4UHUA

W229d mutant of the last common ancestor of gram-negative bacteria (gnca) beta-lactamase class a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADDRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GNCA LACTAMASE W229D
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
total genus 99
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4uhuA00
4Y0OA 4IEDA 4DE0A 4LENA 4N9KA 5BOHA 5DF9A 3V5MA 4EWFA 1CK3A 4JF5A 5F1GA 1GHIA 4Y0UA 1K54A 3D4FA 5CGSA 4QY6A 1FCOA 3GSGA 4OKPA 5CTMA 3HLGA 4OVDA 1H8YA 1YLWA 5FQKA 1MXOA 3HUOA 5FI2A 4P85A 3S22A 3HLFA 1GCEA 3N8RA 1BSGA 1JWVA 3HLBA 4B4XA 1MWTA 4IVIA 3A3JA 4ZJ1A 5M19A 4R0QA 3VFHA 2X01A 2BLSA 5GLDA 3VP4A 4YFMA 4EBPA 2WKHA 3Q07A 4KENB 5JYOA 4BL3A 1RP5A 4JF6A 4OOMA 1IKIA 5EECA 4JXVA 4LCMA 5FQQA 3ZG9B 4O7DA 3O88A 1K56D 4ZDXA 5A93A 5EVIB 1PYYA 5J8XA 3Q7VA 5FAQA 5GLCA 3BFDA 3VSKA 1GHMA 5FA7A 1XXMA 3MKEA 2WGVA 1G68A 1YQSA 2Y59A 3C4OA 4S2PA 1K56A 3V50A 4HBTA 3ZG7B 3ITBA 5A92A 5HX9A 5HFOA 4KZ7A 3M6BA 5CECA 4QD4A 1Y54A 4U3TA 1PWGA 1PZOA 2WK0A 3PAEA 2E8IA 4BQMA 4DDYA 5CEDA 1SDEA 1WE4A 5DF7A 3E2KA 3OPLA 4LV3A 3V3RA 1XP4A 4GDNA 1GHPA 3Q1FA 4PMAA 2Y2OA 5FSRA 3DW0A 3NI9A 3C5AA 5FAOA 3GTCA 2HDUA 5G18A 3G35A 3M2KA 4OPQA 1N9BA 4WZ5C 4UA7A 2WGWA 4HESA 1YLTA 2Y2IA 1SDNA 1KE0A 1NYMA 5DF8A 1XPBA 3P09A 4S2MA 1SCWA 3UO9A 3G34A 3LY4A 3IXGA 4S2JA 1K55C 3ZGAB 3MBZA 4OQIA 2Y2KA 4ID4A 1SHVA 1FR1A 1YMXA 1E25A 2IWCA 4PPRA 4S2KA 4WELA 3AGFA 3MXRA 5CTNA 4DXBA 3ZNTA 4DKIA 2X71A 5FAPA 2ZQCA 2ZMAA 3G30A 4IVKA 4Q8IA 2P74A 4N92A 3ISGA 1NYYA 2XDMA 2BG1A 1M40A 3IXBA 3MXSA 4ZAMA 2XD1A 3FYZA 4HEFA 4XUXA 5AQ9A 5GLAA 4BLMA 1DJBA 3ITAA 1E4DA 3Q81A 5EVIC 3HUMA 3G31A 4WEJA 4MLLA 1XGJA 4JKTA 1BLHA 2XF3A 3FZCA 5DVAA 1KGGA 5DTTA 2WGWB 3SS5A 1PIOA 3HUNA 3ZDJA 5EOOA 4KG2A 1CEGA 3OPHA 2XH9A 3EQUA 3UDIA 3IF5A 3IT9A 1W8QA 1XGIA 5FQJA 1SKFA 1LHYA 1TDLA 4UA9A 3VOYA 4OH0A 1E3UD 2Y2MA 3GRJA 1PI5A 3G2ZA 2ZQDA 4FH4A 5KSCA 1W79A 1NRFA 3BLSA 2A49A 4OLGA 1EWZA 2B5RA 5E43A 1E3UA 1MWRA 5F83A 4X55A 3SOIA 1JTDA 1FCMA 3HLWA 3NY4A 1ES3A 4UA6A 3M2JA 1BZAA 4OP8A 4GOGA 4KZ9A 5TGFA 5U47A 4R3BA 1XA7A 2R9XA 1FQGA 2OSUA 4MBKA 3IXDA 5E2HA 1XKZA 2EX6A 1YLZA 4U0TA 4CPKA 2Y2QA 3VFFA 5HARA 5KSHA 3VP0A 2QZ6A 3N8SA 4PM9A 4X53A 3A3FA 5AQ7A 1YMSA 3PBQA 4E6XA 4WM9A 3VMAA 4S2IA 2HDQA 3BFEA 3CG5A 3UPOA 5KZHA 2WAFA 4A5RA 1L0FA 4X68A 1K57A 2PBYA 1L0EA 1XA1A 5F82A 2G2UA 2ZQ8A 3ZG8B 4NK3A 5FQIA 2DCFA 2XFTA 3OCLA 4FH2A 2P9VB 4XXRA 3SH7A 1Z6FA 3IWQA 4KQQA 4WYYA 2R9WA 1CEFA 3IXHA 1LL9A 3RXXA 3W4PA 3TG9A 3I7JA 5CGXA 3NIAA 4IBXA 2HDSA 1WYCA 3VP3A 2H0YA 4EV4A 2ZC7A 3UDFA 3MZEA 3RJUA 4R4RA 2A3UA 5A91A 5AQBA 3W4QA 2J7VA 5M18A 4U0XA 4ZTKA 2ZC6B 1KGFA 1KGEA 5DTSA 2HDRA 4E3OA 5KMWA 2IWDA 1KE3A 4KQOA 1S0WA 4E3LA 3BYDA 3GV9A 3IF6A 1ZC2A 4E3MA 2WZZA 2G2WA 1KVMA 1TDGA 1NXYA 4ZBEA 4RYEA 3HLCA 3NDGA 4JPMA 5CERA 4E3JA 1ONGA 2EX8A 2J9PA 1TVFA 3OCNA 4KZ4A 4WZ4A 3A3IA 1KDWA 4RX3A 3ZG0A 4S2NA 3NBLA 4OLDA 2ZD8A 3OPPA 2VGJA 5EOEA 4P0MA 4FSFA 1ZG6A 4LV2A 4N9LA 3WS1A 3WWXA 1DJAA 3MKFA 1DJCA 1W7FA 2ZM0A 3ZVWA 1O07A 4DXCA 2I72A 1S6RA 1H5XA 2EFUA 2XEPA 4BENA 3DTMA 4YINA 1RGYA 4L0LA 1C3BA 3W8KA 2WZXA 2C5WB 5M1AA 2Y2PA 3Q7VB 2RCXA 3ZHHA 5D3OA 4BL2A 1FSWA 2Y2NA 3IQAA 4JXSA 1LI9A 3GMWA 2XK1A 2RL3A 3JYIA 4JLFA 4OONA 3TOIA 3C7UA 3EQVA 4E3IA 4EBNA 5FATA 3UPNA 4K0WA 1VM1A 1MKIA 1BLCA 3IH9A 3VP1A 1PW1A 2VGKA 3QHYA 3HL9A 3N8LA 3SH9A 3UNWA 4DE2A 3IWIA 2ZM2A 3QNCA 3ZNYA 3MZFA 4MNRA 3IHAA 1M6KA 4QY5A 3Q82A 2JE5A 4PM7A 3DWZA 2V2FF 2JC7A 4RX2A 1KDSA 4BJPA 3BECA 1DY6A 1PZPA 1K54C 3HLEA 4K0XA 3VOZA 1IELA 3UE1A 4BD0A 4GB7A 4MEZA 4C3QA 1AXBA 4R3JA 1EI5A 3A3DA 5TR7A 3UDXA 1EROA 2Y2JA 2WAEA 5IHVA 1NJ4A 5FASA 4GDBA 4M3KA 1J9MA 1I2SA 1MY8A 3QNBA 3OZHA 3S4XA 5GL9A 3PBNA 4K91A 5E2FA 1ESIA 4MBHA 1L0GA 1BUEA 3O87A 4B4ZA 3E2LA 3OC2A 3ZCZA 4JXGA 1I5QA 1ES5A 4EUZA 4LV0A 1XX2A 3VP2A 3UE3A 3HREA 3IWOA 2V20A 1HD8A 4OP5A 3PBTA 1RGZA 1U60A 4X69A 3HLDA 2PU4A 4ZJ2A 2Z2MB 2EXBA 4KZ5A 4PM8A 3V3SA 1G6AA 4C6YA 4OQHA 4H8RA 1Q2QA 1LLBA 2PU2A 3BEBA 3LO7A 2XD5A 3LEZA 5GLBA 4CJNA 3NCKA 5L2FA 1K38A 2XFSA 1HTZA 2EFXA 3N4IA 1CI8A 4BD1A 3UPPA 2Z2LB 4OPYA 1FOFA 3B3XA 2EX2A 3IHBA 4S2LA 2FFFB 1YLYA 1YLPA 3NC8A 4KZ6A 3LY3A 2Q9MA 4OPZA 3C7VA 4PM6A 1QMEA 3BRMA 2J8YA 3WRZA 4GD6A 1RCJA 3N6IA 4DE1A 4DF6A 1JWZA 2WADA 2Y91A 3PAGA 4XUZA 5FI7A 1NY0A 2Y2GA 5EVIA 1KE4A 5FQMA 3M6HA 4DDSA 3G2YA 4E3NA 2ZLYA 2ZC5B 4UHUA 4QJGA 4N1XA 1BLPA 1MBLA 2QPNA 3SS3A 2JCHA 1BLSA 3PTEA 4R23A 2XGNA 5E2EA 3G32A 5CXWA 2XQZA 4OQGA 3GQZA 1IKGA 5FQ9A 4UAAA 5AQAA 4GZBA 1FCNA 1L2SA 1PI4A 2V1ZA 3OPRA 4KZ8A 4OOLA 4D2OA 4Y0TA 2UWXA 1JWPA 1WYBA 1ERMA 3GVBA 2OLVA 5F1FA 5EE8A 2ZC4B 2Q9NA 3HVFA 3P98A 4KQRA 5TFQA 1NZOA 2QMIA 1YLJA 3PBOA 1K25A 4WMCD 3WS2A 1Q2PA 3FWLA 2J9OA 3NDEA 2FFYA 1YM1A 5EUAA 5A90A 3ZVTA 5HAIA 4WMCA 5CHMA 3CMZA 2ZQ9A 1BT5A 2X02A 3UE0A 5CGWA 4FCFA 3SS4A 4E3KA 5JYPA 4R4SA 4B88A 3Q7ZA 4GKUA 5EVLA 2XR0A 3GR2A 5HAQA 1JVJA 2WGIA 4Y7PA 3WS4A 1ZG4A 2ZQ7A 3FKVA 3ZG5A 1ES4A 1JTGA 1LI0A 2Y55A 4OPRA 3IF6B 1HVBA 1ZKJA 2CC1A 1N4OA 2H5SA 1OMEA 1L0DA 3S1YA 3WS0A 4C75A 4KZBA 1IYOA 1LL5A 1K4EA 4WEKA 1MWUA 5GHXA 3IH8A 3UY6A 4DE3A 1QMFA 5FI6A 2ZM8A 4PM5A 2WKEA 1ALQA 1BTLA 1PW8A 3MFDA 2DRWA 1MPLA 4P87A 4QB8A 1PWDA 4KG5A 1CI9A 4ZJ3A 2HP6A 1I2WA 4QHCA 4EBLA 3CZDA 1IYQA 3FKWA 4GNUA 1GA9A 1TEMA 3N7WA 3CJMA 1IYPA 4X6TA 5CHUA 1BULA 1K6RA 2Y2LA 2WUQA 1MWSA 1K57C 2DNSA 5EPHA 4MBFA 2HPBA 2ZC3B 2HP5A 5GHZA 3BM6A 4GN2A 4RA7A 4IBRA 4JBFA 1NZUA 3WRTA 1GA0A 4LV1A 1W5DA 3ZFZA 3HBRA 4KG6A 4WBGA 5HAPA 2WYXA 1ONHA 3C4PA 3AGEA 1IYSA 3O3VA 2OV5A 3V39A 3O86A 1PWCA 5HL1A 4KZAA 5CHJA 3DWKA 3BFGA 3PBRA 3G4PA 1HZOA 4HBUA 4LCLA 5CEBA 1FSYA 4E6WA 5FDHA 2ZQAA 4R1GA 5DTKA 2HP9A 4F94A 4GD8A 2EXAA 3TSGA 3W4OA 4Z9QA 1K4FA 2GDNA 4QU3A 5CRFA 3IF6C 2ZJ9A 4KZ3A 2OLUA 4RVAA 4JXWA 4EQIA 2H10A 4WZ5A 1FR6A 5HW3A 3FV7A 1ERQA 2P9VA 3LCEA 2WKIA 4X56A 3SH8A 1VQQA 3A3EA 3BLMA 3UN7A 5I94A 1O7EA 1YT4A 3MZDA 2IWBA 3VSLA 2JBFA 1K55A 3BFFA 4OQ0A 5GHYA 1ES2A 4N1HA 1H8ZA 2EX9A 1ESUA 4JF4A 4P6BA 4S2NC 3PBSA 1K6SA 5E2GA 2C6WB 4DRTA 4NETA 4OOYA 3WS5A 3BFCA 4S2OA 1IEMA 2Y2HA 1W8YA 2Y4AA 3AGDA 2XLNA 2H0TA 5EVID 4FD8A 3RXWA 1KVLA
chains in the Genus database with same CATH superfamily
