4UHEA

Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound)
Total Genus 108
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
108
sequence length
272
structure length
272
Chain Sequence
b'AQRVKITTTATPGEIELAFEDTGTGLPVLLVHGFPLDRTMWKAQREELCDEFRVIVPDLRGFGESQVIPGVATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEAKENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNHPEVIEKIRQMILSAPPEGVAAAALGMAERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDAGHLPPMEQPERVTQAIREWLRKVHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTERASE
molecule tags Hydrolase
source organism Planctomycetes bacterium r1
publication title Structural Studies of a Thermophilic Esterase from a New Planctomycetes Species, Thermogutta Terrifontis.
pubmed doi rcsb
total genus 108
structure length 272
sequence length 272
ec nomenclature ec 3.1.1.1: Carboxylesterase.
pdb deposition date 2015-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12697 Abhydrolase_6 Alpha/beta hydrolase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uheA00
3G0IA 4Y2YA 4FKBA 5LZ9A 1FFBA 3OC0A 3FLBA 1CQWA 3WK7A 4ZREA 5A7HA 3SX4A 1XRLA 3DJYA 5JATA 1Y7IA 3O9VA 3WYNA 3VJLA 3T52A 5ALLA 1RWQA 1X2BA 3H1BA 5LZ8A 3G0CA 5DJ5A 4X95A 1LZKA 2XQIA 1UXOA 4AX4A 1WB6A 2B61A 3QMVA 1ACJA 2PSDA 5HK8A 5AKXA 4X6UA 1XKLA 4L9AA 3STWA 1H2XA 5K3FB 4E11A 2HA0A 3O4GA 2WG2A 3WI7A 3ICVA 1ZD2P 3A2LA 1GKLA 4H7KA 3L1JA 4YX9A 4AO6A 4Z49A 3PF9A 4BTVA 3R3VA 4OU4A 4WDRA 4J03A 3WWPA 2XMZA 4MJ3A 1HLGA 3F96A 3FLEA 1WCYA 1MAHA 5ALVA 3HJUA 3G8YA 5ALXA 1AMNA 1MX9A 4WFIA 2HFKA 1B6GA 1P0MA 3O4IA 4X6YA 4B0OA 1MAAA 1UOOA 5IVIA 1YAHA 4X93A 4FWBA 1QIJA 2GBGA 2VT7A 3KWFA 3JWEA 3QMMA 5ALWA 1X70A 1CV2A 1UFOA 2GYVA 4GECA 4B82A 1YA8A 5E4TA 1LPAB 2WHRA 4IH1A 5EHZA 4RE5A 3AZPA 4HAIA 2O2HA 3BL8A 2WUEA 2HRRA 4I4CA 3M82A 1AGYA 4UFNA 2XMQA 2C0QA 2Z8XA 2Y1KA 4OUKX 5ALZA 2X8BA 2WJ4A 2IX9A 5A2GA 4MYSA 1MNAA 5HKAA 3E1GA 1EB9A 1C7JA 2I03A 1MTZA 3U1TA 5LKRA 1YB6A 1LPSA 3C6ZA 5FRDA 4CI9A 5AKIA 1WHTA 4DTCA 2QR5A 3PF8A 1E8MA 2G4LA 4U2FA 4KE9A 2JGFA 1P0QA 2J4CA 1GZ7A 4BE9A 3IA2A 3LS2A 4QDZA 1ODCA 3X3HA 2WIDA 3ZWQA 1QIMA 5ALUA 1K63A 1WOMA 3HACA 5KREA 1QIHA 4F21A 4UBLA 4QDXA 2PKYX 4OB8A 1K6EA 2RAUA 4NS4A 4GLBA 4OYYA 1XZGA 2PSEA 2GYWA 1UK7A 4BTLA 2WIFA 1GKKA 4BATA 4Y2TA 1EINA 5FLKA 3O0DA 4EA6A 2DHEA 4G8CA 1CUUA 2ES4A 3M81A 5AJHA 4BAGA 4RNCA 1G66A 1UOPA 2HA4A 2XB6A 3IVMA 5KWIA 1CRLA 1UKBA 2VAXA 3IURA 5AK3A 4H7EA 3QMWA 2LIPA 3DNMA 4U2GA 1VE7A 4D9JA 2ZYSA 5A7GA 4KE8A 3BF8A 3ZLUA 3E3AA 4BC0A 1WM1A 4Y9SA 1LPNA 2VJBA 1N5RA 2FJ0A 3O95A 3UUFA 5AKEA 4CFSA 3L1HA 3BF7A 5AO9A 3P2MA 3ZV7A 1YSCA 2WILA 1BEEA 1XZFA 2XUDA 1H22A 3WKEA 1CQZA 5AM4A 5I8PA 4DIUA 1R9MA 2OCIA 3C5VA 1GPLA 3MUNA 3OM8A 4YPVA 4LHEA 4EBBA 4EZIA 4BE4A 4K2AA 2H7XA 2Z5GA 2PBLA 3R3UA 2WG1A 1UKCA 4Q3OA 4XVCA 4AZ3A 4QDOA 1EXWA 4AN1A 5C7YA 3VKFA 3C70A 4FTWA 4FOLA 1GQRA 5I7UA 1EX9A 5DYWA 2NW6A 4Q34A 1NU6A 2XUGA 1N5MA 4RE6A 2WTNA 2HIHA 1HBJA 5HF9A 4XWGA 1XRPA 4GEGA 1AKNA 2JGEA 1TIBA 4MQMA 4QDUA 1QIKA 3IDAA 1E89A 1TRHA 4QDTA 4PF1A 1K5PA 4CIAA 4JUIA 4J0DA 1XZEA 1MX1A 5FXMA 3WKAA 1SCQA 1N8SA 1XKTA 4KEAA 3FCXA 3H2JA 1JU4A 2HADA 4UHFA 2ZJ6A 1BCSA 4RPCA 2VJCA 5CT4A 5FUMA 3FYUB 1JJBA 1A88A 4B84A 1BRTA 2BGNA 1H2WA 5DNVA 5D3KA 5HF5A 4UBKA 5BWBA 4K6GA 5E2IA 2HRQA 1Y7HA 3IULA 3PFBA 2ZVDA 4UBMA 4FNMA 1XQYA 1EVEA 4AZ0A 2PPLA 1SCIA 2JF0A 4QZVA 1QO9A 3A2MA 1LGYA 1E8DA 4ZXFA 1UK8A 2OPHA 3FCYA 3I6YA 4Y2UA 4C87A 2BFNA 3JYHA 3OOSA 1CUIA 1AURA 3V9AA 4FLFA 3R3WA 5D3ZA 2V9ZA 5I9IA 5IVHA 3G9ZA 4W1PA 3RM3A 3FAKA 1IMJA 3QM1A 2OGZA 4W1RA 4LXHA 3KDAA 3HSSA 2ECFA 2HU7A 3LIPA 5H3HA 4UUQA 1Z68A 3C6BA 1VXRA 5K3EA 3EBLA 4H77A 4EB0A 1XRQA 2XT0A 3BDVA 4MEAA 4G9EA 5FV4A 4W9RA 4I3FA 1JT2A 5EHQA 5JD6A 4H7IA 2VSQA 3STVA 3V48A 4AQDA 2VF2A 3GBSA 4PNZA 1UZAA 3KOOA 3WIOA 2WUDA 1P0PA 4G4GA 4FHZA 4ZRDA 1VKHA 4HRXA 2DQZA 1VLQA 2R8BA 3R3XA 4KE7A 4U2CA 4BZZA 1F0NA 3DOHA 5K3AA 3H1AA 1U2EA 2CZQA 3BDIA 5K3CA 4JYMA 3BJRA 4AN0A 4OD0A 4IH4A 4OCZA 5LZ4A 3FSGD 4KAAA 3EQ7A 1TAHA 1ODTC 1KU6A 1R9NA 2IITA 2JGIA 3D2CA 3DEAA 4EUSA 4J7AA 4FNGA 3AUKA 5ALHA 2EDAA 5AM3A 4G8DA 4BZWA 4O08A 1MU0A 2I3ZA 2VEOA 4BVLA 1X2EA 1ZIYA 2WSLA 2HM7A 4F5ZA 3HXKA 3F8SA 3GZJA 4J0KA 2YXPX 5LZ5A 1JU3A 4H7DA 2VJAA 4OPMA 4BC1A 3DYIA 3QZUA 4MQLA 2XLCA 1VA4A 2XUQA 4J0CA 3RLIA 3AJAA 1H23A 2OQIA 5ALOA 5ALKA 1XZIA 1XZJA 3M83A 1DWOA 2BGRA 3AILA 3UUEA 3C6YA 4ITVA 1H2YA 1Q84A 5A7FA 1T4MA 1JFRA 1DWPA 3SK0A 1BS9A 4HVTA 5DTIA 1HQDA 1XQVA 1YB7A 3G9TA 5AI4A 3WLAA 2B9VA 3AIKA 3LCRA 2DHDA 1CUWA 4WY5A 3WWOA 4QEKA 5ALFA 3B3QA 3PE6A 2QS9A 1B41A 2J3QA 4G8BA 5LZ2A 2WUGA 1EB8A 3G0GA 4KJXA 1LPBB 3FYTA 4X71A 1QIIA 3AIMA 4J0JA 3Q8WA 4WFJA 2XUOA 5CT5A 2G63A 4N8SA 4B80A 2XQGA 3LLCA 2XUIA 1CUZA 1L7AA 1WPXA 2Y2VA 4CIBA 2AJ8A 5JAUA 4DMFA 4M0MA 3G0DA 1YA4A 2G5PA 1QIFA 1VA5A 1UKAA 3I2HA 4HXEB 1F8UA 4QWWA 3F9CA 4Q3LA 5AKZA 5IH7A 1KU0A 4BDTA 3H2GA 4ZV7A 1AUOA 2QMQA 1E5TA 1LNSA 4Y2SA 5AIAA 2OCLA 4INZA 5DNWA 2Z3WA 4OU5A 4GHWA 1UWCA 1CPYA 1QIEA 3N2ZB 3PI6A 3QYJA 1CEXA 1I6WA 1BN6A 3QPCA 4P92A 1R88A 3DDUA 4N5IX 3DD5A 2WIGA 4QA9A 4CG1A 2C0PA 1XZKA 5LLSA 2QJWA 1J1IA 3BJMA 