4UHUA

W229d mutant of the last common ancestor of gram-negative bacteria (gnca) beta-lactamase class a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
b'QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADDRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA LACTAMASE W229D
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4uhuA00
4C75A 3VP3A 2J8YA 4LV1A 4OLGA 4U0XA 4JLFA 1KDSA 3N8RA 1LI0A 1TVFA 5CGWA 5A91A 3Q7VA 1BULA 3UPOA 2X02A 1PW1A 2OLUA 1YLPA 2XEPA 1C3BA 1GHIA 1SHVA 2DRWA 1W5DA 3BFEA 1NZUA 3O86A 4XUXA 4EBPA 4N1XA 4P6BA 5EE8A 4YINA 1W8QA 1ESIA 4S2LA 4GD8A 3FZCA 1L0GA 4L0LA 4X68A 3SS3A 3G4PA 3BLSA 3GMWA 5EECA 1XA7A 3IWOA 3HLWA 2JE5A 3OPRA 4WMCA 4FH2A 2ZQDA 5CEBA 3RXXA 2EFUA 5AQ9A 4HBUA 4WYYA 4PM9A 4PM5A 3CMZA 1KE4A 4E6WA 1JVJA 4LCMA 4DE1A 1MWTA 1GHPA 1VM1A 1ZC2A 1PI5A 2A3UA 2Y4AA 4LENA 1S0WA 2HDQA 2WADA 3HLGA 1GA9A 3UE0A 3PAEA 1ONGA 2XDMA 2Y2QA 3PBRA 4JXVA 3OPLA 3MFDA 3M2JA 3W4QA 1E3UD 5M18A 1EWZA 4DE0A 3BFFA 2Y55A 5M19A 1K56D 1Y54A 2Y2GA 5CTNA 1NY0A 4JF6A 3UPNA 4RA7A 3JYIA 4OQGA 3OPPA 1BZAA 4ZAMA 2Y2IA 1CI9A 2XQZA 2G2WA 4EQIA 3G30A 2Y91A 4BLMA 4GB7A 4N1HA 2G2UA 1RGYA 2BG1A 1G6AA 2WZXA 2IWCA 3W8KA 3ZG9B 4OQ0A 3VSKA 4EBNA 3HLCA 2HP9A 2P9VA 4BD1A 4WEJA 2B5RA 1QMEA 5EVIB 1NYYA 4OQHA 1YT4A 5FI7A 3DWZA 5FA7A 3HUMA 4PM6A 3W4PA 3A3DA 2ZM8A 4EBLA 2XK1A 3FV7A 4EUZA 1DY6A 5CECA 4C3QA 1QMFA 5JYPA 2Q9MA 2ZJ9A 4JXSA 1Q2QA 4DF6A 5FDHA 2CC1A 3MXSA 3ZVTA 1MWSA 2H0TA 3IXGA 2XGNA 4P85A 3VOZA 4YFMA 4MBFA 2XR0A 4BQMA 3IHBA 5KMWA 3G31A 5HFOA 2EXAA 3CZDA 4X69A 4OP8A 4RX2A 1Z6FA 1AXBA 3NCKA 1IKIA 3VFHA 2HP5A 3IHAA 4WM9A 3SH7A 3WS4A 2X01A 1LL5A 5E2HA 2ZQAA 4BJPA 1FSWA 3G34A 3P98A 3HLDA 2HP6A 3NIAA 1XGJA 2C6WB 5AQBA 1YLJA 1BLCA 4ZJ1A 3GVBA 1ERMA 1ESUA 4WMCD 1JTGA 2ZC5B 1LI9A 2Y2PA 1XXMA 2A49A 1Q2PA 4E3NA 1PWCA 2Y2LA 3FKWA 4P87A 1XX2A 3CJMA 3M6HA 3MBZA 3FKVA 4ID4A 1EI5A 5HAQA 1IYPA 2OSUA 1ERQA 5FQIA 4OLDA 4LV3A 5F83A 3IF6C 1BSGA 2RCXA 4GDNA 1SDNA 1KVMA 4KQOA 1DJCA 1XPBA 4BENA 5DTTA 1BUEA 5FI2A 1K55A 1K55C 2Q9NA 5EVLA 5EPHA 3SS4A 4KQRA 4ZJ3A 4B4XA 2GDNA 1XGIA 1ALQA 1E25A 1PZOA 1KE0A 4H8RA 5F82A 4IBRA 5HW3A 4WBGA 4QHCA 2WGVA 3HBRA 3PBOA 3V39A 2ZD8A 3P09A 3IXBA 4FH4A 4MBHA 1LLBA 3O87A 2VGKA 1SCWA 5GLAA 2H0YA 4OH0A 1CEFA 3WWXA 1ZG4A 1RGZA 3HL9A 4K0XA 5FQQA 4OKPA 4S2PA 5CHMA 5CTMA 5CGXA 1M40A 4DKIA 5E2FA 2Y2MA 5AQAA 4PM8A 1N4OA 1BLPA 4RX3A 4R4SA 5DF7A 1YMXA 2P9VB 4WZ4A 4KZAA 4PMAA 1IYQA 4JXWA 2Y2KA 3IQAA 3IWQA 4PM7A 3UE3A 3V3SA 3WRZA 2FFFB 4F94A 3MKEA 3PBNA 3BM6A 4FSFA 3NBLA 1BLSA 1PZPA 5DF9A 3IWIA 3M2KA 4R3JA 3G35A 1FOFA 3GQZA 3NDEA 5FAQA 3N7WA 3MZDA 4X53A 2ZC7A 5CHUA 3DWKA 4M3KA 2WK0A 1MKIA 3FYZA 5DF8A 1OMEA 3HUNA 3G2YA 2WGWA 3ZG7B 3GRJA 2R9WA 2DCFA 2ZC4B 5EOOA 4KG2A 2IWDA 5D3OA 1RP5A 1JWVA 3BLMA 4Y0UA 1MWUA 3O3VA 4GZBA 4OPRA 4GDBA 3LO7A 4P0MA 3Q7ZA 1ONHA 4LCLA 4X56A 1YLWA 3WS5A 5I94A 2OLVA 2WKEA 5FQ9A 1GCEA 1L2SA 3LY4A 2Y59A 1O7EA 1YLZA 2EXBA 3ZHHA 3PBQA 5F1FA 3BYDA 4E3LA 1MWRA 2WYXA 5HAPA 1FR1A 1K57A 1K57C 4O7DA 4S2OA 5EVID 4QJGA 2JBFA 4RYEA 3UPPA 3OCLA 3W4OA 4Y7PA 3C7UA 2ZQ8A 4N9KA 4PPRA 4R4RA 4X55A 2WKIA 5JYOA 3B3XA 5E2GA 3UDXA 3IF6B 3A3IA 3S22A 2ZM0A 2QPNA 4OPZA 3AGEA 5DVAA 2HPBA 5F1GA 5CHJA 1KDWA 3Q07A 4QB8A 4U0TA 2WGIA 1K6SA 4OPYA 1H8YA 4JBFA 4OPQA 4NK3A 4S2NC 4S2NA 4ZTKA 3S4XA 3MKFA 3ITAA 3OC2A 5FAPA 5FQKA 4IVIA 1N9BA 3OCNA 3HUOA 3EQVA 2ZM2A 2J7VA 3LEZA 1W8YA 4KZ3A 1NXYA 2X71A 5FAOA 3UN7A 5KSCA 4OOLA 4GOGA 4QD4A 3UY6A 3Q1FA 1SKFA 5GLDA 1NJ4A 2P74A 4S2JA 3DW0A 3AGDA 1RCJA 1TDLA 1S6RA 3RXWA 4LV2A 1O07A 2EX9A 4WELA 5E2EA 3HLFA 4DDSA 4N9LA 2H10A 3BFDA 4S2MA 3VP2A 1ZG6A 4CJNA 4DE2A 3MXRA 5DTKA 4Q8IA 4C6YA 1M6KA 3WS0A 4U3TA 1ZKJA 3PTEA 4JKTA 2PBYA 5GHYA 4BL3A 2XH9A 1ES3A 3LY3A 4XXRA 2WAFA 4MBKA 3BFCA 5GL9A 4Z9QA 2QMIA 2HDSA 3IF6A 2EX2A 1I2WA 4GKUA 4KZ9A 4UA6A 3VP1A 3N8LA 4K0WA 2IWBA 2WGWB 3N4IA 5GHZA 1LHYA 4DXBA 5FQJA 3NY4A 4KZ6A 3ZVWA 1ES5A 3QNBA 4D2OA 5CGSA 5L2FA 3GR2A 3PAGA 3O88A 4FD8A 1SDEA 4E3IA 3NI9A 5GLBA 3GSGA 2WUQA 1K25A 4E3KA 4CPKA 2ZQ9A 3QNCA 1NRFA 2PU4A 4KZ8A 5U47A 1W79A 1MY8A 3ZNYA 3MZEA 1CEGA 1K54A 1K54C 1KE3A 1XP4A 2WKHA 2FFYA 4KZ5A 5DTSA 3C5AA 4OOMA 3BECA 1XA1A 3EQUA 2ZQCA 1JWPA 4DXCA 3V5MA 4EWFA 5GLCA 1CI8A 1YM1A 5FI6A 4MNRA 3GTCA 3GV9A 3VMAA 5CERA 1IYOA 3I7JA 4E6XA 2Y2HA 4R3BA 4E3JA 3QHYA 2ZQ7A 3E2KA 3IF5A 4MEZA 4HEFA 3BEBA 4EV4A 4OOYA 4B88A 4QU3A 3ISGA 1DJBA 4R23A 3SS5A 2E8IA 1DJAA 5HARA 1JTDA 1YLTA 1HTZA 1E4DA 3M6BA 3VOYA 2ZC6B 4K91A 4X6TA 3UNWA 3ZG5A 5KZHA 3G32A 5A90A 1FR6A 1FSYA 1K4FA 5EOEA 4ZJ2A 1I2SA 4JF5A 4LV0A 3BRMA 1HZOA 3C4OA 1FQGA 2Z2LB 2DNSA 1WYCA 3IT9A 3HLEA 2Y2NA 5EUAA 1G68A 4Y0TA 4JPMA 2HDRA 2V2FF 2V20A 4OVDA 2V1ZA 5FATA 1K6RA 4IVKA 2EFXA 2PU2A 4IEDA 3NC8A 1NYMA 3VSLA 3UE1A 4HBTA 3V3RA 4WZ5A 4WZ5C 3SH8A 4E3MA 1H8ZA 3RJUA 4JF4A 1I5QA 2XD5A 3WS2A 5A93A 4ZBEA 5FQMA 4WEKA 1K4EA 5TGFA 5CXWA 1LL9A 3CG5A 3DTMA 1FCNA 1PIOA 4R1GA 5E43A 4UHUA 5IHVA 4KZBA 3ZFZA 3FWLA 2XLNA 4B4ZA 3C7VA 1J9MA 5FSRA 3TG9A 5TR7A 3V50A 1U60A 1YMSA 5J8XA 3HREA 3IXHA 4OONA 4E3OA 3OZHA 5CRFA 4KZ7A 3S1YA 3HLBA 5HAIA 3LCEA 1FCMA 2J9OA 3MZFA 3UDIA 2VGJA 2XD1A 1KGEA 3SOIA 3BFGA 1WYBA 2EX6A 4KG5A 1IELA 4BL2A 4FCFA 3D4FA 4A5RA 2C5WB 1W7FA 3A3FA 4UA9A 2OV5A 1MPLA 5HL1A 1PI4A 4N92A 1K38A 4MLLA 4KQQA 3ZDJA 1PYYA 4DDYA 2JC7A 1BTLA 4BD0A 4OQIA 2Z2MB 4QY6A 2R9XA 3WRTA 3NDGA 3TSGA 5FASA 2XFSA 1CK3A 2QZ6A 3ZGAB 1HVBA 1IYSA 3UDFA 4ZDXA 1KGFA 2ZMAA 1PWGA 4IBXA 5AQ7A 5CEDA 1IEMA 4GD6A 1KGGA 1GA0A 1L0FA 3G2ZA 3IH8A 2J9PA 3TOIA 1YLYA 1NZOA 2Y2JA 3UO9A 4NETA 1PW8A 3A3EA 3Q7VB 5TFQA 3ITBA 2RL3A 1KVLA 5HX9A 1TEMA 2I72A 2BLSA 3ZG0A 2WZZA 4RVAA 5A92A 2ZC3B 1L0EA 3HVFA 3AGFA 4S2KA 1ES4A 3SH9A 2EX8A 4HESA 3ZCZA 1E3UA 2Y2OA 3IH9A 3OPHA 3PBSA 1ES2A 4GNUA 3ZG8B 1WE4A 1H5XA 1PWDA 1TDGA 1VQQA 5KSHA 1K56A 3VP0A 4XUZA 1IKGA 3N8SA 3N6IA 4DE3A 1HD8A 5M1AA 5BOHA 1FCOA 4QY5A 1MBLA 1EROA 1GHMA 4JXGA 2JCHA 3IXDA 1JWZA 4KENB 2H5SA 4KZ4A 3E2LA 1YQSA 5G18A 2ZLYA 3VP4A 3ZNTA 2XF3A 1BLHA 1L0DA 2HDUA 3Q82A 4R0QA 2UWXA 3PBTA 3WS1A 1XKZA 5EVIA 3C4PA 5EVIC 4KG6A 3Q81A 2XFTA 4GN2A 4OP5A 4Y0OA 4S2IA 5GHXA 4DRTA 2WAEA 1MXOA 4UA7A 3VFFA 4UAAA 1BT5A 3A3JA
chains in the Genus database with same CATH superfamily