3PXPA 5BOHA 5DF9A 4EWFA 5F1GA 1UGUA 1GHIA 2O9CA 1K54A 2W3FA 2O0YA 5CGSA 4QY6A 3GSGA 4OVDA 1YLWA 1OJ5A 1AWIA 3H7WA 4B4XA 5L8MA 4JGOA 3VFHA 2X01A 2BLSA 3VP4A 1JNUA 1XJ2A 4L9GA 4YFMA 5A8BA 4KENB 2D01A 3UB5P 1RP5A 2VZWA 3IBJA 1IKIA 5EECA 3TE8A 4LCMA 1OJGA 4O7DA 1K56D 3H82B 5FAQA 1GHMA 4Y5FA 3T4OA 3T4SA 4WLAA 1G68A 4HBTA 3ZG7B 5A92A 4EU0A 2PD8A 4KZ7A 2QKPA 1DP6A 3DTEA 3C8CA 4WF0A 1XP4A 3L9KA 3Q1FA 4PMAA 1OT9A 5FAOA 3GTCA 2AVXA 2V1BA 3G35A 2WGWA 4HESA 1YLTA 2ZOIA 5DF8A 5CX7A 3LY4A 4S2JA 4OQIA 3NJAA 1YMXA 1E25A 3UE6A 2ZQCA 1TS7A 4F3LA 4Q8IA 2I9VA 4LGWA 4XUXA 5GLAA 1DJBA 3HUMA 1SKOA 4LLOB 4JKTA 2XF3A 3FZCA 3O5YA 1KGGA 3ZDJA 3SS5A 1NRJA 1CEGA 4EETB 4L9FA 3VOYA 4MDZA 4NXEA 3T50A 3MQOA 1W79A 2W3EA 1EWZA 2PD7A 5E43A 1GSXA 4X55A 3SOIA 1FCMA 3HLWA 1BZAA 3F1OA 4KZ9A 4OP8A 5U47A 2OSUA 3NOUC 3IXDA 4Q0JA 3IS2B 4CPKA 3CHWP 3A3FA 5AQ7A 1YMSA 3BFEA 3D9YA 2XA7S 2WAFA 4GW9A 1T1CA 4A5RA 5KZHA 3ZG8B 4NK3A 5FQIA 1IOUA 1IFQA 1LL9A 1OTBA 3MF0A 2UV0E 3I7JA 3W2ZA 3VP3A 2VJWA 4NG2A 3EGDC 5DTSA 1KGEA 1XJ4A 2VV6A 4KUKA 1S0WA 4E3LA 3BYDA 3GV9A 3IF6A 5HD5A 3E4PA 1G6OA 1TDGA 4ZBEA 3F1PA 2JKTM 4RYEA 4CLCC 5CERA 5FEFA 4E3JA 3OCNA 4KZ4A 3A3IA 1KDWA 4RX3A 2J3TD 5IU1A 1NLYA 3MS6A 4FSFA 3MSHA 1G28A 4HNBA 4HJ3A 1W7FA 1O07A 3LR4A 2XEPA 1G5UA 3BY9A 4LRXC 2HGVA 4YOFA 2C5WB 2Y2PA 3Q7VB 2RCXA 3GECA 3RFBA 3IQAA 1LI9A 2W1RA 3C7UA 4E3IA 4EQ1A 3LI9A 3N8LA 3SH9A 4DE2A 3ZNYA 2M1CA 5F69A 3IHAA 4QY5A 5L07A 1DY6A 1K54C 3T4TA 1YPRA 4II7A 3UDXA 1NJ4A 4M3KA 1MY8A 1ESIA 2W1TA 5K5BA 2XROA 3K2NA 3E2LA 3ZCZA 4JXGA 1ES5A 3E0YA 3HREA 4JGRA 4X69A 4CLCE 2PU4A 2EXBA 4HP4A 2O9BA 4C6YA 5HWWA 4H8RA 5TJJA 2ZMVA 3LO7A 5GLBA 3NCKA 1K38A 3CLOA 4MMNA 3E98A 3UPPA 1FOFA 2K7SA 4KZ6A 3BRMA 1N9NA 1V9YA 3CPTB 2P08A 4DF6A 1N9LA 5FI7A 3MQQA 1FIKA 1KE4A 5FQMA 3KSGA 2ZLYA 3BWLA 1MBLA 2QPNA 2XGNA 5CXWA 4OQGA 5FQ9A 2EWVA 4UAAA 3T4KA 5AQAA 4GZBA 4R38A 4KZ8A 4Y0TA 2UWXA 4P6ZM 5F1FA 5EE8A 3P98A 1NZOA 1YLJA 4PKYA 2BASA 1BT5A 1LSXA 4E3KA 2LB5A 5HAQA 3WS4A 4EUVA 3FKVA 3ZG5A 1ES4A 4X1MA 2EWWA 1L0DA 3WS0A 1IYOA 4WEKA 1K4EA 3KO6A 1MWUA 2ZL1B 4DE3A 4PM5A 3MFDA 4QB8A 4EEPA 4GNUA 1GA9A 1TS0A 4HIAA 5CHUA 4X6TA 1SZVA 1BULA 2Y2LA 3DAVA 2ZBBA 4R70A 5GHZA 4RA7A 1P97A 4B9OA 1NZUA 3HBRA 4WBGA 5HAPA 2XSSA 3AGEA 1PWCA 4HJ6A 4KZAA 2K2NA 3DWKA 4HBUA 3IS2A 1XFNA 4O01A 2DMWA 1P9RA 1VHMA 2EXAA 2YKFA 3TSGA 2GDNA 3IF6C 5KIZA 4KZ3A 4RVAA 4EQIA 4FTXA 1ZHHB 3QP2A 2WKIA 3SH8A 1VQQA 3A3EA 3UN7A 5I94A 1O7EA 1YT4A 4I39A 2VKSA 2JBFA 5GHYA 4OQ0A 3QP5A 1H8ZA 5E2GA 1HLUP 4PKYG 3AGDA 2H0TA 5EVID 3S7PA 3RXWA 3MFXA 4Y0OA 4N9KA 3VE3A 4HH2A 4Y0UA 4OKPA 5CTMA 3BQAA 3U2AA 2V0UA 4P85A 1GCEA 3HLBA 1JWVA 4HHDA 3LIFA 4IVIA 3A3JA 5M19A 4R0QA 2PRFA 3U4LP 4ZDXA 5A93A 3LIBA 5EVIB 1PYYA 3Q7VA 4H6JB 3MKEA 2WGVA 3V50A 3E4QA 5HFOA 1Y28A 5CECA 2HJ9C 1Y54A 1PWGA 5HPIA 4LV3A 5FSRA 3DW0A 3C5AA 3M2KA 1YSQA 4OPQA 4ME4A 4UA7A 3KX0X 1KE0A 1NYMA 1SCWA 3UB7A 3IXGA 3OBFA 1PNEA 3LIDA 2KX6A 2IWCA 2W3HA 2V1AA 4DKIA 2X71A 1DRMA 5FAPA 2ZMAA 1NYYA 2XDMA 3WS2A 1M40A 4BLMA 3FYZA 4HEFA 2PR5A 3ITAA 2EA9A 2INWA 3G31A 4WEJA 1XGJA 5DVAA 5J4EA 5DTTA 3R7WB 4E04A 3UDIA 2XH9A 3EQUA 2XRNA 1SKFA 1EW0A 2GX5A 2JN7A 1E3UD 3QP6A 3GRJA 2VV7A 5FEGA 4FH4A 1NRFA 1MWRA 3NY4A 4GOGA 4R3BA 1FQGA 3EOIA 4MBKA 5E2HA 3D72A 1D1JA 1YLZA 4U0TA 3VFFA 5DFXA 5HARA 3VP0A 4ETZA 3BY8A 3N8SA 4PM9A 4E6XA 4S2IA 3CG5A 1L0FA 5DJUA 4NXBA 1K57A 1L0EA 1XA1A 5F82A 2G2UA 2XFTA 1NWZA 4FH2A 3SH7A 1Z6FA 1CEFA 5CGXA 2QWSA 2HDSA 2H0YA 4EV4A 2ZC7A 1TD5A 4R4RA 4IUKA 2H28A 5AQBA 5M18A 1KGFA 3S7OA 1KE3A 4KQOA 3T1XA 1ZC2A 4E3MA 2WZZA 2G2WA 1KVMA 2QJ7A 3CAXA 4JPMA 3UB8A 2ZL1A 4UQIM 1W63Q 4LRZE 1TVFA 2Z6CA 1S1YA 2L0WA 3NBLA 2Y79A 2NUTC 4LV2A 3WS1A 3MKFA 2ZM0A 3K3DA 1H5XA 4YWZA 4BENA 1RGYA 3K3CA 1XJ6A 2HZ5A 2WZXA 3W8KA 5M1AA 3P01A 3ZHHA 3T4LA 2XK1A 1L3LA 4JLFA 4OONA 4K0WA 1VM1A 5EM1A 5HDSA 1BLCA 3IH9A 1OTDA 2ZM2A 4MNRA 2JE5A 2LB9A 3DWZA 2V2FF 1KDSA 3HLEA 3UE1A 2OAQ1 4MEZA 3IX4A 4C3QA 4BWIA 3A3DA 2Y2JA 2WAEA 5IHVA 4GDBA 3A0RA 3OZHA 3GDIA 1UWPX 2VGLM 4K91A 5E2FA 1L0GA 4LV0A 1XX2A 3VP2A 3UE3A 3IWOA 1HD8A 3PBTA 1U60A 3HLDA 1VB6A 4MN7A 2ZOHA 4OQHA 4GS9A 5G4ZA 1LLBA 3BEBA 4ESPA 5L2FA 3LEZA 3JVVA 2EFXA 3N4IA 4OPYA 2OOLA 4S2LA 2J3TC 3LY3A 4XT2A 4PM6A 2W3GA 3WRZA 3N6IA 1JWZA 1KOUA 5FL3A 2Y91A 3PAGA 2Y2GA 3T4QA 5EVIA 3M6HA 1BLSA 3GQZA 2PHYA 3EEAA 4WN5A 1FCNA 2V1ZA 4D60A 1JWPA 3GVBA 2O99A 3DTIA 2Q9NA 4KQRA 5TFQA 2PDRA 2P7JA 4WMCD 3NDEA 2PR6A 1TS6A 3ZVTA 2GNXA 2X02A 3UE0A 3SS4A 4B88A 3Q7ZA 3GR2A 2WGIA 2ZQ7A 3T12B 1F2KA 2H5SA 4NEED 1QMFA 1ALQA 4P87A 1MPLA 1D06A 5HD3A 4KG5A 1CI9A 3R7WA 3FKWA 1IYQA 2KLIA 1IYPA 1S4RA 1MWSA 1K57C 3MJQA 5EV0A 5EPHA 4MBFA 2HPBA 1KVLA 1K0KA 4HY8A 2HP5A 3LIEA 4GN2A 4CLCD 2A2LA 2V0WA 3B42A 4JBFA 4KQDA 1GA0A 3NULA 3DBAA 4K08A 3FG8A 3V39A 3O86A 5CHJA 4R3AA 2FH5A 5FDHA 1H0MA 1ODVA 5DTKA 5HWTA 2HP9A 3RH8B 2KDKA 3EGXC 1T19A 4Z9QA 5CRFA 2VEAA 4JXWA 2H10A 1CQAA 5HL6A 2L4RA 3LCEA 4X56A 5EVEA 1ES2A 2EX9A 1ESUA 4JF4A 2C6WB 4I3JA 4DRTA 2Y2HA 1W8YA 3LI8A 4FD8A 3KYZA 4DE0A 2VA0A 4LENA 1GSWA 3H82A 3NHQA 2JKRM 1FCOA 4HH3A 2VV8A 3HUOA 3CUEA 3S22A 3HLFA 3N8RA 1BSGA 1CF0A 4ZJ1A 2GJ3A 3IX3A 5GLDA 3EWKA 4EBPA 2WKHA 3B47A 3ZG9B 3O88A 5J8XA 5GLCA 3BFDA 3VSKA 3C4OA 1YQSA 1K56A 5IT5A 5HWVA 1P0ZA 3ITBA 5HX9A 3M6BA 3EEHA 4U3TA 1PZOA 2WK0A 3E2KA 1LL8A 1OPXA 3V3RA 2JKTI 1GHPA 2Y2OA 3LR3A 2HDUA 3C30A 2B18A 4NXGA 3UB6A 3QP4A 4Q0IA 4DJ3A 4LPZA 1XPBA 4S2MA 2M7UA 1SHVA 1FR1A 4S2KA 4G3WA 4DXBA 2CMNA 3G30A 2P74A 3NOPC 4X25A 4Y13A 3IXBA 3LYXA 3MXSA 2XD1A 4ZAMA 5DJTA 5EVIC 1E4DA 3Q81A 1BLHA 2WGWB 1PIOA 1J3WA 3HUNA 4KG2A 1PRQA 3MR0A 1W8QA 1XGIA 1YKDA 4OH0A 2Y2MA 4Y15A 1PI5A 3G2ZA 2ZQDA 5KSCA 3BLSA 2A49A 4I3AA 4F3LB 2VLGA 4YNRA 5TGFA 5HSQA 1XA7A 2R9XA 2WKRA 2EX6A 4LRYC 2QZ6A 3H9WA 3PBQA 4WM9A 3VMAA 3UPOA 1T1BA 3QP8A 1S67L 3SZTA 2ZQ8A 2DCFA 3JPUA 3OCLA 2WKQA 2P9VB 4XXRA 3IWQA 4KQQA 1VEUB 4IUHA 3IXHA 3W4PA 3TG9A 3NIAA 1WYCA 3F1OB 3ZYTA 3UDFA 3MZEA 2A3UA 5A91A 4BBUA 1MC0A 2IA2A 3W4QA 2J7VA 4U0XA 4ZTKA 2ZC6B 2A24B 5L10A 5DKKA 1NXYA 2JKRI 2XA7M 2MJ6A 2EX8A 4BBVA 3ZG0A 4S2NA 2JKFA 4GHIB 2VGJA 4NKPA 4P0MA 1ZG6A 3WWXA 3ZVWA 4DXCA 1S6RA 2EFUA 4JGPA 3DTMA 4L0LA 1C3BA 2B02A 4JXSA 3GMWA 3T1SA 2RL3A 4Q0HA 4EBNA 1MKIA 3B33A 4HQAA 3VP1A 2VGKA 3QHYA 3UNWA 3IWIA 1M6KA 1YAXA 4PM7A 4BJPA 3BECA 4WL9A 3T4JA 1PZPA 4NXFA 3VE4A 4R3JA 1EROA 1OTAA 4Y2FA 5FASA 3CUEC 3OLOA 1I2SA 3S4XA 5GL9A 3PBNA 2PAVP 4MBHA 3O87A 4B4ZA 3QP1A 3CPTA 