1ZJ4A 1CUVA 3DOIA 1UT6A 4G4IA 3Q0TA 2JGJA 3D2BA 5T4EA 2GZRA 4L3WA 5JAOA 5AOCA 2P8SA 5CH3A 4DLNA 3WWCA 1IUNA 1AX9A 4B83A 1UK6A 3MUOA 2FJPA 4F0JA 4Q82A 2CKMA 4U2EA 2WHPB 2UZ0A 2VJDA 3W05A 1ZD4A 3R3YA 1LBTA 4BAZA 3I2KA 3ESAA 1CUBA 2JBWA 5T4HA 2YASA 3STUA 3KSRA 3HABA 4HS9A 1WB4A 2QXTA 2WHPA 1DTEA 3NGMA 1ZI6A 1CUAA 4E14A 1QJ4A 3IUJA 1IVYA 3I2IA 5HZGA 4X7BA 1QO7A 5T4BA 3WQHA 2ZYHA 2JGKA 1ORVA 1DT3A 4U2BA 2C4HA 2XLBA 3TGLA 3D5EA 4L0CA 2WFLA 2WU3A 3WWEA 1CUDA 4H18A 1VZ3A 3DKKA 4S0XA 5LKAA 2O2GA 4PW0A 4FDMA 4GWLA 3A2NA 3DKRA 4GXNA 1ISPA 5FDFA 1LZLA 2C7BA 1ODSA 3WK5A 3C8DA 1ZI8A 5YASA 2PU7A 4W63A 2W6CX 1FFEA 2BCEA 2AXEA 4JEIA 3GELA 3D0KA 3IBTA 2FX5A 5HCUA 3PUHA 2QVBA 1YR2A 3D3NA 2PL5A 3H17A 4KRXA 1EI9A 1JKMA 2I78A 5JADA 5K3BA 2HFJA 2DQYA 5D7BA 1MPXA 2WKWA 3WK4A 2RGUA 2QJRA 4J3JA 3K9BA 4BCBA 1ZGCA 3FWHA 5FKJA 4LYEA 1EDEA 1QFSA 2Q0XA 5J3JA 5EI5A 5CBKA 5HQ3A 4JYPA 3RKSA 3G7NA 3G9UA 4A16A 4IH9A 1MX5A 2OCGA 1PFQA 5AKGA 1UOQA 1CUYA 3RK4A 3W06A 2QZPA 2WHQA 2CMFA 2YH2A 3VXKA 4LXIA 5CXUA 5JANA 3I2GA 2PM8A 3O4JA 2EDCA 4KACA 3WA6A 3FVRA 2QUBA 4PV7A 3I2FA 3F98A 4TGLA 5ALQA 3DYVA 5FPPA 1QIGA 1S8OA 2VATA 1FFCA 2WFLB 5C8ZA 3DQZA 3DS8A 1XZMA 3H2HA 4UHCA 5EFZA 1QFMA 2XMBA 5EIHA 2Z3ZA 4DMKA 4WFKA 1CUJA 5ALEA 5K5EA 3MGAA 4FMPA 3WJ1A 2WJ3A 1GXSA 4MEBA 4RGYA 4CCYA 2JEYA 2YYSA 1XZAA 3ANSA 5ESRA 5JAPA 1THTA 2PU5A 2QOEA 1ZD3A 2QRUA 5ALRA 4WJLA 1NX9A 5LP1A 4HXFB 3VJKA 2OCKA 3EIOA 3ILSA 4BVJA 4C4YA 1ZOIA 2J4FA 1CUGA 2D5LA 1QE3A 4FBMA 3ED1A 1HL7A 4OYLA 4BP9A 5K3DA 5JZBA 1QTIA 4PSCA 5AIBA 2DFPA 3KD2A 3STTA 2JGMA 5DNUA 2XMCA 4CCWA 1GGVA 1H2ZA 5AICA 1JJIA 2JGLA 3PDCA 1VE6A 4Y2JA 2ACKA 5C8XA 2HA3A 5AM1A 4GI1A 1SOMA 5ALPA 5DTJA 5AKJA 4DMCA 4C4ZA 2XUJA 4H7FA 3EQ8A 2HA6A 4UHHA 2X76A 4HTAA 5ALDA 2EEPA 4FLEA 2XQFA 4BP8A 1XQWA 2VA9A 4BB0A 4LKOA 5AOAA 3CXUA 3HLKA 4X85A 1LPOA 2PSHA 1XROA 3BIWA 2V98A 2PVSA 5AK6A 3ZPXA 1QZ3A 1O6FA 1LPMA 4WDQA 2C5GA 1D07A 1EDDA 1Q0RA 4E46A 1F0PA 1GPNA 2C58A 3WK9A 1XLWA 3AZOA 2AJCA 4PO3X 1CUEA 1EDBA 3H18A 4DMHA 1W6RA 5CH8A 3YASA 5SYNA 4A23A 2WM2A 3WL8A 2DSNA 2FUKA 3E0XA 1EVQA 2VQ6A 2Y6VA 1QONA 2G5TA 5CMLA 5FOQA 1VJ5A 3TRDA 4ZV9A 2OLEA 5HF6A 4LXGA 3WWDA 3QPDA 5F4ZA 3R0VA 4Y2VA 3AFIA 2PSJA 1R3DA 5JZ9A 1G42A 3HYSA 2ZYIA 3STYA 2WTMA 1G5FA 3M3DA 4KR0A 4QNNA 3I6ZA 5CTAA 3I1YA 2WFZA 3H04A 4G4JA 2AJLI 4ETWA 5AH0A 5IVKA 1W4LA 2BUBA 2H9YA 3R3ZA 1R1DA 3ZLTA 4U2DA 3WYDA 4K6KA 5AHXA 1ETHA 3BE8A 2X5XA 5JYCA 1HDEA 5DLPA 5ALNA 1ACLA 2OAEA 2WQZA 2XMRA 2AJDA 2OGSA 2XQKA 3HEAA 1CUCA 1XLUA 4EY8A 4B9EA 4MYDA 5HFAA 1XLVA 3PUIA 4DYHA 1XRMA 4Y7DA 1RP1A 3ZI7A 4HZGA 4NZZA 3I2JA 2BAGA 5E4YA 4I19A 5ALJA 5CT8A 2D0DA 4C01A 1BE0A 5AK4A 3S8YA 5E4JA 1AC5A 2CB9A 1BN7A 3HRHA 5EHXA 4DM7A 3B5EA 4QE3A 2PUJA 3OTQA 4QLOA 3H19A 2I3DA 1A8QA 3CCBA 3ICWA 5AI9A 3F97A 3WK8A 1TKRA 1G4HA 5T4FA 2HA5A 3QH4A 4BAUA 2DHCA 1XZDA 2R11A 4H35A 2XUKA 2XQJA 1WB5A 1U4NA 5AOBA 4KRYA 1CVLA 1IZ7A 3D59A 1N1MA 4OSEA 3HI4A 4MWTA 1FFAA 1NU8A 1F6WA 4GBGA 4E15A 3G02A 4K6HA 4IHAA 5KBYA 1Q0ZA 1W1IA 3ANTA 4M0FA 3FOBA 4BDSA 4EHBA 5BOVA 5LZ7A 4X6XA 3OPMA 3ESDA 2CEKA 3D2AA 3G9XA 4N5HX 1EK1A 7YASA 1YS1X 3VJMA 5ALIA 4Y2RA 5JZSA 3I6MA 4B85A 3FBWA 3CN9A 4MWSA 1VZ2A 4CG2A 3V1KA 1W75A 2B4KA 3EF3A 3IIIA 3V1LA 1CLEA 3FLAA 2ZYRA 5HQ3B 2GBCA 5EIAA 4HRYA 4ZI5A 3WZMA 1SC9A 2H1IA 4UBNA 5HK9A 3FSGA 4AO8A 2WJ6A 3R40A 3WIBA 5D6OA 1L7QA 1PJAA 3ESCA 4H7HA 1Q83A 1DWQA 3VVMA 4L72A 4KE6A 1ZGBA 4M0EA 1ZICA 1CUXA 1K4YA 5IVDA 1ZI9A 1TCAA 4ZGBA 1R4ZA 3C43A 2O7RA 4B7ZA 3O9MA 5EGNA 3C6XA 1MN6A 4TVKA 1MT3A 2AJBA 3VVLA 2QKYA 3HZOA 4Y2XA 4BVKA 1VXOA 2O2IA 1U65A 3FVTA 2HA2A 2XDWA 4PSDA 4ZWNA 1DT5A 2RI6A 1J07A 3KXPA 5CH5A 4DSAA 1XFDA 2WIKA 2HDWA 2OQVA 2CBGA 2OG1A 1A8UA 3R41A 1GPKA 2QUAA 4IO0A 5ALYA 1VOTA 5AK5A 3A6ZA 2ZJFA 3WMRA 3UMJA 1DQYA 1WPRA 1XZLA 3HC7A 5AKHA 4LIPD 4AMYA 1J06A 4BYMA 3WL6A 1JMKC 3AZQA 4KYVA 1YCDA 1YS2X 1UK9A 5CT9A 3SWWA 3TEJA 3N0TA 5JASA 4Q05A 5EHNA 2DCMA 4XJVA 2ZSHA 2OXEA 1A7UA 1MO2A 3GA7A 5HF8A 1C4XA 5JARA 3CN7A 1E3QA 2RIPA 4TPKA 5ALGA 4J0IA 1QIDA 3QITA 1E66A 2HU8A 4HXGA 3ZLVA 5CRIA 3TJMA 1ZJ5A 4LYDA 4H7JA 1CUSA 2GYUA 1J2EA 4EY6A 1OILA 2V97A 1K8QA 5SYMA 4DNOA 4J0HA 2ONCA 5KWJA 1SCKA 4W1QA 4G1FA 3AINA 5CT6A 4X91A 1YAJA 3WA7A 1P0IA 3W04A 4FFVA 2ACEA 4EY7A 2J3DA 2GBIA 3BWXA 4AXBA 1XRRA 3C8HA 5LYYA 1XZBA 1OXMA 3O4HA 4N8DA 3U0VA 4ROTA 1XZCA 4C89A 4X00A 3GFFA 4DNFA 4G9GA 3DLTA 4DGQA 3H2IA 3CCCA 4X90A 4Y2QA 4X3CA 3GROA 3WKCA 1KEZA 3LIIA 4CCYB 3EQ9A 1E8NA 1THGA 1XZHA 5AKKA 5BV7A 2QM0A 3IUQA 1QTRA 5JD4A 1CR6A 2CUTA 1DX4A 1R50A 3W9BA 5C81A 5CW2A 1QGED 2DR0A 2XI4A 1BCRA 3W9UA 4IQ4A 4PQEA 5A6VA 3WJ2A 2JEZA 3BXPA 3H2KA 2Y6UA 1HPLA 2PSFA 2QTBA 5CURA 5IKXA 3G0BA 2PUHA 4BRZA 5AI0A 1ORWA 1CUHA 4WCVA 4BRSA 5AM2A 4Y2PA 4ARAA 4C4XA 3PICA 1BEZA 1EH5A 5DWDA 4BBZA 4JNCA 4EY5A 3D7RA 4AO7A 1DX6A 4H0CA 3JW8A 2XMDA 1U8EA 4QLAA 4F60A 1A8SA 4B9AA 2BJHA 2ZSIA 5AKYA 5AI5A 3K6KA 4B0PA 5BWCA 1SFRA 3V1NA 4YK7A 1AQLA 4J0GA 1QOZA 2BKLA 5ALMA 3QBJA 4PSUA 4B81A 4GW3A 4UHDA 2XUHA 5JIBA 1TK3A 1ZD5A 1Y37A 3VISA 5AP9A 3WK6A 2O7VA 2QXUA 5FPQA 2VT6A 3WL5A 3FYUA 4UFPA 2OGTA 2HL6A 3I1IA 3L1IA 5HKBA 3C45A 1CUFA 4WY8A 4UBJA 4ARBA 4UPDA 