIA 5C81A 4L72A 3O4GA 4EBBA 4TVKA 2DHDA 4BE9A 4UFNA 2H7YA 1CUUA 1ACLA 3AIKA 5AK5A 4EY8A 4KAFA 2QVBA 1L7QA 3C87A 1DWPA 3EQ7A 1JMYA 3C5VA 5JZ9A 4W1RA 5KWJA 1XZLA 2X5XA 1FJ2A 1YSCA 4N8SA 1QZ3A 2OAEA 4HAIA 2HFJA 2Z8ZA 2WU3A 5AOCA 2JF0A 4HVTA 3R3VA 1JJBA 1U65A 2VJCA 3UUFA 4FMPA 5IH7A 5KWIA 1JU4A 5KBYA 1F8UA 4UFOA 5LZ8A 3G7NA 2WJ3A 4X85A 1ZJ5A 1J1IA 3I2KA 2QJWA 1VA4A 4B7ZA 2C4HA 1LPSA 3DS8A 1VE7A 1O6FA 4X6YA 3SWWA 3O4HA 5IVDA 5ALZA 1QONA 3U1TA 4CG3A 3BWXA 2ZJ6A 2J4CA 5EHXA 3G0CA 3KOOA 4QLOA 1LLFA 1F6WA 1G42A 1WM1A 4IH1A 5AJHA 1XRPA 3Q8WA 1MJ5A 3GZJA 1ZI8A 1Q83A 3FWHA 3PI6A 3D3NA 4F0JA 1CUGA 1BCRA 2HRQA 3OOSA 2PKYX 4UBKA 1N1MA 5E4JA 1R50A 3DEAA 5DJ5A 3AINA 1K6EA 1GPLA 1S8OA 2IITA 4F21A 4U2FA 1UK7A 4FLEA 4GLBA 5JD5A 3H2IA 5ALEA 5I8PA 5AI8A 4WDRA 4BVLA 1A88A 1BS9A 3RK4A 2XE4A 3I2GA 1CUYA 4E11A 3IUMA 2HL6A 3O95A 1ETHA 3C8DA 2BAGA 1AMNA 3KXPA 4FLMA 2HA2A 4G4JA 4FKBA 1EDBA 3R3YA 3W04A 2QM0A 2QR5A 1ORWA 1HQDA 2GBCA 1LZKA 2VT7A 2UZ0A 4C6HA 5A7FA 3FSGA 4OU5A 4C4ZA 4INZA 4YPVA 4V2IA 1TKRA 4ROTA 5FPPA 5DNWA 2JGKA 3DD5A 4M0FA 1VE6A 2VJBA 1XKLA 2XB6A 5DWDA 2O2GA 5D3ZA 5DYTA 3LIPA 4BC1A 1BRTA 2E3JA 1QE3A 2GBGA 5AI6A 5ALDA 5JZBA 1KU6A 3B3QA 5AM0A 3ESBA 1G5FA 1UK9A 5IKXA 1ZD4A 4CI9A 5JZSA 1XRMA 3VJKA 1ZGBA 4BZZA 4G4IA 2OQVA 4UHDA 1CUSA 4CIBA 2QUAA 3QPCA 1W76A 1M33A 3A2LA 1HDEA 3E4DA 3WKDA 5HF8A 1CR6A 4Q05A 4U2DA 1UZAA 3ZLUA 2R11A 2V97A 4L0CA 1ZOIA 2IX9A 1FSSA 4CCWA 4G4GA 3PF8A 3Q0TA 1X2EA 4XIIA 3QPAA 1D07A 1QIGA 2RHWA 4LYEA 1UKAA 1LPNA 1MAHA 3F9CA 1EHYA 4ARBA 4NMWA 2LIPA 4HRXA 2XDWA 1XQWA 1JJFA 1PFQA 4X92A 2XMCA 3PUIA 3EBLA 3ED1A 4H7EA 1QO9A 4NVRA 5EIEA 3D4LA 4PW0A 2PSEA 4C4XA 3H19A 1P0QA 5AKHA 1YR2A 4S0XA 2WLSA 4Y2VA 2O2HA 3WKAA 1LGYA 5AKJA 4QDTA 4FLFA 4UHHA 2ZYHA 3MVEA 1EB9A 3QMMA 3YASA 1NX9A 3KD2A 1AX9A 3DNMA 3I6ZA 3I6YA 2BGRA 2HA3A 3QBJA 3WKBA 2GBFA 1R4ZA 4X94A 4CCYA 4W1PA 2QS9A 2HA7A 1TCBA 1ZIXA 2JGFA 2YH2A 3V48A 5FOQA 3WK7A 2XQJA 5HF9A 2CMFA 3JYHA 3LS2A 3QPDA 4JNCA 4BBZA 3BE8A 3WLAA 3A70A 2AJBA 4FTWA 1XZCA 1SCQA 4X71A 1R3DA 2W6CX 1JJIA 3I1IA 4DIUA 3GROA 1PJAA 1T4MA 1XLVA 2J4FA 5AP9A 1XZMA 3A2MA 1B6GA 4G9EA 4CIAA 2WU4A 5BWCA 2WHRA 4Y2PA 1IUPA 4KEAA 3R3WA 2GZRA 1TIBA 4KRXA 3VISA 5K5EA 2WIDA 3LP5A 3JW8A 1QJ4A 2ZJ7A 4LKOA 1RYYA 5HQ3A 4DGQA 1WB6A 1TRHA 4AZ0A 5J3JA 2VATA 2H7XA 4CFSA 5ALQA 3LIIA 2Y2UA 3PFBA 3BXPA 2CJPA 2QTBA 3G9XA 3WK9A 3WMRA 2DCMA 2OXEA 4ZRDA 5EIAA 5DNUA 2JGMA 2WTNA 5ALMA 2XUOA 1Q84A 1MU0A 5K3EA 2XMGA 1FFBA 4OSEA 5F4ZA 6YASA 5C7YA 5JAOA 3E1GA 1LBTA 3QYJA 2Y1KA 1MNAA 4FBMA 1BROA 2OCGA 3WA6A 1LPBB 3D7RA 4ZI5A 1USWA 5CH3A 3F96A 3V9AA 2JGEA 2HRRA 3WZLA 4ETWA 4MEBA 3RLIA 4EY4A 3C8HA 4EY5A 4OB6A 4DM7A 4G8DA 3W9UA 3ZLTA 5LLSA 5K3FA 1DQZA 1EVEA 2C5FA 5ALNA 2QZPA 4ZV7A 4FBLA 1CQWA 2Y2VA 2XUIA 3WWCA 2QRUA 4DLNA 4G9GA 2XLCA 5AI9A 1QIEA 1CLEA 3R3ZA 5DLPA 2H1IA 2YYSA 2XMRA 1ODSA 3WIBA 1EDEA 3N0TA 1AGYA 4JYPA 3B5EA 2C7BA 4J3JA 4QA9A 4H0CA 4Q1VA 1Y7IA 3DKKA 1YA8A 4NZZA 4M0EA 3BF8A 3V1NA 2FJPA 2XT0A 1XZJA 4BDSA 2PVSA 3V1MA 1PV1A 1VA5A 3G8YA 4GXNA 1LBSA 3FBWA 3GELA 4PSDA 4M0MA 5CT5A 1MO2A 2XUGA 3G9ZA 3CCCA 3R3XA 2JBWA 3TRDA 4OYLA 3PDCA 1XZKA 3G02A 3W2TA 1J2EA 4WFJA 4Y2TA 3DJYA 2WUEA 4B82A 3IDAA 4WFKA 4LIPD 4RPCA 3RKSA 5JATA 2VEOA 5AKXA 3K2IA 4RNCA 5LZ2A 2ZVDA 3K6KA 5LZ7A 2AJCA 5A7HA 2O7VA 4X90A 3FLEA 4AMYA 1G4HA 2W22A 3DL7A 4EY7A 2QOEA 3VJLA 5FDFA 2C58A 1C7JA 3OG9A 4G8CA 4UBJA 2QMQA 2PX6A 2VAXA 1ISPA 3S2ZA 4QNNA 1CPYA 1OCEA 1GXSA 4ITVA 5FV4A 1UKCA 4KE9A 3WK5A 1EK2A 2WG2A 4X97A 1CUXA 3DDUA 3H18A 4AMZA 2HADA 4I4CA 5HKBA 4B0OA 5T4EA 4KE7A 2DQYA 4H77A 3MGAA 4KAJA 3DCNA 5KREA 1MX5A 1QFSA 4B6GA 1G66A 3C45A 4GHWA 3G0DA 1HLGA 4BRZA 4Q3LA 4OYYA 1GT6A 4G5XA 4BAUA 1JKMA 1XLUA 4H7HA 3C6YA 1VZ3A 3FOBA 1FFDA 3SC2A 1E3QA 2XMSA 4X91A 3ZV7A 3WI7A 2FJ0A 3QM1A 2V96A 1E8DA 3VVMA 1SCIA 2JGLA 2CB9A 3P2MA 3G0BA 3L1JA 4MYSA 4OU4A 2D5LA 2CZQA 1XLWA 1CRLA 3IVMA 1FFAA 1P0IA 2AJDA 1JFRA 2OPHA 2QXTA 2XQIA 1XZBA 2XUHA 3F97A 2ROQA 2Q0XA 2O2IA 1MAAA 1SFRA 3W9BA 4PSCA 1FFCA 1HBJA 3IUJA 4RGYA 1Q0ZA 4L9AA 1KEZA 2PUJA 3EF3A 4E14A 4BAZA 1J07A 3VVLA 1U2EA 2WFLA 2JGJA 1H22A 3QVMA 2OQIA 4QZVA 1ZD5A 2ONCA 2XUJA 2HA4A 5I9IA 1QIMA 4QWMA 1YB7A 5CXUA 5FKJA 2CEKA 1TAHA 1TK3A 5A62A 5D6OA 5ALGA 3TJMA 2PL5A 2RI6A 4IHAA 3N2ZB 5EHQA 4PO3X 5SYMA 1XROA 4OPMA 1ZD2P 2I3ZA 3C6XA 4UBNA 1GQSA 5T4FA 5HQ3B 3O4IA 1WCYA 1WOMA 4QWWA 1E8NA 4UBOA 1MTZA 1ACJA 3FYUC 