3D3OA 4C75A 2VLGA 4MN5A 1LI0A 5CGWA 4K08A 4YOFA 3UPOA 4GS9B 5F68A 2XEPA 3V67A 5L09A 4M4XA 2DRWA 1W5DA 4NXBA 5F6AA 3UB6A 1ESIA 4I3JA 4S2LA 4ESPA 3FZCA 1L0GA 4X68A 3G4PA 3QP8A 3F1NA 4IJGA 3DTIA 3KO6A 4WYYA 4PM5A 1KE4A 1JVJA 4DJ3A 3LEQA 1GHPA 1VM1A 1ZC2A 1S0WA 2WADA 1GA9A 1XFQA 1ONGA 2Y2QA 3OPLA 5FEGA 3M2JA 3BFFA 1K56D 1Y54A 1NY0A 4JF6A 3UPNA 4EQ1A 1D7EA 4OQGA 2VV6A 5KIZA 2XQZA 4DN0A 1FILA 4EQIA 3G30A 1ZTUA 2WZXA 2P9VA 4NXEA 4BD1A 4WEJA 1YT4A 5FI7A 2ZL1A 5FA7A 3T4LA 4NEED 4PHTA 5JYPA 1Q2QA 1MWSA 5HSQA 2XGNA 4P85A 4MBFA 4BQMA 3G31A 2EXAA 3CZDA 3MSHA 4OP8A 4L9FA 2JKFA 1IKIA 3UB7A 2HP5A 4I38A 2ZQAA 3G34A 3P98A 3HLDA 5LBRA 3IBJA 3K3DA 5L8MA 4ZJ1A 3GVBA 1ERMA 2P08A 1P0ZA 1LI9A 3F1NB 1PWCA 3CJMA 4CLCD 1EI5A 1IYPA 2I9VA 1H8MA 2RCXA 4GDNA 5FL3A 2QJ5A 1BUEA 4Q0HA 1K55A 1K55C 3T1SA 5EPHA 4KQRA 1S1ZA 4Y5FA 1P97A 3LI9A 5IS1A 4IBRA 3PBOA 2CMNA 3O87A 4I3AA 3CWFA 3KSHA 3NULA 1VB6A 4K0XA 5CTMA 4BBUA 2VEAA 5E2FA 3W2ZA 4RX3A 2P9VB 3S7PA 4PM7A 4Y17A 4F94A 2FFFB 2ZL1B 2HGVA 1PZPA 2HV1A 3NDEA 3KSIA 5FAQA 2P7JA 2WGWA 1FIKA 3ZG7B 3MF0A 2R9WA 2H28A 5EOOA 4KG2A 1RP5A 2HJEA 4X56A 1YLWA 3DTEA 2OLVA 1L2SA 4EEUA 3LICA 3ZHHA 3BYDA 4E3LA 1OJ5A 2XRNA 4O0PA 1NWZA 4O7DA 2W1RA 2A2LA 5EVID 3QP2A 3W4OA 4Y7PA 2D01A 4PPRA 4R4RA 2WKIA 1ZHHB 3A3IA 2PHYA 2ZM0A 5F1GA 2HPBA 2NUPC 4OPQA 3IBRA 4ZTKA 4II7A 3MKFA 1YAXA 5FAPA 4UQIM 4F3LB 3OCNA 3MXQA 1W8YA 1NXYA 2X71A 2E8JA 3UY6A 5GLDA 3PR6A 3DW0A 1PRQA 1RCJA 2O99A 4HP4A 1MKMA 3JPUA 4DDSA 4N9LA 4Q8IA 2K7SA 3MXRA 3QP4A 2XA7M 4C6YA 1M6KA 4U3TA 1ACFA 3MQOA 3KSGA 3KYZA 1ES3A 3LY3A 2WAFA 3BFCA 5HPIA 2HDSA 1I2WA 4UA6A 3N8LA 2ZBBA 2WGWB 4DXBA 4KZ6A 3QNBA 5L2FA 3T1XA 3CAXA 4E3KA 4CPKA 3QNCA 3P7NA 4KZ8A 1W79A 2WKHA 1XA1A 4DXCA 2ZQCA 5GLCA 4LGWA 2EA9A 3GTCA 5G4YA 3VMAA 1L3LA 1XJ3A 4E3JA 2ZQ7A 4JGRA 1OPXA 3IF5A 3SS5A 2E8IA 1YLTA 3LGOA 3UNWA 5KZHA 3G32A 5A90A 5EOEA 1G5UA 1A0KA 1FQGA 1WYCA 5EUAA 3HLEA 2OWJA 4YWZA 4Y0TA 2J3WA 2BTFP 4JPMA 2HDRA 5FATA 4IEDA 3NC8A 4WZ5A 4WZ5C 3RFBA 3RJUA 3NOPC 5A93A 1YSPA 3CG5A 4R1GA 3TE8A 5K5BA 4KZBA 5EVEA 5J8XA 1GSVA 4OONA 3OZHA 4KZ7A 5HAIA 4NXFA 3U4LP 1X0OA 3T4KA 3QP6A 1TS6A 1PI4A 3H82A 4FOFA 3LIBA 4KQQA 3S7QA 4DDYA 4BD0A 2Z2MB 2R9XA 3FC7A 5FASA 2V1BA 1HVBA 1IYSA 2ZMAA 3E4QA 3T4QA 5J4EA 3LIFA 3LIAA 1IEMA 3TOIA 1NZOA 3A3EA 5TFQA 3ITBA 2I72A 4G3KA 3PBSA 4GNUA 3OPHA 1ES2A 1K0KA 3VV4A 1PWDA 4XUZA 4NXGA 3OLOA 1EROA 1GHMA 1NLZA 5CX7A 4KENB 1T19A 3VP4A 3ZNTA 1J3WA 3K2NA 4R0QA 3PBTA 4KG6A 3Q81A 4GN2A 4S2IA 3VFFA 3ULFA 3LR0A 3A3JA 4LV1A 4JLFA 1OTDA 5TJJA 4UQIS 4KUOA 1Y4OA 3Q7VA 4XT2B 2X02A 3TJZC 1YLPA 1GHIA 1SHVA 1PNEA 2PBDP 3O86A 1NZUA 4P6BA 2EWWA 4GD8A 1SZVA 4L0LA 2Y8HA 1F5MA 5HL6A 2PD8A 3BLSA 3GMWA 5EECA 4MN6A 1UGUA 2JE5A 4FH2A 3CMZA 2V8CA 4CQHA 4LCMA 1MWTA 2A3UA 3HLGA 4Y2FA 5DKLA 3PAEA 3MFDA 3W4QA 3EGDC 5M18A 5I5LA 3JYIA 3H7WA 4GS9A 3BWLA 2PYRA 2Y91A 4ZRRA 4BLMA 3GDIA 2ZMVA 1G6AA 2IWCA 3W8KA 2W3HA 3VSKA 3ZG9B 3HLCA 2HP9A 3T1QB 3NHQA 4PM6A 2OWHA 3W4PA 3E4OA 5F5YA 3SZTA 4C3QA 2Q9MA 3FPVA 4QPRA 5FDHA 3ZVTA 3VE4A 3IXGA 1VETB 1DP6A 2XR0A 4CLCE 5HFOA 1Z6FA 3NCKA 3VFHA 4PKYG 4LPZA 4GJ4A 3IHAA 2X01A 1LL5A 4LRYC 1CF0A 5DFXA 1FSWA 2HP6A 4Y13A 5AQBA 1JTGA 1GSXA 2Y2PA 3G6OA 2A49A 1Q2PA 4E3NA 4KQDA 2Y2LA 3M6HA 2O0YA 3FKVA 4ID4A 1ERQA 1XJ4A 4OLDA 5IU1A 1KVMA 1XPBA 5DTTA 3DTKA 5EVLA 4ZJ3A 4B4XA 1ALQA 1E25A 5C5KA 5F82A 4QHCA 3V39A 3IXBA 4MBHA 1LLBA 3H7WB 3DBAA 1SCWA 2H0YA 4OH0A 1CEFA 1UWNX 5CHMA 3PHYA 2PR6A 1N4OA 3F1OA 4R4SA 4KZAA 1IYQA 4X25A 2Y2KA 3IQAA 3UE3A 3V3SA 3WRZA 2M7UA 3MKEA 3PBNA 3ZQ5A 4FSFA 3M2KA 2V0UA 3G35A 3GQZA 1SKOA 4RQ9A 2VV7A 3LR4A 3FYZA 2DCFA 2ZC4B 4HH2A 4R38A 1JWVA 3BLMA 1MWUA 4GZBA 4GDBA 1ONHA 3WS5A 2WKEA 2KX6A 1GCEA 5FQ9A 4Z1WA 5J7EA 3PBQA 1XJ6A 1T1BA 2JKRI 1FR1A 4EU0A 4RYEA 3UPPA 1OTBA 2ZQ8A 2KDKA 5JYOA 3B3XA 1Z09A 1PFLA 2V1AA 2LB5A 3AGEA 1N9OA 4QB8A 4OPYA 4JBFA 3UMEA 1EW0A 3OC2A 5FQKA 2JKRM 4WF0A 3LEZA 3O5YA 5FAOA 5KSCA 4S2JA 3BJNA 2J3TC 4LV2A 3F1OB 2V0WA 2H10A 3CPTA 4S2MA 3U2AA 4DE2A 3WS0A 3PTEA 1S4RA 2A24B 1SKOB 4XXRA 4Y3IA 1CQAA 4LRXC 5F69A 2QMIA 4KZ9A 5EM1A 4K0WA 2IWBA 5GHZA 1LHYA 1YSQA 5FQJA 3NY4A 3ZVWA 3O88A 1SDEA 2V9AA 3GECA 3NI9A 1P9RA 4F3LA 1K25A 3R7WB 3A0SA 3C2WA 4HOIA 3HJIA 2O9BA 2ZQ9A 4BBVA 3LIDA 1MY8A 1TS8A 3ZNYA 1CEGA 1XP4A 4KZ5A 5DTSA 3C5AA 3V5MA 4HJ3A 3KYQA 4MNRA 1NRJA 2K2NA 3KX0X 2FZ0A 2ZMFA 4G3WA 3BEBA 1TD5A 1IOUA 4B88A 3ISGA 1DJAA 2HZ5A 3FPWA 3VOYA 3M6BA 1LSXA 1FSYA 1I2SA 2AVXA 3BRMA 1HZOA 2Z2LB 3IT9A 2Y2NA 1W63M 3IX8A 2V2FF 2V20A 1K6RA 2EFXA 3ICYA 3V3RA 3F1PB 4E3MA 5IT5A 3CPTB 4CLCA 4CLCC 1FCNA 2G7UA 4HP9A 3ZFZA 3RH8B 1J9MA 2BASA 3HREA 4E3OA 5CRFA 3LCEA 1FCMA 2J9OA 3MZFA 3UDIA 2OOLA 3D72A 4GHIA 4KG5A 3S7OA 1D06A 1LT0A 1PYYA 5DJUA 3TSGA 2QZ6A 5EFWA 3PXPA 4GLQA 5CEDA 2W27A 4MN7A 1YLYA 4Y15A 2Y2JA 3UO9A 1KOUA 4NETA 1PW8A 1TEMA 3ZG0A 5AJGA 4RVAA 4S2KA 3SH9A 4KUKA 1E3UA 1H5XA 3VP0A 4EUVA 1IKGA 4DE3A 1HD8A 2WKRA 5M1AA 5BOHA 4QY5A 1MBLA 4PKYA 3TRCA 2Z6CA 4KZ4A 1LL8A 2FH5A 5FDSA 2UWXA 5EVIA 3C4PA 5EVIC 2QWSA 4CLCB 4OP5A 4Y0OA 1MXOA 4UAAA 2VV8A 1BT5A 5HDDA 3CHWP 1KDSA 3N8RA 1BULA 1PW1A 4GHIB 2OLUA 1C3BA 4B93A 3BFEA 4XUXA 3NJAA 4EBPA 3OBFA 4P6ZS 4I5SA 1W8QA 1OTEA 3P01A 3SS3A 2B95A 3CITA 1XA7A 1W63Q 4O01A 3OPRA 4WMCA 5CEBA 2EFUA 4E6WA 4DE1A 3T12B 3C38A 2Y4AA 1YPRA 4LENA 2HDQA 3VOLA 4D60A 2XDMA 4JXVA 4HNBA 1BZAA 2L1MA 2HF6A 4XT2A 4ZAMA 3JVUA 2Y2IA 1CI9A 1UWPX 4GB7A 2BG1A 4OQ0A 4EBNA 1QMEA 5EVIB 1NYYA 3KSFA 4OQHA 3DWZA 2Y79A 2ZOIA 2GX5A 2ZM8A 2XK1A 1LSVA 3FV7A 4EUZA 5CECA 1QMFA 1BYWA 2ZJ9A 4JXSA 1D1JA 3MXSA 2H0TA 5TBMA 5HWWA 3VOZA 5HDCA 5KMWA 4EEPA 2YKHA 4WM9A 3LR5A 3WS4A 1OJGA 4BJPA 4EERA 3CLOA 3NIAA 2QHKA 1XGJA 2C6WB 5HWTA 1ESUA 5J3WA 2ZC5B 5HD5A 3A0VA 4NG2A 4LV3A 4UEYA 5F83A 3IF6C 1BSGA 2HJ9C 1SDNA 2J80A 4KQOA 5A8BA 3MMHA 2Q9NA 3SS4A 2WKPA 2GDNA 1XGIA 1N9LA 4H8RA 1STZA 4WBGA 2WGVA 3HBRA 2ZD8A 1VETA 3EEHA 4EESA 1N9NA 2VGKA 5GLAA 4WLAA 1VEUA 3QP5A 3WWXA 3QP1A 1ZG4A 2M1CA 1RGZA 3HL9A 4S2PA 5CGXA 1M40A 4DKIA 2Y2MA 5AQAA 4PM8A 4WZ4A 3UMDA 3IS2A 3NOUC 4DMZA 3BM6A 3NBLA 5DF9A 3IWIA 1FOFA 3N7WA 1S67L 1TS0A 4X53A 5CHUA 4M3KA 4EETB 1MKIA 5TBMB 5DF8A 3HUNA 5HWVA 3K3CA 2W1TB 2IWDA 5D3OA 3UB9A 3O3VA 4P0MA 4LCLA 3EWKA 5I94A 1S1YA 5L10A 3LY4A 2Y59A 1NLYA 3BQ8A 3L9KA 2JKGA 2WYXA 2WKQA 1K57A 1K57C 2W3EA 2JBFA 3C7UA 3E0YA 4N9KA 4X55A 2PDRA 3IF6B 5AVEA 3S22A 2QPNA 4OPZA 5DVAA 4HJ6A 2UV0E 3A0RA 3Q07A 4I3IA 4U0TA 4S2NA 4S2NC 3S4XA 4ETZA 4IVIA 5HZHA 1N9BA 3HUOA 3EQVA 2ZM2A 2J7VA 2L0WA 3UN7A 4OOLA 1VEUB 4QD4A 4HY8A 1SKFA 1NJ4A 2P74A 2JKTI 3AGDA 1TDLA 4Q0IA 1S6RA 5HPFA 5E2EA 3BFDA 3VP2A 3IS2B 4CJNA 2OAP1 1ZKJA 4JKTA 4R70A 4MDZA 2IA2A 5GHYA 4BL3A 4HQAA 2JKTM 4GKUA 3N4IA 1HLUP 2LB9A 2XROA 5CGSA 3GR2A 3PAGA 1S66L 2QYBA 5GLBA 2WUQA 2W3FA 1NRFA 2PU4A 1K54A 1K54C 1KE3A 1XJ2A 2FFYA 4ETXA 4OOMA 1JWPA 2B02A 1CI8A 5FI6A 3NOTC 3GV9A 5CERA 4E6XA 4R3BA 3E2KA 4OOYA 2W3DA 1DJBA 2XSSA 1JTDA 1E4DA 3ZG5A 2A24A 2ZC6B 4K91A 4X6TA 1K4FA 3B47A 4ZJ2A 4JF5A 3C4OA 2DNSA 3CUEA 3CUEC 2V1ZA 1G6OA 3DAVA 2J3TD 1NYMA 3VSLA 5MC7A 3R7WA 4JF4A 3MFXA 1I5QA 2XD5A 3WS2A 5FQMA 4WEKA 1K4EA 5CXWA 1LL9A 1PIOA 3FWLA 3D9YA 5FSRA 3TG9A 3V50A 3IXHA 3HLBA 2VGJA 2XD1A 2PYPA 1WYBA 4BL2A 4FCFA 2Q0OA 4G3VA 4ARZA 1W7FA 2ACGA 3A3FA 2OV5A 1MPLA 4I39A 1K38A 3VE3A 3ZDJA 2JC7A 1BTLA 2INWA 1F9IA 1CK3A 2GNXA 4GCZA 3RTYA 3F1PA 4YNRA 4P6ZM 1V9ZA 4IBXA 1V9YA 3R4KA 1KGGA 4IUKA 1L0FA 3G2ZA 4EXOA 5HX9A 1KVLA 3LI8A 4FTXA 1YKDA 2VZWA 2WZZA 2ZC3B 3HVFA 3AGFA 1JNUA 2EX8A 4HESA 2Y2OA 3ZG8B 2OAQ1 