2WU4A 2CJPA 2H7CA 1GT6A 4DSZA 5DYYA 3MVEA 4XIIA 4X97A 1GQSA 3K2IA 1JJFA 4W1SA 2C5FA 4A5SA 3NUZA 4MXDA 3FNBA 4BCCA 1BU8A 3QVMA 3VDXA 2VAVA 2WIJA 2HU5A 3V1MA 5EIEA 4EY4A 1L7RA 1DINA 6YASA 1USWA 1CFJA 2WUFA 1PV1A 4C88A 4Q1VA 4AB1A 1YASA 1XQXA 3DCNA 2V96A 2RHWA 4XX1A 5CXXA 2Y2UA 4V2IA 2BUCA 4P9NA 4GDMA 2XUFA 2GZSA 4G5XA 4BCDA 4P08A 1FFDA 4FLMA 5JD5A 5LIPA 2B20A 2ROQA 2WLSA 1EHYA 1LBSA 4Q3KA 5ALSA 2RONA 3WKDA 2ZJ7A 3OG9A 3QPAA 1XRNA 2XUPA 4UHBA 4K5QA 3I28A 3W2TA 4UBIA 5AM5A 1LLFA 5AM0A 3S2ZA 5JALA 1W52X 5JAHA 3WZLA 3SC2A 2GBFA 4OB6A 1AZWA 2XE4A 3FYUC 2H7YA 4DNQA 4OB7A 2OAGA 1IUOA 1BROA 3F67A 1RYYA 2E3JA 1FSSA 3H0CA 1EA5A 5AI8A 1LPPA 4UBOA 4X94A 1T2NA 3PFCA 1FJ2A 5ALTA 3IUNA 3AIOA 3KWJA 4B6GA 5ISMA 2HHAA 1TQHA 4CG3A 5DYTA 1EK2A 1O6GA 2QT9A 3NOXA 4UFOA 1IUPA 4P93A 3DL4A 2HA7A 3WKBA 5A62A 2VTVA 2K2QB 3C5WP 1DU4A 3B12A 3WL7A 4X92A 3D4LA 4FFWA 2BUAA 2XMSA 2XMGA 2W22A 3C87A 3RARA 3ESBA 4QWMA 1IZ8A 1QLWA 1JMYA 2RHTA 3LP5A 1M33A 2IIVA 3E4DA 5AKLA 3STXA 5K3FA 4FBLA 4YASA 2PX6A 1JI3A 5A71A 1ZIXA 1CIJA 2ORYA 2WFMA 3GUUA 4KAFA 4AMZA 3NWOA 1OCEA 4JH0A 3IUMA 1DQZA 2Z8ZA 4UHEA 4N8EA 2WG0A 1TCBA 1MJ5A 3IB3A 4C6HA 3T4UA 1HKHA 3A70A 5FP0A 4DNPA 4NVRA 1MNQA 4KAJA 1TCCA 2JIDA 3BIXA 5AI6A 4NMWA 1W76A 1C7IA 3DL7A 2XUAA 3OURA 5C8VA 1WHSA 5HFNA
chains in the Genus database with same CATH superfamily
1T91A 3I9FA 3HZZA 2IHJA 2FPPB 3G3EA 1X1TA 3QYAA 3DB1A 2XTJA 4I66A 1PK7A 3SMQA 3O4FA 5ITSA 5EKUA 3H2YA 4CKBB 2GJKA 5LZ9A 3COSA 3EVNA 2CMKA 1TO2E 5BN3B 3C7CB 1DLIA 1UMCB 2BGLA 1G6KA 2P4QA 4CN8A 4YJ3F 3SX4A 4TTPA 5EWMB 3CLRC 4EELA 4DDHA 3LZCA 1YO6A 2IUSA 2UYCA 3KO8A 3VNSA 3ZIAD 3ZGXA 1KMCA 4JCCA 1SUSA 4I8DA 1AHNA 3O03A 4MB2A 2MR5A 3M70A 4CTNA 3BD8A 5JS6A 1A69A 5J2TB 3HK2A 1FYVA 1X2BA 4N3BA 3CB4A 3MAAC 3MYYA 2BH9A 1GL7A 2O6HA 3BFPA 1D6JA 4JSTA 1DXOA 4X95A 2IPNA 1LZKA 2CXUA 2P5UA 4Z53A 4OXNA 2XQIA 2O8DB 1U2PA 1ADJA 2QM3A 3GZ4A 3CNNA 1RT9A 5I9SA 5B30A 2CK3D 2Q21A 3U09A 3RRXA 1ACJA 5HK8A 1NVXQ 3F6RA 3AOEC 1N8TA 1XKLA 2JC3A 5BNFA 5TGDA 4DIMA 5UKDA 1KEPA 1ZVMA 1S6YA 4EX6A 1RYFA 5A9RA 3STWA 1RWBA 4JXJA 3HH8A 4B45A 1L4LA 1E9BA 1YGYA 1DC7A 4MGKR 4GXTA 1X7XB 1XMXA 3D5TA 1N78A 3IDFA 3UMFA 5CVDA 1FPQA 4V38A 2WG2A 4WTOA 3TW0A 1S3SA 5HKKD 1NIPA 2CNBA 2GHRA 4F4HA 1LQUA 4G0XA 1WSDA 1A9ZA 5E95A 3ZWMA 2A9OA 2R3SA 3A2LA 3PQ5A 4F1KA 5JXHA 5KEIA 3L1JA 3NHLA 3KJIA 4H9GA 1J33A 2VJKA 3ZDXB 4M8NE 4YX9A 1NVAA 2E6UX 4Q9KA 4B4KA 1U7DA 5AVVA 3CUTA 3OEWA 3P7MA 3R3VA 4OU4A 4BTVA 4C5BA 3VKHA 4HB0A 1X7WA 2XD4A 3HBMA 3I6BA 3P26A 3W9SA 3D0OA 1RLMA 4R7GA 1W35A 2VTBA 1FBNA 4OMUA 1EGMB 1HLGA 4MJ3A 2XPCA 4MVJA 1KIAA 3D6JA 4DLLA 1TZCA 1HLFA 4RHTA 2P9JA 3E9CA 5ALVA 4FCWA 5DX0A 1REQA 3CO5A 3D6NB 2A7QA 1GUBA 2EC5A 3G8YA 3HO1A 4Z51A 2WWWA 4QDKA 1A3CA 4ARCA 1GGHA 1X8LA 1AMNA 2FWJA 5JISA 2QZJA 3WB9A 2HFKA 5F51A 4KW7A 3GJYA 5REQA 4X6YA 3O4IA 4MKXA 1NHGA 3IAHA 2FMKA 4B0OA 1OWLA 1RCTE 3M33A 1PJ2A 3O38A 3EGDB 1T1RA 4GI5A 1YAHA 2FPXA 2BEWA 3WQBA 1E0DA 1HE1C 1K6IA 3LFUA 2CW5A 3B2QA 3GXBA 3E0QA 4V0OA 3U7RA 5F2NA 4TXHA 4QUIA 2PGNA 2ZE7A 3DT8A 5AVXA 5TGTA 1D1PA 4EHDA 2UKDA 4KR3A 3VA7A 2GAOA 1MC5A 2DY0A 2BSQA 1L9XA 1XXHE 4MLCA 5GQSA 3SBEA 2Q62A 3U5TA 2JGAA 1X70A 4LJ8A 4TWAA 4CR7A 2HSGA 4G85A 4DEVA 5IN4A 4CIWA 4B82A 4HMQA 4EW3A 3TMAA 1ZG3A 4H27A 3A6HA 1KAGA 1YQQA 2QMOA 3CUUA 4RM2A 1QMPA 3PVZA 5CLGA 5ENZA 4XKJA 5CIQA 3S44A 2WV9A 1VRWA 1TPYA 3TLKA 5CCBA 3RSLA 1FS4A 3EXHB 2JG3A 2O2HA 1PE0A 5CFNA 1Z6PA 2P6RA 2EZ8A 2QG4A 1KI1A 4R8LA 3K2EA 4X9XA 1W4RA 4BJHB 3IAUA 2XRFA 2ZI7A 5HZKA 1G0OA 2KI5A 3ONEA 2X15A 1HX7A 2C4KA 3MRSA 3OJ0A 3V8RA 2WVGA 1WZNA 3E23A 5AVSA 3M6MD 5A2GA 5T67A 3WICA 4BNVA 1F2DA 3NW9A 1BGWA 4MNTA 3VO9A 1A4RA 3BMOB 1BH2A 3X0DA 5HKAA 3U16A 4QM7A 3EAGA 3U4QA 5KTNA 3RT1A 4KU4A 1AZSC 2KB0A 4FJ1A 1Z5VA 4ZP1A 1B00A 5T57A 3RS0A 1JDBC 3NBAA 5C80A 3EZ7A 3MLBA 3ICEA 1K9SA 3EDQA 1M2EA 4XXHA 3DAPA 3OQPA 5K0SA 3TSYA 2V9PA 3QVXA 1EFKA 3D3KA 1Y0BA 1WF3A 2PWYA 2ZRMA 4ASUA 3N8GA 4Q19A 4IMJB 5ARBA 4JLOA 1NWCA 1OFUX 2MYUA 5AKIA 4AKSA 4FHCA 3C39A 1XHFA 3HR8A 1C9YA 3PJGA 4DQXA 4ZMSA 5K0ZA 1E8MA 4DJAA 4OQ4A 4U2FA 5BW6B 2X7XA 1IYZA 3HUUA 1GZ7A 1QYWA 4C7XA 3OLZA 1EVJA 1YQXA 1ZINA 3FH0A 1A9QA 2ZREA 4TZKA 3OTHA 1NURA 4D02A 1AN0A 2P9EA 2QTCA 1PRYA 3MT8A 2J9XB 3LS2A 5EOVA 1FNSA 3ZWDA 2P9QA 4QDZA 1ZK3A 1OLSA 3BORA 3JZIA 2WYUA 3II6X 4O4JA 3ZWQA 2PZKA 1QIMA 3E2PA 1K63A 3LRTA 3M2PA 3HACA 3PSHA 3DDNA 4HDAA 5ALUA 4AY6A 2ZT7A 3HKBA 1ULTA 2N9UA 2B1QA 4F21A 1SJ9A 4EYEA 2IOFK 3R7WB 2EFJA 1PK9A 2Q4BA 3PQ3A 4I1OA 1MJGA 3CONA 1GPMA 2F4NA 1YUNA 4EENA 3OQVA 1UWVA 3PXDA 5K4AA 2QTAA 1Y1TA 3QVGA 2FP4B 4EJ0A 1MOQA 2POQX 1YHNA 2ZRHA 3OEHD 4GBED 3JARB 3NHBA 4FZ3A 1U02A 4MV1A 4KGDA 5DWQA 1SU8A 4AZ3B 1O0BA 4PNPA 2PSEA 2AW3A 2I87A 3ECSA 3OIGA 1DIRA 2V0GA 4R16A 2O8BB 4HLDA 2E4ZA 1KEEB 4G1BA 4QUGA 5CPBA 1ULHA 1M6EX 3V80A 3TYXA 1JR3A 3LQQA 4IGAA 1BIFA 1GKKA 1VDZA 1ZK0A 3PDIA 4D57A 1WUYA 2KYRA 2QM8A 2V7VA 4PCUA 5HGXA 5FLKA 4IOJA 3SHQA 1MKYA 3RADC 2ZRGA 2DHEA 1XGKA 1VJDA 4URWR 2ES4A 1D2GA 4HEA1 3A1FA 1Q7BA 1VI6A 3PGJA 3EXHA 2G28A 2ZT8A 4IQ8A 4LYHA 1G20A 4BNDA 1DVRA 3KUKA 2O9JA 5PGMA 3COWA 4MKGA 5BQ5A 3RGGA 1FC0A 1U3CA 1YDFA 4F4UA 