1I5QA 3CITA 4EUZA 3C2WA 4OP5A 5EM0A 2QYBA 4ZJ2A 2Z2MB 3KSIA 3V3SA 1G6AA 1Q2QA 3T1RA 4O8GA 3D3OA 4CJNA 4P6ZS 5C5KA 1CI8A 4BD1A 3UMDA 3B3XA 2Y8HA 3IHBA 2FFFB 1YLYA 2J3WA 1YLPA 2P04A 3NC8A 1LSWA 3MXQA 5FDSA 3FPVA 4GD6A 3RTYA 2WADA 2NUPC 4DDSA 2OWJA 4E3NA 4UHUA 1BLPA 3SS3A 5E2EA 3MMHA 1IKGA 3OPRA 4D2OA 1CJFA 1ERMA 2OLVA 1N9OA 3TJZC 3HVFA 2QMIA 3PBOA 1K25A 1Q2PA 2FFYA 1YM1A 2J80A 5EUAA 3CMZA 2ZQ9A 5CGWA 4FCFA 5JYPA 3VV4A 4R4SA 4JGQA 4GKUA 5EVLA 1ZG4A 1XFQA 4Y17A 4O0PA 1JTGA 2CC1A 4GCZA 1N4OA 3E4OA 3S1YA 2GZAA 4MN6A 4KZBA 1LL5A 1S1ZA 5GHXA 3UY6A 5F5YA 2WKEA 1BTLA 1PWDA 3BQ8A 4EBLA 3N7WA 3G6OA 3LICA 2WUQA 3HJKA 3MQ0A 4EW7A 3NOTC 2ZC3B 3BM6A 5F6AA 3KSHA 3WRTA 4LV1A 1W5DA 2WYXA 3C4PA 3PHYA 1IYSA 2OV5A 3S7NA 5HL1A 1MKMA 2PYPA 4B93A 3PBRA 4LCLA 2WKPA 2ZQAA 1T1AA 3KYQA 1GSVA 1F5MA 1VETB 2BTFP 3W4OA 1K4FA 2HV1A 2OLUA 1FR6A 3FV7A 1ERQA 2P9VA 3LUQA 5L09A 1VEUA 2HF6A 2V9AA 4DJ2A 4P6BA 4S2NC 3PBSA 4OOYA 4G3VA 1IEMA 2Y4AA 1OTIA 3NECA 2O9AA 4IEDA 2A24A 4Z1WA 3OOVA 3V5MA 1CK3A 4JF5A 4H6JA 5EFWA 3D4FA 3F1NB 3HLGA 3LR5A 1H8YA 1LT0A 5FQKA 1MXOA 5FI2A 1S4SA 4M4XA 4GHIA 1MWTA 4HI4A 5DFYA 3V67A 1TF1A 3Q07A 1H3QA 5JYOA 4BL3A 4JF6A 2QHKA 4OOMA 4JXVA 5FQQA 5LBRA 4I38A 3FC7A 3IBRA 4ETXA 5FA7A 1XXMA 2Y59A 4S2PA 4R6LA 2KOIA 3KSFA 1STZA 1Y4OA 5HDCA 2L1MA 2OWHA 4QD4A 1UWNX 3PAEA 2E8IA 4BQMA 4DDYA 5CEDA 1SDEA 1WE4A 5DF7A 3OPLA 2G7UA 4GDNA 3DTKA 3NI9A 5G18A 1F98A 1N9BA 4PAUA 4WZ5C 2Z6DA 2Y2IA 1SDNA 1S66L 3P09A 3UO9A 4PHTA 3G34A 2D02A 1K55C 3ZGAB 3MBZA 2Y2KA 4ID4A 4PPRA 4WELA 3VOLA 1W63M 3AGFA 3MXRA 5CTNA 1DP8A 3ZNTA 4IVKA 4N92A 3ISGA 4I3IA 2W0NA 2BG1A 2FZ0A 5AQ9A 4EXOA 5TBMB 4MLLA 5EOOA 1F9IA 4ARZB 3OPHA 3IF5A 3UB9A 1TS8A 4RQ9A 3IT9A 2E8JA 1TDLA 1LHYA 3PYPA 4UA9A 5FQJA 1NLZA 4MN5A 1LSVA 2HJEA 2QJ5A 4MCWA 4OLGA 2B5RA 1E3UA 5F83A 4CLCB 1JTDA 1ES3A 3TRCA 4UA6A 3M2JA 1DP9A 1XKZA 4QWOA 2Y2QA 5KSHA 2R78A 4EEUA 4X53A 5MC7A 2HDQA 4UQIS 4X68A 2PBYA 4HOIA 4HJ4A 4WYYA 2R9WA 3RXXA 3ULFA 1P9WA 1FILA 4IBXA 3RJUA 2JHEA 4DN0A 4EERA 2HDRA 4E3OA 5KMWA 2IWDA 4CQHA 3LEQA 5HZHA 3A0SA 1MZUA 4FUWA 3HLCA 3NDGA 3P7NA 3CWFA 1ONGA 2J9PA 1BYWA 4HP9A 4WZ4A 3KYEA 1OTEA 1D7EA 3H7WB 4OLDA 2ZD8A 4LFUA 3OPPA 5EOEA 5HPFA 4N9LA 1DJAA 1DJCA 4GJ4A 1T18A 3T1QB 2I72A 5J7EA 2W27A 4YINA 2VGLS 4BL2A 5D3OA 1FSWA 2Y2NA 3JYIA 3TOIA 1ACFA 3EQVA 1X0OA 5FATA 3UPNA 1PW1A 3HL9A 3QNCA 2PBDP 3MZFA 1VETA 3Q82A 2V8FA 2JC7A 4RX2A 1A0KA 4K0XA 3VOZA 1IELA 4BD0A 4GB7A 1AXBA 1EI5A 5TR7A 2M7VA 4BMWA 1J9MA 3QNBA 3FPWA 1PFLA 1BUEA 5F68A 4UEYA 3OC2A 2YKHA 2V20A 1RGZA 4WUJA 4PM8A 3F1NA 1SKOB 3LIAA 3IX8A 2PU2A 2XD5A 3BJNA 2XFSA 1HTZA 2PT7A 2Z2LB 2ZMFA 2VX8A 2EX2A 3LGOA 4DMZA 2ACGA 2Q9MA 4OPZA 3C7VA 1QMEA 2J8YA 1RCJA 4DE1A 4XUZA 2W3DA 1NY0A 4EESA 4AFIA 3JVUA 3LR0A 4ZRRA 3G2YA 4GS9B 2ZC5B 4QJGA 4N1XA 1YSPA 2JCHA 3PTEA 2JKGA 4R23A 3G32A 2XQZA 1L2SA 1PI4A 2VK3A 4KUOA 4OOLA 5J3WA 1WYBA 2ZC4B 3HJIA 4XT2B 3FWLA 2J9OA 2V8CA 4FOFA 3BW6A 5A90A 5HAIA 4WMCA 5CHMA 1V9ZA 4Y3IA 3TW8A 2XR0A 1Z09A 5AVFA 5AJGA 1JVJA 4Y7PA 1LI0A 2Y55A 4OPRA 3IF6B 1HVBA 1ZKJA 1OMEA 4C75A 3F1PB 1H8MA 3IH8A 5FI6A 2ZM8A 3ZQ5A 1PW8A 2DRWA 3A0VA 5TBMA 3LFVA 5AVEA 4X1LA 5G4YA 4ZJ3A 3UMEA 2HP6A 1I2WA 4QHCA 3CZDA 3PR6A 4ARZA 2Q0OA 1TEMA 3CJMA 3ICYA 1K6RA 4QPRA 2DNSA 3SW1A 2PYRA 4L9EA 2B95A 4IBRA 3L7HA 4GLQA 3ZFZA 4KG6A 5DKLA 4BBTA 1ONHA 4CLCA 4G3KA 3O3VA 1WA9A 5IS1A 5CEBA 3BFGA 3G4PA 1HZOA 4IJGA 3CI6A 1FSYA 4E6WA 4R1GA 3HCYA 4IHQA 4F94A 4GD8A 4I5SA 4QU3A 1ZTUA 2ZJ9A 3C38A 2OAP1 4WZ5A 5I5LA 5HW3A 1OT6A 3BLMA 5HDDA 3MZDA 2IWBA 3VSLA 1K55A 3BFFA 4N1HA 2K31A 1K6SA 4NETA 3WS5A 3BFCA 3R4KA 1XJ3A 4S2OA 2W1TB 3S7QA 2XLNA 4KZ5A
chains in the Genus database with same CATH topology
4Y0OA 4IEDA 4DE0A 4LENA 4N9KA 5BOHA 5DF9A 3V5MA 4EWFA 1CK3A 4JF5A 5F1GA 1GHIA 4Y0UA 1K54A 3D4FA 5CGSA 4QY6A 1FCOA 3GSGA 4OKPA 5CTMA 3HLGA 4OVDA 1H8YA 1YLWA 5FQKA 1MXOA 3HUOA 5FI2A 4P85A 3S22A 3HLFA 1GCEA 3N8RA 1BSGA 1JWVA 3HLBA 4B4XA 1MWTA 4IVIA 3A3JA 4ZJ1A 5M19A 4R0QA 3VFHA 2X01A 2BLSA 5GLDA 3VP4A 4YFMA 4EBPA 2WKHA 3Q07A 4KENB 5JYOA 4BL3A 1RP5A 4JF6A 4OOMA 1IKIA 5EECA 4JXVA 4LCMA 5FQQA 3ZG9B 4O7DA 3O88A 1K56D 4ZDXA 5A93A 5EVIB 1PYYA 5J8XA 3Q7VA 5FAQA 5GLCA 3BFDA 3VSKA 1GHMA 5FA7A 1XXMA 3MKEA 2WGVA 1G68A 1YQSA 2Y59A 3C4OA 4S2PA 1K56A 3V50A 4HBTA 3ZG7B 3ITBA 5A92A 5HX9A 5HFOA 4KZ7A 3M6BA 5CECA 4QD4A 1Y54A 4U3TA 1PWGA 1PZOA 2WK0A 3PAEA 2E8IA 4BQMA 4DDYA 5CEDA 1SDEA 1WE4A 5DF7A 3E2KA 3OPLA 4LV3A 3V3RA 1XP4A 4GDNA 1GHPA 3Q1FA 4PMAA 2Y2OA 5FSRA 3DW0A 3NI9A 3C5AA 5FAOA 3GTCA 2HDUA 5G18A 3G35A 3M2KA 4OPQA 1N9BA 4WZ5C 4UA7A 2WGWA 4HESA 1YLTA 2Y2IA 1SDNA 1KE0A 1NYMA 5DF8A 1XPBA 3P09A 4S2MA 1SCWA 3UO9A 3G34A 3LY4A 3IXGA 4S2JA 1K55C 3ZGAB 3MBZA 4OQIA 2Y2KA 4ID4A 1SHVA 1FR1A 1YMXA 1E25A 2IWCA 4PPRA 4S2KA 4WELA 3AGFA 3MXRA 5CTNA 4DXBA 3ZNTA 4DKIA 2X71A 5FAPA 2ZQCA 2ZMAA 3G30A 4IVKA 4Q8IA 2P74A 4N92A 3ISGA 1NYYA 2XDMA 2BG1A 1M40A 3IXBA 3MXSA 4ZAMA 2XD1A 3FYZA 4HEFA 4XUXA 5AQ9A 5GLAA 4BLMA 1DJBA 3ITAA 1E4DA 3Q81A 5EVIC 3HUMA 3G31A 4WEJA 4MLLA 1XGJA 4JKTA 1BLHA 2XF3A 3FZCA 5DVAA 1KGGA 5DTTA 2WGWB 3SS5A 1PIOA 3HUNA 3ZDJA 5EOOA 4KG2A 1CEGA 3OPHA 2XH9A 3EQUA 3UDIA 3IF5A 3IT9A 1W8QA 1XGIA 5FQJA 1SKFA 1LHYA 1TDLA 4UA9A 3VOYA 4OH0A 1E3UD 2Y2MA 3GRJA 1PI5A 3G2ZA 2ZQDA 4FH4A 5KSCA 1W79A 1NRFA 3BLSA 2A49A 4OLGA 1EWZA 2B5RA 5E43A 1E3UA 1MWRA 5F83A 4X55A 3SOIA 1JTDA 1FCMA 3HLWA 3NY4A 1ES3A 4UA6A 3M2JA 1BZAA 4OP8A 4GOGA 4KZ9A 5TGFA 5U47A 4R3BA 1XA7A 2R9XA 1FQGA 2OSUA 4MBKA 3IXDA 5E2HA 1XKZA 2EX6A 1YLZA 4U0TA 4CPKA 2Y2QA 3VFFA 5HARA 5KSHA 3VP0A 2QZ6A 3N8SA 4PM9A 4X53A 3A3FA 5AQ7A 1YMSA 3PBQA 4E6XA 4WM9A 3VMAA 4S2IA 2HDQA 3BFEA 3CG5A 3UPOA 5KZHA 2WAFA 4A5RA 1L0FA 4X68A 1K57A 2PBYA 1L0EA 1XA1A 5F82A 2G2UA 2ZQ8A 3ZG8B 4NK3A 5FQIA 2DCFA 2XFTA 3OCLA 4FH2A 2P9VB 4XXRA 3SH7A 1Z6FA 3IWQA 4KQQA 4WYYA 2R9WA 1CEFA 3IXHA 1LL9A 3RXXA 3W4PA 3TG9A 3I7JA 5CGXA 3NIAA 4IBXA 2HDSA 1WYCA 3VP3A 2H0YA 4EV4A 2ZC7A 3UDFA 3MZEA 3RJUA 4R4RA 2A3UA 5A91A 5AQBA 3W4QA 2J7VA 5M18A 4U0XA 4ZTKA 2ZC6B 1KGFA 1KGEA 5DTSA 2HDRA 4E3OA 5KMWA 2IWDA 1KE3A 4KQOA 1S0WA 4E3LA 3BYDA 3GV9A 3IF6A 1ZC2A 4E3MA 2WZZA 2G2WA 1KVMA 1TDGA 1NXYA 4ZBEA 4RYEA 3HLCA 3NDGA 4JPMA 5CERA 4E3JA 1ONGA 2EX8A 2J9PA 1TVFA 3OCNA 4KZ4A 4WZ4A 3A3IA 1KDWA 4RX3A 3ZG0A 4S2NA 3NBLA 4OLDA 2ZD8A 3OPPA 2VGJA 5EOEA 4P0MA 4FSFA 1ZG6A 4LV2A 4N9LA 