4BB0A 4BE4A 1LPMA 1R9MA 4CG1A 4FNGA 5YASA 1H2WA 2WIJA 4JYMA 2PSJA 1AURA 4W1SA 4EA6A 2QJRA 3M3DA 1WB5A 3UMJA 4AXBA 3RARA 1CIJA 5CURA 2PSHA 3H17A 3F8SA 2HU8A 3AJAA 2OAGA 3FYUA 1BN6A 4GI1A 1XZFA 1XZEA 2V98A 2WHPB 3IIIA 3WJ2A 1DT3A 4ZREA 3WWEA 3KDAA 2ZYSA 5CH5A 4J0GA 3GA7A 5ALTA 1GQRA 2GYUA 4PNZA 4UBIA 5AO9A 4NS4A 1XRQA 4UBLA 3PE6A 1IUOA 5A6VA 2RIPA 3EQ8A 2EEPA 3C70A 3FAKA 4MYDA 3HC7A 5HK8A 3H1AA 1UWCA 2P8SA 5EIHA 5ALSA 3KWJA 3FNBA 3STUA 1N8SA 3EIOA 2HA0A 2HFKA 4KRYA 1VJ5A 1GPNA 1L7RA 4I3FA 4BDTA 1JT2A 4W1QA 2J3DA 4J0JA 4UHCA 5T4BA 4DNFA 3V1LA 5CRIA 5LKRA 3ZWQA 3HJUA 1H23A 1EINA 2VQ6A 4DNPA 4G1FA 4CG2A 1DTEA 3H2JA 5AKKA 4HTAA 4G8BA 1XZIA 5EI5A 4F60A 3AZOA 4W9RA 4HXEB 1MPXA 5AK6A 3WK6A 1UFOA 2H7CA 1QIDA 3FVRA 1CFJA 1RP1A 2GBIA 1YASA 5JYCA 3WYNA 3I2IA 4WFIA 1TQHA 5BWBA 2Z5GA 4B85A 4DSZA 5HF6A 3WWOA 4C01A 1XQXA 4A16A 5DNVA 4BATA 4QDXA 4DYHA 1CUVA 1CUZA 1U8EA 4QDOA 1MX9A 1YAHA 4UHBA 2WIFA 4U2EA 1L7AA 3IA2A 4K6HA 1CUWA 2Y6UA 1E8MA 4DSAA 3CXUA 1ZJ4A 5FP0A 2PM8A 2XI4A 3PF9A 2ZSIA 3VDXA 1UXOA 1Z68A 5K3CA 1W4LA 2XMQA 2HDWA 3TGLA 4Y2XA 3E3AA 5JD4A
chains in the Genus database with same CATH superfamily
3PC4A 2C88A 3WP1B 3OM8A 2D0OB 1YCFA 3VOSA 4RSGA 5LA6B 4MRNA 4OQLA 1I1HA 3TL3A 4E0BA 5HOQA 1JXOA 1HNZB 4RTPA 4Z8XA 2OBLA 3VAAA 2C2XA 2K87A 4EHAA 1E2QA 3HUEA 1SG9A 3NC4A 1UFKA 2Y05A 3BCRA 5F9FA 3I9OA 2EFCB 3Q3IA 5AW0A 2FR8A 2VDQB 2X0EA 4IL5A 3UV3A 4DRXB 1QU2A 1ZH0A 1F6BA 1H4TA 2OHGA 3L8DA 3M83A 1T4GA 4IMIB 2QLJA 3HEBA 4O4HF 3UMYA 2GN0A 5JJKA 3DDHA 1Z0ZA 4LJAA 3WGNA 5KOJA 3FCOA 3VKHA 5FPHA 4CTMA 5KMGB 4URFA 1U0NA 4CIVA 1UDWA 1TJYA 1KZ7B 1N5MA 2QYHA 3EQZA 3OOJA 4BYMA 5AQ1A 1QYIA 5JMWA 2CSUA 1ADJA 1T3SA 1NVWQ 3MTEA 3U60B 1T5LA 4HNHA 4RLSA 2ADMA 1ZJJA 3P71T 2I4OA 4PR0A 1NIJA 1NVFA 3ZGNA 3N58A 4J0FA 4E7OA 2JANA 5J4YA 5TE9A 3WIOA 1E4VA 3SC3A 2DAPA 2P9JA 1Y9EA 1QE0A 5F3DA 2Q5FA 4G63A 1KBOA 4X84A 4BNNA 2EJCA 3UUWA 1BMQA 1MENA 1XAJA 2AUTA 4Z9YA 3EY9A 1JSLA 2O1WA 5BW6B 1XQVA 3TLXA 3OIVA 1CZOA 2I2WA 4JXKA 5LA6A 3K4HA 1PJ2A 3A0RB 4TRRA 2MIIA 3LT1A 5K8CA 3TE6A 3O5AA 3Q7PA 5JZMA 3MWDB 3DEJA 1L5GB 1H2FA 2DSNA 3PFCA 5IFLA 3DE7X 4U7WA 5IJXA 1R18A 2GVZC 3G1WA 4RJ2A 4CU5A 1DC7A 3KCQA 4L5AA 4GR4A 2OLJA 1ZCBA 4F71A 3DZFA 3ZCRA 1TGVA 4IYRA 4QG7A 5LM3A 2J9XB 2A1UB 5ICCA 3ZH2A 1H1DA 1JW9B 5DK4A 3CVOA 3COYA 4PBRA 1O96B 3PC8A 2ATVA 1MVOA 3L9XA 4DNQA 3RGGA 1GKKA 2XA2A 4PHHA 1E5LA 3BXFA 1K2VN 2AQHA 3N59A 3ZQ6A 4F5YA 1KO4A 2D8MA 3PTAA 2HO4A 1UKYA 2XLBA 1N6NA 2PGXA 3KRTA 3IBSA 2HXSA 4N3CA 1M6WA 1P4SA 1TMOA 4O0MA 4YMVA 4QXAA 1C4XA 4K9RA 2Q1XA 5A2QA 2QGZA 4AN1A 1A8SA 1FXWF 2GR9A 2ZYRA 1DADA 3I01M 3DV0A 3C7CB 3CN7A 4CM6A 3IEXA 2V0GA 4C20A 5C5DA 3D9QX 5A5GA 1SCKA 3CRVA 1RRFA 3IP3A 3QXHA 1IXSB 1U9YA 5J2UB 3V33A 4HV4A 2RIRA 4A9AA 5C5IA 5FEMA 5DSXA 2QL6A 4H1UA 4BX9A 2A4KA 1HOXA 4WA8A 1V11A 5LMZA 4XFKA 4QUEA 4XQ0A 2A14A 2PD3A 4H2DA 1QPGA 1Z4OA 3R7FA 1XVAA 3BIXA 1E79A 2OILA 2R84A 3CR8A 3D59A 4MHOA 1ZXBA 3GJ6A 1Z17A 2Z1NA 2ODQA 2QX7A 3K1JA 1RCUA 4KV9A 5HDBB 3V8NA 1XNHA 3OETA 5C7LO 1P18A 3ZTYA 3BMQA 1V1MB 1TMYA 1JPNA 1IEQA 2VRWA 2QGFA 5DX8A 3TX6A 1X94A 3TUJC 3I6QA 5KTPA 1Y89A 3PC3A 3R9XB 4MO2A 3QVOA 1EJ6A 1GFSA 4TWBA 2Z6QA 5JMOA 2BM9A 3L49A 3TE7A 5EJ9A 1MX1A 4Q1DA 4QUDA 4X9XA 1VLJA 2NXCA 4IH4A 3ECCA 3WO0A 5EE1A 4Z9BA 3E8SA 4WWHA 4MHSA 5G1PA 3DBRA 5CIQA 2J7KA 1FW6A 1E0AA 1DAKA 2O3RA 4FFWA 4RO0A 4DA8A 4UEJA 2H5EA 1TVKB 1Z5NA 1EDOA 3I1FA 2HWWA 4PZAA 3VKWA 2JZCA 2IOYA 2R7LA 4WSOA 4DCPA 2PRYA 4DQKA 2CD9A 2H2WA 3UM9A 3BD7A 1RIFA 4EHJA 1RKBA 2D5AA 1RS0A 4UVEA 4X45A 5BQPA 3VGJA 4HGOA 5A4MS 3C6MA 4U7DA 3TD2A 3MN1A 4PQYA 4B47A 4BBPA 4E5SA 4P86A 4BUJA 3JVIA 5LYYA 2ATXA 1QIHA 1F8XA 2OO3A 3PNKA 4KVFA 2QX6A 3ANTA 3U7GA 1O9BA 3FFBA 2C4NA 3PKJA 4R69A 2F48A 3GLFB 3KR2A 2B3TA 2JJ1A 1X87A 2CNNA 3AF1A 5DNAA 1JDBB 5BMVF 4DMMA 3UWSA 1E1RD 1M0SA 2X2EA 4G0WA 5CR9A 4N9WA 2DOKA 2FX5A 4A6XA 5EHZA 2O8DA 1FTGA 1T6XA 2VBFA 4GVLA 4AQYB 4BLSA 5ILOA 1ST3A 3HR8A 5IC5A 4C3ZA 2DGDA 1G2IA 4NL4H 4OLHA 3ZHXA 2GKGA 4HEA6 5EZYB 4DQLA 1Y4ZA 2J6CA 3FHTA 5EEHA 4AW9A 3A1VA 3AEUB 5K0SA 4PQRA 5ALOA 1ORDA 2X8JB 1ZSVA 2P9CA 4MPRA 4U6NA 3S27A 5AK4A 3PXCX 4B84A 1W2GA 3GAAA 1TYAE 1UQTA 3DR5A 3TR6A 1YI8A 2J59A 3H3FA 1FTWA 4FMCB 4N0MA 4MI6A 4HVLA 2X5OA 2JRCA 2NO7A 1DV1A 1HFJA 3WG9A 1HG0A 1VMKA 2CHFA 2UVQA 2R47A 5KYXA 3KVNA 3OJCA 1AOXA 1C30A 3ZW8A 3HCFA 2Y9PB 5F3WB 1PSZA 1OJ7A 1NLYA 4DLWA 3RTEA 