1TDGA 1K56A 3N6IA 2VKSA 3BY9A 4JXGA 3C30A 2JCHA 1JWZA 3E2LA 3H9WA 3MR0A 5G18A 2ZLYA 2XF3A 2P04A 1BLHA 2HDUA 3HCYA 1XKZA 2XFTA 3L7HA 5GHXA 4DRTA 4UA7A 2D02A 2W3GA 2MJ6A 5DFYA 3VP3A 2J8YA 4OLGA 4U0XA 4QWOA 4X1LA 1TVFA 5A91A 3BY8A 2R78A 4ARZB 1TS7A 2NUTC 4N1XA 5EE8A 4YINA 2PAVP 4H6JA 4EW7A 3IWOA 3HLWA 3MQQA 2ZQDA 3RXXA 5AQ9A 4HBUA 4PM9A 1XFNA 5DJTA 3T4SA 1PI5A 3MS6A 3UE0A 2ZOHA 3PBRA 4MMNA 1H0MA 1E3UD 1EWZA 4DE0A 2Y55A 5M19A 2Y2GA 5CTNA 4RA7A 3OPPA 2B18A 2G2WA 4B9OA 5EM0A 4FUWA 4N1HA 3TW8A 2G2UA 1RGYA 2B5RA 1GSWA 3MJQA 3HUMA 3A3DA 4ME4A 2Z6DA 4EBLA 1DY6A 4DF6A 3EGXC 2CC1A 4YFMA 3IHBA 3CI6A 3T4TA 2VGLM 4X69A 4RX2A 1AXBA 3OOVA 1MC0A 3SH7A 5E2HA 2V8FA 4JGPA 3PYPA 4H6JB 1YLJA 1BLCA 3UB8A 4WMCD 3UB5P 1XXMA 3FG8A 1TF1A 3FKWA 4P87A 1XX2A 3MBZA 5HAQA 2O9CA 2OSUA 5FQIA 1AWIA 1DJCA 2KLIA 4BENA 5FI2A 4JGQA 1PZOA 1KE0A 3LYXA 3HJKA 5HW3A 2DMWA 3P09A 1OTIA 5EV0A 4FH4A 3B33A 5FEFA 3KYEA 5FQQA 4OKPA 1BLPA 5DF7A 1YMXA 4WL9A 4PMAA 4JXWA 4L9GA 3IWQA 4WN5A 1DP9A 1F2KA 1BLSA 4R3JA 2JN7A 1Y28A 3UE6A 5G4ZA 3MZDA 2ZC7A 4PAUA 3DWKA 4R6LA 4JGOA 2WK0A 1OMEA 3G2YA 3GRJA 2EWVA 1MZUA 4GW9A 3ZYTA 3LIEA 4Y0UA 4OPRA 3LO7A 1OTAA 1ODVA 3Q7ZA 4O8GA 3T1RA 1O7EA 3IX3A 1YLZA 2EXBA 5F1FA 3NECA 4NKPA 2QKPA 1MWRA 5HAPA 4QJGA 4S2OA 1WA9A 3T4JA 3OCLA 4X1MA 4LLOB 2PRFA 4Q0JA 5E2GA 3UDXA 5CHJA 1KDWA 3T4OA 1T1AA 3SW1A 3EEAA 2WGIA 1K6SA 1H8YA 4NK3A 3ITAA 4AFIA 4KZ3A 2W1TA 4GOGA 3Q1FA 1P9WA 3RXWA 4HIAA 1O07A 2EX9A 4WELA 3HLFA 4HH3A 1ZG6A 2VA0A 5DTKA 4BBTA 5DKKA 2PBYA 2K31A 3MQ0A 2XH9A 1CJFA 4MBKA 5GL9A 2PR5A 4Z9QA 3IF6A 2EX2A 3VP1A 2VJWA 3EOIA 4D2OA 1ES5A 5L07A 4FD8A 4E3IA 3GSGA 3S7NA 3LFVA 5U47A 3C8CA 3MZEA 4BMWA 3BECA 3EQUA 4LFUA 4EWFA 1YM1A 2PD7A 1IYOA 3I7JA 2Y2HA 2VX8A 3QHYA 4MEZA 1IFQA 2L4RA 4HEFA 4EV4A 4QU3A 4R23A 1DRMA 5HARA 1HTZA 2VGLS 3B42A 1FR6A 4LV0A 4MCWA 2VK3A 3LR3A 1G68A 3H82B 3LUQA 4OVDA 4IVKA 2GJ3A 2PU2A 2QJ7A 2XA7S 4BWIA 1LSWA 3UE1A 4HBTA 3E4PA 3SH8A 1H8ZA 1VHMA 4ZBEA 5TGFA 4DJ2A 1OT6A 3DTMA 5E43A 4UHUA 5IHVA 2XLNA 4B4ZA 3C7VA 5TR7A 1U60A 1YMSA 3S1YA 1KGEA 3SOIA 3BFGA 2EX6A 1H3QA 4LRZE 3E98A 4HI4A 1IELA 3D4FA 4IHQA 4A5RA 2C5WB 4HHDA 5HL1A 4UA9A 4N92A 4MLLA 4OQIA 4QY6A 4E04A 3WRTA 3NDGA 4L9EA 2XFSA 2M7VA 1S4SA 3ZGAB 3UDFA 4ZDXA 1KGFA 1PWGA 2O9AA 2KOIA 5AQ7A 4GD6A 1GA0A 1OT9A 3IH8A 2J9PA 3Q7VB 3JVVA 2RL3A 5HDSA 2BLSA 5A92A 1L0EA 2PT7A 2JHEA 1ES4A 2GZAA 3ZCZA 3IH9A 1WE4A 1VQQA 5KSHA 3N8SA 1FCOA 1F98A 4R3AA 3IX4A 5HD3A 3IXDA 2H5SA 1YQSA 1T1CA 4IUHA 1DP8A 3BQAA 3T50A 1L0DA 3Q82A 5AVFA 4WUJA 3WS1A 1G28A 1T18A 2W0NA 3BW6A 2WAEA 2YKFA 4HJ4A
chains in the Genus database with same CATH topology
4C75A 3VP3A 2J8YA 4LV1A 4OLGA 4U0XA 4JLFA 1KDSA 3N8RA 1LI0A 1TVFA 5CGWA 5A91A 3Q7VA 1BULA 3UPOA 2X02A 1PW1A 2OLUA 1YLPA 2XEPA 1C3BA 1GHIA 1SHVA 2DRWA 1W5DA 3BFEA 1NZUA 3O86A 4XUXA 4EBPA 4N1XA 4P6BA 5EE8A 4YINA 1W8QA 1ESIA 4S2LA 4GD8A 3FZCA 1L0GA 4L0LA 4X68A 3SS3A 3G4PA 3BLSA 3GMWA 5EECA 1XA7A 3IWOA 3HLWA 2JE5A 3OPRA 4WMCA 4FH2A 2ZQDA 5CEBA 3RXXA 2EFUA 5AQ9A 4HBUA 4WYYA 4PM9A 4PM5A 3CMZA 1KE4A 4E6WA 1JVJA 4LCMA 4DE1A 1MWTA 1GHPA 1VM1A 1ZC2A 1PI5A 2A3UA 2Y4AA 4LENA 1S0WA 2HDQA 2WADA 3HLGA 1GA9A 3UE0A 3PAEA 1ONGA 2XDMA 2Y2QA 3PBRA 4JXVA 3OPLA 3MFDA 3M2JA 3W4QA 1E3UD 5M18A 1EWZA 4DE0A 3BFFA 2Y55A 5M19A 1K56D 1Y54A 2Y2GA 5CTNA 1NY0A 4JF6A 3UPNA 4RA7A 3JYIA 4OQGA 3OPPA 1BZAA 4ZAMA 2Y2IA 1CI9A 2XQZA 2G2WA 4EQIA 3G30A 2Y91A 4BLMA 4GB7A 4N1HA 2G2UA 1RGYA 2BG1A 1G6AA 2WZXA 2IWCA 3W8KA 3ZG9B 4OQ0A 3VSKA 4EBNA 3HLCA 2HP9A 2P9VA 4BD1A 4WEJA 2B5RA 1QMEA 5EVIB 1NYYA 4OQHA 1YT4A 5FI7A 3DWZA 5FA7A 3HUMA 4PM6A 3W4PA 3A3DA 2ZM8A 4EBLA 2XK1A 3FV7A 4EUZA 1DY6A 5CECA 4C3QA 1QMFA 5JYPA 2Q9MA 2ZJ9A 4JXSA 1Q2QA 4DF6A 5FDHA 2CC1A 3MXSA 3ZVTA 1MWSA 2H0TA 3IXGA 2XGNA 4P85A 3VOZA 4YFMA 4MBFA 2XR0A 4BQMA 3IHBA 5KMWA 3G31A 5HFOA 2EXAA 3CZDA 4X69A 4OP8A 4RX2A 1Z6FA 1AXBA 3NCKA 1IKIA 3VFHA 2HP5A 3IHAA 4WM9A 3SH7A 3WS4A 2X01A 1LL5A 5E2HA 2ZQAA 4BJPA 1FSWA 3G34A 3P98A 3HLDA 2HP6A 3NIAA 1XGJA 2C6WB 5AQBA 1YLJA 1BLCA 4ZJ1A 3GVBA 1ERMA 1ESUA 4WMCD 1JTGA 2ZC5B 1LI9A 2Y2PA 1XXMA 2A49A 1Q2PA 4E3NA 1PWCA 2Y2LA 3FKWA 4P87A 1XX2A 3CJMA 3M6HA 3MBZA 3FKVA 4ID4A 1EI5A 5HAQA 1IYPA 2OSUA 1ERQA 5FQIA 4OLDA 4LV3A 5F83A 3IF6C 1BSGA 2RCXA 4GDNA 1SDNA 1KVMA 4KQOA 1DJCA 1XPBA 4BENA 5DTTA 1BUEA 5FI2A 1K55A 1K55C 2Q9NA 5EVLA 5EPHA 3SS4A 4KQRA 4ZJ3A 4B4XA 2GDNA 1XGIA 1ALQA 1E25A 1PZOA 1KE0A 4H8RA 5F82A 4IBRA 5HW3A 4WBGA 4QHCA 2WGVA 3HBRA 3PBOA 3V39A 2ZD8A 3P09A 3IXBA 4FH4A 4MBHA 1LLBA 3O87A 2VGKA 1SCWA 5GLAA 2H0YA 4OH0A 1CEFA 3WWXA 1ZG4A 1RGZA 3HL9A 4K0XA 5FQQA 4OKPA 4S2PA 5CHMA 5CTMA 5CGXA 1M40A 4DKIA 5E2FA 2Y2MA 5AQAA 4PM8A 1N4OA 1BLPA 4RX3A 4R4SA 5DF7A 1YMXA 2P9VB 4WZ4A 4KZAA 4PMAA 1IYQA 4JXWA 2Y2KA 3IQAA 3IWQA 4PM7A 3UE3A 3V3SA 3WRZA 2FFFB 4F94A 3MKEA 3PBNA 3BM6A 4FSFA 3NBLA 1BLSA 1PZPA 5DF9A 3IWIA 3M2KA 4R3JA 3G35A 1FOFA 3GQZA 3NDEA 5FAQA 3N7WA 3MZDA 4X53A 2ZC7A 5CHUA 3DWKA 4M3KA 2WK0A 1MKIA 3FYZA 5DF8A 1OMEA 3HUNA 3G2YA 2WGWA 3ZG7B 3GRJA 2R9WA 2DCFA 2ZC4B 5EOOA 4KG2A 2IWDA 5D3OA 1RP5A 1JWVA 3BLMA 4Y0UA 1MWUA 3O3VA 4GZBA 4OPRA 4GDBA 3LO7A 4P0MA 3Q7ZA 1ONHA 4LCLA 4X56A 1YLWA 3WS5A 5I94A 2OLVA 2WKEA 5FQ9A 1GCEA 1L2SA 3LY4A 2Y59A 1O7EA 1YLZA 2EXBA 3ZHHA 3PBQA 5F1FA 3BYDA 4E3LA 1MWRA 2WYXA 5HAPA 1FR1A 1K57A 1K57C 4O7DA 4S2OA 5EVID 4QJGA 2JBFA 4RYEA 3UPPA 3OCLA 3W4OA 4Y7PA 3C7UA 2ZQ8A 4N9KA 4PPRA 4R4RA 4X55A 2WKIA 5JYOA 3B3XA 5E2GA 3UDXA 3IF6B 3A3IA 3S22A 2ZM0A 2QPNA 4OPZA 3AGEA 5DVAA 2HPBA 5F1GA 5CHJA 1KDWA 3Q07A 4QB8A 4U0TA 2WGIA 1K6SA 4OPYA 1H8YA 4JBFA 4OPQA 4NK3A 4S2NC 4S2NA 4ZTKA 3S4XA 3MKFA 3ITAA 3OC2A 5FAPA 5FQKA 4IVIA 1N9BA 3OCNA 3HUOA 3EQVA 2ZM2A 2J7VA 3LEZA 1W8YA 4KZ3A 1NXYA 2X71A 5FAOA 3UN7A 5KSCA 4OOLA 4GOGA 4QD4A 3UY6A 3Q1FA 1SKFA 5GLDA 1NJ4A 2P74A 4S2JA 3DW0A 3AGDA 1RCJA 1TDLA 1S6RA 3RXWA 4LV2A 1O07A 2EX9A 4WELA 5E2EA 3HLFA 4DDSA 4N9LA 2H10A 3BFDA 4S2MA 3VP2A 1ZG6A 4CJNA 4DE2A 3MXRA 5DTKA 4Q8IA 4C6YA 1M6KA 3WS0A 4U3TA 1ZKJA 3PTEA 4JKTA 2PBYA 5GHYA 4BL3A 2XH9A 1ES3A 3LY3A 4XXRA 2WAFA 4MBKA 3BFCA 5GL9A 4Z9QA 2QMIA 2HDSA 3IF6A 2EX2A 1I2WA 4GKUA 4KZ9A 4UA6A 3VP1A 3N8LA 4K0WA 2IWBA 2WGWB 3N4IA 5GHZA 1LHYA 4DXBA 5FQJA 3NY4A 4KZ6A 3ZVWA 1ES5A 3QNBA 4D2OA 5CGSA 5L2FA 3GR2A 3PAGA 3O88A 4FD8A 1SDEA 4E3IA 3NI9A 5GLBA 3GSGA 2WUQA 1K25A 4E3KA 4CPKA 2ZQ9A 3QNCA 1NRFA 2PU4A 4KZ8A 5U47A 1W79A 1MY8A 3ZNYA 3MZEA 1CEGA 1K54A 1K54C 1KE3A 1XP4A 2WKHA 2FFYA 4KZ5A 5DTSA 3C5AA 4OOMA 3BECA 1XA1A 3EQUA 2ZQCA 1JWPA 4DXCA 3V5MA 4EWFA 5GLCA 1CI8A 1YM1A 5FI6A 4MNRA 3GTCA 3GV9A 3VMAA 5CERA 1IYOA 3I7JA 4E6XA 2Y2HA 4R3BA 4E3JA 3QHYA 2ZQ7A 3E2KA 3IF5A 4MEZA 4HEFA 3BEBA 4EV4A 4OOYA 4B88A 4QU3A 3ISGA 1DJBA 4R23A 3SS5A 2E8IA 1DJAA 5HARA 1JTDA 1YLTA 1HTZA 1E4DA 3M6BA 3VOYA 2ZC6B 4K91A 4X6TA 3UNWA 3ZG5A 5KZHA 3G32A 5A90A 1FR6A 1FSYA 1K4FA 5EOEA 4ZJ2A 1I2SA 4JF5A 4LV0A 3BRMA 1HZOA 