3WS1A 3WWXA 1DJAA 3MKFA 1DJCA 1W7FA 2ZM0A 3ZVWA 1O07A 4DXCA 2I72A 1S6RA 1H5XA 2EFUA 2XEPA 4BENA 3DTMA 4YINA 1RGYA 4L0LA 1C3BA 3W8KA 2WZXA 2C5WB 5M1AA 2Y2PA 3Q7VB 2RCXA 3ZHHA 5D3OA 4BL2A 1FSWA 2Y2NA 3IQAA 4JXSA 1LI9A 3GMWA 2XK1A 2RL3A 3JYIA 4JLFA 4OONA 3TOIA 3C7UA 3EQVA 4E3IA 4EBNA 5FATA 3UPNA 4K0WA 1VM1A 1MKIA 1BLCA 3IH9A 3VP1A 1PW1A 2VGKA 3QHYA 3HL9A 3N8LA 3SH9A 3UNWA 4DE2A 3IWIA 2ZM2A 3QNCA 3ZNYA 3MZFA 4MNRA 3IHAA 1M6KA 4QY5A 3Q82A 2JE5A 4PM7A 3DWZA 2V2FF 2JC7A 4RX2A 1KDSA 4BJPA 3BECA 1DY6A 1PZPA 1K54C 3HLEA 4K0XA 3VOZA 1IELA 3UE1A 4BD0A 4GB7A 4MEZA 4C3QA 1AXBA 4R3JA 1EI5A 3A3DA 5TR7A 3UDXA 1EROA 2Y2JA 2WAEA 5IHVA 1NJ4A 5FASA 4GDBA 4M3KA 1J9MA 1I2SA 1MY8A 3QNBA 3OZHA 3S4XA 5GL9A 3PBNA 4K91A 5E2FA 1ESIA 4MBHA 1L0GA 1BUEA 3O87A 4B4ZA 3E2LA 3OC2A 3ZCZA 4JXGA 1I5QA 1ES5A 4EUZA 4LV0A 1XX2A 3VP2A 3UE3A 3HREA 3IWOA 2V20A 1HD8A 4OP5A 3PBTA 1RGZA 1U60A 4X69A 3HLDA 2PU4A 4ZJ2A 2Z2MB 2EXBA 4KZ5A 4PM8A 3V3SA 1G6AA 4C6YA 4OQHA 4H8RA 1Q2QA 1LLBA 2PU2A 3BEBA 3LO7A 2XD5A 3LEZA 5GLBA 4CJNA 3NCKA 5L2FA 1K38A 2XFSA 1HTZA 2EFXA 3N4IA 1CI8A 4BD1A 3UPPA 2Z2LB 4OPYA 1FOFA 3B3XA 2EX2A 3IHBA 4S2LA 2FFFB 1YLYA 1YLPA 3NC8A 4KZ6A 3LY3A 2Q9MA 4OPZA 3C7VA 4PM6A 1QMEA 3BRMA 2J8YA 3WRZA 4GD6A 1RCJA 3N6IA 4DE1A 4DF6A 1JWZA 2WADA 2Y91A 3PAGA 4XUZA 5FI7A 1NY0A 2Y2GA 5EVIA 1KE4A 5FQMA 3M6HA 4DDSA 3G2YA 4E3NA 2ZLYA 2ZC5B 4UHUA 4QJGA 4N1XA 1BLPA 1MBLA 2QPNA 3SS3A 2JCHA 1BLSA 3PTEA 4R23A 2XGNA 5E2EA 3G32A 5CXWA 2XQZA 4OQGA 3GQZA 1IKGA 5FQ9A 4UAAA 5AQAA 4GZBA 1FCNA 1L2SA 1PI4A 2V1ZA 3OPRA 4KZ8A 4OOLA 4D2OA 4Y0TA 2UWXA 1JWPA 1WYBA 1ERMA 3GVBA 2OLVA 5F1FA 5EE8A 2ZC4B 2Q9NA 3HVFA 3P98A 4KQRA 5TFQA 1NZOA 2QMIA 1YLJA 3PBOA 1K25A 4WMCD 3WS2A 1Q2PA 3FWLA 2J9OA 3NDEA 2FFYA 1YM1A 5EUAA 5A90A 3ZVTA 5HAIA 4WMCA 5CHMA 3CMZA 2ZQ9A 1BT5A 2X02A 3UE0A 5CGWA 4FCFA 3SS4A 4E3KA 5JYPA 4R4SA 4B88A 3Q7ZA 4GKUA 5EVLA 2XR0A 3GR2A 5HAQA 1JVJA 2WGIA 4Y7PA 3WS4A 1ZG4A 2ZQ7A 3FKVA 3ZG5A 1ES4A 1JTGA 1LI0A 2Y55A 4OPRA 3IF6B 1HVBA 1ZKJA 2CC1A 1N4OA 2H5SA 1OMEA 1L0DA 3S1YA 3WS0A 4C75A 4KZBA 1IYOA 1LL5A 1K4EA 4WEKA 1MWUA 5GHXA 3IH8A 3UY6A 4DE3A 1QMFA 5FI6A 2ZM8A 4PM5A 2WKEA 1ALQA 1BTLA 1PW8A 3MFDA 2DRWA 1MPLA 4P87A 4QB8A 1PWDA 4KG5A 1CI9A 4ZJ3A 2HP6A 1I2WA 4QHCA 4EBLA 3CZDA 1IYQA 3FKWA 4GNUA 1GA9A 1TEMA 3N7WA 3CJMA 1IYPA 4X6TA 5CHUA 1BULA 1K6RA 2Y2LA 2WUQA 1MWSA 1K57C 2DNSA 5EPHA 4MBFA 2HPBA 2ZC3B 2HP5A 5GHZA 3BM6A 4GN2A 4RA7A 4IBRA 4JBFA 1NZUA 3WRTA 1GA0A 4LV1A 1W5DA 3ZFZA 3HBRA 4KG6A 4WBGA 5HAPA 2WYXA 1ONHA 3C4PA 3AGEA 1IYSA 3O3VA 2OV5A 3V39A 3O86A 1PWCA 5HL1A 4KZAA 5CHJA 3DWKA 3BFGA 3PBRA 3G4PA 1HZOA 4HBUA 4LCLA 5CEBA 1FSYA 4E6WA 5FDHA 2ZQAA 4R1GA 5DTKA 2HP9A 4F94A 4GD8A 2EXAA 3TSGA 3W4OA 4Z9QA 1K4FA 2GDNA 4QU3A 5CRFA 3IF6C 2ZJ9A 4KZ3A 2OLUA 4RVAA 4JXWA 4EQIA 2H10A 4WZ5A 1FR6A 5HW3A 3FV7A 1ERQA 2P9VA 3LCEA 2WKIA 4X56A 3SH8A 1VQQA 3A3EA 3BLMA 3UN7A 5I94A 1O7EA 1YT4A 3MZDA 2IWBA 3VSLA 2JBFA 1K55A 3BFFA 4OQ0A 5GHYA 1ES2A 4N1HA 1H8ZA 2EX9A 1ESUA 4JF4A 4P6BA 4S2NC 3PBSA 1K6SA 5E2GA 2C6WB 4DRTA 4NETA 4OOYA 3WS5A 3BFCA 4S2OA 1IEMA 2Y2HA 1W8YA 2Y4AA 3AGDA 2XLNA 2H0TA 5EVID 4FD8A 3RXWA 1KVLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y0O A;  4IED A;  4DE0 A;  4LEN A;  4N9K A;  5BOH A;  5DF9 A;  3V5M A;  4EWF A;  1CK3 A;  4JF5 A;  5F1G A;  1GHI A;  4Y0U A;  1K54 A;  3D4F A;  5CGS A;  4QY6 A;  1FCO A;  3GSG A;  4OKP A;  5CTM A;  3HLG A;  4OVD A;  1H8Y A;  1YLW A;  5FQK A;  1MXO A;  3HUO A;  5FI2 A;  4P85 A;  3S22 A;  3HLF A;  1GCE A;  3N8R A;  1BSG A;  1JWV A;  3HLB A;  4B4X A;  1MWT A;  4IVI A;  3A3J A;  4ZJ1 A;  5M19 A;  4R0Q A;  3VFH A;  2X01 A;  2BLS A;  5GLD A;  3VP4 A;  4YFM A;  4EBP A;  2WKH A;  3Q07 A;  4KEN B;  5JYO A;  4BL3 A;  1RP5 A;  4JF6 A;  4OOM A;  1IKI A;  5EEC A;  4JXV A;  4LCM A;  5FQQ A;  3ZG9 B;  4O7D A;  3O88 A;  1K56 D;  4ZDX A;  5A93 A;  5EVI B;  1PYY A;  5J8X A;  3Q7V A;  5FAQ A;  5GLC A;  3BFD A;  3VSK A;  1GHM A;  5FA7 A;  1XXM A;  3MKE A;  2WGV A;  1G68 A;  1YQS A;  2Y59 A;  3C4O A;  4S2P A;  1K56 A;  3V50 A;  4HBT A;  3ZG7 B;  3ITB A;  5A92 A;  5HX9 A;  5HFO A;  4KZ7 A;  3M6B A;  5CEC A;  4QD4 A;  1Y54 A;  4U3T A;  1PWG A;  1PZO A;  2WK0 A;  3PAE A;  2E8I A;  4BQM A;  4DDY A;  5CED A;  1SDE A;  1WE4 A;  5DF7 A;  3E2K A;  3OPL A;  4LV3 A;  3V3R A;  1XP4 A;  4GDN A;  1GHP A;  3Q1F A;  4PMA A;  2Y2O A;  5FSR A;  3DW0 A;  3NI9 A;  3C5A A;  5FAO A;  3GTC A;  2HDU A;  5G18 A;  3G35 A;  3M2K A;  4OPQ A;  1N9B A;  4WZ5 C;  4UA7 A;  2WGW A;  4HES A;  1YLT A;  2Y2I A;  1SDN A;  1KE0 A;  1NYM A;  5DF8 A;  1XPB A;  3P09 A;  4S2M A;  1SCW A;  3UO9 A;  3G34 A;  3LY4 A;  3IXG A;  4S2J A;  1K55 C;  3ZGA B;  3MBZ A;  4OQI A;  2Y2K A;  4ID4 A;  1SHV A;  1FR1 A;  1YMX A;  1E25 A;  2IWC A;  4PPR A;  4S2K A;  4WEL A;  3AGF A;  3MXR A;  5CTN A;  4DXB A;  3ZNT A;  4DKI A;  2X71 A;  5FAP A;  2ZQC A;  2ZMA A;  3G30 A;  4IVK A;  4Q8I A;  2P74 A;  4N92 A;  3ISG A;  1NYY A;  2XDM A;  2BG1 A;  1M40 A;  3IXB A;  3MXS A;  4ZAM A;  2XD1 A;  3FYZ A;  4HEF A;  4XUX A;  5AQ9 A;  5GLA A;  4BLM A;  1DJB A;  3ITA A;  1E4D A;  3Q81 A;  5EVI C;  3HUM A;  3G31 A;  4WEJ A;  4MLL A;  1XGJ A;  4JKT A;  1BLH A;  2XF3 A;  3FZC A;  5DVA A;  1KGG A;  5DTT A;  2WGW B;  3SS5 A;  1PIO A;  3HUN A;  3ZDJ A;  5EOO A;  4KG2 A;  1CEG A;  3OPH A;  2XH9 A;  3EQU A;  3UDI A;  3IF5 A;  3IT9 A;  1W8Q A;  1XGI A;  5FQJ A;  1SKF A;  1LHY A;  1TDL A;  4UA9 A;  3VOY A;  4OH0 A;  1E3U D;  2Y2M A;  3GRJ A;  1PI5 A;  3G2Z A;  2ZQD A;  4FH4 A;  5KSC A;  1W79 A;  1NRF A;  3BLS A;  2A49 A;  4OLG A;  1EWZ A;  2B5R A;  5E43 A;  1E3U A;  1MWR A;  5F83 A;  4X55 A;  3SOI A;  1JTD A;  1FCM A;  3HLW A;  3NY4 A;  1ES3 A;  4UA6 A;  3M2J A;  1BZA A;  4OP8 A;  4GOG A;  4KZ9 A;  5TGF A;  5U47 A;  4R3B A;  1XA7 A;  2R9X A;  1FQG A;  2OSU A;  4MBK A;  3IXD A;  5E2H A;  1XKZ A;  2EX6 A;  1YLZ A;  4U0T A;  4CPK A;  2Y2Q A;  3VFF A;  5HAR A;  5KSH A;  3VP0 A;  2QZ6 A;  3N8S A;  4PM9 A;  4X53 A;  3A3F A;  5AQ7 A;  1YMS A;  3PBQ A;  4E6X A;  4WM9 A;  3VMA A;  4S2I A;  2HDQ A;  3BFE A;  3CG5 A;  3UPO A;  5KZH A;  2WAF A;  4A5R A;  1L0F A;  4X68 A;  1K57 A;  2PBY A;  1L0E A;  1XA1 A;  5F82 A;  2G2U A;  2ZQ8 A;  3ZG8 B;  4NK3 A;  5FQI A;  2DCF A;  2XFT A;  3OCL A;  4FH2 A;  2P9V B;  4XXR A;  