2XUZA 3UF0A 4OF4A 4BXOA 2YJTD 2FPWA 3GU3A 4WOPA 5BO5A 3TRIA 4I8IA 4YGYA 2SECE 5AHOA 3HCDA 4DLBA 1KYQA 3G85A 4RIGA 1DIRA 3ZY6A 1N9GA 4Z7QB 4CV3A 1ZGZA 3E58A 4YMIA 3ZXSA 1HQYE 3W1EA 4F38A 4JI0B 1NR1A 3IDOA 3P2JA 4NJEA 1EGAA 2WFAA 3KJFA 3O73A 3OZGA 1NT2A 4K86A 3FPAA 5JPIA 5TGTA 4GI2A 1DBPA 3QKUA 5AH0A 4H1HA 3CEAA 2XMZA 2I34A 1CRPA 4K6CA 4EHBA 7REQA 5LZ4A 3A1TA 1RLIA 1I13A 1U3WA 1JDSA 1KA9H 4Q3EA 3A9CA 5B5SA 1KVSA 2BHTA 3GJQA 1SKQA 1SOWA 3DOOA 3HU5A 3KR9A 3OZ7A 5DYWA 1FSGA 3EGXB 5HKAA 1UK6A 1ZIDA 5JYEA 4PS1A 3TQRA 4H7IA 5CLIA 1U7DA 5JD6A 1CX9B 3DAGA 2C82A 1I7LA 1L5LA 2VPPA 1H6DA 5CTAA 2XKAA 3GUUA 4DHWA 2BKLA 2WU1A 3N6XA 2C31A 1VMEA 3HL0A 3KQOA 5AKEA 1XJCA 2WF9A 2GZAA 2I0FA 4XIGS 4NDNE 1FDWA 2VP3A 2QZZA 3F7NA 1ZUNB 5MFPA 1NOIA 4DY4A 4OSOA 1P44A 3TLGB 1Q19A 1T0UA 3L1IA 4ERXA 1N0HA 3EXHA 2VK8A 2VF2A 5I6DA 3HKBB 1U2RA 1VIAA 2XVAA 2WAXA 1M1ZA 4HKTA 5K3FB 3QKRB 1DX9A 1OWMA 4GIBA 1OREA 2XQKA 4DJEC 5KHLB 3V4VB 1CZNA 1YR1A 2XBLA 1PR2A 2ACWA 2ORVA 2G1PA 5ADUS 3NFYA 3UKOA 4W82A 2M6KA 1QR2A 3EDOA 1HWYA 3LGSA 5L95A 4YP7A 2WDPA 1TQ4A 1LVGA 1N0VC 3VMMA 4NBNA 1E3EA 1Q3HA 4H3KB 3BYZA 4FYKA 1N77A 4LJYA 1F1JA 1FX0A 3EEIA 4KPUA 2CXRA 1RWNA 4UJ5A 1NW6A 3TAHA 5IF9A 2ZS7A 4COOA 1KI1A 4B6JA 1J06A 4D81A 4L0MA 1RQGA 1WD5A 1GT91 2OHOA 4PG5A 1E2UA 1RAFA 2C7VA 2BFNA 3C48A 3C43A 2FMKA 4YWJA 4JQYA 2QN3A 2G36A 3GFOA 2OCLA 4LF6B 3DZKA 4HH4A 3VVBA 2A59A 4RZSA 2L19A 2EF1A 3GCDA 3IJRA 3EWSA 3R3JA 1BQEA 3FYUB 4G97A 4MICA 3JALB 4P9NA 3WDKA 3WJ7A 5L4SA 4KI0A 4TWAA 1NFQA 1VL0A 3U80A 3DAPA 1G59A 5FA6A 2CDCA 1UJ4A 5DWVA 1NLMA 4WXRA 2YV4A 1Y0BA 2VH5R 3PNOA 4WJZA 2GAOA 1P7ZA 1AT1A 2O0JA 3II6X 4RSHA 5CVVA 1QNFA 2ECFA 4ZZ1A 2YHAA 3S7ZA 1U4OA 4MRMB 3JWEA 2NXEA 3EAFA 4ZANA 2VLBA 1S89A 3ETNA 2QZ9A 3QE0A 2Z3ZA 3GLIB 1B26A 1GNQA 3DOUA 1VCHA 3F90A 4NOKA 4I1OA 3OLXA 5BUQA 3ECSA 5B3KA 3BICA 1I9GA 2Q5CA 2YJ3A 3CIFA 2DFPA 2O0KA 2O4CA 2BVNA 3HK2A 1VSTA 1H2EA 4HUJA 3W5IA 3I32A 1JR3E 2CK3D 4RE5A 4C4TA 2H4JA 3AEZA 3SEZA 4YALA 2PZFA 2C9CA 4OFZA 2HIMA 2OPBA 3KOMA 2ZVQX 4BUZA 3I62A 2JBAB 5TVGA 3HTXA 3ICOA 1HLPA 2AN1A 2OT3B 1C2TA 1E1RA 2ZB3A 3N7UA 1Q17A 1JBKA 3C1AA 3E9YA 2N0SA 4LWQA 2A5DA 1GLGA 4C4RA 3H0CA 1OAKA 2OOSA 2I71A 4C88A 1Z07A 4R40A 4A8JB 2IV3A 2GEKA 1BCRB 2H3HA 1A4UA 4PTZA 3H1GA 3MJCA 1BGVA 3GFPA 4ZU1X 3ZE1B 4F6LA 4JLNA 3A6PC 4XCQA 3RC3A 2PMFA 4N9QA 2FOXA 3RF6A 5CVTA 1YO6A 1C0KA 3FWYA 1UIMA 3NP7A 4P7FA 4DJDC 3SIXA 1RHJA 3A2NA 5LDGA 2PX0A 2IU0A 3U3JA 4ARZA 1K08A 2IHTA 2VHTA 4US0R 4CKEA 4EARA 2H1LA 2OGWA 4YRCA 1E2EA 5K9ZA 1LBIA 3OH8A 4GLJA 3T15A 3GCWA 2PFKA 4BS9A 1ZK4A 1T0PA 3OJXA 2VN8A 3DUFB 1HMYA 2W8BB 5JNVA 3S1LA 3WLNA 1XQ6A 1A97A 1FTQA 1LDYA 1MXFA 5AI5A 2JIZD 3PP8A 5T6MA 4BBAA 3CS3A 3E15A 1GPKA 2D59A 4JFRA 2E18A 4DR1B 4QGGA 2GAJA 4OGKA 3KB1A 4QYIB 4XSHA 2EFDB 4YMSA 3LLVA 2A5JA 2UYOA 3I2JA 1ZIYA 2JIDA 4PF1A 5THKA 2W6ZA 5F21A 2ZITA 3LK6A 4RLQA 2GK3A 3V5NA 3HRHA 5CT6A 2IW3A 3IX7A 4G5YA 4KYUA 5FI1B 4MV0A 3U5ZB 4KVZA 2H63A 2V65A 1OLSA 2XUKA 3F6EX 4MQLA 3TQFA 9LDBA 1EMDA 5JS6A 5DGDA 1KJ9A 3EF0A 4OUKX 3PYLA 5ILGA 3T1NA 3TFOA 4AJNA 1T2NA 2WJ4A 3O6VA 3SKXA 3MLEA 4R1TA 1K8QA 1CCWA 1XEWY 3A4NA 1CDZA 5CT9A 1TPYA 3NVMB 4G2TA 1HR0B 4NBWA 1CUCA 1USVA 1PDWA 5FUYA 1UMKA 1ZBDA 3IIKA 3LBAA 3LOUA 4K9MA 5B30A 2H54A 2BTEA 2J9FA 1SURA 2XUAA 2FPSA 3CNBA 5L6MB 2ZU0C 1G5PA 4TMYA 3KEMA 4XDYA 2QP9X 4P93A 5CT8A 3F98A 1FFEA 1Y8AA 5G0SA 2XCSB 1JA9A 3SHOA 4BVJA 1YAJA 3JD0A 1T1GA 4MQMA 3EVEA 3BAZA 3BPSA 3L2OB 3NYIA 2VAMA 1X6VA 4X3OA 3L0YA 4BNLA 3DMTC 4KUEA 1S7CA 4F3YA 3VYVA 1WULS 3ND6A 1NXWA 2ODWA 1G8HA 3SAJA 2VJMB 1ENPA 1PLJA 3H9EO 4JLUA 5A1TA 4GMXA 3STVA 1DKPA 4L78A 3BIWA 2GD0A 2PNJA 5A4DA 1F0PA 5KTRA 3ROKA 5ALRA 2G4LA 3QGMA 3RG8A 4UMVA 4ECAA 1SUCA 1I3CA 4A4DA 3HKDA 1UMDB 1WR8A 3KKMA 1L4BA 4FBGA 4M53A 1LVUA 1NNUA 3PNYA 4UARA 1OH6A 3BDIA 1XPRA 4IXNA 2AFHA 2N1MA 1NY6A 2GFIA 4CMIA 2JLRA 4P35A 5KNDA 1V39A 4NFLA 4QL3A 1AHPA 4RX1A 2R8YA 4HWSA 4CF5A 2BH2A 1L7VC 2H29A 1HM5A 2PKRA 2I7XA 3DBRB 4OHUA 3THWB 2Q28A 2VJYA 3JAWA 3RW9A 4LXGA 3TIXB 3DE2X 3RE1A 2QYOA 3PQ4A 3OKAA 2LR0A 3U7RA 2XBUA 4EG4A 3TW0A 3T7EA 2M9MA 1AHNA 1XCBA 4OB8A 5I9SA 3BN3A 2DKNA 5D3MA 4K46A 1MO5A 7ABPA 5LP6A 1HKUA 1FTSA 4G09A 2BCGY 2WA2A 1V9LA 4DR4B 2GTIA 2QR2A 4LOKA 3AFHA 5CT4A 4IDCA 5I7OA 1EYZA 2J9GA 4KGZA 5BNIA 3IQDB 3I04M 2HJSA 3Q7TA 5LQSA 4QKQA 5JO0A 2Z56A 2PKXA 5TXGA 5KOHB 1D8AA 2IODA 1WB9A 1UP4A 4JI6B 