3C4OA 1FQGA 2Z2LB 2DNSA 1WYCA 3IT9A 3HLEA 2Y2NA 5EUAA 1G68A 4Y0TA 4JPMA 2HDRA 2V2FF 2V20A 4OVDA 2V1ZA 5FATA 1K6RA 4IVKA 2EFXA 2PU2A 4IEDA 3NC8A 1NYMA 3VSLA 3UE1A 4HBTA 3V3RA 4WZ5A 4WZ5C 3SH8A 4E3MA 1H8ZA 3RJUA 4JF4A 1I5QA 2XD5A 3WS2A 5A93A 4ZBEA 5FQMA 4WEKA 1K4EA 5TGFA 5CXWA 1LL9A 3CG5A 3DTMA 1FCNA 1PIOA 4R1GA 5E43A 4UHUA 5IHVA 4KZBA 3ZFZA 3FWLA 2XLNA 4B4ZA 3C7VA 1J9MA 5FSRA 3TG9A 5TR7A 3V50A 1U60A 1YMSA 5J8XA 3HREA 3IXHA 4OONA 4E3OA 3OZHA 5CRFA 4KZ7A 3S1YA 3HLBA 5HAIA 3LCEA 1FCMA 2J9OA 3MZFA 3UDIA 2VGJA 2XD1A 1KGEA 3SOIA 3BFGA 1WYBA 2EX6A 4KG5A 1IELA 4BL2A 4FCFA 3D4FA 4A5RA 2C5WB 1W7FA 3A3FA 4UA9A 2OV5A 1MPLA 5HL1A 1PI4A 4N92A 1K38A 4MLLA 4KQQA 3ZDJA 1PYYA 4DDYA 2JC7A 1BTLA 4BD0A 4OQIA 2Z2MB 4QY6A 2R9XA 3WRTA 3NDGA 3TSGA 5FASA 2XFSA 1CK3A 2QZ6A 3ZGAB 1HVBA 1IYSA 3UDFA 4ZDXA 1KGFA 2ZMAA 1PWGA 4IBXA 5AQ7A 5CEDA 1IEMA 4GD6A 1KGGA 1GA0A 1L0FA 3G2ZA 3IH8A 2J9PA 3TOIA 1YLYA 1NZOA 2Y2JA 3UO9A 4NETA 1PW8A 3A3EA 3Q7VB 5TFQA 3ITBA 2RL3A 1KVLA 5HX9A 1TEMA 2I72A 2BLSA 3ZG0A 2WZZA 4RVAA 5A92A 2ZC3B 1L0EA 3HVFA 3AGFA 4S2KA 1ES4A 3SH9A 2EX8A 4HESA 3ZCZA 1E3UA 2Y2OA 3IH9A 3OPHA 3PBSA 1ES2A 4GNUA 3ZG8B 1WE4A 1H5XA 1PWDA 1TDGA 1VQQA 5KSHA 1K56A 3VP0A 4XUZA 1IKGA 3N8SA 3N6IA 4DE3A 1HD8A 5M1AA 5BOHA 1FCOA 4QY5A 1MBLA 1EROA 1GHMA 4JXGA 2JCHA 3IXDA 1JWZA 4KENB 2H5SA 4KZ4A 3E2LA 1YQSA 5G18A 2ZLYA 3VP4A 3ZNTA 2XF3A 1BLHA 1L0DA 2HDUA 3Q82A 4R0QA 2UWXA 3PBTA 3WS1A 1XKZA 5EVIA 3C4PA 5EVIC 4KG6A 3Q81A 2XFTA 4GN2A 4OP5A 4Y0OA 4S2IA 5GHXA 4DRTA 2WAEA 1MXOA 4UA7A 3VFFA 4UAAA 1BT5A 3A3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C75 A;  3VP3 A;  2J8Y A;  4LV1 A;  4OLG A;  4U0X A;  4JLF A;  1KDS A;  3N8R A;  1LI0 A;  1TVF A;  5CGW A;  5A91 A;  3Q7V A;  1BUL A;  3UPO A;  2X02 A;  1PW1 A;  2OLU A;  1YLP A;  2XEP A;  1C3B A;  1GHI A;  1SHV A;  2DRW A;  1W5D A;  3BFE A;  1NZU A;  3O86 A;  4XUX A;  4EBP A;  4N1X A;  4P6B A;  5EE8 A;  4YIN A;  1W8Q A;  1ESI A;  4S2L A;  4GD8 A;  3FZC A;  1L0G A;  4L0L A;  4X68 A;  3SS3 A;  3G4P A;  3BLS A;  3GMW A;  5EEC A;  1XA7 A;  3IWO A;  3HLW A;  2JE5 A;  3OPR A;  4WMC A;  4FH2 A;  2ZQD A;  5CEB A;  3RXX A;  2EFU A;  5AQ9 A;  4HBU A;  4WYY A;  4PM9 A;  4PM5 A;  3CMZ A;  1KE4 A;  4E6W A;  1JVJ A;  4LCM A;  4DE1 A;  1MWT A;  1GHP A;  1VM1 A;  1ZC2 A;  1PI5 A;  2A3U A;  2Y4A A;  4LEN A;  1S0W A;  2HDQ A;  2WAD A;  3HLG A;  1GA9 A;  3UE0 A;  3PAE A;  1ONG A;  2XDM A;  2Y2Q A;  3PBR A;  4JXV A;  3OPL A;  3MFD A;  3M2J A;  3W4Q A;  1E3U D;  5M18 A;  1EWZ A;  4DE0 A;  3BFF A;  2Y55 A;  5M19 A;  1K56 D;  1Y54 A;  2Y2G A;  5CTN A;  1NY0 A;  4JF6 A;  3UPN A;  4RA7 A;  3JYI A;  4OQG A;  3OPP A;  1BZA A;  4ZAM A;  2Y2I A;  1CI9 A;  2XQZ A;  2G2W A;  4EQI A;  3G30 A;  2Y91 A;  4BLM A;  4GB7 A;  4N1H A;  2G2U A;  1RGY A;  2BG1 A;  1G6A A;  2WZX A;  2IWC A;  3W8K A;  3ZG9 B;  4OQ0 A;  3VSK A;  4EBN A;  3HLC A;  2HP9 A;  2P9V A;  4BD1 A;  4WEJ A;  2B5R A;  1QME A;  5EVI B;  1NYY A;  4OQH A;  1YT4 A;  5FI7 A;  3DWZ A;  5FA7 A;  3HUM A;  4PM6 A;  3W4P A;  3A3D A;  2ZM8 A;  4EBL A;  2XK1 A;  3FV7 A;  4EUZ A;  1DY6 A;  5CEC A;  4C3Q A;  1QMF A;  5JYP A;  2Q9M A;  2ZJ9 A;  4JXS A;  1Q2Q A;  4DF6 A;  5FDH A;  2CC1 A;  3MXS A;  3ZVT A;  1MWS A;  2H0T A;  3IXG A;  2XGN A;  4P85 A;  3VOZ A;  4YFM A;  4MBF A;  2XR0 A;  4BQM A;  3IHB A;  5KMW A;  3G31 A;  5HFO A;  2EXA A;  3CZD A;  4X69 A;  4OP8 A;  4RX2 A;  1Z6F A;  1AXB A;  3NCK A;  1IKI A;  3VFH A;  2HP5 A;  3IHA A;  4WM9 A;  3SH7 A;  3WS4 A;  2X01 A;  1LL5 A;  5E2H A;  2ZQA A;  4BJP A;  1FSW A;  3G34 A;  3P98 A;  3HLD A;  2HP6 A;  3NIA A;  1XGJ A;  2C6W B;  5AQB A;  1YLJ A;  1BLC A;  4ZJ1 A;  3GVB A;  1ERM A;  1ESU A;  4WMC D;  1JTG A;  2ZC5 B;  1LI9 A;  2Y2P A;  1XXM A;  2A49 A;  1Q2P A;  4E3N A;  1PWC A;  2Y2L A;  3FKW A;  4P87 A;  1XX2 A;  3CJM A;  3M6H A;  3MBZ A;  3FKV A;  4ID4 A;  1EI5 A;  5HAQ A;  1IYP A;  2OSU A;  1ERQ A;  5FQI A;  4OLD A;  4LV3 A;  5F83 A;  3IF6 C;  1BSG A;  2RCX A;  4GDN A;  1SDN A;  1KVM A;  4KQO A;  1DJC A;  1XPB A;  4BEN A;  5DTT A;  1BUE A;  5FI2 A;  1K55 A;  1K55 C;  2Q9N A;  5EVL A;  5EPH A;  3SS4 A;  4KQR A;  4ZJ3 A;  4B4X A;  2GDN A;  1XGI A;  1ALQ A;  1E25 A;  1PZO A;  1KE0 A;  4H8R A;  5F82 A;  4IBR A;  5HW3 A;  4WBG A;  4QHC A;  2WGV A;  3HBR A;  3PBO A;  3V39 A;  2ZD8 A;  3P09 A;  3IXB A;  4FH4 A;  4MBH A;  1LLB A;  3O87 A;  2VGK A;  1SCW A;  5GLA A;  2H0Y A;  4OH0 A;  1CEF A;  3WWX A;  1ZG4 A;  1RGZ A;  3HL9 A;  4K0X A;  5FQQ A;  4OKP A;  4S2P A;  5CHM A;  5CTM A;  5CGX A;  1M40 A;  4DKI A;  5E2F A;  2Y2M A;  5AQA A;  4PM8 A;  1N4O A;  1BLP A;  4RX3 A;  4R4S A;  5DF7 A;  1YMX A;  2P9V B;  4WZ4 A;  4KZA A;  4PMA A;  1IYQ A;  4JXW A;  2Y2K A;  3IQA A;  3IWQ A;  4PM7 A;  3UE3 A;  3V3S A;  3WRZ A;  2FFF B;  4F94 A;  3MKE A;  3PBN A;  3BM6 A;  4FSF A;  3NBL A;  1BLS A;  1PZP A;  5DF9 A;  3IWI A;  3M2K A;  4R3J A;  3G35 A;  1FOF A;  3GQZ A;  3NDE A;  5FAQ A;  3N7W A;  3MZD A;  4X53 A;  2ZC7 A;  5CHU A;  3DWK A;  4M3K A;  2WK0 A;  1MKI A;  3FYZ A;  5DF8 A;  1OME A;  3HUN A;  3G2Y A;  2WGW A;  3ZG7 B;  3GRJ A;  2R9W A;  2DCF A;  2ZC4 B;  5EOO A;  4KG2 A;  2IWD A;  5D3O A;  1RP5 A;  1JWV A;  3BLM A;  4Y0U A;  1MWU A;  3O3V A;  4GZB A;  4OPR A;  4GDB A;  3LO7 A;  4P0M A;  3Q7Z A;  1ONH A;  4LCL A;  4X56 A;  1YLW A;  3WS5 A;  5I94 A;  2OLV A;  2WKE A;  5FQ9 A;  1GCE A;  1L2S A;  3LY4 A;  2Y59 A;  1O7E A;  1YLZ A;  2EXB A;  3ZHH A;  3PBQ A;  5F1F A;  3BYD A;  4E3L A;  1MWR A;  2WYX A;  5HAP A;  1FR1 A;  1K57 A;  1K57 C;  4O7D A;  4S2O A;  5EVI D;  4QJG A;  2JBF A;  4RYE A;  3UPP A;  3OCL A;  3W4O A;  4Y7P A;  3C7U A;  2ZQ8 A;  4N9K A;  4PPR A;  4R4R A;  4X55 A;  2WKI A;  5JYO A;  3B3X A;  5E2G A;  3UDX A;  3IF6 B;  3A3I A;  3S22 A;  2ZM0 A;  2QPN A;  4OPZ A;  3AGE A;  5DVA A;  2HPB A;  5F1G A;  5CHJ A;  1KDW A;  3Q07 A;  4QB8 A;  4U0T A;  2WGI A;  1K6S A;  4OPY A;  1H8Y A;  4JBF A;  4OPQ A;  4NK3 A;  4S2N C;  4S2N A;  4ZTK A;  3S4X A;  3MKF A;  3ITA A;  3OC2 A;  5FAP A;  5FQK A;  4IVI A;  1N9B A;  3OCN A;  3HUO A;  3EQV A;  2ZM2 A;  2J7V A;  3LEZ A;  1W8Y A;  4KZ3 A;  1NXY A;  2X71 A;  5FAO A;  3UN7 A;  5KSC A;  4OOL A;  4GOG A;  4QD4 A;  3UY6 A;  3Q1F A;  1SKF A;  5GLD A;  1NJ4 A;  2P74 A;  4S2J A;  3DW0 A;  3AGD A;  1RCJ A;  1TDL A;  1S6R A;  3RXW A;  4LV2 A;  1O07 A;  2EX9 A;  4WEL A;  5E2E A;  3HLF A;  4DDS A;  4N9L A;  2H10 A;  3BFD A;  4S2M A;  3VP2 A;  1ZG6 A;  4CJN A;  4DE2 A;  3MXR A;  5DTK A;  4Q8I A;  4C6Y A;  1M6K A;  3WS0 A;  4U3T A;  1ZKJ A;  3PTE A;  4JKT A;  2PBY A;  5GHY A;  4BL3 A;  2XH9 A;  1ES3 A;  3LY3 A;  4XXR A;  2WAF A;  4MBK A;  3BFC A;  5GL9 A;  4Z9Q A;  2QMI A;  2HDS A;  3IF6 A;  2EX2 A;  1I2W A;  4GKU A;  4KZ9 A;  4UA6 A;  3VP1 A;  3N8L A;  4K0W A;  