2NTYC 1HSOA 1HYQA 2HA4A 3IVMA 4G1MB 3VUEA 1NF9A 2VAXA 3IURA 5GONB 5HWSA 3W9YA 2HYIC 4JLVA 5AK3A 1B3BA 3OCWA 4YECA 1FS5A 4F91B 3VO1A 1VE7A 3T7KA 4M9QA 1YR9A 4KE8A 2HI0A 2PNFA 3DZ8A 4J2TA 4MKZA 1MQAA 2WC1A 2AOTB 4Z9YA 3DLPX 3IIEA 3MTQA 5H7XA 3D8RA 1DIHA 5TT0A 1L5NA 2OV6A 3RAJA 3AUYA 3SZUA 2BGWA 2E5LB 2YJNA 1T0HB 5EQDA 1DI0A 1LPNA 2VJBA 2FPUA 3PL5A 4TN5A 5F4BA 3RYCB 1JG1A 4ZRNA 3D6UA 1GGNA 4DCGA 1OD6A 1XOIA 4EYSA 3AF3A 1E2JA 3OLVA 4CYMA 2FJ0A 3M6IA 4R9UC 2PTHA 4NH0A 1ECGA 4EG8A 5CFOA 1G8GA 4CFSA 3U1BA 4CLOB 2F8LA 4CXMA 3ZK7A 4ZALA 4ZMRA 3A9VA 5BO5A 3BKXA 1ZNQO 5L3QA 1V8OA 3GO4A 3RODA 3ILVA 1UANA 1V8FA 2B25A 2VP2A 3OHPA 4Q02A 4R2HA 5H8WA 1Z3CA 5K9ZA 2A86A 1GXSB 3NHSA 5JWRA 3BF7A 3TLMA 3FSEA 1Q16A 1Z2OX 3PEUA 4BNFA 3V97A 3IILA 5DI3A 4YLYA 1QZTA 2RH9B 2BFWA 3TCKA 1KMIY 2WILA 1G2QA 1ZM9A 3E3OA 3V7YA 2OHVA 4C4AA 1H22A 4YJ2A 2XCSB 3C98A 2D2IA 1VI2A 2XNDD 1TUGA 2O4CA 2V54A 4DMGA 3PRHA 4WGGA 5GIOE 1TLFA 4ZVRA 1R9MA 4Y1GA 4F6RB 3EVTA 2IVZA 1F1JA 3OM8A 5KVSA 3LECA 4LHEA 1YBHA 3KUDA 5D2CA 4EZIA 2B7CA 4A15A 1V1JA 4K05A 4BE4A 1WV0A 2FXVA 4QPCA 1ESZA 1QRAA 2Z5GA 4V0ME 5FTJA 4DM4A 2VNSA 1I1OA 4MDHA 4EVQA 1QTQA 4EMBA 1T5SA 2D5IA 2WG1A 1SCJA 1TIPA 1HE4A 1QKKA 2XIQA 2D0IA 3AIIA 3BK2A 3KLOA 3N74A 1CWUA 2QMUA 1V9CA 2VOEA 3GQVA 5DYNA 4C0KA 3JQGB 3B1VA 3WDSA 4F46A 4GGOA 4E2XA 4DILA 2IYLD 3HCCA 3TXYA 4PTYA 3MA0A 3EJ6A 1I0IA 2H1SA 4JEMA 1U9YA 2X1MA 1XF1A 4UNIA 1OBHA 4D9MA 4M88A 3QWFA 1ST3A 5F9HA 4JVLA 2OUKA 2O14A 3ON5A 5TQJA 2NW6A 2F3PA 1SH7A 2RJNA 1NU6A 1P62B 1V43A 3LBFA 5A06A 4JASB 1KBQA 1TEHA 1ILWA 1RZUA 3I9V6 4IO1A 5BW4A 3VC7A 5I4BA 2ZBDA 1NAHA 4AXXA 4C0XA 8GPBA 4JDPA 1E20A 3FPBA 3WDKA 4GEGA 1ISMA 5FBKA 1TIBA 3TW8A 2FZCA 2NO9A 2IZ7A 1T0IA 3RC1A 3L7MA 4ND4A 2XBMA 1XR3A 3F74A 5BORA 2FFBA 2FN8A 1OB2A 4XCXA 5F12A 2H92A 1NBMD 3DGEC 3B20A 1TM2A 2FLKA 1BJKA 3QKIA 4PF1A 3UVEA 5C3MA 4OX9B 3NCTA 2A1TS 1R4NB 1MDBA 1SN7A 4P34A 4CIAA 4J0DA 3OCUA 5FXMA 3I4CA 1R27A 1Z8DA 1NN1A 3FWPA 1Y3CE 3DLCA 4QBIA 4B3BA 4S1NA 1M2WA 2JD2A 4PINA 4PFQA 2YW9A 4Z0PA 1XKTA 2WQ7A 1EFPA 4YBZA 4KEAA 2NT4A 1VL8A 3FCXA 2WJIA 4UHFA 3RS5A 1P9NA 2AH5A 2Q46A 2NU9B 4HGOA 4HT3B 1V7CA 3T0GA 1GZHB 2EJBA 2QYOA 4O33A 3VAAA 4DJFC 4WESA 2MINB 1LXCA 2VJCA 5CT4A 2PGXA 1AXEA 3FYUB 4N7BA 3UAOA 3IJRA 3BWYA 3EIHA 3UCFA 3V7NA 1A88A 1J22A 3SC3A 5KYXB 3FZNA 1AJEA 4G5QA 3AOGA 1TA0A 5DNVA 1PNQA 1YFZA 3HO6A 3FR7A 1TYCA 3Q7PA 4RMGA 1Q7GA 2FPKA 4TKUA 1M10A 2EP7A 4U5QA 4ZU1X 3W7BA 5BWBA 3AF6A 1XDSA 1ZVKA 4GGMX 2ZJBA 1Y7HA 4MS1A 3IULA 4B40A 1GZUA 2FFQA 2ZI6A 2ZVDA 3H8SA 3OFND 4FNMA 4NE7A 1EVEA 1CBUA 1M6VA 4TMZA 4JZKA 5CNJA 4FK8A 1J0EA 5FUBA 1HURA 1KR5A 3ZHBA 4GPD1 4NBKA 4P4GA 4ZAVA 4B5LA 1WA5A 4M1TA 1CY6A 5JVDF 4C0LA 3S81A 1UQUA 3DFMA 5F2EA 3K15A 1XZQA 1XEXB 3C3BA 3KB2A 3QKWA 3TQQA 4B6EA 3SJZA 1L4EA 1T34A 5BYBA 3GPBA 2PMKA 4MO9A 4ZPXA 1E8DA 1IE3A 3D7NA 5E8RA 4DCNA 2WF9A 3RU3A 1U98A 1QV6A 2HMAA 2PRZA 3G85A 2HPHA 4CCAA 4YB8A 4AK9A 4NYJR 4BKRA 1G2PA 3I6YA 4BWYA 2BFNA 3HN2A 4ZO7A 1QCDA 3JYHA 1CY1A 5JSUA 1US8A 1H6AA 1Q20A 4PRLA 1Y1PA 3K5HA 5IBPA 4UMEA 3ETGA 1GOTA 4D0SA 5FNVF 3EUWA 2N3ZA 1ULBA 3DMTA 2CFSA 1TI7A 1XJCA 2WJAA 4GX0A 3R3WA 5AMXA 5JC8A 2VF8A 4KXUA 4JFRA 2IUTA 1KETA 3WIUA 1MIOB 3QFSA 5C8YA 4WY2A 4E07A 5IJ0A 5IVHA 4W1PA 1Y8RA 1KIMA 3RC2A 3FAKA 4L02A 3X1ZA 5FO1A 4J07A 4RXUA 1W36D 1DHTA 1RBQA 4W1RA 1QOQB 4PZ0A 4IWYA 4XIJA 4QOEA 1XXHB 3ADOA 1ZLYA 3I3SR 1ZD1A 2PS3A 1YI1A 3PFWO 4A0QA 3HSSA 4BV3A 3P27A 4QJBA 1WWKA 1QYCA 1J4AA 4GO1A 4TYMA 3DSRA 4JJFA 2OLKA 4LOLA 3MMSA 4UUQA 2XRYA 4XIGS 2PL3A 1Z68A 5EMKA 5IKEA 2JBAA 3FNRA 1P4HA 3C6BA 4BBAA 2PG3A 3EBLA 3IR5A 4UUAA 4D79A 1OT5A 1H6CA 2TRSB 2JASA 2RB4A 3LGSA 1HYGA 5SICE 3TSWA 4NCIA 3ZEAA 3U7FB 1DAPA 1JKJB 3TUIC 5LC1A 1RPZA 4GX1A 4OH1A 4O0MA 4PX5A 3N2GA 3X1DA 3E8MA 3AJRA 3MJVA 3PC2A 4Q7JB 1F2TB 5K0GA 5DBOA 2VSQA 4OJYA 2Y0PA 3V48A 4AQDA 1L4NA 3QTLA 1YT5A 1Z62A 4E3WA 3VR4D 2EQ5A 3GBSA 3GEGA 4PNZA 1ZUIA 3EFBA 3FMIA 3S1SA 4JLJA 3I4FA 3OPVA 5AHWA 2QNRA 1F06A 1P0PA 2EFYA 2GZ3A 5JJ5A 1NBMA 1YBMA 3INRA 4C5CA 4HNHA 4NFSA 2GAIA 4YONB 2N1MA 4RWEA 4K9NA 2Z09A 2O8DA 4Q9JA 2DQZA 1H05A 1VLQA 4GSLA 1HTBA 3BCSA 3S28A 1NVEA 3EXHC 4YN3A 4E33A 3VSDA 5CR9A 5BUSA 1QGUA 2CK3A 4RTMA 2R8BA 3DP9A 4MV6A 3S3TA 1Q0PA 4DUPA 4TVSA 5DCUA 2JHFA 1DB3A 1Z82A 1YQ9A 2ZUSA 1Q92A 3R2JA 1DRKA 4KE7A 4U2CA 5EPOA 3URMA 2LIVA 2MOKA 1UFVA 4A6DA 3GYBA 4DCPA 3AR8A 1BCSB 3G88A 4JP3A 2W7TA 1U2EA 2GVZC 2P9ZA 1O96B 1QYVA 3WLKX 4AAYA 2H65A 1RMYA 2ECKA 4OD0A 4IH4A 5B58T 2CLOB 1F6DA 3O83A 2EATA 1P8AA 2VPTA 3WY9A 3FOCA 5FIUA 2O2SA 4FJ2A 4N65A 1LK7A 1WAMA 4RV9A 3OZTA 5G0WA 4BN4A 1SPXA 2ZK7A 4ZOQI 2FQYA 5B37A 4IMPA 2JLVA 1WP4A 2G1PA 2ODBA 3HPQA 4I9NA 1KJQA 1TW3A 2V45A 4Y2GA 4Y6QA 4BZPA 5CFMA 2JGIA 5FTWA 1RRMA 3D2CA 3B70A 3L49A 4NMXB 3RD5A 3AY0A 4J7AA 3B5JA 3GRPA 3CUVA 1V39A 3W5DA 2E7ZA 3SM3A 2EDAA 4R8SA 2ZUFA 1GCAA 5GONF 4I1RA 1QRRA 2FZGA 4EDFA 4LSGA 1S4QA 4IIBA 2MYPA 1IOWA 2INGX 2FAXA 3HN6A 3OIUA 1GR0A 4O08A 3TLYA 1KYIA 4PC6A 5I45A 2FR8C 3I3OA 3NM4A 1P91A 2CLDX 2V7QD 1E6WA 2MSKA 3DP7A 3QVSA 3V32A 4YAKA 5KNCD 2AC4A 4UREA 4LDQA 3SKXA 3BGSA 5AFSA 3JRWA 3E53A 2A3NA 2RG7A 1WTAA 3OUUA 5FPKA 1W36B 2OZEA 