3SH7 A;  1Z6F A;  3IWQ A;  4KQQ A;  4WYY A;  2R9W A;  1CEF A;  3IXH A;  1LL9 A;  3RXX A;  3W4P A;  3TG9 A;  3I7J A;  5CGX A;  3NIA A;  4IBX A;  2HDS A;  1WYC A;  3VP3 A;  2H0Y A;  4EV4 A;  2ZC7 A;  3UDF A;  3MZE A;  3RJU A;  4R4R A;  2A3U A;  5A91 A;  5AQB A;  3W4Q A;  2J7V A;  5M18 A;  4U0X A;  4ZTK A;  2ZC6 B;  1KGF A;  1KGE A;  5DTS A;  2HDR A;  4E3O A;  5KMW A;  2IWD A;  1KE3 A;  4KQO A;  1S0W A;  4E3L A;  3BYD A;  3GV9 A;  3IF6 A;  1ZC2 A;  4E3M A;  2WZZ A;  2G2W A;  1KVM A;  1TDG A;  1NXY A;  4ZBE A;  4RYE A;  3HLC A;  3NDG A;  4JPM A;  5CER A;  4E3J A;  1ONG A;  2EX8 A;  2J9P A;  1TVF A;  3OCN A;  4KZ4 A;  4WZ4 A;  3A3I A;  1KDW A;  4RX3 A;  3ZG0 A;  4S2N A;  3NBL A;  4OLD A;  2ZD8 A;  3OPP A;  2VGJ A;  5EOE A;  4P0M A;  4FSF A;  1ZG6 A;  4LV2 A;  4N9L A;  3WS1 A;  3WWX A;  1DJA A;  3MKF A;  1DJC A;  1W7F A;  2ZM0 A;  3ZVW A;  1O07 A;  4DXC A;  2I72 A;  1S6R A;  1H5X A;  2EFU A;  2XEP A;  4BEN A;  3DTM A;  4YIN A;  1RGY A;  4L0L A;  1C3B A;  3W8K A;  2WZX A;  2C5W B;  5M1A A;  2Y2P A;  3Q7V B;  2RCX A;  3ZHH A;  5D3O A;  4BL2 A;  1FSW A;  2Y2N A;  3IQA A;  4JXS A;  1LI9 A;  3GMW A;  2XK1 A;  2RL3 A;  3JYI A;  4JLF A;  4OON A;  3TOI A;  3C7U A;  3EQV A;  4E3I A;  4EBN A;  5FAT A;  3UPN A;  4K0W A;  1VM1 A;  1MKI A;  1BLC A;  3IH9 A;  3VP1 A;  1PW1 A;  2VGK A;  3QHY A;  3HL9 A;  3N8L A;  3SH9 A;  3UNW A;  4DE2 A;  3IWI A;  2ZM2 A;  3QNC A;  3ZNY A;  3MZF A;  4MNR A;  3IHA A;  1M6K A;  4QY5 A;  3Q82 A;  2JE5 A;  4PM7 A;  3DWZ A;  2V2F F;  2JC7 A;  4RX2 A;  1KDS A;  4BJP A;  3BEC A;  1DY6 A;  1PZP A;  1K54 C;  3HLE A;  4K0X A;  3VOZ A;  1IEL A;  3UE1 A;  4BD0 A;  4GB7 A;  4MEZ A;  4C3Q A;  1AXB A;  4R3J A;  1EI5 A;  3A3D A;  5TR7 A;  3UDX A;  1ERO A;  2Y2J A;  2WAE A;  5IHV A;  1NJ4 A;  5FAS A;  4GDB A;  4M3K A;  1J9M A;  1I2S A;  1MY8 A;  3QNB A;  3OZH A;  3S4X A;  5GL9 A;  3PBN A;  4K91 A;  5E2F A;  1ESI A;  4MBH A;  1L0G A;  1BUE A;  3O87 A;  4B4Z A;  3E2L A;  3OC2 A;  3ZCZ A;  4JXG A;  1I5Q A;  1ES5 A;  4EUZ A;  4LV0 A;  1XX2 A;  3VP2 A;  3UE3 A;  3HRE A;  3IWO A;  2V20 A;  1HD8 A;  4OP5 A;  3PBT A;  1RGZ A;  1U60 A;  4X69 A;  3HLD A;  2PU4 A;  4ZJ2 A;  2Z2M B;  2EXB A;  4KZ5 A;  4PM8 A;  3V3S A;  1G6A A;  4C6Y A;  4OQH A;  4H8R A;  1Q2Q A;  1LLB A;  2PU2 A;  3BEB A;  3LO7 A;  2XD5 A;  3LEZ A;  5GLB A;  4CJN A;  3NCK A;  5L2F A;  1K38 A;  2XFS A;  1HTZ A;  2EFX A;  3N4I A;  1CI8 A;  4BD1 A;  3UPP A;  2Z2L B;  4OPY A;  1FOF A;  3B3X A;  2EX2 A;  3IHB A;  4S2L A;  2FFF B;  1YLY A;  1YLP A;  3NC8 A;  4KZ6 A;  3LY3 A;  2Q9M A;  4OPZ A;  3C7V A;  4PM6 A;  1QME A;  3BRM A;  2J8Y A;  3WRZ A;  4GD6 A;  1RCJ A;  3N6I A;  4DE1 A;  4DF6 A;  1JWZ A;  2WAD A;  2Y91 A;  3PAG A;  4XUZ A;  5FI7 A;  1NY0 A;  2Y2G A;  5EVI A;  1KE4 A;  5FQM A;  3M6H A;  4DDS A;  3G2Y A;  4E3N A;  2ZLY A;  2ZC5 B;  4UHU A;  4QJG A;  4N1X A;  1BLP A;  1MBL A;  2QPN A;  3SS3 A;  2JCH A;  1BLS A;  3PTE A;  4R23 A;  2XGN A;  5E2E A;  3G32 A;  5CXW A;  2XQZ A;  4OQG A;  3GQZ A;  1IKG A;  5FQ9 A;  4UAA A;  5AQA A;  4GZB A;  1FCN A;  1L2S A;  1PI4 A;  2V1Z A;  3OPR A;  4KZ8 A;  4OOL A;  4D2O A;  4Y0T A;  2UWX A;  1JWP A;  1WYB A;  1ERM A;  3GVB A;  2OLV A;  5F1F A;  5EE8 A;  2ZC4 B;  2Q9N A;  3HVF A;  3P98 A;  4KQR A;  5TFQ A;  1NZO A;  2QMI A;  1YLJ A;  3PBO A;  1K25 A;  4WMC D;  3WS2 A;  1Q2P A;  3FWL A;  2J9O A;  3NDE A;  2FFY A;  1YM1 A;  5EUA A;  5A90 A;  3ZVT A;  5HAI A;  4WMC A;  5CHM A;  3CMZ A;  2ZQ9 A;  1BT5 A;  2X02 A;  3UE0 A;  5CGW A;  4FCF A;  3SS4 A;  4E3K A;  5JYP A;  4R4S A;  4B88 A;  3Q7Z A;  4GKU A;  5EVL A;  2XR0 A;  3GR2 A;  5HAQ A;  1JVJ A;  2WGI A;  4Y7P A;  3WS4 A;  1ZG4 A;  2ZQ7 A;  3FKV A;  3ZG5 A;  1ES4 A;  1JTG A;  1LI0 A;  2Y55 A;  4OPR A;  3IF6 B;  1HVB A;  1ZKJ A;  2CC1 A;  1N4O A;  2H5S A;  1OME A;  1L0D A;  3S1Y A;  3WS0 A;  4C75 A;  4KZB A;  1IYO A;  1LL5 A;  1K4E A;  4WEK A;  1MWU A;  5GHX A;  3IH8 A;  3UY6 A;  4DE3 A;  1QMF A;  5FI6 A;  2ZM8 A;  4PM5 A;  2WKE A;  1ALQ A;  1BTL A;  1PW8 A;  3MFD A;  2DRW A;  1MPL A;  4P87 A;  4QB8 A;  1PWD A;  4KG5 A;  1CI9 A;  4ZJ3 A;  2HP6 A;  1I2W A;  4QHC A;  4EBL A;  3CZD A;  1IYQ A;  3FKW A;  4GNU A;  1GA9 A;  1TEM A;  3N7W A;  3CJM A;  1IYP A;  4X6T A;  5CHU A;  1BUL A;  1K6R A;  2Y2L A;  2WUQ A;  1MWS A;  1K57 C;  2DNS A;  5EPH A;  4MBF A;  2HPB A;  2ZC3 B;  2HP5 A;  5GHZ A;  3BM6 A;  4GN2 A;  4RA7 A;  4IBR A;  4JBF A;  1NZU A;  3WRT A;  1GA0 A;  4LV1 A;  1W5D A;  3ZFZ A;  3HBR A;  4KG6 A;  4WBG A;  5HAP A;  2WYX A;  1ONH A;  3C4P A;  3AGE A;  1IYS A;  3O3V A;  2OV5 A;  3V39 A;  3O86 A;  1PWC A;  5HL1 A;  4KZA A;  5CHJ A;  3DWK A;  3BFG A;  3PBR A;  3G4P A;  1HZO A;  4HBU A;  4LCL A;  5CEB A;  1FSY A;  4E6W A;  5FDH A;  2ZQA A;  4R1G A;  5DTK A;  2HP9 A;  4F94 A;  4GD8 A;  2EXA A;  3TSG A;  3W4O A;  4Z9Q A;  1K4F A;  2GDN A;  4QU3 A;  5CRF A;  3IF6 C;  2ZJ9 A;  4KZ3 A;  2OLU A;  4RVA A;  4JXW A;  4EQI A;  2H10 A;  4WZ5 A;  1FR6 A;  5HW3 A;  3FV7 A;  1ERQ A;  2P9V A;  3LCE A;  2WKI A;  4X56 A;  3SH8 A;  1VQQ A;  3A3E A;  3BLM A;  3UN7 A;  5I94 A;  1O7E A;  1YT4 A;  3MZD A;  2IWB A;  3VSL A;  2JBF A;  1K55 A;  3BFF A;  4OQ0 A;  5GHY A;  1ES2 A;  4N1H A;  1H8Z A;  2EX9 A;  1ESU A;  4JF4 A;  4P6B A;  4S2N C;  3PBS A;  1K6S A;  5E2G A;  2C6W B;  4DRT A;  4NET A;  4OOY A;  3WS5 A;  3BFC A;  4S2O A;  1IEM A;  2Y2H A;  1W8Y A;  2Y4A A;  3AGD A;  2XLN A;  2H0T A;  5EVI D;  4FD8 A;  3RXW A;  1KVL A; 
#chains in the Genus database with same CATH topology