2IWB A;  2WGW B;  3N4I A;  5GHZ A;  1LHY A;  4DXB A;  5FQJ A;  3NY4 A;  4KZ6 A;  3ZVW A;  1ES5 A;  3QNB A;  4D2O A;  5CGS A;  5L2F A;  3GR2 A;  3PAG A;  3O88 A;  4FD8 A;  1SDE A;  4E3I A;  3NI9 A;  5GLB A;  3GSG A;  2WUQ A;  1K25 A;  4E3K A;  4CPK A;  2ZQ9 A;  3QNC A;  1NRF A;  2PU4 A;  4KZ8 A;  5U47 A;  1W79 A;  1MY8 A;  3ZNY A;  3MZE A;  1CEG A;  1K54 A;  1K54 C;  1KE3 A;  1XP4 A;  2WKH A;  2FFY A;  4KZ5 A;  5DTS A;  3C5A A;  4OOM A;  3BEC A;  1XA1 A;  3EQU A;  2ZQC A;  1JWP A;  4DXC A;  3V5M A;  4EWF A;  5GLC A;  1CI8 A;  1YM1 A;  5FI6 A;  4MNR A;  3GTC A;  3GV9 A;  3VMA A;  5CER A;  1IYO A;  3I7J A;  4E6X A;  2Y2H A;  4R3B A;  4E3J A;  3QHY A;  2ZQ7 A;  3E2K A;  3IF5 A;  4MEZ A;  4HEF A;  3BEB A;  4EV4 A;  4OOY A;  4B88 A;  4QU3 A;  3ISG A;  1DJB A;  4R23 A;  3SS5 A;  2E8I A;  1DJA A;  5HAR A;  1JTD A;  1YLT A;  1HTZ A;  1E4D A;  3M6B A;  3VOY A;  2ZC6 B;  4K91 A;  4X6T A;  3UNW A;  3ZG5 A;  5KZH A;  3G32 A;  5A90 A;  1FR6 A;  1FSY A;  1K4F A;  5EOE A;  4ZJ2 A;  1I2S A;  4JF5 A;  4LV0 A;  3BRM A;  1HZO A;  3C4O A;  1FQG A;  2Z2L B;  2DNS A;  1WYC A;  3IT9 A;  3HLE A;  2Y2N A;  5EUA A;  1G68 A;  4Y0T A;  4JPM A;  2HDR A;  2V2F F;  2V20 A;  4OVD A;  2V1Z A;  5FAT A;  1K6R A;  4IVK A;  2EFX A;  2PU2 A;  4IED A;  3NC8 A;  1NYM A;  3VSL A;  3UE1 A;  4HBT A;  3V3R A;  4WZ5 A;  4WZ5 C;  3SH8 A;  4E3M A;  1H8Z A;  3RJU A;  4JF4 A;  1I5Q A;  2XD5 A;  3WS2 A;  5A93 A;  4ZBE A;  5FQM A;  4WEK A;  1K4E A;  5TGF A;  5CXW A;  1LL9 A;  3CG5 A;  3DTM A;  1FCN A;  1PIO A;  4R1G A;  5E43 A;  4UHU A;  5IHV A;  4KZB A;  3ZFZ A;  3FWL A;  2XLN A;  4B4Z A;  3C7V A;  1J9M A;  5FSR A;  3TG9 A;  5TR7 A;  3V50 A;  1U60 A;  1YMS A;  5J8X A;  3HRE A;  3IXH A;  4OON A;  4E3O A;  3OZH A;  5CRF A;  4KZ7 A;  3S1Y A;  3HLB A;  5HAI A;  3LCE A;  1FCM A;  2J9O A;  3MZF A;  3UDI A;  2VGJ A;  2XD1 A;  1KGE A;  3SOI A;  3BFG A;  1WYB A;  2EX6 A;  4KG5 A;  1IEL A;  4BL2 A;  4FCF A;  3D4F A;  4A5R A;  2C5W B;  1W7F A;  3A3F A;  4UA9 A;  2OV5 A;  1MPL A;  5HL1 A;  1PI4 A;  4N92 A;  1K38 A;  4MLL A;  4KQQ A;  3ZDJ A;  1PYY A;  4DDY A;  2JC7 A;  1BTL A;  4BD0 A;  4OQI A;  2Z2M B;  4QY6 A;  2R9X A;  3WRT A;  3NDG A;  3TSG A;  5FAS A;  2XFS A;  1CK3 A;  2QZ6 A;  3ZGA B;  1HVB A;  1IYS A;  3UDF A;  4ZDX A;  1KGF A;  2ZMA A;  1PWG A;  4IBX A;  5AQ7 A;  5CED A;  1IEM A;  4GD6 A;  1KGG A;  1GA0 A;  1L0F A;  3G2Z A;  3IH8 A;  2J9P A;  3TOI A;  1YLY A;  1NZO A;  2Y2J A;  3UO9 A;  4NET A;  1PW8 A;  3A3E A;  3Q7V B;  5TFQ A;  3ITB A;  2RL3 A;  1KVL A;  5HX9 A;  1TEM A;  2I72 A;  2BLS A;  3ZG0 A;  2WZZ A;  4RVA A;  5A92 A;  2ZC3 B;  1L0E A;  3HVF A;  3AGF A;  4S2K A;  1ES4 A;  3SH9 A;  2EX8 A;  4HES A;  3ZCZ A;  1E3U A;  2Y2O A;  3IH9 A;  3OPH A;  3PBS A;  1ES2 A;  4GNU A;  3ZG8 B;  1WE4 A;  1H5X A;  1PWD A;  1TDG A;  1VQQ A;  5KSH A;  1K56 A;  3VP0 A;  4XUZ A;  1IKG A;  3N8S A;  3N6I A;  4DE3 A;  1HD8 A;  5M1A A;  5BOH A;  1FCO A;  4QY5 A;  1MBL A;  1ERO A;  1GHM A;  4JXG A;  2JCH A;  3IXD A;  1JWZ A;  4KEN B;  2H5S A;  4KZ4 A;  3E2L A;  1YQS A;  5G18 A;  2ZLY A;  3VP4 A;  3ZNT A;  2XF3 A;  1BLH A;  1L0D A;  2HDU A;  3Q82 A;  4R0Q A;  2UWX A;  3PBT A;  3WS1 A;  1XKZ A;  5EVI A;  3C4P A;  5EVI C;  4KG6 A;  3Q81 A;  2XFT A;  4GN2 A;  4OP5 A;  4Y0O A;  4S2I A;  5GHX A;  4DRT A;  2WAE A;  1MXO A;  4UA7 A;  3VFF A;  4UAA A;  1BT5 A;  3A3J A; 
#chains in the Genus database with same CATH topology
 3D3O A;  4C75 A;  2VLG A;  4MN5 A;  1LI0 A;  5CGW A;  4K08 A;  4YOF A;  3UPO A;  4GS9 B;  5F68 A;  2XEP A;  3V67 A;  5L09 A;  4M4X A;  2DRW A;  1W5D A;  4NXB A;  5F6A A;  3UB6 A;  1ESI A;  4I3J A;  4S2L A;  4ESP A;  3FZC A;  1L0G A;  4X68 A;  3G4P A;  3QP8 A;  3F1N A;  4IJG A;  3DTI A;  3KO6 A;  4WYY A;  4PM5 A;  1KE4 A;  1JVJ A;  4DJ3 A;  3LEQ A;  1GHP A;  1VM1 A;  1ZC2 A;  1S0W A;  2WAD A;  1GA9 A;  1XFQ A;  1ONG A;  2Y2Q A;  3OPL A;  5FEG A;  3M2J A;  3BFF A;  1K56 D;  1Y54 A;  1NY0 A;  4JF6 A;  3UPN A;  4EQ1 A;  1D7E A;  4OQG A;  2VV6 A;  5KIZ A;  2XQZ A;  4DN0 A;  1FIL A;  4EQI A;  3G30 A;  1ZTU A;  2WZX A;  2P9V A;  4NXE A;  4BD1 A;  4WEJ A;  1YT4 A;  5FI7 A;  2ZL1 A;  5FA7 A;  3T4L A;  4NEE D;  4PHT A;  5JYP A;  1Q2Q A;  1MWS A;  5HSQ A;  2XGN A;  4P85 A;  4MBF A;  4BQM A;  3G31 A;  2EXA A;  3CZD A;  3MSH A;  4OP8 A;  4L9F A;  2JKF A;  1IKI A;  3UB7 A;  2HP5 A;  4I38 A;  2ZQA A;  3G34 A;  3P98 A;  3HLD A;  5LBR A;  3IBJ A;  3K3D A;  5L8M A;  4ZJ1 A;  3GVB A;  1ERM A;  2P08 A;  1P0Z A;  1LI9 A;  3F1N B;  1PWC A;  3CJM A;  4CLC D;  1EI5 A;  1IYP A;  2I9V A;  1H8M A;  2RCX A;  4GDN A;  5FL3 A;  2QJ5 A;  1BUE A;  4Q0H A;  1K55 A;  1K55 C;  3T1S A;  5EPH A;  4KQR A;  1S1Z A;  4Y5F A;  1P97 A;  3LI9 A;  5IS1 A;  4IBR A;  3PBO A;  2CMN A;  3O87 A;  4I3A A;  3CWF A;  3KSH A;  3NUL A;  1VB6 A;  4K0X A;  5CTM A;  4BBU A;  2VEA A;  5E2F A;  3W2Z A;  4RX3 A;  2P9V B;  3S7P A;  4PM7 A;  4Y17 A;  4F94 A;  2FFF B;  2ZL1 B;  2HGV A;  1PZP A;  2HV1 A;  3NDE A;  3KSI A;  5FAQ A;  2P7J A;  2WGW A;  1FIK A;  3ZG7 B;  3MF0 A;  2R9W A;  2H28 A;  5EOO A;  4KG2 A;  1RP5 A;  2HJE A;  4X56 A;  1YLW A;  3DTE A;  2OLV A;  1L2S A;  4EEU A;  3LIC A;  3ZHH A;  3BYD A;  4E3L A;  1OJ5 A;  2XRN A;  4O0P A;  1NWZ A;  4O7D A;  2W1R A;  2A2L A;  5EVI D;  3QP2 A;  3W4O A;  4Y7P A;  2D01 A;  4PPR A;  4R4R A;  2WKI A;  1ZHH B;  3A3I A;  2PHY A;  2ZM0 A;  5F1G A;  2HPB A;  2NUP C;  4OPQ A;  3IBR A;  4ZTK A;  4II7 A;  3MKF A;  1YAX A;  5FAP A;  4UQI M;  4F3L B;  3OCN A;  3MXQ A;  1W8Y A;  1NXY A;  2X71 A;  2E8J A;  3UY6 A;  5GLD A;  3PR6 A;  3DW0 A;  1PRQ A;  1RCJ A;  2O99 A;  4HP4 A;  1MKM A;  3JPU A;  4DDS A;  4N9L A;  4Q8I A;  2K7S A;  3MXR A;  3QP4 A;  2XA7 M;  4C6Y A;  1M6K A;  4U3T A;  1ACF A;  3MQO A;  3KSG A;  3KYZ A;  1ES3 A;  3LY3 A;  2WAF A;  3BFC A;  5HPI A;  2HDS A;  1I2W A;  4UA6 A;  3N8L A;  2ZBB A;  2WGW B;  4DXB A;  4KZ6 A;  3QNB A;  5L2F A;  3T1X A;  3CAX A;  4E3K A;  4CPK A;  3QNC A;  3P7N A;  4KZ8 A;  1W79 A;  2WKH A;  1XA1 A;  4DXC A;  2ZQC A;  5GLC A;  4LGW A;  2EA9 A;  3GTC A;  5G4Y A;  3VMA A;  1L3L A;  1XJ3 A;  4E3J A;  2ZQ7 A;  4JGR A;  1OPX A;  3IF5 A;  3SS5 A;  2E8I A;  1YLT A;  3LGO A;  3UNW A;  5KZH A;  3G32 A;  5A90 A;  5EOE A;  1G5U A;  1A0K A;  1FQG A;  1WYC A;  5EUA A;  3HLE A;  2OWJ A;  4YWZ A;  4Y0T A;  2J3W A;  2BTF P;  4JPM A;  2HDR A;  5FAT A;  4IED A;  3NC8 A;  4WZ5 A;  4WZ5 C;  3RFB A;  3RJU A;  3NOP C;  5A93 A;  1YSP A;  3CG5 A;  4R1G A;  3TE8 A;  5K5B A;  4KZB A;  5EVE A;  5J8X A;  1GSV A;  4OON A;  3OZH A;  4KZ7 A;  5HAI A;  4NXF A;  3U4L P;  1X0O A;  3T4K A;  3QP6 A;  1TS6 A;  1PI4 A;  3H82 A;  4FOF A;  3LIB A;  4KQQ A;  3S7Q A;  4DDY A;  4BD0 A;  2Z2M B;  2R9X A;  3FC7 A;  5FAS A;  2V1B A;  