2IOHA 1VPDA 4CMIA 3HXKA 2WU0A 3TOCA 2X3UA 3KXLA 1AUXA 1IQRA 2C2YA 2QAJA 3F8SA 4J0KA 3SBOA 5KPJA 3B52X 1BG6A 4Y6LA 5LZ5A 1T29A 2PKQO 1PJLA 2VJAA 2EBHX 3RS4A 4HS4A 4XM0A 5IT4A 4EABA 4Z1MA 1BU5A 2X3YA 1CZUA 4MQLA 4O2BB 4GQBA 4QRDA 1BXGA 2XLCA 2PLAA 4GPIB 4H3HB 4WLOA 5FBRB 4EZEA 4J0CA 3KKEA 1QWOA 2J3HA 3RLIA 4CEHB 3EGWA 1YZLA 2YWDA 2GBLA 4JU9A 3VQTA 4B44A 1NG9A 3LPNA 3WGZA 1XQ1A 4LGYA 4HWRA 5GJVC 5BWLA 1E2DA 1MC8A 3QUSA 2VDRB 1EWVA 4G0ZA 4AJPA 2D2XA 4ETNA 2UYOA 3ZU3A 2YN2A 4NBWA 5ALOA 4ZVNA 2YVQA 1T10A 1EIZA 1NBME 2X5OA 1STOA 4J9VA 3RTAA 4YMTA 1CDOA 1XZJA 3HFJA 4HAYA 4C0QC 5BV1A 1X7GA 3DAOA 2MMGA 4RK6A 1JEEA 3TZBA 1ZNWA 3GGOA 4X41A 1MO6A 2W4MA 3UUEA 4TRMA 3Q88A 3ELYA 3QOWA 2JCVA 4PPFA 4LJ9A 4AECA 1MG0A 3JX9A 3R6LA 4Z0NA 4X64B 1KJWA 1Q84A 1U0GA 3SHTA 5A7FA 2OM6A 1N5JA 1Q1BA 4Z4IA 2B3DA 1N6NA 4PO8A 1DWPA 1CQJA 2JJ2D 4ZCTA 1XYVA 1Z6YA 1NTOA 3MJSA 4BL5A 2NZUG 3ELDA 1M2FA 3MFQA 4HVTA 2PUDA 3IO5A 1EJ2A 1HQDA 1YB7A 4J7CA 1SBCA 1X74A 3RUEA 2YY7A 3BTSA 4W8OA 5AI4A 5BPHA 4CM9D 3V3TA 1TO6A 1BH6A 5LVAA 4AF6A 3AUXA 5IJZA 3TXXA 3QKSA 5BOSA 3BJEA 2W6PA 1VC2A 4MRRA 5ALFA 3RS8A 1ZUNB 3B3QA 5KSOA 1P5FA 2DYKA 1NRJB 4OBEA 1I4EB 3QU7A 2X9NA 5DBIA 4G8BA 4NCNA 1PDOA 2VSYA 3G0GA 4X71A 3VGJA 2ZLBA 4HI0E 3FNGA 4RD3A 3T5PA 3DHYA 6ADHA 4JT4A 4I9HA 3DEKA 3VUFA 5A9SB 2XUOA 2EW1A 1WDKA 2G63A 1Z0SA 3LWDA 1VL5A 1I7PA 2WF8A 3KZCA 4RPIA 2XUIA 1CUZA 4UE2A 2BHRA 2JFXA 2F8MA 1K75A 1KI6A 2Y2VA 3QNWA 4CIBA 3HWWA 4AJOA 2IYPA 3K1AA 2CWDA 4UOZA 2VIIA 1QCYA 4E7OA 5TMPA 2ENUA 1MHTA 1GV0A 1HFEL 3KE8A 1QGDA 5JQWA 2PVCA 1JQKA 4IDHA 4DMUB 1P45A 8OHMA 4KDCA 5L4SA 1NASA 3OE7A 3A0UA 1QIFA 3IOEA 1TPZA 1CR2A 1VA5A 2OD9A 2V55B 3L0ZA 5ECDA 4CF4A 3ADBA 1QHGA 1XWIA 4M9RA 2VDQB 2UUAB 3RUIA 4WH0A 1GNSA 1W25A 1EJ6A 3GLKA 1OB5A 2DULA 2XDQB 3EUEA 3FPHA 4BNIA 2GHQA 1CU1A 1ODLA 1U9CA 2C96A 4P54A 3UHJA 2H7VA 3ZHTA 3A1UA 1QQ7A 3W6OA 3KPWA 5J5VA 4D9CA 1QBKC 1P1FA 3MT0A 3MD0A 1ONOA 1AUOA 2QMQA 3A05A 3K92A 1E5TA 1LNSA 2QU7A 3MN1A 4LC0A 5AIAA 3IEPA 1MRZA 3RTGA 1WUIS 2I5PO 3SI7A 2OCLA 1EMDA 1KAOA 1SURA 2O1SA 3VHRA 1Y8CA 1W4BA 4EG0A 3IBFA 2PLWA 4R68A 3ZHSA 3ZHRA 4GHWA 4M36A 3FUWA 1USKA 1D0SA 1UWCA 1CPYA 2AX3A 2AN1A 3BILA 4QSMA 1QIEA 4QYXA 4YJ3B 1C9KA 3V4OA 2PKQP 3W2GA 4LMAA 1L3IA 1P2UA 5CPFA 5F5XA 4K9SA 5C1IA 2AX4A 2C84A 1I6WA 2IODA 5LXTA 1GTVA 1C9EA 1BN6A 3QPCA 3TCNA 1MW8X 1RJEA 2PR7A 3DDUA 4N5IX 5I7SA 2Z95A 2IUYA 1SUIA 4QA9A 2JW5A 4CG1A 2EKZA 2DY1A 3N2EA 4K0KB 1SUAA 1P5ZB 3ZD6A 3GJ6A 1XZKA 1MQ8B 1TQDA 5DEOA 5LLSA 1KRXA 2G4CA 2P0YA 3PNVA 5AW5A 3FIJA 3X44A 1USGA 2E18A 4C7OA 2BONA 2ZKLA 2P9GA 3WV4A 3DYBA 2QL5A 1N4DA 1GSOA 2JGDB 1ZJ4A 4MWZA 4OK6A 3L05A 1ECBA 3R7DA 4A0GA 4JR0A 4B5KA 4HAZA 1TMGE 4FSDA 1XEWX 1GQOA 1SHZA 3FKSD 3ZWBA 2PCLA 1C4KA 2Q9BA 1ENPA 2BISA 2ZS9A 3OVMA 2Q3DA 4QECA 3D2BA 4IF6A 2PMWB 4L3WA 2ORIA 3WMGA 4YROA 4O5OA 5AOCA 2AFHA 2ORED 2Q6KA 3HZHA 1H1LB 1XV5A 5E0KB 3WSVA 3DLHA 2GEDA 1HEIA 1Q22A 3H4TA 4Y1EA 1XMVA 2VHJA 1SOWA 3FUTA 2IS6A 3DR3A 1J39A 5A9SA 2X2OA 4Y18A 1OZAA 2LXNA 1PGPA 1FS6A 3Q12A 3VO8A 3I58A 4Q82A 2BRUC 2ODQA 3S68A 3AP1A 2GD0A 1T2EA 1Z4IA 3HDYA 1CZRA 2QN1A 4XGRA 4XFKA 1CY7A 1JSRA 4PGMA 4XEUA 2VJDA 1LRJA 1QGYA 4IIYA 1C3VA 1ZD4A 2AGVA 3PQEA 4HN9A 1JZSA 1JVSA 1O58A 2X0JA 4WKNA 5DN6D 4KQCA 1L5OA 4WBNB 3D3EA 2BH2A 1LX7A 4L8YA 1LBTA 1RYZA 4HC4A 4BAZA 3H8JA 3JQ6A 3L0DA 4QQFA 4ZCQA 1EE2A 2O06A 2XRMA 5A4DA 4KXMA 1KI7A 5T4HA 1NG1A 1X9HA 2AQIA 1KFBB 2C8JA 4HQKA 1SXPA 1M2HA 1MXHA 3FVWA 4IFEA 1SQ0A 1ST2A 1PZXA 1NMYA 3ABOB 3KP1A 1N2XA 4OM8A 1WB4A 2QXTA 2CUZA 1NFQA 1W8DA 4IXNA 4ZEOA 3ZD8A 2WHPA 3IQGX 2D7JA 5CD9A 1S8FA 1UPCA 2B98A 2WF5A 2I6XA 2YN4A 3HUEA 5EE0A 2XYGA 3DE2X 3IEXA 1U0RA 1L4BA 1DTEA 2ZBPA 2CV2A 4LJ7A 4HX9A 1NVDA 4EF5A 1SGWA 1MX3A 2WF6A 3VKWA 3DGFC 1U0LA 1JIKA 2WD9A 3NGMA 4EJSB 7GPBA 1R12A 1LRLA 1VBNA 5BN5A 2I6FA 2B21A 3DMPA 4UE3S 2MU1A 3DMFA 4PICA 4WECA 3DBOB 1RXVA 1OFUA 5FWYA 2FCAA 2RHGB 1QJ4A 2YY6A 2G67A 3MQ4A 3RIXA 2Z04A 4RY0A 5I47A 2BHSA 4RX1A 5HZGA 3I62A 4IDBA 3LVQE 1ZU5A 4FQ7A 4JBYA 5BV0A 2ZYHA 2JKVA 4Y6SA 1FTSA 3IQIX 3DV0B 5JS1A 3SZOA 3UMVA 1LJ8A 3DO8A 2XLBA 4NU5A 3TGLA 2NTEA 3QVOA 1FZTA 4HAXA 1GG5A 1PZEA 3WWEA 1SBQA 3ND8A 2VR1A 4HN4B 4KBGA 2PHZA 2IV2X 3U56A 6NULA 1F7VA 3EMBA 2XW6A 5JVDB 5BNZA 5A9TA 1IWBB 2OAP1 1NJGA 1JDVA 4JQYA 4AP5A 1VZ3A 5KDOA 1PT9A 5ICCA 2O2GA 3FNEA 4PW0A 3GT0A 4FDMA 3EC2A 4Z1MD 3KR0A 1M0EA 3A2NA 3E1SA 3QPVA 5JCOC 3EZYA 1CNEA 4FNAA 4JP1A 4LK2A 4II2A 3NIBA 2C7BA 4IZOA 1II0A 1F0YA 3O8OB 1WVGA 2IYXA 3OE4A 4MIOA 5JMWA 2FP3A 5KQMA 4Z4GA 1D04A 1PR4A 2B4AA 4DC0A 1M54A 5YASA 4G1VA 2A88A 3VVBA 3PXAA 2RB5A 3PX7A 3TMKA 4OGGA 4GVPA 4FOTA 3IKLA 4Q7LA 1OT3A 3GVXA 3TSCA 3I0NA 4EVIA 1ZQ1A 1JXAA 1D7AA 4ACAA 3GELA 3AF1A 4UHKA 3IBTA 5F35A 2P75A 3G8DA 3PUHA 1YR2A 1W34A 2PL5A 3H17A 1T9GR 3GARA 1UC8A 4R41A 1NONA 5EE3A 2Z9CA 2GXSA 2X0IA 2I78A 3KKPA 4KR9A 3FYHA 1XEXA 1CZHA 2ZCUA 2P68A 3TOZA 4D9GA 3B6ZA 2DQYA 1L6IA 1FDTA 1WHTB 3IPXA 4FOPA 4P7BA 2MR6A 4KUHA 4BEBA 3C3CA 4AMUA 5B3LA 5K45A 1EGHA 5FWXB 2RK3A 4DG8A 1JIQA 2H1RA 4J3JA 1IXRC 4YMWA 5F7OA 3PRJA 2X41A 4BCBA 3NJ8A 1XNRB 1CXZA 4DGSA 2P3LA 1EDEA 2QPTA 4YWJA 3NNNA 1O1YA 3P1JA 3Q9LA 4DWVA 