4E03A 4ZHQA 4FR2A 3EH2A 3OA2A 2LDXA 4RWZA 5JARA 2BDUA 2EIHA 2PIDA 2ST1A 1Z6XA 3P94A 1Y4SA 4WY5A 4GQBA 4JR1A 1GG8A 1U11A 2C4VA 5JHHB 4PWZA 3EW7A 4L16A 4DDTA 3K4QA 4K6KA 5IVHA 3HEAA 2YL2A 4ZOLB 3DTVD 4OYRA 5KU1A 1ZNYA 3AUKA 3AJRA 4P7JA 1VI2A 4KMRA 4G0PA 5K0LA 4YMWA 5DM60 1PQYA 3PBKA 5CFZA 1F0KA 3ISJA 4I55B 4TPKA 5F2OA 1M72A 5GM2A 1K88A 1OASA 2Q21A 4BO3A 4C7OA 2F1OA 3OCWA 4N3AA 5ELMA 3I34X 3QF7A 3CH5A 3HY4A 2JEYA 1RYHA 2Z0MA 5CW1A 1U3UA 5K1ZA 4PEVA 1XVTA 1LSUA 1RTTA 3IERA 1GRRA 2C0QA 1KORA 4GL4A 4D98A 4Z3KA 4RK0A 2V5UA 1WW2A 5IVIA 1K7SN 2Y1WA 4HGRA 4EFNA 4X62B 3MK31 1SO8A 1W44A 1YUMA 1NN0A 2R6DA 2ORYA 3NJ8A 1NVEA 2VWHA 3DBOB 3CQ9A 3O26A 3PUYA 4LCEA 5CGZA 1WSDA 3KQHA 1UBTS 2BFCB 1ZL2A 4ZAFA 3K0AB 4DRXA 3HABA 5CNKA 1O96A 4ZAWA 1IJFA 1OAAA 1OYOA 2IV7A 1IPFA 1AHIA 4G5GA 3O8RA 1E59A 2YWEA 3F49S 3GGDA 5ECDA 2E87A 4CKCA 4KSBA 4GX5A 4YMHA 4RPKA 1TO1E 1YL5A 1PK9A 4ALMA 4EZIA 5KU7A 2ZM6B 4IUYA 4ENQA 2Z6UA 3X3HA 4DMHA 2PUEA 1NVKA 2JEOA 3OMWA 1XRNA 4URZR 4EGFA 3ACDA 2JASA 2C0PA 1QVWA 3LBIA 3JVUA 1JIUA 3KD3A 2A7QA 2OG2A 3D2CA 3WYDA 4BFXA 2YNMA 1DBIA 1P29A 1RAGA 3H2SA 4MGIR 3RV4A 3P2IA 1JV2B 3HCPA 3VKFA 1G21B 5CLQA 5ICMA 3ZTWA 2ZCJA 3THSA 1NXOA 1KZ4A 3AI2A 3ZI4A 4DDHA 5I4KA 5IEJA 1KFCB 3C0KA 1NVUQ 3L05A 2WAMA 4J0EA 1OA0A 4QSMA 2IP2A 2NADA 2PJUA 2ZIVB 3RT9A 1UDXA 3EXEB 2L18A 1ZO8A 3KKLA 3N74A 4D9EA 2I78A 5IDQA 4MWCA 1RBMA 3EULA 3WBBA 1BJKA 4RH0A 1AG9A 3Q7EA 5E0OA 1XHFA 1XZHA 2AQKA 2MSNA 2HY7A 2FRXA 3HJAA 1RYNA 3N8GA 1XXLA 4HNQA 5GQSA 2ZRFA 3E2MA 2R60A 2L0XA 2DFKB 2P79A 3NTOA 4PTLA 4O4JF 3IMGA 1GN9A 5EJEA 1RVV1 3QMWA 4Z1MA 3C3BA 1JLLA 1M1NA 5FLKA 2Z5LA 2OV8A 3H1EA 4Y2UA 3UKJA 1Q0UA 2FMXA 5A9SA 4ZCIA 5ETJA 2IPNA 3IE1A 1XALA 4GUAA 5A71A 3TVDA 3VTZA 5EMLA 1MAUA 4JOSA 2RC6A 4YO7A 2GD1O 1OHHA 2PSSA 3MTBA 1Z2EA 1IRIA 1YVEI 1GGFA 1JHOA 3QLJA 2Q1YA 5FOWA 1BWSA 2IEYA 3DUWA 1PVVA 1FNBA 2DFLA 1L6RA 1V2HE 2XDAA 3FCYA 3FWPA 3BDVA 5AXBA 4LG1A 3REOA 1D4OA 2H8GA 2Q9CA 4YJ2A 3UXEA 3AR4A 2EJVA 2YWJA 1W52X 3EA5A 3Q3EA 4NRDA 2YCBA 1G1MA 3CZ9A 4IICA 4IFEA 1I7SB 3FOZA 1XP8A 2GCIA 4P7BA 4PIMA 4R6WA 4B3GA 4RS3A 4UBMA 1BS2A 2O3QA 3HLKA 3HADA 2HREA 1KI6B 4TT3A 4IJVA 3PEVA 4AN0A 5CHEA 1IDOA 1AQNA 2DPHA 1WD7A 2O7RA 1YJAA 1W30A 5IAAA 4B6OA 2ZJZA 3NT2A 4ZO6A 3Q4GA 2Q3CA 2HT6A 2A67A 5EXTA 2WOOA 4N0DA 1OI2A 3NEJA 2BP7A 3OJOA 4B3CA 4LVNA 4HVCA 4JL5A 1S96A 5ADWA 5KSOA 4MUYA 3IPLA 1THGA 1A9TA 4MQ5A 1YVDA 3LDUA 1OXMA 2QZSA 1G6KA 1S2LA 2RAFA 3ICVA 1EVZA 3MTAA 2ZYWX 3O94A 4A2CA 4K0KB 4P08A 4FHCA 1IB6A 3PCTA 3KAPA 1VGQA 2Y1OA 2IL1A 1Y9JA 4DA7A 3TKYA 3A6GA 3PQ2A 2HJGA 4WY8A 1JIKA 1QO0D 3BB3A 1B74A 3HCCA 1S2IA 3WGGA 3PC8C 1FTNA 4JLPA 1T24A 3FSEA 1GPWB 3HBLA 2J3MA 1BRMA 4MSUA 1KZ6A 3AM5A 1N9ZA 3DPIA 4B46A 3KU4A 1L8LA 4PYRA 4CHTA 4YIHA 4TLDA 5CEFA 4MW1A 1YQXA 3OTGA 2GRAA 3DV2A 1AVTA 4Y6GB 1L4LA 2IV2X 4H35A 4OM8A 1KGDA 1G3IA 2LPMA 3L0IB 4UAVA 3TGWA 4M36A 5E4TA 4JC8A 4EJSB 1CUFA 1OQAA 2ZS9A 4Q00A 4UHJA 3IMKA 1OPXA 3EIQA 4OK5A 3U48A 3AUYA 4DJTA 4BMZA 1UDAA 3GZNA 3KBBA 3PIDA 4HUQB 4JOQA 2EW8A 3AJ8A 4KXQA 3VHXA 2DEUA 4C2TA 4UDNA 3MTQA 5IEBA 3KT8A 2DTXA 1SKUA 1MOQA 3VDMA 3WYFA 5CMLA 3VXKA 4CODB 1CF9A 2JLZA 3CRMA 1G7CA 1JTFA 5DLDA 4X95A 3RVDA 3RV3A 3CVYA 1M8JA 1U5BB 3BB1A 3PC2A 1L4HA 5E7MA 4P98A 2VNIA 3PDUA 5G4KB 3HDYA 4HFMA 2EERA 3BXGA 2IIVA 4LRUA 3UW3A 3ACCA 2NU8B 4LYGA 3KVVA 1X8LA 2IDKA 3HBJA 2CSXA 1HL7A 1SOUA 3UPUA 2C4WA 1DBRA 1J24A 1M2JA 1YRHA 2V03A 4JAVC 3CTMA 4QVGA 4K9LA 1YZTA 2NN3C 5ALLA 3W6PA 3ILXA 2EF0A 1TVMA 4AS2A 5FWXB 1P77A 1Z0AA 1A7AA 4FEGA 4J0CA 2Y67A 4PG4A 4OQXA 5LJLA 4NV1A 3BHJA 5ENZA 4X8MA 1KTVA 5EWLB 3VH4A 4Y30A 3RU9A 2EGGA 3G2LA 1R6UA 2OXTA 1YR6A 2C96A 3DF9A 4ZC8A 3SFZA 4CTJA 3LFUA 4I7EA 1Y7TA 2GOYA 3I83A 4J2TA 3WADA 5JDIA 1CY1A 3VZPA 1GN8A 5IUKC 1T5OA 1ZXXA 1GTVA 5B58T 1IHYA 1YI0A 1J23A 2W2TA 4O0LA 3W1VA 5CA1A 3ONWA 5EJ2A 4BKMA 3AR5A 3M49A 1FU4A 4HEQA 2LRHA 1A2BA 1OBHA 3MD0A 3UXMA 2X42A 2HSGA 2AFHB 3OZDA 3V1KA 2QLLA 3N70A 3SVLA 1Z22A 4Z1OA 2VDUE 2HA6A 3ZJ5A 1UMDA 2PUBA 2ZKIA 1YVUA 4YX9A 3A10A 1WTCA 3T52A 2PUCA 4R1PA 1IMJA 2PPVA 4C76A 2XCTB 3KPJA 1ZGCA 1N7IA 4CQMA 1JG1A 1LI7A 3H04A 3VJMA 3K1TA 2WWTA 2OBYA 4I19A 2GAAA 2ZSBA 2GKOA 1XKQA 3L8EA 3LTEA 1V6CA 1ZA1A 2BELA 2W2LA 1X1TA 3Q0EA 4LCBA 2ZSKA 4BCBA 1VHTA 1U3GA 3AVQA 4JIMA 2BSQA 2ZE5A 3RTBA 2JLYA 3GK3A 2C04A 3C3KA 4M86A 2A0FA 1OLUB 3GAZA 2B9EA 2G9QA 1EP9A 1GL7A 1Z3CA 1Z39A 