1HVB A;  1IYS A;  2ZMA A;  3E4Q A;  3T4Q A;  5J4E A;  3LIF A;  3LIA A;  1IEM A;  3TOI A;  1NZO A;  3A3E A;  5TFQ A;  3ITB A;  2I72 A;  4G3K A;  3PBS A;  4GNU A;  3OPH A;  1ES2 A;  1K0K A;  3VV4 A;  1PWD A;  4XUZ A;  4NXG A;  3OLO A;  1ERO A;  1GHM A;  1NLZ A;  5CX7 A;  4KEN B;  1T19 A;  3VP4 A;  3ZNT A;  1J3W A;  3K2N A;  4R0Q A;  3PBT A;  4KG6 A;  3Q81 A;  4GN2 A;  4S2I A;  3VFF A;  3ULF A;  3LR0 A;  3A3J A;  4LV1 A;  4JLF A;  1OTD A;  5TJJ A;  4UQI S;  4KUO A;  1Y4O A;  3Q7V A;  4XT2 B;  2X02 A;  3TJZ C;  1YLP A;  1GHI A;  1SHV A;  1PNE A;  2PBD P;  3O86 A;  1NZU A;  4P6B A;  2EWW A;  4GD8 A;  1SZV A;  4L0L A;  2Y8H A;  1F5M A;  5HL6 A;  2PD8 A;  3BLS A;  3GMW A;  5EEC A;  4MN6 A;  1UGU A;  2JE5 A;  4FH2 A;  3CMZ A;  2V8C A;  4CQH A;  4LCM A;  1MWT A;  2A3U A;  3HLG A;  4Y2F A;  5DKL A;  3PAE A;  3MFD A;  3W4Q A;  3EGD C;  5M18 A;  5I5L A;  3JYI A;  3H7W A;  4GS9 A;  3BWL A;  2PYR A;  2Y91 A;  4ZRR A;  4BLM A;  3GDI A;  2ZMV A;  1G6A A;  2IWC A;  3W8K A;  2W3H A;  3VSK A;  3ZG9 B;  3HLC A;  2HP9 A;  3T1Q B;  3NHQ A;  4PM6 A;  2OWH A;  3W4P A;  3E4O A;  5F5Y A;  3SZT A;  4C3Q A;  2Q9M A;  3FPV A;  4QPR A;  5FDH A;  3ZVT A;  3VE4 A;  3IXG A;  1VET B;  1DP6 A;  2XR0 A;  4CLC E;  5HFO A;  1Z6F A;  3NCK A;  3VFH A;  4PKY G;  4LPZ A;  4GJ4 A;  3IHA A;  2X01 A;  1LL5 A;  4LRY C;  1CF0 A;  5DFX A;  1FSW A;  2HP6 A;  4Y13 A;  5AQB A;  1JTG A;  1GSX A;  2Y2P A;  3G6O A;  2A49 A;  1Q2P A;  4E3N A;  4KQD A;  2Y2L A;  3M6H A;  2O0Y A;  3FKV A;  4ID4 A;  1ERQ A;  1XJ4 A;  4OLD A;  5IU1 A;  1KVM A;  1XPB A;  5DTT A;  3DTK A;  5EVL A;  4ZJ3 A;  4B4X A;  1ALQ A;  1E25 A;  5C5K A;  5F82 A;  4QHC A;  3V39 A;  3IXB A;  4MBH A;  1LLB A;  3H7W B;  3DBA A;  1SCW A;  2H0Y A;  4OH0 A;  1CEF A;  1UWN X;  5CHM A;  3PHY A;  2PR6 A;  1N4O A;  3F1O A;  4R4S A;  4KZA A;  1IYQ A;  4X25 A;  2Y2K A;  3IQA A;  3UE3 A;  3V3S A;  3WRZ A;  2M7U A;  3MKE A;  3PBN A;  3ZQ5 A;  4FSF A;  3M2K A;  2V0U A;  3G35 A;  3GQZ A;  1SKO A;  4RQ9 A;  2VV7 A;  3LR4 A;  3FYZ A;  2DCF A;  2ZC4 B;  4HH2 A;  4R38 A;  1JWV A;  3BLM A;  1MWU A;  4GZB A;  4GDB A;  1ONH A;  3WS5 A;  2WKE A;  2KX6 A;  1GCE A;  5FQ9 A;  4Z1W A;  5J7E A;  3PBQ A;  1XJ6 A;  1T1B A;  2JKR I;  1FR1 A;  4EU0 A;  4RYE A;  3UPP A;  1OTB A;  2ZQ8 A;  2KDK A;  5JYO A;  3B3X A;  1Z09 A;  1PFL A;  2V1A A;  2LB5 A;  3AGE A;  1N9O A;  4QB8 A;  4OPY A;  4JBF A;  3UME A;  1EW0 A;  3OC2 A;  5FQK A;  2JKR M;  4WF0 A;  3LEZ A;  3O5Y A;  5FAO A;  5KSC A;  4S2J A;  3BJN A;  2J3T C;  4LV2 A;  3F1O B;  2V0W A;  2H10 A;  3CPT A;  4S2M A;  3U2A A;  4DE2 A;  3WS0 A;  3PTE A;  1S4R A;  2A24 B;  1SKO B;  4XXR A;  4Y3I A;  1CQA A;  4LRX C;  5F69 A;  2QMI A;  4KZ9 A;  5EM1 A;  4K0W A;  2IWB A;  5GHZ A;  1LHY A;  1YSQ A;  5FQJ A;  3NY4 A;  3ZVW A;  3O88 A;  1SDE A;  2V9A A;  3GEC A;  3NI9 A;  1P9R A;  4F3L A;  1K25 A;  3R7W B;  3A0S A;  3C2W A;  4HOI A;  3HJI A;  2O9B A;  2ZQ9 A;  4BBV A;  3LID A;  1MY8 A;  1TS8 A;  3ZNY A;  1CEG A;  1XP4 A;  4KZ5 A;  5DTS A;  3C5A A;  3V5M A;  4HJ3 A;  3KYQ A;  4MNR A;  1NRJ A;  2K2N A;  3KX0 X;  2FZ0 A;  2ZMF A;  4G3W A;  3BEB A;  1TD5 A;  1IOU A;  4B88 A;  3ISG A;  1DJA A;  2HZ5 A;  3FPW A;  3VOY A;  3M6B A;  1LSX A;  1FSY A;  1I2S A;  2AVX A;  3BRM A;  1HZO A;  2Z2L B;  3IT9 A;  2Y2N A;  1W63 M;  3IX8 A;  2V2F F;  2V20 A;  1K6R A;  2EFX A;  3ICY A;  3V3R A;  3F1P B;  4E3M A;  5IT5 A;  3CPT B;  4CLC A;  4CLC C;  1FCN A;  2G7U A;  4HP9 A;  3ZFZ A;  3RH8 B;  1J9M A;  2BAS A;  3HRE A;  4E3O A;  5CRF A;  3LCE A;  1FCM A;  2J9O A;  3MZF A;  3UDI A;  2OOL A;  3D72 A;  4GHI A;  4KG5 A;  3S7O A;  1D06 A;  1LT0 A;  1PYY A;  5DJU A;  3TSG A;  2QZ6 A;  5EFW A;  3PXP A;  4GLQ A;  5CED A;  2W27 A;  4MN7 A;  1YLY A;  4Y15 A;  2Y2J A;  3UO9 A;  1KOU A;  4NET A;  1PW8 A;  1TEM A;  3ZG0 A;  5AJG A;  4RVA A;  4S2K A;  3SH9 A;  4KUK A;  1E3U A;  1H5X A;  3VP0 A;  4EUV A;  1IKG A;  4DE3 A;  1HD8 A;  2WKR A;  5M1A A;  5BOH A;  4QY5 A;  1MBL A;  4PKY A;  3TRC A;  2Z6C A;  4KZ4 A;  1LL8 A;  2FH5 A;  5FDS A;  2UWX A;  5EVI A;  3C4P A;  5EVI C;  2QWS A;  4CLC B;  4OP5 A;  4Y0O A;  1MXO A;  4UAA A;  2VV8 A;  1BT5 A;  5HDD A;  3CHW P;  1KDS A;  3N8R A;  1BUL A;  1PW1 A;  4GHI B;  2OLU A;  1C3B A;  4B93 A;  3BFE A;  4XUX A;  3NJA A;  4EBP A;  3OBF A;  4P6Z S;  4I5S A;  1W8Q A;  1OTE A;  3P01 A;  3SS3 A;  2B95 A;  3CIT A;  1XA7 A;  1W63 Q;  4O01 A;  3OPR A;  4WMC A;  5CEB A;  2EFU A;  4E6W A;  4DE1 A;  3T12 B;  3C38 A;  2Y4A A;  1YPR A;  4LEN A;  2HDQ A;  3VOL A;  4D60 A;  2XDM A;  4JXV A;  4HNB A;  1BZA A;  2L1M A;  2HF6 A;  4XT2 A;  4ZAM A;  3JVU A;  2Y2I A;  1CI9 A;  1UWP X;  4GB7 A;  2BG1 A;  4OQ0 A;  4EBN A;  1QME A;  5EVI B;  1NYY A;  3KSF A;  4OQH A;  3DWZ A;  2Y79 A;  2ZOI A;  2GX5 A;  2ZM8 A;  2XK1 A;  1LSV A;  3FV7 A;  4EUZ A;  5CEC A;  1QMF A;  1BYW A;  2ZJ9 A;  4JXS A;  1D1J A;  3MXS A;  2H0T A;  5TBM A;  5HWW A;  3VOZ A;  5HDC A;  5KMW A;  4EEP A;  2YKH A;  4WM9 A;  3LR5 A;  3WS4 A;  1OJG A;  4BJP A;  4EER A;  3CLO A;  3NIA A;  2QHK A;  1XGJ A;  2C6W B;  5HWT A;  1ESU A;  5J3W A;  2ZC5 B;  5HD5 A;  3A0V A;  4NG2 A;  4LV3 A;  4UEY A;  5F83 A;  3IF6 C;  1BSG A;  2HJ9 C;  1SDN A;  2J80 A;  4KQO A;  5A8B A;  3MMH A;  2Q9N A;  3SS4 A;  2WKP A;  2GDN A;  1XGI A;  1N9L A;  4H8R A;  1STZ A;  4WBG A;  2WGV A;  3HBR A;  2ZD8 A;  1VET A;  3EEH A;  4EES A;  1N9N A;  2VGK A;  5GLA A;  4WLA A;  1VEU A;  3QP5 A;  3WWX A;  3QP1 A;  1ZG4 A;  2M1C A;  1RGZ A;  3HL9 A;  4S2P A;  5CGX A;  1M40 A;  4DKI A;  2Y2M A;  5AQA A;  4PM8 A;  4WZ4 A;  3UMD A;  3IS2 A;  3NOU C;  4DMZ A;  3BM6 A;  3NBL A;  5DF9 A;  3IWI A;  1FOF A;  3N7W A;  1S67 L;  1TS0 A;  4X53 A;  5CHU A;  4M3K A;  4EET B;  1MKI A;  5TBM B;  5DF8 A;  3HUN A;  5HWV A;  3K3C A;  2W1T B;  2IWD A;  5D3O A;  3UB9 A;  3O3V A;  4P0M A;  4LCL A;  3EWK A;  5I94 A;  1S1Y A;  5L10 A;  3LY4 A;  2Y59 A;  1NLY A;  3BQ8 A;  3L9K A;  2JKG A;  2WYX A;  2WKQ A;  1K57 A;  1K57 C;  2W3E A;  2JBF A;  3C7U A;  3E0Y A;  4N9K A;  4X55 A;  2PDR A;  3IF6 B;  5AVE A;  3S22 A;  2QPN A;  4OPZ A;  5DVA A;  4HJ6 A;  2UV0 E;  3A0R A;  3Q07 A;  4I3I A;  4U0T A;  4S2N A;  4S2N C;  3S4X A;  4ETZ A;  4IVI A;  5HZH A;  1N9B A;  3HUO A;  3EQV A;  2ZM2 A;  2J7V A;  2L0W A;  3UN7 A;  4OOL A;  1VEU B;  4QD4 A;  4HY8 A;  1SKF A;  1NJ4 A;  2P74 A;  2JKT I;  3AGD A;  1TDL A;  4Q0I A;  1S6R A;  5HPF A;  5E2E A;  3BFD A;  3VP2 A;  3IS2 B;  4CJN A;  2OAP 1;  1ZKJ A;  4JKT A;  4R70 A;  4MDZ A;  2IA2 A;  5GHY A;  4BL3 A;  4HQA A;  2JKT M;  4GKU A;  3N4I A;  1HLU P;  2LB9 A;  2XRO A;  5CGS A;  3GR2 A;  3PAG A;  1S66 L;  2QYB A;  5GLB A;  2WUQ A;  2W3F A;  1NRF A;  2PU4 A;  1K54 A;  1K54 C;  1KE3 A;  1XJ2 A;  2FFY A;  4ETX A;  4OOM A;  