 3PXP A;  5BOH A;  5DF9 A;  4EWF A;  5F1G A;  1UGU A;  1GHI A;  2O9C A;  1K54 A;  2W3F A;  2O0Y A;  5CGS A;  4QY6 A;  3GSG A;  4OVD A;  1YLW A;  1OJ5 A;  1AWI A;  3H7W A;  4B4X A;  5L8M A;  4JGO A;  3VFH A;  2X01 A;  2BLS A;  3VP4 A;  1JNU A;  1XJ2 A;  4L9G A;  4YFM A;  5A8B A;  4KEN B;  2D01 A;  3UB5 P;  1RP5 A;  2VZW A;  3IBJ A;  1IKI A;  5EEC A;  3TE8 A;  4LCM A;  1OJG A;  4O7D A;  1K56 D;  3H82 B;  5FAQ A;  1GHM A;  4Y5F A;  3T4O A;  3T4S A;  4WLA A;  1G68 A;  4HBT A;  3ZG7 B;  5A92 A;  4EU0 A;  2PD8 A;  4KZ7 A;  2QKP A;  1DP6 A;  3DTE A;  3C8C A;  4WF0 A;  1XP4 A;  3L9K A;  3Q1F A;  4PMA A;  1OT9 A;  5FAO A;  3GTC A;  2AVX A;  2V1B A;  3G35 A;  2WGW A;  4HES A;  1YLT A;  2ZOI A;  5DF8 A;  5CX7 A;  3LY4 A;  4S2J A;  4OQI A;  3NJA A;  1YMX A;  1E25 A;  3UE6 A;  2ZQC A;  1TS7 A;  4F3L A;  4Q8I A;  2I9V A;  4LGW A;  4XUX A;  5GLA A;  1DJB A;  3HUM A;  1SKO A;  4LLO B;  4JKT A;  2XF3 A;  3FZC A;  3O5Y A;  1KGG A;  3ZDJ A;  3SS5 A;  1NRJ A;  1CEG A;  4EET B;  4L9F A;  3VOY A;  4MDZ A;  4NXE A;  3T50 A;  3MQO A;  1W79 A;  2W3E A;  1EWZ A;  2PD7 A;  5E43 A;  1GSX A;  4X55 A;  3SOI A;  1FCM A;  3HLW A;  1BZA A;  3F1O A;  4KZ9 A;  4OP8 A;  5U47 A;  2OSU A;  3NOU C;  3IXD A;  4Q0J A;  3IS2 B;  4CPK A;  3CHW P;  3A3F A;  5AQ7 A;  1YMS A;  3BFE A;  3D9Y A;  2XA7 S;  2WAF A;  4GW9 A;  1T1C A;  4A5R A;  5KZH A;  3ZG8 B;  4NK3 A;  5FQI A;  1IOU A;  1IFQ A;  1LL9 A;  1OTB A;  3MF0 A;  2UV0 E;  3I7J A;  3W2Z A;  3VP3 A;  2VJW A;  4NG2 A;  3EGD C;  5DTS A;  1KGE A;  1XJ4 A;  2VV6 A;  4KUK A;  1S0W A;  4E3L A;  3BYD A;  3GV9 A;  3IF6 A;  5HD5 A;  3E4P A;  1G6O A;  1TDG A;  4ZBE A;  3F1P A;  2JKT M;  4RYE A;  4CLC C;  5CER A;  5FEF A;  4E3J A;  3OCN A;  4KZ4 A;  3A3I A;  1KDW A;  4RX3 A;  2J3T D;  5IU1 A;  1NLY A;  3MS6 A;  4FSF A;  3MSH A;  1G28 A;  4HNB A;  4HJ3 A;  1W7F A;  1O07 A;  3LR4 A;  2XEP A;  1G5U A;  3BY9 A;  4LRX C;  2HGV A;  4YOF A;  2C5W B;  2Y2P A;  3Q7V B;  2RCX A;  3GEC A;  3RFB A;  3IQA A;  1LI9 A;  2W1R A;  3C7U A;  4E3I A;  4EQ1 A;  3LI9 A;  3N8L A;  3SH9 A;  4DE2 A;  3ZNY A;  2M1C A;  5F69 A;  3IHA A;  4QY5 A;  5L07 A;  1DY6 A;  1K54 C;  3T4T A;  1YPR A;  4II7 A;  3UDX A;  1NJ4 A;  4M3K A;  1MY8 A;  1ESI A;  2W1T A;  5K5B A;  2XRO A;  3K2N A;  3E2L A;  3ZCZ A;  4JXG A;  1ES5 A;  3E0Y A;  3HRE A;  4JGR A;  4X69 A;  4CLC E;  2PU4 A;  2EXB A;  4HP4 A;  2O9B A;  4C6Y A;  5HWW A;  4H8R A;  5TJJ A;  2ZMV A;  3LO7 A;  5GLB A;  3NCK A;  1K38 A;  3CLO A;  4MMN A;  3E98 A;  3UPP A;  1FOF A;  2K7S A;  4KZ6 A;  3BRM A;  1N9N A;  1V9Y A;  3CPT B;  2P08 A;  4DF6 A;  1N9L A;  5FI7 A;  3MQQ A;  1FIK A;  1KE4 A;  5FQM A;  3KSG A;  2ZLY A;  3BWL A;  1MBL A;  2QPN A;  2XGN A;  5CXW A;  4OQG A;  5FQ9 A;  2EWV A;  4UAA A;  3T4K A;  5AQA A;  4GZB A;  4R38 A;  4KZ8 A;  4Y0T A;  2UWX A;  4P6Z M;  5F1F A;  5EE8 A;  3P98 A;  1NZO A;  1YLJ A;  4PKY A;  2BAS A;  1BT5 A;  1LSX A;  4E3K A;  2LB5 A;  5HAQ A;  3WS4 A;  4EUV A;  3FKV A;  3ZG5 A;  1ES4 A;  4X1M A;  2EWW A;  1L0D A;  3WS0 A;  1IYO A;  4WEK A;  1K4E A;  3KO6 A;  1MWU A;  2ZL1 B;  4DE3 A;  4PM5 A;  3MFD A;  4QB8 A;  4EEP A;  4GNU A;  1GA9 A;  1TS0 A;  4HIA A;  5CHU A;  4X6T A;  1SZV A;  1BUL A;  2Y2L A;  3DAV A;  2ZBB A;  4R70 A;  5GHZ A;  4RA7 A;  1P97 A;  4B9O A;  1NZU A;  3HBR A;  4WBG A;  5HAP A;  2XSS A;  3AGE A;  1PWC A;  4HJ6 A;  4KZA A;  2K2N A;  3DWK A;  4HBU A;  3IS2 A;  1XFN A;  4O01 A;  2DMW A;  1P9R A;  1VHM A;  2EXA A;  2YKF A;  3TSG A;  2GDN A;  3IF6 C;  5KIZ A;  4KZ3 A;  4RVA A;  4EQI A;  4FTX A;  1ZHH B;  3QP2 A;  2WKI A;  3SH8 A;  1VQQ A;  3A3E A;  3UN7 A;  5I94 A;  1O7E A;  1YT4 A;  4I39 A;  2VKS A;  2JBF A;  5GHY A;  4OQ0 A;  3QP5 A;  1H8Z A;  5E2G A;  1HLU P;  4PKY G;  3AGD A;  2H0T A;  5EVI D;  3S7P A;  3RXW A;  3MFX A;  4Y0O A;  4N9K A;  3VE3 A;  4HH2 A;  4Y0U A;  4OKP A;  5CTM A;  3BQA A;  3U2A A;  2V0U A;  4P85 A;  1GCE A;  3HLB A;  1JWV A;  4HHD A;  3LIF A;  4IVI A;  3A3J A;  5M19 A;  4R0Q A;  2PRF A;  3U4L P;  4ZDX A;  5A93 A;  3LIB A;  5EVI B;  1PYY A;  3Q7V A;  4H6J B;  3MKE A;  2WGV A;  3V50 A;  3E4Q A;  5HFO A;  1Y28 A;  5CEC A;  2HJ9 C;  1Y54 A;  1PWG A;  5HPI A;  4LV3 A;  5FSR A;  3DW0 A;  3C5A A;  3M2K A;  1YSQ A;  4OPQ A;  4ME4 A;  4UA7 A;  3KX0 X;  1KE0 A;  1NYM A;  1SCW A;  3UB7 A;  3IXG A;  3OBF A;  1PNE A;  3LID A;  2KX6 A;  2IWC A;  2W3H A;  2V1A A;  4DKI A;  2X71 A;  1DRM A;  5FAP A;  2ZMA A;  1NYY A;  2XDM A;  3WS2 A;  1M40 A;  4BLM A;  3FYZ A;  4HEF A;  2PR5 A;  3ITA A;  2EA9 A;  2INW A;  3G31 A;  4WEJ A;  1XGJ A;  5DVA A;  5J4E A;  5DTT A;  3R7W B;  4E04 A;  3UDI A;  2XH9 A;  3EQU A;  2XRN A;  1SKF A;  1EW0 A;  2GX5 A;  2JN7 A;  1E3U D;  3QP6 A;  3GRJ A;  2VV7 A;  5FEG A;  4FH4 A;  1NRF A;  1MWR A;  3NY4 A;  4GOG A;  4R3B A;  1FQG A;  3EOI A;  4MBK A;  5E2H A;  3D72 A;  1D1J A;  1YLZ A;  4U0T A;  3VFF A;  5DFX A;  5HAR A;  3VP0 A;  4ETZ A;  3BY8 A;  3N8S A;  4PM9 A;  4E6X A;  4S2I A;  3CG5 A;  1L0F A;  5DJU A;  4NXB A;  1K57 A;  1L0E A;  1XA1 A;  5F82 A;  2G2U A;  2XFT A;  1NWZ A;  4FH2 A;  3SH7 A;  1Z6F A;  1CEF A;  5CGX A;  2QWS A;  2HDS A;  2H0Y A;  4EV4 A;  2ZC7 A;  1TD5 A;  4R4R A;  4IUK A;  2H28 A;  5AQB A;  5M18 A;  1KGF A;  3S7O A;  1KE3 A;  4KQO A;  3T1X A;  1ZC2 A;  4E3M A;  2WZZ A;  2G2W A;  1KVM A;  2QJ7 A;  3CAX A;  4JPM A;  3UB8 A;  2ZL1 A;  4UQI M;  1W63 Q;  4LRZ E;  1TVF A;  2Z6C A;  1S1Y A;  2L0W A;  3NBL A;  2Y79 A;  2NUT C;  4LV2 A;  3WS1 A;  3MKF A;  2ZM0 A;  3K3D A;  1H5X A;  4YWZ A;  4BEN A;  1RGY A;  3K3C A;  1XJ6 A;  2HZ5 A;  2WZX A;  3W8K A;  5M1A A;  3P01 A;  3ZHH A;  3T4L A;  2XK1 A;  1L3L A;  4JLF A;  4OON A;  4K0W A;  1VM1 A;  5EM1 A;  5HDS A;  1BLC A;  3IH9 A;  1OTD A;  2ZM2 A;  4MNR A;  2JE5 A;  2LB9 A;  3DWZ A;  2V2F F;  1KDS A;  3HLE A;  3UE1 A;  2OAQ 1;  4MEZ A;  3IX4 A;  4C3Q A;  4BWI A;  3A3D A;  2Y2J A;  2WAE A;  5IHV A;  4GDB A;  3A0R A;  3OZH A;  3GDI A;  1UWP X;  2VGL M;  4K91 A;  5E2F A;  1L0G A;  4LV0 A;  1XX2 A;  3VP2 A;  3UE3 A;  3IWO A;  1HD8 A;  3PBT A;  1U60 A;  3HLD A;  1VB6 A;  4MN7 A;  2ZOH A;  4OQH A;  4GS9 A;  5G4Z A;  1LLB A;  3BEB A;  4ESP A;  5L2F A;  3LEZ A;  3JVV A;  2EFX A;  3N4I A;  4OPY A;  2OOL A;  4S2L A;  2J3T C;  3LY3 A;  4XT2 A;  4PM6 A;  2W3G A;  3WRZ A;  3N6I A;  1JWZ A;  1KOU A;  5FL3 A;  2Y91 A;  3PAG A;  2Y2G A;  3T4Q A;  5EVI A;  3M6H A;  1BLS A;  3GQZ A;  2PHY A;  3EEA A;  4WN5 A;  1FCN A;  2V1Z A;  4D60 A;  1JWP A;  3GVB A;  2O99 A;  3DTI A;  2Q9N A;  4KQR A;  5TFQ A;  2PDR A;  2P7J A;  4WMC D;  3NDE A;  2PR6 A;  1TS6 A;  3ZVT A;  2GNX A;  2X02 A;  3UE0 A;  3SS4 A;  4B88 A;  3Q7Z A;  3GR2 A;  2WGI A;  2ZQ7 A;  3T12 B;  1F2K A;  2H5S A;  4NEE D;  1QMF A;  1ALQ A;  4P87 A;  1MPL A;  1D06 A;  5HD3 A;  4KG5 A;  1CI9 A;  3R7W A;  3FKW A;  1IYQ A;  2KLI A;  1IYP A;  1S4R A;  1MWS A;  1K57 C;  3MJQ A;  5EV0 A;  5EPH A;  4MBF A;  2HPB A;  1KVL A;  1K0K A;  4HY8 A;  2HP5 A;  3LIE A;  4GN2 A;  