5T3UA 2VXCA 1OGIA 2G77B 4IRUB 1DO2A 4KBYA 3U2QA 3RYCA 4ZJZA 3KETA 4GMKA 3EGXB 4NBUA 1E3MA 4NTZA 3F6YA 1A7JA 1OFGA 5HFJA 3T7JA 4EG6A 3FMPB 1TMYA 2ZZNA 2ZTVA 4PY2A 2P35A 3A6DA 3SKVA 2JVIA 4YRDA 3NUQA 1YE3A 3E7PA 3MTDA 5JEEA 1MX5A 2QMEA 2OCGA 3B6MA 2ZB8A 9ABPA 4RSRA 1PFQA 2NAPA 4HDRA 3CRZA 5AKGA 4KG7A 5E1DA 3WFJA 4OVKA 1VIYA 1JFLA 4E21A 4ZYYA 421PA 2GARA 2GFIA 1NE2A 3FJYA 3RK4A 3CQ9A 3W06A 5IF3A 4FE4A 2QZPA 5A3VA 1OTYA 2Z30A 5TARA 3O3OB 5DTRA 2BFCB 4G6ZA 3S0JA 1NVUQ 1T8UA 1G64A 1QU3A 3ZHUA 4HNVA 2B1GA 1JH9A 5HP4A 4POAA 3DMTC 2R7NA 1G3RA 4D2IA 5T3YA 2Z57A 3ZNOA 3OLCX 3AF4A 3Q7QA 4DUGD 3PCXA 3UGJA 5JANA 2D2VA 3I2GA 4H0FA 3CJRA 3SM9A 2E55A 1JECA 1MV8A 1NUQA 3QJYA 3HXLA 3QSGA 2IPAB 1YL6A 5DVZA 5LUBA 3SLGA 4JY7A 5FULA 3W7VA 3ZWPA 1M6WA 4B4VA 1YVDA 5CFRA 4U6QA 1QAQA 1XYGA 1FFSA 4ARZB 3LUBA 4LV5B 4EKEA 1I4WA 3CR8A 4TKMA 4ZAWA 5BURA 1H3FA 3FVRA 1UM9A 2O0JA 1W59A 1Q74A 2QUBA 3I2FA 3B1JA 2HQOA 2HDOA 4LYGA 1U11A 3NVMB 3Q7RA 4GLLA 1H3NA 1QFZA 4EYGA 2P67A 4TGLA 1LDMA 2IYAA 4V39A 5C18A 1UBLS 3F8WA 3KEFA 1Z0JA 4RD2A 2NADA 5FPPA 3KALA 4FIDA 3GCZA 2CXXA 2EFEB 1ZAYA 3VX3A 1RXIA 2NO7A 4NCKA 4WGFA 4PCAA 3W2IA 4AKTA 4OHMA 1DXYA 1KK3A 3VHXB 4BNUA 3CE6A 4R1OA 4DG9A 1QGUB 4O4IA 1QVZA 4W7SA 1NATA 1RQ7A 4ECEA 4Z1OA 1NBAA 1E3LA 1D09A 1SBZA 2Q2VA 3MLEA 2PUBA 1VIDA 4UCWA 1H2HA 4O25A 4G56A 1P9WA 4BFLA 2KSQA 5T64A 1JW9B 2VZ8A 3K0CA 4P4SA 3RWOA 4DMKA 3IBSA 4I4IA 3UWMA 4WFKA 4RSMA 3UKDA 4JJGA 4DG5A 1BKYA 1K8YB 1SC4A 4JL8A 4CDGA 3G2IA 5KJ6A 3EH1A 1P1RA 1GL6A 1WQ1R 4OHYA 4TVOA 3RJZA 5B1YA 5LBIA 2Q5IA 3I05A 1NUUA 1S7GA 3JQBA 2ZI5A 3PT5A 3HCEA 4MRPA 1DKQA 3D0RA 3DVSX 2RHDA 3UT6A 1JEQA 5DDIP 1M3SA 2AG8A 2H2FA 1PZNA 2ZT5A 2EZ9A 4NE2A 2H4WA 4N6GA 4Y2HA 5BSWA 3L4BC 3VNUA 2JHCA 2YYSA 3KUUA 2WF7A 3O2NA 4WZBB 3IEVA 2QE7A 1P2VA 2Q2WA 4UUBA 2FE1A 5LMCA 3IE1A 1D6SA 3IE2A 3BCUA 4I5DA 4XGIA 5ESRA 4TWRA 3DKVA 3MFYA 3WLQA 1Y63A 4GOXA 2N47A 5MHTA 2BDUA 3FGNA 4EQ6A 1THTA 4M8KA 1ZD3A 3VRHA 1Y5RA 5ALRA 2E0IA 1TVEA 4PYQA 4ZC1A 2HDNB 3H6GA 2E5FA 4XR9A 1C5KA 3BA6A 3WAJA 1ATZA 4NXMB 3KJHA 4RZXA 3FHJA 1LW7A 4W5WA 1VHWA 3SP1A 5K0BA 1J8MF 2HEGA 4KX3A 4Q7KA 1Z63A 2HT6A 2Y0BA 3FPJA 3ORFA 2FSVA 4LRSB 4WINA 3B82A 3VYUB 4C4YA 1ODIA 3ZYCA 4QIHA 1S9DA 3FY4A 4URVR 2CVOA 2TMDA 2WFAA 1EXNA 2IYQA 2VP3A 1KZGB 1Q21A 1QE3A 1VE3A 1ECJA 2DBYA 1BWRA 3C0KA 1B73A 1XKXA 1K88A 2BI8A 2XXBA 3ED1A 3QKRB 4K9LA 3T3EA 1PF7E 1YIDA 1C0LA 2YJ4A 4WJZA 4N9QA 3R7LA 4P7GA 1UPTA 1GZ3A 5DRYA 3C3MA 4UAGA 1IDOA 2CY0A 4NOMA 4ADSG 1T43A 2OENG 3BM5A 4LZNA 1C30A 3TKLA 1MTOA 2B8EA 4EGSA 1Z26A 3ZTTA 4DIFA 1T8RA 1MZVA 4PONA 3OA0A 2JIMA 2PVPA 3UF0A 1JZTA 1U0OC 2O0MA 4W82A 3RAFC 5AICA 3K0SA 3QF4B 1G8AA 1DCMA 2C9CA 3EMVA 1JJIA 1Q17A 4HWTA 4IFIA 3ETHA 4N4AA 5IYZB 2EFGA 1DGQA 4EUEA 1H9AA 4EKYA 2YHAA 3VR5A 2YC4C 4QJ3A 2HJHA 1MO3A 2XTMA 1DFGA 5LIRA 4AZSA 5HS4A 4QTXA 4GI1A 2IYUA 3HFSA 4DSUA 4LOHA 2G4VA 5DCYA 3L6DA 4Q6BA 5ITZB 5DTJA 2O3TA 1VFPA 1DLJA 3F0TA 1E2EA 4JVNA 5AKJA 5DULA 2RE8A 2NYRA 1OBFO 5L7TA 2V0NA 3OOYA 2XUJA 3RREA 4KMOA 3Q8XB 3AKZA 3TR6A 3PQ7A 1DEOA 1Z12A 2HA6A 2DECA 2VKTA 4B3XA 1AKYA 4EF6A 4BX8A 1ZD9A 2JFZA 5H5JA 3WJ7A 1T9GS 2XCOA 1E2HA 3EEFA 4YP9A 2Q29A 2C9ZA 3DZIA 3REFA 1SCNE 1PWEA 3C8MA 3CC8A 3QU9A 4KQXA 4MUAA 2YV3A 5I9MA 3W8EA 4V3CA 4RPHA 1FRQA 3RSSA 3WGLA 5JXWA 4MR8A 2FUCA 5I5GA 2JI4A 3DUWA 5AOAA 3FOZA 5BYAA 2PSHA 4BEJA 1QM5A 4I1PA 1JNXX 3DC2A 4RDHA 2NXEA 3BIWA 1G4AE 4DA7A 2D8MA 3HB7A 1P0FA 4GOMD 3V4LA 2JFOA 3N8KA 3E05A 1NZJA 3BRQA 4XPIA 3A6LA 1S7CA 3UA4A 1O6FA 2Q8NA 1OYOA 1LPMA 3LUFA 1VLZA 2AZMA 4KVAA 2YMQA 3BRSA 3IXLA 4YLEA 2OFFA 3QFRA 3UMCA 4AJEA 2C5GA 2OK7A 4EQ6B 5I7RA 4FDVA 3U7GA 4M21A 3O4RA 2EHDA 3IQEA 1IBKB 4K3UA 3NT4A 1HZZC 1EDDA 5HKOA 4JI0B 1QU2A 4E46A 1Z25A 1KEKA 1D4AA 4G8JA 5FHQA 4ENTA 1NL3A 1C8KA 1Z5PA 1X1CA 3AR4A 4NJOA 1FMJA 1H9BA 1KI2A 1RHKA 3W5UA 1W49A 4JSRA 2G04A 1SVSA 4GPEA 4RELA 2GUGA 2QQEA 2Q3CA 3CX3A 2R2GA 3H18A 3G59A 1W6RA 5GPBA 4H1TA 2HLDD 1RDFA 4INPA 4G63A 1ZSYA 1XTUA 2BM8A 3M5WA 3DAGA 5CH8A 2F1OA 3YASA 4DCJA 1CYDA 1JIXA 5ECWA 4YP7A 4F9FA 4D97A 4YCLA 1QRTA 5B6IA 3WL8A 1XA0A 1C14A 4C6RA 3AUJB 3BK7A 4L6CA 4R2XA 1ZH0A 3HSYA 4WBNF 3RSGA 1UQTA 3C3WA 3F5FA 4X62B 1X8XA 2FXIA 4M2LA 2C9YA 4MQ6A 4D4KA 4ZEMA 5FOQA 1J9ZA 5DM0A 4EKDA 5H02A 1BMTA 4OK5A 5IAEA 3TRDA 4BZXA 1YZTA 3L8GA 2WAXA 4R69A 4ZV9A 3GB9A 1C7ZA 1EGAA 2JFPA 2IKSA 2OZLA 2OLEA 2XVYA 3N5KA 4KQWA 5HF6A 4Q03A 2WZQA 5I51A 1PDWA 5U4QA 6GPBA 3GLFB 1LV7A 5F4ZA 1L8QA 4D9BA 4YRSA 3E5RA 2EJWA 4LVOA 3AFIA 3RLFA 4NU8X 4HYQA 1KAMA 1R3DA 1I24A 2P2DA 4CI0B 4TTJA 2FKAA 1U1CA 1BQEA 1I1QB 4EJSC 5K4HA 4CQNA 2OBBA 4X0EA 3EOAI 2LUOA 2YNMA 4KR0A 4Q4LA 1O0SA 3EVFA 1B8PA 4IYJA 5KOIA 5FB3A 1U2GA 3WMXA 2HHCA 3SIXA 3QE2A 2WFZA 5TVGA 3UTDA 1WF6A 4G4JA 2ATEA 4GC9A 4KQIA 3SEFA 4BO3A 2AJLI 4I50A 2IEGA 4DSNA 3L46A 1DIBA 1JR4A 1SKYE 1W4LA 1WCWA 3C4VA 3R3ZA 4F72A 3TNDA 4GWGA 4U2DA 4OHZA 3RRNA 3EJWA 4K6KA 3UJ8A 4LF4B 5KTPA 2WD7B 2F4VB 2DC1A 3HKDA 4M7WA 1V5WA 4LI0A 3QXSA 2DHQA 4J3FA 4H4DA 3AT1A 4NQRA 1EFHA 2FX3A 1R66A 5C37A 2GK6A 1XMSA 4MGYR 4FHGA 3U62A 1OBOA 2X5XA 4XQEA 1J99A 1KPGA 1PJ8A 1G5QA 2W58A 2Z5VA 4LWQA 5HBRA 1HDEA 2JNWA 5CG1A 5G4KA 1HKUA 2ZYVX 