1JWP A;  2B02 A;  1CI8 A;  5FI6 A;  3NOT C;  3GV9 A;  5CER A;  4E6X A;  4R3B A;  3E2K A;  4OOY A;  2W3D A;  1DJB A;  2XSS A;  1JTD A;  1E4D A;  3ZG5 A;  2A24 A;  2ZC6 B;  4K91 A;  4X6T A;  1K4F A;  3B47 A;  4ZJ2 A;  4JF5 A;  3C4O A;  2DNS A;  3CUE A;  3CUE C;  2V1Z A;  1G6O A;  3DAV A;  2J3T D;  1NYM A;  3VSL A;  5MC7 A;  3R7W A;  4JF4 A;  3MFX A;  1I5Q A;  2XD5 A;  3WS2 A;  5FQM A;  4WEK A;  1K4E A;  5CXW A;  1LL9 A;  1PIO A;  3FWL A;  3D9Y A;  5FSR A;  3TG9 A;  3V50 A;  3IXH A;  3HLB A;  2VGJ A;  2XD1 A;  2PYP A;  1WYB A;  4BL2 A;  4FCF A;  2Q0O A;  4G3V A;  4ARZ A;  1W7F A;  2ACG A;  3A3F A;  2OV5 A;  1MPL A;  4I39 A;  1K38 A;  3VE3 A;  3ZDJ A;  2JC7 A;  1BTL A;  2INW A;  1F9I A;  1CK3 A;  2GNX A;  4GCZ A;  3RTY A;  3F1P A;  4YNR A;  4P6Z M;  1V9Z A;  4IBX A;  1V9Y A;  3R4K A;  1KGG A;  4IUK A;  1L0F A;  3G2Z A;  4EXO A;  5HX9 A;  1KVL A;  3LI8 A;  4FTX A;  1YKD A;  2VZW A;  2WZZ A;  2ZC3 B;  3HVF A;  3AGF A;  1JNU A;  2EX8 A;  4HES A;  2Y2O A;  3ZG8 B;  2OAQ 1;  1TDG A;  1K56 A;  3N6I A;  2VKS A;  3BY9 A;  4JXG A;  3C30 A;  2JCH A;  1JWZ A;  3E2L A;  3H9W A;  3MR0 A;  5G18 A;  2ZLY A;  2XF3 A;  2P04 A;  1BLH A;  2HDU A;  3HCY A;  1XKZ A;  2XFT A;  3L7H A;  5GHX A;  4DRT A;  4UA7 A;  2D02 A;  2W3G A;  2MJ6 A;  5DFY A;  3VP3 A;  2J8Y A;  4OLG A;  4U0X A;  4QWO A;  4X1L A;  1TVF A;  5A91 A;  3BY8 A;  2R78 A;  4ARZ B;  1TS7 A;  2NUT C;  4N1X A;  5EE8 A;  4YIN A;  2PAV P;  4H6J A;  4EW7 A;  3IWO A;  3HLW A;  3MQQ A;  2ZQD A;  3RXX A;  5AQ9 A;  4HBU A;  4PM9 A;  1XFN A;  5DJT A;  3T4S A;  1PI5 A;  3MS6 A;  3UE0 A;  2ZOH A;  3PBR A;  4MMN A;  1H0M A;  1E3U D;  1EWZ A;  4DE0 A;  2Y55 A;  5M19 A;  2Y2G A;  5CTN A;  4RA7 A;  3OPP A;  2B18 A;  2G2W A;  4B9O A;  5EM0 A;  4FUW A;  4N1H A;  3TW8 A;  2G2U A;  1RGY A;  2B5R A;  1GSW A;  3MJQ A;  3HUM A;  3A3D A;  4ME4 A;  2Z6D A;  4EBL A;  1DY6 A;  4DF6 A;  3EGX C;  2CC1 A;  4YFM A;  3IHB A;  3CI6 A;  3T4T A;  2VGL M;  4X69 A;  4RX2 A;  1AXB A;  3OOV A;  1MC0 A;  3SH7 A;  5E2H A;  2V8F A;  4JGP A;  3PYP A;  4H6J B;  1YLJ A;  1BLC A;  3UB8 A;  4WMC D;  3UB5 P;  1XXM A;  3FG8 A;  1TF1 A;  3FKW A;  4P87 A;  1XX2 A;  3MBZ A;  5HAQ A;  2O9C A;  2OSU A;  5FQI A;  1AWI A;  1DJC A;  2KLI A;  4BEN A;  5FI2 A;  4JGQ A;  1PZO A;  1KE0 A;  3LYX A;  3HJK A;  5HW3 A;  2DMW A;  3P09 A;  1OTI A;  5EV0 A;  4FH4 A;  3B33 A;  5FEF A;  3KYE A;  5FQQ A;  4OKP A;  1BLP A;  5DF7 A;  1YMX A;  4WL9 A;  4PMA A;  4JXW A;  4L9G A;  3IWQ A;  4WN5 A;  1DP9 A;  1F2K A;  1BLS A;  4R3J A;  2JN7 A;  1Y28 A;  3UE6 A;  5G4Z A;  3MZD A;  2ZC7 A;  4PAU A;  3DWK A;  4R6L A;  4JGO A;  2WK0 A;  1OME A;  3G2Y A;  3GRJ A;  2EWV A;  1MZU A;  4GW9 A;  3ZYT A;  3LIE A;  4Y0U A;  4OPR A;  3LO7 A;  1OTA A;  1ODV A;  3Q7Z A;  4O8G A;  3T1R A;  1O7E A;  3IX3 A;  1YLZ A;  2EXB A;  5F1F A;  3NEC A;  4NKP A;  2QKP A;  1MWR A;  5HAP A;  4QJG A;  4S2O A;  1WA9 A;  3T4J A;  3OCL A;  4X1M A;  4LLO B;  2PRF A;  4Q0J A;  5E2G A;  3UDX A;  5CHJ A;  1KDW A;  3T4O A;  1T1A A;  3SW1 A;  3EEA A;  2WGI A;  1K6S A;  1H8Y A;  4NK3 A;  3ITA A;  4AFI A;  4KZ3 A;  2W1T A;  4GOG A;  3Q1F A;  1P9W A;  3RXW A;  4HIA A;  1O07 A;  2EX9 A;  4WEL A;  3HLF A;  4HH3 A;  1ZG6 A;  2VA0 A;  5DTK A;  4BBT A;  5DKK A;  2PBY A;  2K31 A;  3MQ0 A;  2XH9 A;  1CJF A;  4MBK A;  5GL9 A;  2PR5 A;  4Z9Q A;  3IF6 A;  2EX2 A;  3VP1 A;  2VJW A;  3EOI A;  4D2O A;  1ES5 A;  5L07 A;  4FD8 A;  4E3I A;  3GSG A;  3S7N A;  3LFV A;  5U47 A;  3C8C A;  3MZE A;  4BMW A;  3BEC A;  3EQU A;  4LFU A;  4EWF A;  1YM1 A;  2PD7 A;  1IYO A;  3I7J A;  2Y2H A;  2VX8 A;  3QHY A;  4MEZ A;  1IFQ A;  2L4R A;  4HEF A;  4EV4 A;  4QU3 A;  4R23 A;  1DRM A;  5HAR A;  1HTZ A;  2VGL S;  3B42 A;  1FR6 A;  4LV0 A;  4MCW A;  2VK3 A;  3LR3 A;  1G68 A;  3H82 B;  3LUQ A;  4OVD A;  4IVK A;  2GJ3 A;  2PU2 A;  2QJ7 A;  2XA7 S;  4BWI A;  1LSW A;  3UE1 A;  4HBT A;  3E4P A;  3SH8 A;  1H8Z A;  1VHM A;  4ZBE A;  5TGF A;  4DJ2 A;  1OT6 A;  3DTM A;  5E43 A;  4UHU A;  5IHV A;  2XLN A;  4B4Z A;  3C7V A;  5TR7 A;  1U60 A;  1YMS A;  3S1Y A;  1KGE A;  3SOI A;  3BFG A;  2EX6 A;  1H3Q A;  4LRZ E;  3E98 A;  4HI4 A;  1IEL A;  3D4F A;  4IHQ A;  4A5R A;  2C5W B;  4HHD A;  5HL1 A;  4UA9 A;  4N92 A;  4MLL A;  4OQI A;  4QY6 A;  4E04 A;  3WRT A;  3NDG A;  4L9E A;  2XFS A;  2M7V A;  1S4S A;  3ZGA B;  3UDF A;  4ZDX A;  1KGF A;  1PWG A;  2O9A A;  2KOI A;  5AQ7 A;  4GD6 A;  1GA0 A;  1OT9 A;  3IH8 A;  2J9P A;  3Q7V B;  3JVV A;  2RL3 A;  5HDS A;  2BLS A;  5A92 A;  1L0E A;  2PT7 A;  2JHE A;  1ES4 A;  2GZA A;  3ZCZ A;  3IH9 A;  1WE4 A;  1VQQ A;  5KSH A;  3N8S A;  1FCO A;  1F98 A;  4R3A A;  3IX4 A;  5HD3 A;  3IXD A;  2H5S A;  1YQS A;  1T1C A;  4IUH A;  1DP8 A;  3BQA A;  3T50 A;  1L0D A;  3Q82 A;  5AVF A;  4WUJ A;  3WS1 A;  1G28 A;  1T18 A;  2W0N A;  3BW6 A;  2WAE A;  2YKF A;  4HJ4 A; 
#chains in the Genus database with same CATH homology
 4C75 A;  3VP3 A;  2J8Y A;  4LV1 A;  4OLG A;  4U0X A;  4JLF A;  1KDS A;  3N8R A;  1LI0 A;  1TVF A;  5CGW A;  5A91 A;  3Q7V A;  1BUL A;  3UPO A;  2X02 A;  1PW1 A;  2OLU A;  1YLP A;  2XEP A;  1C3B A;  1GHI A;  1SHV A;  2DRW A;  1W5D A;  3BFE A;  1NZU A;  3O86 A;  4XUX A;  4EBP A;  4N1X A;  4P6B A;  5EE8 A;  4YIN A;  1W8Q A;  1ESI A;  4S2L A;  4GD8 A;  3FZC A;  1L0G A;  4L0L A;  4X68 A;  3SS3 A;  3G4P A;  3BLS A;  3GMW A;  5EEC A;  1XA7 A;  3IWO A;  3HLW A;  2JE5 A;  3OPR A;  4WMC A;  4FH2 A;  2ZQD A;  5CEB A;  3RXX A;  2EFU A;  5AQ9 A;  4HBU A;  4WYY A;  4PM9 A;  4PM5 A;  3CMZ A;  1KE4 A;  4E6W A;  1JVJ A;  4LCM A;  4DE1 A;  1MWT A;  1GHP A;  1VM1 A;  1ZC2 A;  1PI5 A;  2A3U A;  2Y4A A;  4LEN A;  1S0W A;  2HDQ A;  2WAD A;  3HLG A;  1GA9 A;  3UE0 A;  3PAE A;  1ONG A;  2XDM A;  2Y2Q A;  3PBR A;  4JXV A;  3OPL A;  3MFD A;  3M2J A;  3W4Q A;  1E3U D;  5M18 A;  1EWZ A;  4DE0 A;  3BFF A;  2Y55 A;  5M19 A;  1K56 D;  1Y54 A;  2Y2G A;  5CTN A;  1NY0 A;  4JF6 A;  3UPN A;  4RA7 A;  3JYI A;  4OQG A;  3OPP A;  1BZA A;  4ZAM A;  2Y2I A;  1CI9 A;  2XQZ A;  2G2W A;  4EQI A;  3G30 A;  2Y91 A;  4BLM A;  4GB7 A;  4N1H A;  2G2U A;  1RGY A;  2BG1 A;  1G6A A;  2WZX A;  2IWC A;  3W8K A;  3ZG9 B;  4OQ0 A;  3VSK A;  4EBN A;  3HLC A;  2HP9 A;  2P9V A;  4BD1 A;  4WEJ A;  2B5R A;  1QME A;  5EVI B;  1NYY A;  4OQH A;  1YT4 A;  5FI7 A;  3DWZ A;  5FA7 A;  3HUM A;  4PM6 A;  3W4P A;  3A3D A;  2ZM8 A;  4EBL A;  2XK1 A;  3FV7 A;  4EUZ A;  1DY6 A;  5CEC A;  4C3Q A;  1QMF A;  5JYP A;  2Q9M A;  2ZJ9 A;  4JXS A;  1Q2Q A;  4DF6 A;  5FDH A;  2CC1 A;  3MXS A;  3ZVT A;  1MWS A;  2H0T A;  3IXG A;  2XGN A;  4P85 A;  3VOZ A;  4YFM A;  4MBF A;  2XR0 A;  4BQM A;  3IHB A;  5KMW A;  3G31 A;  5HFO A;  2EXA A;  3CZD A;  4X69 A;  4OP8 A;  4RX2 A;  1Z6F A;  1AXB A;  3NCK A;  1IKI A;  3VFH A;  2HP5 