4CLC D;  2A2L A;  2V0W A;  3B42 A;  4JBF A;  4KQD A;  1GA0 A;  3NUL A;  3DBA A;  4K08 A;  3FG8 A;  3V39 A;  3O86 A;  5CHJ A;  4R3A A;  2FH5 A;  5FDH A;  1H0M A;  1ODV A;  5DTK A;  5HWT A;  2HP9 A;  3RH8 B;  2KDK A;  3EGX C;  1T19 A;  4Z9Q A;  5CRF A;  2VEA A;  4JXW A;  2H10 A;  1CQA A;  5HL6 A;  2L4R A;  3LCE A;  4X56 A;  5EVE A;  1ES2 A;  2EX9 A;  1ESU A;  4JF4 A;  2C6W B;  4I3J A;  4DRT A;  2Y2H A;  1W8Y A;  3LI8 A;  4FD8 A;  3KYZ A;  4DE0 A;  2VA0 A;  4LEN A;  1GSW A;  3H82 A;  3NHQ A;  2JKR M;  1FCO A;  4HH3 A;  2VV8 A;  3HUO A;  3CUE A;  3S22 A;  3HLF A;  3N8R A;  1BSG A;  1CF0 A;  4ZJ1 A;  2GJ3 A;  3IX3 A;  5GLD A;  3EWK A;  4EBP A;  2WKH A;  3B47 A;  3ZG9 B;  3O88 A;  5J8X A;  5GLC A;  3BFD A;  3VSK A;  3C4O A;  1YQS A;  1K56 A;  5IT5 A;  5HWV A;  1P0Z A;  3ITB A;  5HX9 A;  3M6B A;  3EEH A;  4U3T A;  1PZO A;  2WK0 A;  3E2K A;  1LL8 A;  1OPX A;  3V3R A;  2JKT I;  1GHP A;  2Y2O A;  3LR3 A;  2HDU A;  3C30 A;  2B18 A;  4NXG A;  3UB6 A;  3QP4 A;  4Q0I A;  4DJ3 A;  4LPZ A;  1XPB A;  4S2M A;  2M7U A;  1SHV A;  1FR1 A;  4S2K A;  4G3W A;  4DXB A;  2CMN A;  3G30 A;  2P74 A;  3NOP C;  4X25 A;  4Y13 A;  3IXB A;  3LYX A;  3MXS A;  2XD1 A;  4ZAM A;  5DJT A;  5EVI C;  1E4D A;  3Q81 A;  1BLH A;  2WGW B;  1PIO A;  1J3W A;  3HUN A;  4KG2 A;  1PRQ A;  3MR0 A;  1W8Q A;  1XGI A;  1YKD A;  4OH0 A;  2Y2M A;  4Y15 A;  1PI5 A;  3G2Z A;  2ZQD A;  5KSC A;  3BLS A;  2A49 A;  4I3A A;  4F3L B;  2VLG A;  4YNR A;  5TGF A;  5HSQ A;  1XA7 A;  2R9X A;  2WKR A;  2EX6 A;  4LRY C;  2QZ6 A;  3H9W A;  3PBQ A;  4WM9 A;  3VMA A;  3UPO A;  1T1B A;  3QP8 A;  1S67 L;  3SZT A;  2ZQ8 A;  2DCF A;  3JPU A;  3OCL A;  2WKQ A;  2P9V B;  4XXR A;  3IWQ A;  4KQQ A;  1VEU B;  4IUH A;  3IXH A;  3W4P A;  3TG9 A;  3NIA A;  1WYC A;  3F1O B;  3ZYT A;  3UDF A;  3MZE A;  2A3U A;  5A91 A;  4BBU A;  1MC0 A;  2IA2 A;  3W4Q A;  2J7V A;  4U0X A;  4ZTK A;  2ZC6 B;  2A24 B;  5L10 A;  5DKK A;  1NXY A;  2JKR I;  2XA7 M;  2MJ6 A;  2EX8 A;  4BBV A;  3ZG0 A;  4S2N A;  2JKF A;  4GHI B;  2VGJ A;  4NKP A;  4P0M A;  1ZG6 A;  3WWX A;  3ZVW A;  4DXC A;  1S6R A;  2EFU A;  4JGP A;  3DTM A;  4L0L A;  1C3B A;  2B02 A;  4JXS A;  3GMW A;  3T1S A;  2RL3 A;  4Q0H A;  4EBN A;  1MKI A;  3B33 A;  4HQA A;  3VP1 A;  2VGK A;  3QHY A;  3UNW A;  3IWI A;  1M6K A;  1YAX A;  4PM7 A;  4BJP A;  3BEC A;  4WL9 A;  3T4J A;  1PZP A;  4NXF A;  3VE4 A;  4R3J A;  1ERO A;  1OTA A;  4Y2F A;  5FAS A;  3CUE C;  3OLO A;  1I2S A;  3S4X A;  5GL9 A;  3PBN A;  2PAV P;  4MBH A;  3O87 A;  4B4Z A;  3QP1 A;  3CPT A;  1I5Q A;  3CIT A;  4EUZ A;  3C2W A;  4OP5 A;  5EM0 A;  2QYB A;  4ZJ2 A;  2Z2M B;  3KSI A;  3V3S A;  1G6A A;  1Q2Q A;  3T1R A;  4O8G A;  3D3O A;  4CJN A;  4P6Z S;  5C5K A;  1CI8 A;  4BD1 A;  3UMD A;  3B3X A;  2Y8H A;  3IHB A;  2FFF B;  1YLY A;  2J3W A;  1YLP A;  2P04 A;  3NC8 A;  1LSW A;  3MXQ A;  5FDS A;  3FPV A;  4GD6 A;  3RTY A;  2WAD A;  2NUP C;  4DDS A;  2OWJ A;  4E3N A;  4UHU A;  1BLP A;  3SS3 A;  5E2E A;  3MMH A;  1IKG A;  3OPR A;  4D2O A;  1CJF A;  1ERM A;  2OLV A;  1N9O A;  3TJZ C;  3HVF A;  2QMI A;  3PBO A;  1K25 A;  1Q2P A;  2FFY A;  1YM1 A;  2J80 A;  5EUA A;  3CMZ A;  2ZQ9 A;  5CGW A;  4FCF A;  5JYP A;  3VV4 A;  4R4S A;  4JGQ A;  4GKU A;  5EVL A;  1ZG4 A;  1XFQ A;  4Y17 A;  4O0P A;  1JTG A;  2CC1 A;  4GCZ A;  1N4O A;  3E4O A;  3S1Y A;  2GZA A;  4MN6 A;  4KZB A;  1LL5 A;  1S1Z A;  5GHX A;  3UY6 A;  5F5Y A;  2WKE A;  1BTL A;  1PWD A;  3BQ8 A;  4EBL A;  3N7W A;  3G6O A;  3LIC A;  2WUQ A;  3HJK A;  3MQ0 A;  4EW7 A;  3NOT C;  2ZC3 B;  3BM6 A;  5F6A A;  3KSH A;  3WRT A;  4LV1 A;  1W5D A;  2WYX A;  3C4P A;  3PHY A;  1IYS A;  2OV5 A;  3S7N A;  5HL1 A;  1MKM A;  2PYP A;  4B93 A;  3PBR A;  4LCL A;  2WKP A;  2ZQA A;  1T1A A;  3KYQ A;  1GSV A;  1F5M A;  1VET B;  2BTF P;  3W4O A;  1K4F A;  2HV1 A;  2OLU A;  1FR6 A;  3FV7 A;  1ERQ A;  2P9V A;  3LUQ A;  5L09 A;  1VEU A;  2HF6 A;  2V9A A;  4DJ2 A;  4P6B A;  4S2N C;  3PBS A;  4OOY A;  4G3V A;  1IEM A;  2Y4A A;  1OTI A;  3NEC A;  2O9A A;  4IED A;  2A24 A;  4Z1W A;  3OOV A;  3V5M A;  1CK3 A;  4JF5 A;  4H6J A;  5EFW A;  3D4F A;  3F1N B;  3HLG A;  3LR5 A;  1H8Y A;  1LT0 A;  5FQK A;  1MXO A;  5FI2 A;  1S4S A;  4M4X A;  4GHI A;  1MWT A;  4HI4 A;  5DFY A;  3V67 A;  1TF1 A;  3Q07 A;  1H3Q A;  5JYO A;  4BL3 A;  4JF6 A;  2QHK A;  4OOM A;  4JXV A;  5FQQ A;  5LBR A;  4I38 A;  3FC7 A;  3IBR A;  4ETX A;  5FA7 A;  1XXM A;  2Y59 A;  4S2P A;  4R6L A;  2KOI A;  3KSF A;  1STZ A;  1Y4O A;  5HDC A;  2L1M A;  2OWH A;  4QD4 A;  1UWN X;  3PAE A;  2E8I A;  4BQM A;  4DDY A;  5CED A;  1SDE A;  1WE4 A;  5DF7 A;  3OPL A;  2G7U A;  4GDN A;  3DTK A;  3NI9 A;  5G18 A;  1F98 A;  1N9B A;  4PAU A;  4WZ5 C;  2Z6D A;  2Y2I A;  1SDN A;  1S66 L;  3P09 A;  3UO9 A;  4PHT A;  3G34 A;  2D02 A;  1K55 C;  3ZGA B;  3MBZ A;  2Y2K A;  4ID4 A;  4PPR A;  4WEL A;  3VOL A;  1W63 M;  3AGF A;  3MXR A;  5CTN A;  1DP8 A;  3ZNT A;  4IVK A;  4N92 A;  3ISG A;  4I3I A;  2W0N A;  2BG1 A;  2FZ0 A;  5AQ9 A;  4EXO A;  5TBM B;  4MLL A;  5EOO A;  1F9I A;  4ARZ B;  3OPH A;  3IF5 A;  3UB9 A;  1TS8 A;  4RQ9 A;  3IT9 A;  2E8J A;  1TDL A;  1LHY A;  3PYP A;  4UA9 A;  5FQJ A;  1NLZ A;  4MN5 A;  1LSV A;  2HJE A;  2QJ5 A;  4MCW A;  4OLG A;  2B5R A;  1E3U A;  5F83 A;  4CLC B;  1JTD A;  1ES3 A;  3TRC A;  4UA6 A;  3M2J A;  1DP9 A;  1XKZ A;  4QWO A;  2Y2Q A;  5KSH A;  2R78 A;  4EEU A;  4X53 A;  5MC7 A;  2HDQ A;  4UQI S;  4X68 A;  2PBY A;  4HOI A;  4HJ4 A;  4WYY A;  2R9W A;  3RXX A;  3ULF A;  1P9W A;  1FIL A;  4IBX A;  3RJU A;  2JHE A;  4DN0 A;  4EER A;  2HDR A;  4E3O A;  5KMW A;  2IWD A;  4CQH A;  3LEQ A;  5HZH A;  3A0S A;  1MZU A;  4FUW A;  3HLC A;  3NDG A;  3P7N A;  3CWF A;  1ONG A;  2J9P A;  1BYW A;  4HP9 A;  4WZ4 A;  3KYE A;  1OTE A;  1D7E A;  3H7W B;  4OLD A;  2ZD8 A;  4LFU A;  3OPP A;  5EOE A;  5HPF A;  4N9L A;  1DJA A;  1DJC A;  4GJ4 A;  1T18 A;  3T1Q B;  2I72 A;  5J7E A;  2W27 A;  4YIN A;  2VGL S;  4BL2 A;  5D3O A;  1FSW A;  2Y2N A;  3JYI A;  3TOI A;  1ACF A;  3EQV A;  1X0O A;  5FAT A;  3UPN A;  1PW1 A;  3HL9 A;  3QNC A;  2PBD P;  3MZF A;  1VET A;  3Q82 A;  2V8F A;  2JC7 A;  4RX2 A;  1A0K A;  4K0X A;  3VOZ A;  1IEL A;  4BD0 A;  4GB7 A;  1AXB A;  1EI5 A;  5TR7 A;  2M7V A;  4BMW A;  1J9M A;  