1RLIA 2ACVA 2DTEA 2XMRA 4LNHA 4MI6A 5CFPA 2XQKA 5EWMA 3V8VA 1JDZA 1XLUA 3VYRB 1PZFA 4B9EA 1T4CB 4R9RA 4ZU3A 1C1YA 3DHNA 2J30A 4MYDA 4RU1A 2XZPA 3M1AA 2OILA 4IIJB 3RVRA 3T12A 1FDVA 1I33A 4LJKA 3A8TA 3ABSB 1BOFA 2C59A 3M49A 4QFMA 3SSAA 3QVKA 4DYHA 5AXAA 5EMNA 4G5RA 1XRMA 3A28A 4QULA 3HJHA 3IMKA 1SA0A 4Y7DA 5EJ7A 2GPTA 4FYPA 2HWXA 4RKFA 2J5KA 1ISGA 3KAQA 3OX3A 2F1HA 4MI1A 5LXTF 3THXB 5D1NA 5KQGA 1W5AA 4HGYA 3OICA 2LPMA 3INGA 1ND6A 2ZCVA 4Z0TA 3SJAA 3BERA 1GY8A 3A37A 3DTYA 2C07A 1ESNA 2FSFA 5E4YA 4DB2A 4P5DA 1QS0B 1UDXA 4R8MA 2J9GA 4ZOAA 3ZR4B 3U4GA 1CKEA 1NR1A 1NULA 4LOIA 4B3IA 1OXBB 1W5BA 2CZCA 4R2KA 3TLEA 1RAFA 1VJRA 4MVJD 4N82A 4U7HA 4XWWA 3W78A 4IBOA 4M0UA 3BVPA 5KWSA 1AC5A 2AR0A 3U17A 3VDRA 1HOTA 3SVTA 3H16A 2ZM6B 5IUKC 3ZGLA 3QWIA 1YFLA 3IPRA 3NNDA 1CQIA 5DXFA 2XZDA 2IHVA 3CLRD 5JS7A 4IAOA 2CB0A 1NXPA 2IOFA 3D5QA 1SK9A 3L0SA 2P3OA 3C41J 5DNAA 3VSBA 2EP5A 3U4DA 1E60A 1QP8A 2Z8YM 5FLEX 1LUAA 2QT1A 1I5RA 4DZRA 5KX5F 2CLEB 2FKNA 2I3DA 4R4JA 1A97A 3ICWA 2O3SA 5AI9A 1AN9A 2GPWA 2W0MA 3K05A 3IAEA 4GG1A 4FB4A 4DLRA 2JCXA 3CZCA 3F97A 1UM8A 1GFWA 2C98A 2OGUA 1TKRA 5H70A 3WFZA 1IEXA 1LTHR 4QPJC 5TNXA 3IO3A 5T4FA 4CM9A 3OMLA 4QD3A 3H9QA 1Y3AA 1ZHFA 3A06A 4LDAA 3R0XA 2ZBUA 1IBRA 3NH9A 5JQGA 2X13A 5J2UA 4N18A 2DFNA 2W6JA 4I50B 3PD0A 2UZ3A 3K1AB 2OB2A 3QBTA 3ZVKA 4I8IA 4ZIRB 4G81A 4IJWA 4J90A 4IG9A 4URYR 4IRMA 5KKNB 4PX9A 4Z4FA 1DG1G 4NU6A 1UBRS 1NXTA 1UMKA 2IKQA 2Q3JA 2IUFA 4MI3A 1YULA 3SOZA 3M6WA 4JODA 4N3NA 1LI7A 3U4CA 1JXMA 4PZCA 3VR6H 4OSEA 2FW8A 2G5CA 1P2BA 4B3DA 2HNBA 2YINC 3UOGA 1W7AA 2JAHA 3LT1A 4MWTA 4KQHA 4NU0A 5DRTA 4D9HA 2JZNA 3CTPA 3CIOA 2NOAA 3PU6A 5TY0A 3I6QA 3VZSA 4K9DA 1KTVA 1PFVA 3KDSE 1PZHA 4DSOA 4GBGA 4PG6A 1FNMA 2MYNA 1FZQA 1KQ3A 3L7IA 3FZYA 4CDMA 1H5NA 1WXWA 3UKJA 3QLEA 1ZOOA 2HREA 4CMGA 4ZZ0A 4KIJA 5I4CA 2QVLA 2I8LA 3ETEA 4GZ3A 1FLNA 3OQMA 3OM0A 3QUTA 4A8JC 4BDSA 1FTWA 3NEAA 4X60A 4ED9A 4U7TB 3RIEA 3E7FA 5IWAB 4R0NA 5JYBA 2R00A 3ZX5A 4KN6A 1KO7A 4X1KB 4BV2A 4YQYA 1O97C 1K8RA 3VPHA 1DC8A 1O6CA 1W87A 1Y9DA 3ESDA 4IHJF 4B4UA 4ZV4A 3GUYA 2NU6A 1FVXA 1U1IA 3CZAA 2XWBF 1T5TA 4AZTA 4N5HX 1EK1A 1G21A 1PIWA 2GLTA 2XA2A 3NIFB 2J5XA 3Q7EA 3F90A 3QVVA 3TKYA 3CISA 4AC9A 5DM60 3L4KA 4OHRA 1EDOA 3E9YA 3OF5A 4OQFA 1SUFA 1KYVA 3RFFA 3I6MA 1DQPA 3K4HA 4IWNA 3GZNB 1PWYE 3FBWA 2Q28A 3RRFA 3CN9A 5BXYA 2J0UA 1J49A 4XIYA 4EOGA 4MWSA 2QNIA 3LY7A 4CG2A 4OHBA 1WSWA 2B0JA 4Q3BA 2JFWA 2DWCA 3AH8A 3EF3A 3QUQA 3ZDEA 3V1LA 3D4NA 2OSVA 1HY3A 1Z0UA 4LDJA 3ZZUA 4AULA 4DHEA 4EPWA 1G8PA 4DQDA 4TWZA 4M38A 4MV5A 4C07A 3EA0A 3KZOA 4JGBA 3GY0A 4MVJM 1RWVA 1U5BA 4MW6A 4W6ZA 2L19A 2FPPA 2P0EA 1DBIA 2HF7A 3ACCA 4OBXA 2XKBA 1G291 2OCXA 4JU8A 4W8GA 5KYWB 1BDBA 1UAGA 4P3PA 3W4KA 5EZYF 2JLZA 2H1IA 3RT9A 4MV0A 1BA2A 3JQRA 5HK9A 5F7XA 5AVZA 2EBUA 5D1HA 2WJ6A 2UYHA 4A6XA 2NXCA 4LVCA 4TV9A 1JBKA 1KHTA 1YC2A 5B53A 3ZKWB 2BFCA 3PRYA 2JJYA 4L1KA 3KR2A 4QAQA 5D6OA 2X6QA 5DEIA 1K2VN 3KJGA 4H7HA 2OXIA 4KODA 4AJIA 3RIHA 3JQ8A 3HA5A 1ISHA 2JVKA 1P2GA 1GD1O 4GMXA 3OH8A 4FDLA 1CUXA 1J56A 2A5FA 2CBZA 4R51A 5EPEA 3ZV4A 5JMOA 3DBIA 3GIDA 2IP1A 4GUDA 4RA9A 1KYWA 1WL8A 3LW7A 5J59A 1TCAA 1Z2DA 2ODPA 3Q3EA 1HOXA 3VPFA 2J6IA 2OO3A 3FHCB 2IHUA 4XW2A 1LSUA 4AD8A 2G36A 3HCBA 5KC8A 1A9SA 5EGNA 2LE0A 4YUWA 2FK8A 2RGXA 3C6XA 2QRLA 1MN6A 1HI9A 4BQPA 5C1PA 5LP6A 4A92A 1ONSA 5B1EA 1UBKS 3VVLA 3FUXA 4GWKA 2C7RA 2OQRA 2QKYA 3U31A 4OO3A 1QH9A 5BPFA 2GUWA 4QUKA 3LI2A 2O2IA 3K6RA 3DWGA 1JMVA 3H99A 3FVTA 3H5TA 1C1HA 1SVIA 2QLBA 2E1RA 2G0AA 3QELB 1EA7A 3BCHA 3PD7A 4ZWNA 4QELA 4LX0A 4PWZA 1UMBB 3E15A 3ESYA 3F5DA 4MMYB 4OI1A 4PZ9A 1N2CA 1U7TA 1Y9EA 4NNOA 4RGBA 3U3OA 1A7AA 3FVQA 1LX6A 5DGIA 5E6UA 1A9RA 3KOMA 5AHRA 2OQVA 3GLIA 2J4DA 2OG1A 4ZO8A 5EJ2A 5K01A 3CUKA 5IC6A 3IV7A 1FDOA 2Q07A 3KSDO 4F11A 5DXAA 1GPKA 1WO8A 2PZMA 2QUAA 2WJVA 3ES9A 3NVAA 3JU3A 4H6PA 3A6ZA 4NEGA 2R25B 5AK5A 4DMRA 1QFYA 5MDHA 2ZJFA 2FSSA 1W6UA 3WMRA 4Q9AA 5KVAA 2R7KA 1P6XA 3Q3GE 4JOSA 4UCQA 1WPRA 5T6BA 3T1VA 1XZLA 1PS9A 4DLZA 3NKLA 1TADA 1ZIDA 3BTOA 1XMJA 3WLIA 5EXEA 4E4RA 3GG2A 4QODA 3HLYA 3PZRA 1JAXA 2JAWA 4Q1DA 3L6RA 1PU2A 3B7WA 1J06A 3P0JA 4XB2A 4URHA 1T3TA 1KVSA 2B5OA 1BWSA 1BSVA 2IDMA 2QLNA 3ABIA 3AZQA 3EXEA 2WK1A 4OMCA 5CT9A 2AZXA 2V4ZA 4L5JA 1ISFA 1KP2A 4OF4A 4BUJA 4ZI7F 2C2BA 3FTNA 3EVBA 4CQMD 4L22A 3IR7A 5FADA 5J4VA 5JASA 4YAWA 3GLHE 1JLLB 3FOWA 4QO8A 5DBEX 5FQNA 1Z6ZA 1IEWA 3R5JA 2FWAA 1TL7C 4B73A 1OH8A 4Q05A 1L4KA 1S2MA 2A30A 4JBIA 1AB5A 3KQLA 1T2UA 5EHNA 1L7NA 2QTWB 1YJ5A 3G2LA 3ZLBA 2OXEA 4IQFA 1A7UA 1SRQA 3JPWA 4J2HA 3T3PB 2CFOA 1MJGM 5L45A 2P4HX 3VR1A 3ZW9A 5LOVB 1JLKA 2GEFA 4M1EA 2ZROA 1EFUA 1NIJA 3BL5A 1ONBA 4E2WA 4E94A 5FUWA 4Y1RB 5DASA 5ALGA 2CSXA 4J0IA 1F14A 3Q0IA 4TT3D 4Q4HA 1E66A 2ZZMA 2HU8A 4JHXA 4W8HA 2PA3A 5CIWA 3QFFA 1PDVA 4XQ0A 2R6DA 1VKRA 2ZR7A 3P9RA 3OY2A 2Q9AA 3CLUC 1KDRA 1JDUA 1K6XA 4M0LA 3D9QX 4A0SA 4MJ7A 1QC5B 1GCUA 1RWKA 1JAHA 3WQQA 4BQOA 3GD5A 2IC5A 2PBFA 5AW1A 1SMKA 3FGOA 1Q77A 1OILA 3IT1A 2P4UA 2N46A 2DPHA 3BHNA 4L0DA 5C51B 1EDZA 4OM7A 4DV5B 4J0HA 4LW8A 1NW4A 5BV8A 2ADMA 5ITWA 3GLIE 1O0CA 3ZGZA 1LF0A 3C1OA 3OTWA 4A03A 2I2AA 1I9GA 2CMHA 2D7CA 2O50A 1MVOA 