2RGDA 4OJYA 4POOA 4YCCA 2ZRDA 5TV2A 1PUXA 5AM4A 4P7KA 3MTGA 4RMJA 1SG0A 2F67A 1CS4C 5H8WA 4ARVA 3KOZA 1EK6A 5IT4A 3H5OA 4KQJA 2JI4A 5AOAA 4MNTA 3M4JA 3TXAA 2PIAA 3UBTA 5I7SA 1KJIA 2P9TA 4CR7A 3REFA 4RQTA 1Q3KA 2LIVA 1OXXK 4MUAA 1NF8A 2OFXA 1W8DA 2QG4A 2RGNA 1I4LD 3O3OB 1GCOA 5DHQA 5KSPA 2RMKA 6LDHA 2BYTA 2PU7A 3I2YX 3J7TA 5GONF 3DA8A 4XM0A 3TTYA 5KTKA 4E1VA 2ZIXB 4PPNA 4CKWB 2BR4A 1TM7E 5L3QB 1UC8A 3VHRA 5KNDH 1ZVVA 3LY5A 1ZUD1 3BQ9A 4O4LA 4D3XA 1P1IA 1GL3A 4DLYA 2EBFX 2OE2A 4E46A 1HPLA 4KH1A 2RHHA 4UPVA 2OCIA 1R0LA 4ALIA 1EI9A 1Z06A 5IP5A 2VQEB 1RRVA 3AF0A 2AL7A 4N40A 3C3CA 4Y8VA 2Y0PA 3LT5A 4QX6A 2RC5A 3H7AA 1BGWA 3FLMA 4M88A 3IQWA 2EJUA 1F48A 1W75A 1IM8A 4Q4HA 1TMKA 5EERA 3VNBA 4TL9A 1KNXA 2ZP1A 3DOCA 1A9XA 4WK6A 1Q0HA 2NW6A 3HVUA 2LP4Y 2PS9A 5EXXA 3B1ZA 3T1HB 1ZJ6A 2DWUA 1TB4A 3BD9A 3EIHA 3NOXA 4ZCQA 3SFVA 1GQFA 2VOEA 3ZWMA 5TMPA 4OH7A 5GVRA 4A8TA 3DR3A 4G2NA 4E5VA 1X7YA 4JJZA 1M83A 3EVNA 1SD5A 4Q34A 1EXMA 2OHJA 4IXTA 3DOHA 4LXQA 4YK7A 5CD1A 2IYWA 4HMOA 3Q7SA 2PPLA 4MYRA 4IS2A 4DMCA 5HUJA 2OBBA 2P65A 2W48A 5F5LA 5JH7B 1ZM3A 1UJCA 1A9SA 4FDTA 2JIQA 5AKLA 4GD3Q 3E23A 4H27A 4LVOA 2FN4A 3KJNA 3DOIA 3OTQA 1NVXQ 3F1KA 1ETUA 2FUG1 3I4LA 1BX0A 1CDOA 1C0EA 1T34A 4LS3A 1YQWA 5LQNA 1HZZA 4NAHA 2XDQA 3CW8X 4DBLE 2HJWA 1GZHB 1J22A 1RC0A 4BRWA 1SXJC 5JI3E 2Z6AA 1VKOA 4Y2SA 2O8CB 3PENA 2NUBA 4KR9A 3E9QA 4K8OA 4RHYA 3EFHA 1UJ2A 5COAA 2J0SA 3IUSA 4I5IA 1Y1PA 3O0DA 3GZ4A 3NUZA 3QH4A 4UUNA 5IH3A 4EA8A 4L07A 3NWOA 1JKFA 2BJWA 5IU6A 2HBQA 4HR7A 1Q7CA 3WL6A 2X6RA 2YZ2A 5K2OA 4A5SA 4J03A 4UNIA 1GJRA 3S5JA 4QEDA 2GNOA 2VI5A 3THOA 1XRRA 4DZRA 1O89A 2VNJA 3OESA 2BEWA 4RELA 4AL4A 3K8ZA 4L4YA 3AG6A 1UL1X 1SKMA 1NPTO 1XJ0A 4E2WA 1G2OA 1U28C 4MDYA 1LXCA 1HNXB 5L6LB 1U2GC 1N2EA 3UOWA 4AJ2A 3L9WA 3B78A 1V7QA 1N7GA 3BJZA 7MHTA 2A7XA 3WKEA 4CZ2A 2BTQA 3G1UA 2G1JA 3NTUA 1ZA2A 3MIZA 1T1IA 3K09A 2YKGA 3MCWA 3L0DA 3PGA1 1E7YA 1VIDA 4XJTA 1EZ1A 1X2BA 2HU7A 2MSCB 4Q7JB 1RI2A 3SX4A 1RLMA 3IAS6 2DQ4A 2ZRBA 1WKCA 4PSKA 2ZWIA 2QD1A 5JSKA 1WMSA 5C9ZA 2H1SA 1U8UA 3AFMA 3PE3A 4A10A 1VYHA 4KUGA 2UYCA 2IS2A 3AV3A 4EW3A 5A1JA 2Z43A 5IC4A 2XNJA 4FQ5A 3T61A 4BNGA 2ZPUA 2PAAA 3V42A 3ZWAA 4TKVA 1AE1A 4YRMA 1QTQA 1AV6A 5LQJA 2QAGC 2NWQA 1AKYA 4C6SA 1NF3A 4KE8A 1P2VA 1G21E 1HI9A 1MQ8B 5JVDA 5JADA 1VKJA 1I7NA 3CURA 4DFDA 5D3MB 1RSZA 3QITA 2ERYA 3DDNA 5C8YF 4ND8B 1VP9A 3Q8XB 1A2QA 4TN5A 5JZVA 4YRTA 2FYTA 1HDCA 4MEAA 3RVNA 2AUMA 3DLAA 3PEWA 4KZPA 2Y6VA 4X1KB 4B81A 4KO4S 4WE3A 4RDCA 4B3TB 1P0PA 5AIAA 5KJEA 5TY0A 3HSKA 3G2IA 4ACAA 5CA0F 5IUNC 3EGDA 3GDHA 4ID9A 4OL9A 4PFJA 1UBKS 1B2LA 4IIDA 2O2SA 2ZI3A 1QPZA 2HSJA 2RHBA 5DSZA 4X64B 1QG4A 4B9AA 2OFFA 5DTIA 5JCOA 4BMVA 3NO4A 4LDQA 4DLSA 1EFLA 3E5NA 5E2BA 4D44A 5JAHA 3VBCA 1KDVA 3WISA 2JVKA 1GRVA 4I1VA 5AESA 4JC5A 3AUJB 4DLVA 1US8B 3STWA 2P9GA 2EYUA 2ZYUX 1U6KA 2ILTA 4XWAA 1XC7A 4Y3UA 1M1YB 4JXJA 4OQ4A 1KR5A 4UXJA 1J5PA 1E77A 4GC5A 5LWHA 3H4TA 4E1AA 1Z8FA 2FRDC 2P5TB 3HU1A 5CPFA 3N86A 2ISSD 3W6ZA 3SVTA 3WAGA 3HB7A 3HNRA 4WBNF 4DYVA 4R3NA 4UHEA 1A5ZA 5ALIA 3HU2A 4L72A 4AP6A 5C81A 4RW0A 4TMXA 3VR2D 2HGZA 2ZU6A 4TVKA 1XE3A 2DHDA 4MGYR 4E5UA 4GX2A 4KDEA 3ZD9A 4JWTA 4ZARA 4HZUA 3T7SA 1KPHA 2H7YA 3H5RA 2I4TA 2E49A 3C97A 5TQ2B 4IM7A 3I58A 3ZHTA 1K6JA 4EY8A 2BRUA 2Y77A 3M6MD 1O0SA 4WLOA 5BSVA 5KSYA 5CVCA 4BX3A 1RKQA 2GD6A 5GAJA 4CDRA 1I7QB 1NWHA 3OT5A 1EGMB 1L7QA 3PDHA 2D6FA 3ANMA 5A9TA 3SKYA 1TTPB 1HETA 4RADA 5HVNA 1Y3DE 4ZVRA 2HNKA 4P2BA 5KWJA 1J97A 2NT4A 4ZOBA 3IMFA 1DL5A 1W9MA 3E6AA 2IS1A 2UUOA 4DA4A 4GOND 4K81B 4CM7A 4Z99A 1GUBA 5FNVB 3OQMA 1D0SA 2IXFA 3C7KA 1XCGB 3TJZA 3VOBA 4DY6A 2OV4A 2YHIA 3W3ZB 4CF3A 1QZ3A 3GZNB 5HIIA 2QB5A 5BSUA 1EIWA 4BGUA 2MYTA 2QEQA 1G20A 2MMGA 5IN5A 3F6YA 2HFJA 2XF8A 5MGNA 2IIPA 2Z8ZA 5CDHA 2HHHB 2Y1DA 3MTDA 2XCIA 1BE6A 2JCXA 2JF0A 2YRXA 1SZDA 1J5EB 4LMRA 5FD8A 1JJBA 1YOBA 5C37A 1ONBA 1N6OA 4ZDJA 1PNTA 3H13A 3G2JA 4JEUA 3UUFA 4C4PA 2JCGA 4CYMA 3IEMA 1H9CA 1T8UA 3CJQA 2O54A 5IH7A 2QX4A 3QF4B 1UFQA 4XWYA 1M0WA 5E8JA 4D0NA 4R51A 4EMBA 4FKMA 1MVNA 3HY3A 4E4TA 2QE7D 5KHOC 1DKOA 2V6IA 5EL0A 5TQ0B 5B1IA 1S5PA 3SBXA 4D7AA 5IW8A 3C98A 1GY8A 4JLMA 3C8ZA 2WW8A 4QU5A 4O59O 2VSXA 3UANA 1LW6E 4IQGA 4ZYTA 1T29A 1MW8X 1FY2A 1E64A 2WMOB 3TFWA 2CWWA 1W35A 4MW5A 3KQLA 3HUFA 1J1IA 1MD9A 1Q57A 1Z7GA 2QJWA 4BKUA 5ENDA 4EATA 1VA4A 4B7ZA 4B8YA 1J8YF 1DPFA 1M5TA 2YDXA 2Z57A 3CC8A 4QT0A 3DS8A 