A;  3IHA A;  4WM9 A;  3SH7 A;  3WS4 A;  2X01 A;  1LL5 A;  5E2H A;  2ZQA A;  4BJP A;  1FSW A;  3G34 A;  3P98 A;  3HLD A;  2HP6 A;  3NIA A;  1XGJ A;  2C6W B;  5AQB A;  1YLJ A;  1BLC A;  4ZJ1 A;  3GVB A;  1ERM A;  1ESU A;  4WMC D;  1JTG A;  2ZC5 B;  1LI9 A;  2Y2P A;  1XXM A;  2A49 A;  1Q2P A;  4E3N A;  1PWC A;  2Y2L A;  3FKW A;  4P87 A;  1XX2 A;  3CJM A;  3M6H A;  3MBZ A;  3FKV A;  4ID4 A;  1EI5 A;  5HAQ A;  1IYP A;  2OSU A;  1ERQ A;  5FQI A;  4OLD A;  4LV3 A;  5F83 A;  3IF6 C;  1BSG A;  2RCX A;  4GDN A;  1SDN A;  1KVM A;  4KQO A;  1DJC A;  1XPB A;  4BEN A;  5DTT A;  1BUE A;  5FI2 A;  1K55 A;  1K55 C;  2Q9N A;  5EVL A;  5EPH A;  3SS4 A;  4KQR A;  4ZJ3 A;  4B4X A;  2GDN A;  1XGI A;  1ALQ A;  1E25 A;  1PZO A;  1KE0 A;  4H8R A;  5F82 A;  4IBR A;  5HW3 A;  4WBG A;  4QHC A;  2WGV A;  3HBR A;  3PBO A;  3V39 A;  2ZD8 A;  3P09 A;  3IXB A;  4FH4 A;  4MBH A;  1LLB A;  3O87 A;  2VGK A;  1SCW A;  5GLA A;  2H0Y A;  4OH0 A;  1CEF A;  3WWX A;  1ZG4 A;  1RGZ A;  3HL9 A;  4K0X A;  5FQQ A;  4OKP A;  4S2P A;  5CHM A;  5CTM A;  5CGX A;  1M40 A;  4DKI A;  5E2F A;  2Y2M A;  5AQA A;  4PM8 A;  1N4O A;  1BLP A;  4RX3 A;  4R4S A;  5DF7 A;  1YMX A;  2P9V B;  4WZ4 A;  4KZA A;  4PMA A;  1IYQ A;  4JXW A;  2Y2K A;  3IQA A;  3IWQ A;  4PM7 A;  3UE3 A;  3V3S A;  3WRZ A;  2FFF B;  4F94 A;  3MKE A;  3PBN A;  3BM6 A;  4FSF A;  3NBL A;  1BLS A;  1PZP A;  5DF9 A;  3IWI A;  3M2K A;  4R3J A;  3G35 A;  1FOF A;  3GQZ A;  3NDE A;  5FAQ A;  3N7W A;  3MZD A;  4X53 A;  2ZC7 A;  5CHU A;  3DWK A;  4M3K A;  2WK0 A;  1MKI A;  3FYZ A;  5DF8 A;  1OME A;  3HUN A;  3G2Y A;  2WGW A;  3ZG7 B;  3GRJ A;  2R9W A;  2DCF A;  2ZC4 B;  5EOO A;  4KG2 A;  2IWD A;  5D3O A;  1RP5 A;  1JWV A;  3BLM A;  4Y0U A;  1MWU A;  3O3V A;  4GZB A;  4OPR A;  4GDB A;  3LO7 A;  4P0M A;  3Q7Z A;  1ONH A;  4LCL A;  4X56 A;  1YLW A;  3WS5 A;  5I94 A;  2OLV A;  2WKE A;  5FQ9 A;  1GCE A;  1L2S A;  3LY4 A;  2Y59 A;  1O7E A;  1YLZ A;  2EXB A;  3ZHH A;  3PBQ A;  5F1F A;  3BYD A;  4E3L A;  1MWR A;  2WYX A;  5HAP A;  1FR1 A;  1K57 A;  1K57 C;  4O7D A;  4S2O A;  5EVI D;  4QJG A;  2JBF A;  4RYE A;  3UPP A;  3OCL A;  3W4O A;  4Y7P A;  3C7U A;  2ZQ8 A;  4N9K A;  4PPR A;  4R4R A;  4X55 A;  2WKI A;  5JYO A;  3B3X A;  5E2G A;  3UDX A;  3IF6 B;  3A3I A;  3S22 A;  2ZM0 A;  2QPN A;  4OPZ A;  3AGE A;  5DVA A;  2HPB A;  5F1G A;  5CHJ A;  1KDW A;  3Q07 A;  4QB8 A;  4U0T A;  2WGI A;  1K6S A;  4OPY A;  1H8Y A;  4JBF A;  4OPQ A;  4NK3 A;  4S2N C;  4S2N A;  4ZTK A;  3S4X A;  3MKF A;  3ITA A;  3OC2 A;  5FAP A;  5FQK A;  4IVI A;  1N9B A;  3OCN A;  3HUO A;  3EQV A;  2ZM2 A;  2J7V A;  3LEZ A;  1W8Y A;  4KZ3 A;  1NXY A;  2X71 A;  5FAO A;  3UN7 A;  5KSC A;  4OOL A;  4GOG A;  4QD4 A;  3UY6 A;  3Q1F A;  1SKF A;  5GLD A;  1NJ4 A;  2P74 A;  4S2J A;  3DW0 A;  3AGD A;  1RCJ A;  1TDL A;  1S6R A;  3RXW A;  4LV2 A;  1O07 A;  2EX9 A;  4WEL A;  5E2E A;  3HLF A;  4DDS A;  4N9L A;  2H10 A;  3BFD A;  4S2M A;  3VP2 A;  1ZG6 A;  4CJN A;  4DE2 A;  3MXR A;  5DTK A;  4Q8I A;  4C6Y A;  1M6K A;  3WS0 A;  4U3T A;  1ZKJ A;  3PTE A;  4JKT A;  2PBY A;  5GHY A;  4BL3 A;  2XH9 A;  1ES3 A;  3LY3 A;  4XXR A;  2WAF A;  4MBK A;  3BFC A;  5GL9 A;  4Z9Q A;  2QMI A;  2HDS A;  3IF6 A;  2EX2 A;  1I2W A;  4GKU A;  4KZ9 A;  4UA6 A;  3VP1 A;  3N8L A;  4K0W A;  2IWB A;  2WGW B;  3N4I A;  5GHZ A;  1LHY A;  4DXB A;  5FQJ A;  3NY4 A;  4KZ6 A;  3ZVW A;  1ES5 A;  3QNB A;  4D2O A;  5CGS A;  5L2F A;  3GR2 A;  3PAG A;  3O88 A;  4FD8 A;  1SDE A;  4E3I A;  3NI9 A;  5GLB A;  3GSG A;  2WUQ A;  1K25 A;  4E3K A;  4CPK A;  2ZQ9 A;  3QNC A;  1NRF A;  2PU4 A;  4KZ8 A;  5U47 A;  1W79 A;  1MY8 A;  3ZNY A;  3MZE A;  1CEG A;  1K54 A;  1K54 C;  1KE3 A;  1XP4 A;  2WKH A;  2FFY A;  4KZ5 A;  5DTS A;  3C5A A;  4OOM A;  3BEC A;  1XA1 A;  3EQU A;  2ZQC A;  1JWP A;  4DXC A;  3V5M A;  4EWF A;  5GLC A;  1CI8 A;  1YM1 A;  5FI6 A;  4MNR A;  3GTC A;  3GV9 A;  3VMA A;  5CER A;  1IYO A;  3I7J A;  4E6X A;  2Y2H A;  4R3B A;  4E3J A;  3QHY A;  2ZQ7 A;  3E2K A;  3IF5 A;  4MEZ A;  4HEF A;  3BEB A;  4EV4 A;  4OOY A;  4B88 A;  4QU3 A;  3ISG A;  1DJB A;  4R23 A;  3SS5 A;  2E8I A;  1DJA A;  5HAR A;  1JTD A;  1YLT A;  1HTZ A;  1E4D A;  3M6B A;  3VOY A;  2ZC6 B;  4K91 A;  4X6T A;  3UNW A;  3ZG5 A;  5KZH A;  3G32 A;  5A90 A;  1FR6 A;  1FSY A;  1K4F A;  5EOE A;  4ZJ2 A;  1I2S A;  4JF5 A;  4LV0 A;  3BRM A;  1HZO A;  3C4O A;  1FQG A;  2Z2L B;  2DNS A;  1WYC A;  3IT9 A;  3HLE A;  2Y2N A;  5EUA A;  1G68 A;  4Y0T A;  4JPM A;  2HDR A;  2V2F F;  2V20 A;  4OVD A;  2V1Z A;  5FAT A;  1K6R A;  4IVK A;  2EFX A;  2PU2 A;  4IED A;  3NC8 A;  1NYM A;  3VSL A;  3UE1 A;  4HBT A;  3V3R A;  4WZ5 A;  4WZ5 C;  3SH8 A;  4E3M A;  1H8Z A;  3RJU A;  4JF4 A;  1I5Q A;  2XD5 A;  3WS2 A;  5A93 A;  4ZBE A;  5FQM A;  4WEK A;  1K4E A;  5TGF A;  5CXW A;  1LL9 A;  3CG5 A;  3DTM A;  1FCN A;  1PIO A;  4R1G A;  5E43 A;  4UHU A;  5IHV A;  4KZB A;  3ZFZ A;  3FWL A;  2XLN A;  4B4Z A;  3C7V A;  1J9M A;  5FSR A;  3TG9 A;  5TR7 A;  3V50 A;  1U60 A;  1YMS A;  5J8X A;  3HRE A;  3IXH A;  4OON A;  4E3O A;  3OZH A;  5CRF A;  4KZ7 A;  3S1Y A;  3HLB A;  5HAI A;  3LCE A;  1FCM A;  2J9O A;  3MZF A;  3UDI A;  2VGJ A;  2XD1 A;  1KGE A;  3SOI A;  3BFG A;  1WYB A;  2EX6 A;  4KG5 A;  1IEL A;  4BL2 A;  4FCF A;  3D4F A;  4A5R A;  2C5W B;  1W7F A;  3A3F A;  4UA9 A;  2OV5 A;  1MPL A;  5HL1 A;  1PI4 A;  4N92 A;  1K38 A;  4MLL A;  4KQQ A;  3ZDJ A;  1PYY A;  4DDY A;  2JC7 A;  1BTL A;  4BD0 A;  4OQI A;  2Z2M B;  4QY6 A;  2R9X A;  3WRT A;  3NDG A;  3TSG A;  5FAS A;  2XFS A;  1CK3 A;  2QZ6 A;  3ZGA B;  1HVB A;  1IYS A;  3UDF A;  4ZDX A;  1KGF A;  2ZMA A;  1PWG A;  4IBX A;  5AQ7 A;  5CED A;  1IEM A;  4GD6 A;  1KGG A;  1GA0 A;  1L0F A;  3G2Z A;  3IH8 A;  2J9P A;  3TOI A;  1YLY A;  1NZO A;  2Y2J A;  3UO9 A;  4NET A;  1PW8 A;  3A3E A;  3Q7V B;  5TFQ A;  3ITB A;  2RL3 A;  1KVL A;  5HX9 A;  1TEM A;  2I72 A;  2BLS A;  3ZG0 A;  2WZZ A;  4RVA A;  5A92 A;  2ZC3 B;  1L0E A;  3HVF A;  3AGF A;  4S2K A;  1ES4 A;  3SH9 A;  2EX8 A;  4HES A;  3ZCZ A;  1E3U A;  2Y2O A;  3IH9 A;  3OPH A;  3PBS A;  1ES2 A;  4GNU A;  3ZG8 B;  1WE4 A;  1H5X A;  1PWD A;  1TDG A;  1VQQ A;  5KSH A;  1K56 A;  3VP0 A;  4XUZ A;  1IKG A;  3N8S A;  3N6I A;  4DE3 A;  1HD8 A;  5M1A A;  5BOH A;  1FCO A;  4QY5 A;  1MBL A;  1ERO A;  1GHM A;  4JXG A;  2JCH A;  3IXD A;  1JWZ A;  4KEN B;  2H5S A;  4KZ4 A;  3E2L A;  1YQS A;  5G18 A;  2ZLY A;  3VP4 A;  3ZNT A;  2XF3 A;  1BLH A;  1L0D A;  2HDU A;  3Q82 A;  4R0Q A;  2UWX A;  3PBT A;  3WS1 A;  1XKZ A;  5EVI A;  3C4P A;  5EVI C;  4KG6 A;  3Q81 A;  2XFT A;  4GN2 A;  4OP5 A;  4Y0O A;  4S2I A;  5GHX A;  4DRT A;  2WAE A;  1MXO A;  4UA7 A;  3VFF A;  4UAA A;  1BT5 A;  3A3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...