2QUIA 2QX9A 3EDRA 1MB0A 1HLPA 2Q1SA 4QHTA 4ZZ2A 1G0NA 3COJA 3EZLA 3F8TA 1R74A 3K0HA 1NLFA 3R75A 4J1TA 1N3IA 4K46A 5CT6A 4INAA 4WQMA 3FR8A 3V42A 5JBNA 1JLMA 2ZG6A 1YAJA 2R65A 1E94E 2ZAIA 1U63A 3BB3A 4CU5A 1NFRA 3ZYZA 4FFVA 1XK7A 5EXDA 3AO0B 1SZJG 2VLBA 3DA8A 1DAMA 2E21A 1P5JA 2FSGA 1I2BA 1E69A 2JI7A 4EHIA 3LOUA 3GUZA 4PPGA 4EB6A 2PUGA 2F1KA 2V1UA 4I4TA 5BN4A 3ESQA 4B4DA 4LG1A 3BWXA 4DE5A 4TLMB 4CTKA 3GJZA 3T99A 3HVRA 3I30X 3IJ5A 4I99A 5BY2A 4KWIA 5HS6A 5CBPB 1E7SA 5FUQA 2PD6A 1QLJA 2ANBA 4N8DA 4YXWA 2ASVA 3DDZX 4DC1A 1PT5A 1DJOA 2WVJA 3A2KA 4YMLA 4HZUA 2RHBA 2HTFA 3MG9A 4D42A 5A4MS 2LKCA 2WNIA 3C6MA 5D86A 4H1VA 2NAFA 3MCWA 3WRWA 4PNHA 3SPXA 2XVZA 3PYMA 2X0DA 3QW2A 4B6RA 3DLTA 4V02A 1NWHA 4BU1A 4DNFA 4DGQA 5B3JC 4P35A 3CCCA 1JSZA 1OIWA 1CVRA 2QRZA 1J0DA 1Z4OA 4X3CA 1R8XA 3CWQA 4DPMA 3WKCA 4ER0A 1FXWF 3UOAB 4OKIA 3PC4A 3UHPA 2WAOA 3FSJX 4KAXA 4P0QB 1E8NA 1XZHA 3TAUA 4BFCA 3IAS1 1T3LA 2P65A 2PTGA 3C24A 2GCPA 2QM0A 2Y68A 3AESA 1ZA1A 1YJQA 2IV7A 1I3CA 3CTMA 1M0SA 1SKYB 1TM1E 1XTTA 4ZT5A 4W9NC 4M7RA 4IXDA 1Y3IA 3GEHA 2G9NA 4M8LA 1UXGA 2CXRA 2DPMA 1HEUA 1W2WB 3IP9A 5IPFA 5CW2A 5EIWA 1NBOA 3L41A 3MBOA 3AVXA 2XI4A 4C6TA 1DMRA 2QN7A 3R5KA 3JRNA 1SVNA 4LOJA 1R0SA 3KT0A 2R47A 9GPBA 4JXXA 2ZSEA 3QV1A 1L8XA 3DHEA 4PQEA 4B2LA 1YOVA 1K7XB 2HBYA 2NUPA 4G0PA 1BE6A 4RTKA 4Z9BA 1VGRA 3TVYA 3BXPA 3H2KA 1K2WA 2B4QA 3N58A 2OA0A 3Q1KA 4L95C 2QR3A 3WP1B 3HP4A 1SBNE 5M29A 3ER8A 4DL9A 5EJ6A 1CRPA 2VBCA 4DDTA 2GRJA 3S2UA 1GYRA 1DMSA 2FI1A 3O82A 4HHEA 1X13A 3TM4A 1RXSA 4MW9A 1L5YA 2PUHA 4OUDA 1YBFA 2JIRA 2GO1A 1RM5A 4YMSA 1K0FA 4N0PA 2ZOSA 4Y2PA 5JS8A 3ZV6A 4F3NA 3PWSA 3FFBA 5D5PA 3O26A 4BBZA 1HLDA 3KXDA 3QX9A 4HX2A 1KRHA 2B8NA 3L6EA 3RUPA 4JNCA 1O94A 4LRTB 4ZOLB 4BFYA 1PG5A 2BGUA 1Q50A 3CX7A 4AO7A 4F4IA 3I45A 2FSUA 4Q9IA 2Z5FA 2XTZA 3AHEA 3H6KA 3OLQA 4OKSA 2PK3A 5J63A 3A6JA 3IAM1 1XVVA 3DOJA 3O8CA 5FAXA 3KQOA 5BSEA 3LMKA 4GMDA 1DEKA 3JW8A 4M7PA 5JLJA 3KC2A 2JAPA 3CNBA 4NLLA 1JLSA 4S2UA 5DT2A 4IICA 2NPFA 1JILA 2QX7A 5CDFE 1Q0HA 3EGOA 4N5DA 1VB3A 3K0EA 1W5FA 4Z7OB 2JIZA 2LDBA 3B48A 4V0RA 3TTTA 4J76A 2BFPA 2ET6A 3MYRA 3LX8A 5TQ2A 3WBKA 4K6CA 3PQFA 1T4CA 1H8HD 5BWCA 2H07A 4A0FA 1Y80A 2WMNB 3V1NA 7MHTA 5BSKA 2C29D 1MLDA 1O57A 5LQAA 1W0JD 1F2UB 1N6RA 2PGAA 2BKLA 3NHKA 3NIWA 1N9GB 3PXCX 2CXNA 4Q7QA 1EE1A 2C5AA 2YY5A 4GR5A 4YT5A 1XL0A 3ERCA 4L5IA 1P7CA 1EQUA 2LR0A 3U4QB 4UHDA 2ZU0C 2OV1A 2ZTMA 3G2NA 3KB6A 1E1RA 2PLNA 2WSSD 4LOKA 2HSZA 4ZCSA 4A10A 4D8YA 2F9FA 2NVUA 4HLNA 5DCLA 3AESB 3GEDA 3KPUA 3PPWA 4WUVA 1N0WA 5AP9A 4TYNA 1DP4A 4M8SA 1UL1X 2DCUA 4RJJA 3W1WA 2P9CA 3K96A 1CS4C 3GGSA 3LXUX 2VT6A 3JPYA 2L18A 3KTDA 3UYLA 3VTAA 5U9CA 4C20A 1NTRA 3HYTA 4CGYA 3GLGE 3I0ZA 2FX2A 2HL6A 1SXQA 3SC2B 3KJNA 5HBGA 1MH9A 3HNPA 4O1MA 5JO9A 3AKEA 3PUJA 3KYIB 4O6VA 3EZGA 3AVQA 3WNCA 3ROXA 2QSYA 1COWA 3SYNA 1C3OA 4DSZA 1OH6A 1OVGA 2R4QA 1XVAA 4D9NA 3R7SA 3BE6A 5KYYB 1WR8A 5DX8A 1YIOA 4YBRA 4CKCB 1V96A 3BFJA 1G98A 1O94D 2B94A 3HKCA 4L27A 5JNRA 5JNSA 3E48A 3K2IA 1PNRA 3R0ZA 3CR3C 4JI4B 1JJFA 3IAAA 2YXDA 2B5VA 4QBTA 2I2WA 5EUQB 3ZS9A 2H5JA 4IGKA 3LBAA 2E48A 1W94A 3EC1A 3NP7A 4WCFC 3T3IA 2Q4EA 2VWQA 1PZMA 4AYXA 1DDIA 2DWUA 3ETLA 4GH5A 2I7CA 4MXDA 4EKIA 5L40A 1KSFX 1XTQA 2POCA 1AKEA 5EQJB 1G6OA 4ICIA 4RNDB 1E7YA 4JB0A 2VNHA 4Q66C 2EYQA 1WQ4A 2WIJA 4XQ9A 4Y30A 4CF3A 4N5MA 1QVRA 5B7QA 2H8KA 3L0IB 1TK9A 2XOKD 1J9EA 2HU5A 5FWDA 4N0MA 2W4QA 2NV0A 1BA3A 1S2LA 5EIEA 2OZVA 4D5EA 3B9RA 3KQKA 1AQ6A 5GM2A 1YZVA 3U6BA 1DBVO 3QFHA 3ND7A 2QIOA 3EWNA 4LJYA 3TBHA 1CEEA 3HM2A 2WUFA 3Q1LA 1GILA 4AB1A 4ECAA 2AXQA 3AHCA 5CEFA 2H5IA 3OIYA 1A0OA 4O4LA 2JLAA 1EESA 3B2NA 2NYVA 2NZVG 1G8MA 3JQ7B 3NBQA 3QFTA 5JBQA 5JZMA 4KV9A 2Y2UA 3UATA 1Z8HA 3PPVA 2JI9A 4HLCA 1E2FA 4YCJA 1XELA 4XJTA 3LWNA 3SS7X 3TG8A 2EX0A 4I1UA 4JYAB 1E5XA 1G16A 1R6XA 1PYOA 3RS3A 5DYGA 3WX0A 1PR1A 4B6QA 2I2XB 4PHTA 5K1ZA 4YP5A 3IDSA 3DKPA 4ZVKA 2SKDA 2OY0A 5AVOA 4AKIA 1N2IA 3CXRA 2WLSA 4UVHA 1WEHA 3GJRA 5B2ZA 4XUDA 1E1LA 1CVIA 3LVFO 3IERA 2GRAA 3O94A 3U48A 3WKDA 2HSDA 2DTDA 2A84A 1UBSB 2BN4A 2ZJ7A 1FDIA 4HDMB 1Y9AA 4XSVA 5T5QA 5BW5A 4NXNB 1MB4A 3AC0A 1XRNA 2BEKA 1RVV1 4NY1A 5DCWA 3TE7A 1Z7BA 4BNHA 4X1IB 4EAQA 1U4OA 1R5JA 2BVNA 5CA1B 3GJ0A 4F71A 1NVWQ 1WCV1 1LLFA 1FSGA 3B1YA 4FGWA 3KHTA 3IVCA 1X15A 4UC0A 3U61B 3ESXA 2P40A 3KQQA 4QU9A 4CL2A 1NQUA 3TG2A 1QUEA 3F5MA 2YHUA 1FPMA 2XE4A 2ZRNA 1VE5A 3EZFA 4QICA 1P75A 4LY3A 3ZEIA 1GDTA 1AV7A 1CERA 1RIIA 1T9KA 2Z2ZA 4JC5A 4LBZA 4R6XA 3L7YA 2FETA 1BROA 2F48A 3BE5A 4EPVA 1GM5A 2VPXA 1SELA 3KKQA 1XIVA 3NBYC 1Z2PX 3ZDCA 2ZBGA 3G9QA 5HUQA 1QX3A 1TTQB 3H0CA 3KQHA 5CM2Z 4YRAA 3EPRA 1FW8A 1KOFA 1R6UA 2C7VA 5I9LA 3KZVA 1OIVA 3CLUD 3IVXA 2G7ZA 2YWCA 4HNQA 3BCRA 5DP1A 1FJ2A 1SQGA 1WIWA 3HWX1 5ISMA 2ILVA 2XT9A 5JZVA 3TX6A 1Z2EA 5DTEA 3D7MA 4YFVA 3NOXA 2F55A 1EUDB 4IKPA 4QQRA 4UFOA 1BD3A 1QK4A 1XDBA 2AG5A 1IUPA 2OFWA 4U9IS 2WEKA 2CD9A 1PYGA 3V1UA 2YVKA 2CXOA 4C0AC 1MEOA 1ZCFA 2HAEA 3K6JA 2VJNA 4GOKA 1GNQA 2IIPA 3JZAA 2FFAA 4GMHA 2YV5A 3S29A 4F3TA 5HJ2A 3RYIB 2V6IA 4LV8B 1EEHA 2C99A 1OI4A 1CETA 2WSYB 4MWDA 1XKQA 5H68A 2YIDA 4TLDA 5FOVA 1AA9A 1OXKB 4BFUA 3C97A 1FP4A 2K2QB 4QOGA 3U