4N47A 1VE7A 1O6FA 1JEAA 1JFVA 2QUHA 5IVDA 1P5FA 4HRAA 5FUQA 3GOQA 1IJEA 1Q1ZA 4GMDA 1QONA 5CDSA 5L51A 5LYJA 1ZH4A 3AR6A 2C7RA 2VSYA 3T1YB 4CG3A 4ZI3A 1K8YB 1FA9A 2J4CA 4BO1A 1EFUA 1R5OA 3MWLA 4GXRA 4ZYYA 1X7ZB 2X1HA 1NV9A 4UHKA 2ID4A 3UJ7A 1KY5A 4F7DA 3KOOA 5HPYB 1NNLA 1V16A 2BC9A 1PR5A 4RVUA 4KH0A 5EHIA 1U1IA 3R5HA 4M83A 1FOEB 1JHZA 2IP4A 4XAQA 5AJHA 1XRPA 3I01A 3KLOA 1TTTA 1ESEA 2OWDA 3K8YA 4KWCA 4U7TB 1M2HA 4G89A 1U1DA 2VYNA 2BR3A 1CDDA 1Q83A 3PI6A 3MOGA 2ZCVA 5HG0A 2ZK7A 4F0JA 1GPBA 3SPXA 5DN6A 2GUWA 4BQPA 1A72A 1NQOA 4FFRA 2ZIFA 4W7HA 3SDSA 3A1EA 4R2WA 4EDFA 5HX7A 4BNMA 3NP9A 4GS5A 5LDDC 1PJBA 5EWMB 4Z9FA 4CM9D 2MSDB 4CETA 1N1MA 2DHQA 4LAFA 1NDUA 4UUPA 5E4JA 3AVTA 5BNZA 3PHIA 2UVDA 2PL9A 4DLPA 1KJQA 1SBCA 1FUYB 5GZ1A 1SC6A 2YOHA 3PPYA 3TZHA 2C2ZA 3T99A 2ZLBA 5CB4A 1W85A 1S8OA 3BG5A 4QT4A 2YV1A 3M6IA 4MUIA 4CLHA 3L46A 3U56A 1GM5A 1CF4A 5DTQA 4K1LA 4U2FA 3BXOA 3LUJA 1PWHA 1DUIA 1XA3A 1V96A 4LMBA 1ZUHA 1KZYC 4HOYA 1C1HA 1C41A 2ZYDA 3GEDA 3M1IA 4FN5A 4LDPA 2AT1A 4YJ3F 3OWXA 4B73A 1VYVA 5AI8A 4J2HA 4OKIA 2NVUA 1NUSA 3NFRA 4HADA 4LHYA 6Q21A 1QV6A 2OZPA 1L5FA 4DSOA 5K3SA 3TNYA 1KDPA 5KJ1A 1A88A 1BS9A 3MJFA 3B1YA 1D4ZA 2B34A 2MSLA 2CNOA 3I2GA 4MO9A 1QRSA 1ZJZA 3O0TA 3GIWA 5FA8A 1VJ1A 1SQ0A 2P9EA 3JYNA 3LNTA 2C8JA 1C3XA 2FUEA 4GMFA 4LY3A 4N18A 4E11A 1FBTA 2PV0A 3ADCA 2Y68A 2BIFA 2HL6A 4IZIA 3AIIA 3W6UA 1K9VF 2L17A 3ROPA 3JASA 2NO6A 5DIFA 5AVKA 4X63A 3TZKA 2PVCA 1CRWG 1S4MA 3WO1A 1NNEA 1DCTA 1U81A 3V32A 1N5KA 5D01A 4YV2A 1B00A 2ZULA 1MJGM 3G5LA 3PRKE 4ZVTA 4FKBA 2V9PA 4MP8A 3R3YA 4GMHA 1QP4A 1Z34A 4LTMA 2Z9DA 5CGQB 5BN1A 1RD4A 4KHZA 2UZ0A 4CQMD 5A7FA 4ZI2A 2GF9A 3HPRA 2WYIA 4L6AA 3T95A 4RK6A 3UW1A 1CBUA 4EF4A 1N3YA 4OU5A 5JPDA 4FJ0A 3TB4A 3G8CA 3PC7A 1E98A 1F4LA 5FWYA 1BHQ1 2A4MA 1C1XA 4AYTA 4MUMA 5FT9A 5GJBA 1WS6A 4B75A 5DNWA 2JGKA 3MCTA 1FS6A 1RW4A 2DF8A 3UHJA 4ZYVA 4TV9A 2BFDB 1WUYA 4QXOA 1NURA 3ELBA 4A15A 2FMTA 3QWIA 3AR3A 2V6JA 1XKLA 3GJ4A 3M6LA 4IILA 4P4SB 3TNFA 2FUG6 2OO5C 4ENRA 1W5TA 3S1SA 5DWDA 2H4WA 4KMMA 3C4JA 4CMGA 3MT8A 3OJWA 2R00A 3HKDB 1BRTA 2E3JA 4B33A 5DNCA 5IXJA 1GTL1 2FPKA 4UE2A 4F6CA 4HUTA 1HUQA 4EFDA 1KU6A 3B3QA 3QLVC 1Z4NA 4CNBA 1GHTA 3JATB 1QF9A 1UK9A 2JCSA 3D2LA 4EHFA 1JAZA 1DG3A 4PIVA 1SZCA 3INRA 3QK7A 3SSNA 4CI9A 1P4HA 3BSFA 5F33A 3V9PA 1ZGBA 2W5UA 4UVGA 4BZZA 5M7EA 3GH1A 3ZU2A 5H4HA 4I1SA 4QFDA 4RKEA 5IAJA 3V6MA 1E9BA 1BXZA 5FPSA 3T8YA 1U2SA 3GT0A 1C1DB 5EZ5A 4HEA1 4L4RA 1IN8A 1N2CE 5IF3A 1W76A 1T5BA 3E27A 2W6PA 3I9MA 2GASA 1L4YA 3RRXA 3W90A 1NFRA 3UEOA 3GD7A 3ZLJA 1Z7BA 4FZRA 4R1QA 2C3UA 3PA8A 4RZUA 5HF8A 4DA9A 1CR6A 1YVPA 1PBTA 1NBMD 3EXHC 3THYA 1BWQA 1BXRB 3FCAA 3P9CA 2BLLA 3ODGA 4HX9A 4KCGA 5I9BA 1QV9A 2AOTA 2PJDA 2ZUCA 3FMFA 4IAOA 5CNIA 4BLTA 3I0ZA 1C29B 1PSDA 3KALA 1K5GA 3N87A 1E20A 4O5AA 5G40A 4CCWA 2FETA 1AIPA 1KFJB 1FLVA 3PYMA 1Z5VA 3IP7A 1X3SA 4ZVQA 4XSVA 3HVHA 4C3OB 4BMYA 3I37X 2FE1A 3UQZA 2Q3MA 2B1QA 3IAUA 4C0QC 2YBDA 5ER9A 5GP1A 1D9XA 2FAXA 1QUEA 8AT1A 1QIGA 2RHWA 1N32B 1YJXA 4UUAA 2EU8A 1SWWA 3ANNA 3JU3A 1UKAA 4QYIA 4R68A 1FQOA 3HP7A 2D00A 4R41A 1IG0A 4XUCA 1L4NA 4IJ5A 1N3LA 2OECA 3AEQB 4JUBA 1N2CB 1M7GA 3F9CA 4IF4A 1V8PA 4IDDA 4MI1A 3V4SA 1PU2A 3W0LB 1IRXA 3TAUA 1AB6A 1T26A 2LIPA 3DL2A 4F2DA 1EUZA 4M1SA 4N6OA 5FEUA 4B6PA 2XMCA 5T8KC 3X2EA 1R9JA 3OEEA 4I4NA 4OP2A 3ZZMA 3TO5A 3ETLA 1YA6A 4JT2A 4GP6A 3EBLA 5ED0A 2AG1A 4PO1A 3WLSA 2FPPB 5LOVF 3SJBA 1SBNE 4ZCPA 4EJ0A 3D3WA 4CKBB 3A32A 4E5NA 1YC5A 3UJAA 4HQNA 4BWVA 3JXEA 5AKHA 4EEXA 2XY4A 3OPXA 3ZWOA 2WLSA 1J8QA 1M0TA 3IHTA 4FT2A 3TSWA 3R0ZA 3NXSA 5AKJA 4U3JA 3CNNA 3LD9A 2ZYHA 5B55A 1EB9A 1P6QA 3E81A 5IMBA 1UM9A 4LZOA 1I94B 2CJWA 4XJXA 1KH3A 3KFLA 1DELA 1OX4A 1UDRA 2C92A 2F3QA 3I6YA 4V1CA 2HA3A 4AJ9A 1T5HX 4Z4EA 3AR8A 1PK7A 1VIVA 1LVHA 1MMFB 1OXUA 1OLXA 2CZGA 4ENUA 1G63A 2ZQZA 5JO9A 4CCYA 3SYKA 3U4QB 1FXSA 4ND5A 3WFIA 3MPOA 1SNYA 3D6TB 5KYUA 3TRJA 4BFTA 2A1UA 3AW8A 1NW3A 4IOJA 2DFTA 2W7TA 1RQ7A 4LA4A 2TS1A 1L7NA 2P1RA 1W0JA 3NV9A 5FOQA 1K4KA 1WXWA 3OPYB 3FZQA 2D5CA 1SVWA 4YONB 3SG0A 3TW8A 3USCS 4P54A 3ENKA 4HLNA 3TKAA 5BT8A 3D7KA 2R87A 4OHRA 2CMFA 1RLUA 2ZRLA 3EUAA 3HB0A 3IBCA 1YU9A 1I51A 1KMMA 2A5YB 4HD8A 5KCZA 1ISSA 1EX7A 1R8JA 4F92B 4D74A 3PKIA 5JTTA 1L1QA 3SZUA 1G17A 2FLKA 4JLSA 4PLPA 2ESRA 4HVAA 4UAGA 4EGQA 4FTWA 3J80A 1MZVA 1GU7A 2W6CX 2MMCA 1R8SA 1JEQA 1SC1A 1M34E 2DG2A 2J4FA 1Q1AA 3FZGA 1KYXA 3OFSA 5J59A 4M1OA 3A2MA 3IXLA 2AMLA 1V8OA 1XO1A 2HK9A 2HKIA 4JJ8A 1YL7A 3CX4A 2WT4A 5H81A 4CIAA 3NHFA 3H4IA 2CCGA 4QJIA 4DBLC 2QTVA 2WU4A 4W5WA 2FVYA 2WHRA 4AWBA 4WNCA 2MT9A 3BXZA 2NU9B 1HDZA 1CRQA 1PIWA 3DTVB 4GZ5A 1JVBA 3GLIA 2BT4A 3CSUA 3GA5A 1K5DA 1Y98A 4QO7A 4KRXA 3FTEA 4MRMA 4HQOA 1I1QB 1VQ1A 3E9CA 2QV7A 4WGGA 2IY7A 4ZZ0A 4EJ6A 2GHQA 2JFHA 2WIDA 2XODA 4UXHA 5F3RA 3VYWA 3LYUA 3RS7A 4ND6A 4DTIA 2UUAB 3DVRX 2ZJ7A 1PL0A 1WY5A 2V0CA 3FHCB 1TEZA 1X7GA 3H3XA 1TRHA 4S1WA 5DDIP 4FIDA 5GJCA 3O8OA 3UJBA 2JGDA 4FHFA 5J3JA 4X1OA 4U2KA 3UVEA 3RFUA 3OE1A 4GMKA 3EG9A 3LIIA 5C53B 2BHSA 4EI8A 4ABYA 1NBHA 1XKXA 2XF2A 4HT3B 2CJPA 5C51B 4LJSA 1Z26A 4QOSA 4CN9A 1WV0A 1VLLA 1QSGA 3NPAA 5B4TA 2DCMA 4LN1A 5BRAA 4F12A 1ESCA 4P6VF 1VJRA 2PLWA 2ZTMA 3RJMA 3FCCA 1RRGA 3KLMX 3GFTA 1U8YA 3ROGA 4YRAA 3INGA 4RESA 1DBWA 3NTRA 3VZSA 1FFBA 3OUTA 3OZWA 1CHDA 4PFQA 1Y5IA 4A8PA 5L3ZA 1W49A 5BVGB 4KQEA 2NZXA 4RHFA 1ODKA 1WXGA 2G0NA 4XD7A 3E1GA 4AAYA 4M8NE 5LUAA 1E79D 3U4GA 1D09A 2A9JA 1A1SA 1TLTA 3FVQA 1YQTA 1V1RA 1X9GA 3N0VA 3S2UA 3M1AA 2YN4A 4MJXA 4OBEA 3SIPA 4L74A 1CXZA 1SPXA 3HRKA 1XSEA 3MXTA 4RV5A 5EVJA 4DC0A 1UBGA 5I4IA 1KE2A 3CPEA 1BFDA 2QT0A 2XMPA 5FBLB 3RUAA 1RM0A 1JQBA 2C61A 4FYPA 4QUGA 3LBYA 4HSEA 1TKAA 1USWA 2AQIA 4IPTA 4YJKA 4ZA2A 2GJ4A 3K0KA 5DP2A 1F6DA 4O8CA 4CIXA 2FW6A 2NAFA 2BONA 3V9AA 4Y18A 4BECA 5B2EA 5JQGF 3VSDA 2XQVA 3OQHA 4JGGA 4HAXA 2VTDA 4B7UA 3TCKA 3R75A 5E4FA 2F4VB 4ETWA 4Q6BA 4U0JA 5DN6D 2IE0A 3HR7A 3OD5A 4M9SA 3ZBTA 3ITNA 5SZIA 5AMXA 2G25A 3ZHQA 3QXJA 4CKEB 4EX7A 2AFRA 1U28A 1U7UA 3IXQA 3N39C 4OEHA 1K97A 3ONEA 1ACMA 1P45A 3V2UA 3CRNA 5JUWA 3VTKA 1DQZA 3WQQA 3OTIA 4KX5A 3QXXA 4JB2A 1UWVA 2QZPA 1HT1E 3AP1A 1EFVB 3D4IA 2BMWA 2PWPA 3L7BA 4JA0A 4XB1A 5CK5A 4R1LA 4R1SA 3WWCA 4LFAB 3VO1A 1LS1A 3CKKA 1QQ5A 5DXFA 3RROA 2J7PD 4BIIA 4A26A 5L45A 1DFIA 2ACVA 1KJYA 4O1IA 3TSCA 5BWLA 3DKIA 2VJMA 3VX3A 1JXMA 4MR7B 3AB8A 2XLCA 3TPFA 3AMVA 1NFFA 5J63A 2ONZA 3EDYA 3PX3A 3CE6A 1G19A 2NUTB 3RK1A 4EKDA 4P32A 2R7AA 1QIEA 4UU0A 5JY1A 1KFKB 1O3YA 1CLEA 2REXB 2HBYA 2BMVA 1AXRA 3AXTA 5DLPA 1PT5A 1R00A 1WW8A 3LJKA 3VPFA 4B3JA 4CQLB 4KBGA 4CR6A 3CUSA 4N76A 2XMRA 3WIBA 3DNPA 3T5BA 3HB9A 3QVVA 1ZJYA 2IHKA 4I50A 2QUIA 2VUSA 4AJ1A 4KTVE 3L6UA 1WF3A 3ABZA 2HJ9A 1J0EA 3EC1A 1Y5MA 1P3JA 2ZIGA 3LOPA 4J3JA 4RAQA 3EODA 1Y6QA 1S01A 4EP1A 2G3YA 4C2BA 3L8FA 4EMTA 2R8XA 1L5WA 3EFOA 1VPLA 2FW0A 2GHRA 2FQXA 1JYFA 1YA8A 3QU2A 4WCDA 3UBMA 2IHNA 2PMDA 4M0EA 4HNTA 4B6RA 1I24A 1ML4A 1UBOS 2HDHA 2L2QA 4L9RA 4Q39A 4RHXA 5IJAA 3V1NA 3DFZA 5FOXA 2XH8A 1R4MB 3FOEC 3T7IA 1DAFA 1EBUA 1M8GA 3VPXA 3F3KA 1C9MA 4FNOA 2XWJI 4M9UA 1PV1A 1SK9A 1VHLA 4K6MA 4EKYA 1LBEA 5ICGA 1JXAA 1V11B 2JGNA 3EUFA 2H1HA 1VBMA 5GWXA 5KOIA 3D54D 3UOAB 2A1TR 1A9XB 2CF6A 1H6BA 1ULZA 1YRYE 4PSDA 2HX1A 2C2BA 2Q8QA 1A7JA 1MO2A 2XUGA 3G9ZA 4PYIA 2PYIA 4L4XA 4W8GA 3RRYA 1FP4B 1MA0A 3CCCA 3I53A 1GA6A 3EJ6A 2VNHA 4OMDA 4X3PA 4OYLA 4NE9A 2YWBA 3WL3A 1TU3A 1J2EA 3ZQKA 1SZJG 4GYYA 1P1JA 5M29A 1G9TA 1DO2A 2XZDA 3DJYA 1OAOA 3KPVA 4UD2A 3UCEA 1V95A 3CSSA 5EMNA 5IT0A 4WFKA 2NO4A 1FFYA 4LIPD 4RPCA 2C0CA 3KQYA 3AR9A 3K70C 1DDIA 2B69A 2J6HA 4X61A 4MA0A 4FSDA 3WGYA 3GLUA 3G7SA 2F3TA 10MHA 3K6KA 1D0VA 4UDYX 1QKIA 3SF8B 2AJCA 1Z2AA 2GH1A 2PBZA 1M3SA 2O7VA 2R6FA 4KFUA 2ODBA 3EH1A 4PGFA 5A7HA 1CDEA 1QFZA 3FLEA 2O2CA 3LDGA 3QFFA 3R09A 2B4RO 2W22A 2O3JA 4URUR 2NP6A 3SJUA 4CL3A 3BMQB 4P4TA 3VJLA 2OB1A 2D74A 4DDVA 4OHPA 2C2HA 3CEPB 3QX3A 1RPZA 1YQUA 4L7VA 1P2GA 1O97D 5CJ2A 1PDOA 4JY7A 1C4OA 2VEDA 4JNKA 4LSGA 5KOYA 5C31A 4Z2YA 3DGFC 4UTPA 1C7ZA 2QMQA 2YJ5A 4XKJA 1PWXA 3L7JA 2PX6A 4U7JA 4AZVA 1ISPA 1KRXA 1JKJA 2FSPA 1N5IA 4ZYUA 5JH7A 4QNNA 4F45A 4IWNA 3TI9A 2BFOA 4F4UA 1OCEA 2WKPA 3KCNA 1W8IA 3KTFA 2AR7A 3OCCA 3PR2B 2NU9A 4ITVA 1H3FA 5DHTA 3TWOA 5FV4A 3VNVA 1U0LA 4QPJC 1D6MA 4BASA 2VF8A 3GRCA 1EK2A 4IFIA 4JOBA 3WZ2A 4FFLA 5IZ4A 1CUXA 4URYR 4G85A 5BVHA 4OMFG 2IYNA 3T5CA 1Q1QA 4MULA 4D6PA 4LDRA 1RM3A 4ZJZA 2CFOA 2I6TA 2ZAYA 5J4LA 4ZXPA 3B20A 4ITRC 5JRDS 1KH1A 3AUUA 4X8HA 4JGBA 3K70D 1J8MF 3GYGA 2P6PA 3WYGA 2DQYA 2BBWA 2ZYTX 3GPIA 4IUBS 4PLGA 4Z86A 2YUTA 1SCBA 1JG7A 4KAJA 1VE9A 3JQ8B 4XR4A 4LCJA 4EW6A 3LF1A 3QX8A 2A9KA 1V5EA 2PQ2A 1I5EA 1M73E 2VTBB 5EJ4A 4S12A 2C78A 1Q7BA 2ASEA 2VJOA 3C45A 4OHOA 5IPFA 3G0DA 1P1BA 1HLGA 4WOKA 3KYBA 4YJGB 3KOUA 3WS7A 4BRZA 3EAQA 4DT1A 5IULC 2FKNA 4XDHA 4OYYA 1I5RA 5CJJA 4F9EA 1PT7A 3FMOB 2AIRA 2UVPA 2DUJA 1XLUA 5JCPA 3KTDA 4BV2A 2ZI4A 4C6TA 2VF7A 2GM5A 2OCXA 5MN5A 3RJ5A 2Q3DA 1IEWA 3W3AA 1FFDA 1IVNA 2XD4A 3DKVA 4C4SA 1F12A 2FW9A 1Y81A 2PT6A 5LOVB 4ER7A 3I76A 3ZV7A 4FPXA 1MFPA 3WI7A 5B53A 4BGEA 1A8PA 1BKSB 4XYGA 1YJCA 2QN6A 5DLYA 4D2IA 5JBQA 5M5BA 3VVMA 3ZHVA 2I5PO 3H6HA 3JTMA 2F90A 4FX5A 1WDTA 2GD2A 3NWEA 4G0ZA 4I55F 5TEVA 1AK9A 2ARKA 3GARA 3QEMA 1PEYA 4AQ7A 1QC5A 4NPCA 2JGLA 1NXXA 4FYJA 1ADFA 4DAEA 4DIKA 4C4OA 1U2DC 2PGOA 3LO5A 2IYYA 4MYSA 2I3GA 3LZ6A 1T36A 2REQA 2ZRKA 4HNGA 3EGDB 3T9FA 2JZOA 4NJMA 4E32A 1YZFA 2NZJA 2O6LA 2HN9A 3NWPA 2B4TO 3O93A 1CY0A 3UICA 1CRLA 1K89A 2JLSA 2Q9UA 1S02A 2AJDA 2R86A 3IVMA 3NIWA 2RFLA 2QXTA 2V7UA 1RYZA 1R6AA 2JFNA 3CMMA 3HHEA 2ZIZA 3PL5A 4V0SA 3K1ZA 1XNRB 2Q0XA 3LHSA 3W2GA 4M9CA 2FZLA 3T7TA 1TAUA 3CZAA 1MAAA 4QREA 1YNSA 3W9BA 3U16A 4HO1X 4PSCA 4YYEA 1RXSA 3BTOA 4L5YA 1TT5A 4BQFA 4IDQA 1NLZA 2J67A 4QFMA 2QRPA 3L7AA 1CZLA 3UWDA 1RT9A 2BDEA 3PXAA 5AVRA 3ZJTA 4ARCA 1V45E 2FOIA 3JAKA 1NI5A 2WWHA 3VGPA 4CDNA 3C8MA 3KM0A 2VPYA 4TSFD 3IHWA 3PLAE 3I05A 2GM9A 1U2EA 2J5RA 4LGVA 2P9YA 2I7TA 1P1HA 2L42A 2P4QA 1XCPA 3QLUA 3SSAA 3ZV3A 1E4EA 3B5IA 1AGXA 2ONCA 2I67A 2XUJA 2HA4A 2QR3A 3SXJA 4B3FX 2QBYB 1ZM7A 1V3UA 4ZOLA 4HHEA 1IHUA 4JITA 3W7AA 1OSNA 3IRUA 5DHPA 3B6ZA 2XGOA 3U6KA 4DUYB 5B7NA 3L1UA 2AYZA 1NMZA 1UXGA 2CEKA 3Q9LA 3OA0A 4Q4AA 5CXUA 3KEQA 3BIFA 1TK3A 1ZEJA 1NQTA 2FPPA 2XZTA 3S1AB 5A62A 1GZ6A 4B4DA 4FE4A 1RRPA 2PH7A 4BJ1A 3EA4A 1M6VA 3AEKB 4JJFA 2VIIA 2GO1A 2PN1A 2W2XA 2A1TS 5G0TA 4ZN6A 3I1JA 5FTMA 3EPRA 2RI6A 4JHXA 4KXNA 2QD3A 5EHQA 4GVPA 4IMPA 5HKKD 2D7CA 4M89A 4U8GA 2FPMA 3AO0B 1WBDA 3JZDA 3R6DA 1PG0A 3RNOA 2F1KA 3P4UA 1MIHA 4PXSA 5LR6A 3TOVA 1WOMA 2QMZA 3L79A 4L8GA 4UBOA 1JIIA 3P20A 4E94A 3HA2A 2QMEA 2NO0A 5BUSA 4R7ZA 1KO5A 2ONYA 4Y1RA 1XNJA 1SXJE 4FNGA 3CF4A 1JDJA 2ZUFA 1REQB 2HLHA 2GCPA 2WIJA 3URMA 1MABB 1CWUA 3DMPA 6PFKA 5ITSA 3OO0A 3TVTA 4IIJF 3EFBA 3VTAA 2OV1A 3DOFA 3CISA 3NBFA 3UJ9A 5BR8B 3KKOA 4M4SA 1JH8A 3W2IA 3EGIA 2B7CA 3GP5A 5F7OA 3FKSA 3UUGA 1KJ8A 4Y9TA 1X38A 1Q1NA 5F78A 4TV9F 1PUJA 3ADKA 5TB5A 1LUAA 1SHJA 4Q18A 5KO2A 2PSHA 2YV2A 1TFUA 2NP7A 3F8SA 2GEDA 3AJAA 3T1QA 1NASA 4G1BA 2HWXA 2QIOA 5FOSA 2RCNA 2YVKA 1YJBA 3U9TA 1YTLA 3BL6A 3GRKA 1ZP6A 1JN0A 1XZEA 4JLBA 3IIIA 4ZHQF 3NBYC 5BMVB 1IG3A 1E0KA 2Y0DA 2RGAA 4ND7A 1OH7A 4KIFA 3CEMA 1M54A 4U63A 3TLKA 5CA0A 1VBKA 3CUEF 4I1YA 1FMTA 3VHQA 5CH5A 4X1YA 3UWKA 2A2ZA 4KFCA 2JPDA 4BFUA 2NUAB 5IWAB 2JLAA 1EWQA 2AEFA 4IVQA 1SXJA 2QN8A 4HAYA 1OMOA 3E5MA 3GW8A 3L4EA 5E1BA 4CMCA 1CQIA 1YZ3A 2A84A 1SEVA 3D6VA 3EZLA 4RPJA 5PGMA 4I5FA 4NS4A 1XRQA 3PFFA 3SXUA 4CV1A 1IUOA 4FFMA 4UNSA 1ORIA 5DKFA 1IIRA 3U4QA 1TK9A 2BE7A 2QL7A 2NSLA 3IKTA 2GILA 2PFSA 4MKRA 1J2YA 2WDZA 2PDAA 4XTCS 1ZCJA 5HIMA 2V9CA 1YACA 2HPHA 2WJYA 3FAKA 1KPIA 2EGHA 3UV6A 1X1CA 3FNFA 1CK4A 2G5CA 4MITA 4MYDA 2H59A 4UJ3A 3HC7A 5HK8A 2F43A 1QVZA 2E82A 1A95A 2P8SA 2VOJA 2WV9A 5F7ZA 4N0PA 2A1IA 3GEEA 3SHVA 4D9KA 1M76A 1XWWA 1N8SA 1R0SA 1LS6A 2Q5LA 2VWQA 3GXOA 1GGJA 3LG2A 3EIOA 3N8HA 4IJ6A 4CEIA 1XJQA 3CG0A 1VJ5A 3U9LA 4AXXA 3IV9A 5L4LA 1OC2A 3QLTA 3EDCA 5LXTB 3PX7A 3BZBA 3D31A 1I6KA 2D7DA 1MJNA 2EJWA 5A05A 4UUMA 2PNFA 3GMIA 4MQEA 2WD8A 2A92A 1T6ZA 2CEAA 3N2LA 4ANFA 4EPWA 2HH9A 3LHDA 5JRZA 1TA4A 2V54A 3GUZA 1PGPA 3A58B 3G13A 2J3DA 1C9DB 3PE4A 4ER6A 3PQ5A 2YZ7A 4ZDIA 3CLTD 2ZAGA 1L9KA 4D9FA 1LTKA 2F1RA 3K15A 2E4UA 3KXDA 3ZEAA 4DN6A 1ZUIA 4UM9D 1AMUA 1DTSA 3ZWQA 5EESA 3HO6A 3OCUA 2DBZA 4C3VA 4RVDA 1PO7A 4WACA 5EP4A 3AX6A 3TTTA 2I2CA 3W7VA 3QPUA 5TGZA 3VOAA 1V5FA 1IN7A 1NN5A 4RVGA 1P2BA 3G79A 4PBTA 1KO8A 3ULKA 3KLBA 4DWVA 3V34A 1G8PA 1RC1A 4X41A 3DBLA 5G1OA 3UJ6A 3S3TA 2ZI6A 2OXCA 2AMJA 3HN7A 3ZUGA 4HQRA 3L4KA 3B1XA 3PWSA 3QHAA 3ZHUA 3L8MA 4TS3A 3I12A 1YQQA 4LX0A 3M4ZA 2J9YB 2B78A 4RKQA 1HSOA 2YJGA 3GMTA 1P2DA 3KZVA 3RSOA 4WN9B 3G6WA 3HV0A 3FB1A 4HXEB 5DH9A 3RPEA 1GYQA 4A0FA 5KX5F 9MHTA 2DY1A 2J5QA 4NMHA 4W5JA 2CMGA 1UJMA 3GJRA 3PUXA 3U3XA 4MUHA 1QS0A 1N6PA 3WK6A 3ZU4A 1TX4B 1E9CA 4FUQA 4IX1A 4IGEA 4NZ9A 4RL4A 2R5NA 3DT8A 3PQCA 1QIDA 1V8FA 2R1VA 2ECOA 2YCLA 3GVCA 4ZEVA 1R3UA 1VL6A 2OFOA 1OGYA 2W83A 1B8OA 3TDNA 1XBTA 2BFEA 2QRLA 1SBQA 3CE9A 4LTDA 1CR4A 5K0FA 5AVTA 4DG8A 5BSWA 1Z7YA 2KBEA 1RYMA 3IPXA 3JTEA 3MQ4A 2YNMD 3HYTA 2UZ1A 4HYYA 4O2AA 2HLPA 2G06A 3JQFA 3O47A 5LUBA 5JJCA 3U7FB 1EG7A 4CNQA 1QYDA 4RD2A 4FR0A 4B85A 3TIGA