3QNB A;  3FPW A;  1PFL A;  1BUE A;  5F68 A;  4UEY A;  3OC2 A;  2YKH A;  2V20 A;  1RGZ A;  4WUJ A;  4PM8 A;  3F1N A;  1SKO B;  3LIA A;  3IX8 A;  2PU2 A;  2XD5 A;  3BJN A;  2XFS A;  1HTZ A;  2PT7 A;  2Z2L B;  2ZMF A;  2VX8 A;  2EX2 A;  3LGO A;  4DMZ A;  2ACG A;  2Q9M A;  4OPZ A;  3C7V A;  1QME A;  2J8Y A;  1RCJ A;  4DE1 A;  4XUZ A;  2W3D A;  1NY0 A;  4EES A;  4AFI A;  3JVU A;  3LR0 A;  4ZRR A;  3G2Y A;  4GS9 B;  2ZC5 B;  4QJG A;  4N1X A;  1YSP A;  2JCH A;  3PTE A;  2JKG A;  4R23 A;  3G32 A;  2XQZ A;  1L2S A;  1PI4 A;  2VK3 A;  4KUO A;  4OOL A;  5J3W A;  1WYB A;  2ZC4 B;  3HJI A;  4XT2 B;  3FWL A;  2J9O A;  2V8C A;  4FOF A;  3BW6 A;  5A90 A;  5HAI A;  4WMC A;  5CHM A;  1V9Z A;  4Y3I A;  3TW8 A;  2XR0 A;  1Z09 A;  5AVF A;  5AJG A;  1JVJ A;  4Y7P A;  1LI0 A;  2Y55 A;  4OPR A;  3IF6 B;  1HVB A;  1ZKJ A;  1OME A;  4C75 A;  3F1P B;  1H8M A;  3IH8 A;  5FI6 A;  2ZM8 A;  3ZQ5 A;  1PW8 A;  2DRW A;  3A0V A;  5TBM A;  3LFV A;  5AVE A;  4X1L A;  5G4Y A;  4ZJ3 A;  3UME A;  2HP6 A;  1I2W A;  4QHC A;  3CZD A;  3PR6 A;  4ARZ A;  2Q0O A;  1TEM A;  3CJM A;  3ICY A;  1K6R A;  4QPR A;  2DNS A;  3SW1 A;  2PYR A;  4L9E A;  2B95 A;  4IBR A;  3L7H A;  4GLQ A;  3ZFZ A;  4KG6 A;  5DKL A;  4BBT A;  1ONH A;  4CLC A;  4G3K A;  3O3V A;  1WA9 A;  5IS1 A;  5CEB A;  3BFG A;  3G4P A;  1HZO A;  4IJG A;  3CI6 A;  1FSY A;  4E6W A;  4R1G A;  3HCY A;  4IHQ A;  4F94 A;  4GD8 A;  4I5S A;  4QU3 A;  1ZTU A;  2ZJ9 A;  3C38 A;  2OAP 1;  4WZ5 A;  5I5L A;  5HW3 A;  1OT6 A;  3BLM A;  5HDD A;  3MZD A;  2IWB A;  3VSL A;  1K55 A;  3BFF A;  4N1H A;  2K31 A;  1K6S A;  4NET A;  3WS5 A;  3BFC A;  3R4K A;  1XJ3 A;  4S2O A;  2W1T B;  3S7Q A;  2XLN A;  4KZ5 A; 
#chains in the Genus database with same CATH homology
 4Y0O A;  4IED A;  4DE0 A;  4LEN A;  4N9K A;  5BOH A;  5DF9 A;  3V5M A;  4EWF A;  1CK3 A;  4JF5 A;  5F1G A;  1GHI A;  4Y0U A;  1K54 A;  3D4F A;  5CGS A;  4QY6 A;  1FCO A;  3GSG A;  4OKP A;  5CTM A;  3HLG A;  4OVD A;  1H8Y A;  1YLW A;  5FQK A;  1MXO A;  3HUO A;  5FI2 A;  4P85 A;  3S22 A;  3HLF A;  1GCE A;  3N8R A;  1BSG A;  1JWV A;  3HLB A;  4B4X A;  1MWT A;  4IVI A;  3A3J A;  4ZJ1 A;  5M19 A;  4R0Q A;  3VFH A;  2X01 A;  2BLS A;  5GLD A;  3VP4 A;  4YFM A;  4EBP A;  2WKH A;  3Q07 A;  4KEN B;  5JYO A;  4BL3 A;  1RP5 A;  4JF6 A;  4OOM A;  1IKI A;  5EEC A;  4JXV A;  4LCM A;  5FQQ A;  3ZG9 B;  4O7D A;  3O88 A;  1K56 D;  4ZDX A;  5A93 A;  5EVI B;  1PYY A;  5J8X A;  3Q7V A;  5FAQ A;  5GLC A;  3BFD A;  3VSK A;  1GHM A;  5FA7 A;  1XXM A;  3MKE A;  2WGV A;  1G68 A;  1YQS A;  2Y59 A;  3C4O A;  4S2P A;  1K56 A;  3V50 A;  4HBT A;  3ZG7 B;  3ITB A;  5A92 A;  5HX9 A;  5HFO A;  4KZ7 A;  3M6B A;  5CEC A;  4QD4 A;  1Y54 A;  4U3T A;  1PWG A;  1PZO A;  2WK0 A;  3PAE A;  2E8I A;  4BQM A;  4DDY A;  5CED A;  1SDE A;  1WE4 A;  5DF7 A;  3E2K A;  3OPL A;  4LV3 A;  3V3R A;  1XP4 A;  4GDN A;  1GHP A;  3Q1F A;  4PMA A;  2Y2O A;  5FSR A;  3DW0 A;  3NI9 A;  3C5A A;  5FAO A;  3GTC A;  2HDU A;  5G18 A;  3G35 A;  3M2K A;  4OPQ A;  1N9B A;  4WZ5 C;  4UA7 A;  2WGW A;  4HES A;  1YLT A;  2Y2I A;  1SDN A;  1KE0 A;  1NYM A;  5DF8 A;  1XPB A;  3P09 A;  4S2M A;  1SCW A;  3UO9 A;  3G34 A;  3LY4 A;  3IXG A;  4S2J A;  1K55 C;  3ZGA B;  3MBZ A;  4OQI A;  2Y2K A;  4ID4 A;  1SHV A;  1FR1 A;  1YMX A;  1E25 A;  2IWC A;  4PPR A;  4S2K A;  4WEL A;  3AGF A;  3MXR A;  5CTN A;  4DXB A;  3ZNT A;  4DKI A;  2X71 A;  5FAP A;  2ZQC A;  2ZMA A;  3G30 A;  4IVK A;  4Q8I A;  2P74 A;  4N92 A;  3ISG A;  1NYY A;  2XDM A;  2BG1 A;  1M40 A;  3IXB A;  3MXS A;  4ZAM A;  2XD1 A;  3FYZ A;  4HEF A;  4XUX A;  5AQ9 A;  5GLA A;  4BLM A;  1DJB A;  3ITA A;  1E4D A;  3Q81 A;  5EVI C;  3HUM A;  3G31 A;  4WEJ A;  4MLL A;  1XGJ A;  4JKT A;  1BLH A;  2XF3 A;  3FZC A;  5DVA A;  1KGG A;  5DTT A;  2WGW B;  3SS5 A;  1PIO A;  3HUN A;  3ZDJ A;  5EOO A;  4KG2 A;  1CEG A;  3OPH A;  2XH9 A;  3EQU A;  3UDI A;  3IF5 A;  3IT9 A;  1W8Q A;  1XGI A;  5FQJ A;  1SKF A;  1LHY A;  1TDL A;  4UA9 A;  3VOY A;  4OH0 A;  1E3U D;  2Y2M A;  3GRJ A;  1PI5 A;  3G2Z A;  2ZQD A;  4FH4 A;  5KSC A;  1W79 A;  1NRF A;  3BLS A;  2A49 A;  4OLG A;  1EWZ A;  2B5R A;  5E43 A;  1E3U A;  1MWR A;  5F83 A;  4X55 A;  3SOI A;  1JTD A;  1FCM A;  3HLW A;  3NY4 A;  1ES3 A;  4UA6 A;  3M2J A;  1BZA A;  4OP8 A;  4GOG A;  4KZ9 A;  5TGF A;  5U47 A;  4R3B A;  1XA7 A;  2R9X A;  1FQG A;  2OSU A;  4MBK A;  3IXD A;  5E2H A;  1XKZ A;  2EX6 A;  1YLZ A;  4U0T A;  4CPK A;  2Y2Q A;  3VFF A;  5HAR A;  5KSH A;  3VP0 A;  2QZ6 A;  3N8S A;  4PM9 A;  4X53 A;  3A3F A;  5AQ7 A;  1YMS A;  3PBQ A;  4E6X A;  4WM9 A;  3VMA A;  4S2I A;  2HDQ A;  3BFE A;  3CG5 A;  3UPO A;  5KZH A;  2WAF A;  4A5R A;  1L0F A;  4X68 A;  1K57 A;  2PBY A;  1L0E A;  1XA1 A;  5F82 A;  2G2U A;  2ZQ8 A;  3ZG8 B;  4NK3 A;  5FQI A;  2DCF A;  2XFT A;  3OCL A;  4FH2 A;  2P9V B;  4XXR A;  3SH7 A;  1Z6F A;  3IWQ A;  4KQQ A;  4WYY A;  2R9W A;  1CEF A;  3IXH A;  1LL9 A;  3RXX A;  3W4P A;  3TG9 A;  3I7J A;  5CGX A;  3NIA A;  4IBX A;  2HDS A;  1WYC A;  3VP3 A;  2H0Y A;  4EV4 A;  2ZC7 A;  3UDF A;  3MZE A;  3RJU A;  4R4R A;  2A3U A;  5A91 A;  5AQB A;  3W4Q A;  2J7V A;  5M18 A;  4U0X A;  4ZTK A;  2ZC6 B;  1KGF A;  1KGE A;  5DTS A;  2HDR A;  4E3O A;  5KMW A;  2IWD A;  1KE3 A;  4KQO A;  1S0W A;  4E3L A;  3BYD A;  3GV9 A;  3IF6 A;  1ZC2 A;  4E3M A;  2WZZ A;  2G2W A;  1KVM A;  1TDG A;  1NXY A;  4ZBE A;  4RYE A;  3HLC A;  3NDG A;  4JPM A;  5CER A;  4E3J A;  1ONG A;  2EX8 A;  2J9P A;  1TVF A;  3OCN A;  4KZ4 A;  4WZ4 A;  3A3I A;  1KDW A;  4RX3 A;  3ZG0 A;  4S2N A;  3NBL A;  4OLD A;  2ZD8 A;  3OPP A;  2VGJ A;  5EOE A;  4P0M A;  4FSF A;  1ZG6 A;  4LV2 A;  4N9L A;  3WS1 A;  3WWX A;  1DJA A;  3MKF A;  1DJC A;  1W7F A;  2ZM0 A;  3ZVW A;  1O07 A;  4DXC A;  2I72 A;  1S6R A;  1H5X A;  2EFU A;  2XEP A;  4BEN A;  3DTM A;  4YIN A;  1RGY A;  4L0L A;  1C3B A;  3W8K A;  2WZX A;  2C5W B;  5M1A A;  2Y2P A;  3Q7V B;  2RCX A;  3ZHH A;  5D3O A;  4BL2 A;  1FSW A;  2Y2N A;  3IQA A;  4JXS A;  1LI9 A;  3GMW A;  2XK1 A;  2RL3 A;  3JYI A;  4JLF A;  4OON A;  3TOI A;  3C7U A;  3EQV A;  4E3I A;  4EBN A;  5FAT A;  3UPN A;  4K0W A;  1VM1 A;  1MKI A;  1BLC A;  3IH9 A;  3VP1 A;  1PW1 A;  2VGK A;  3QHY A;  3HL9 A;  3N8L A;  3SH9 A;  3UNW A;  4DE2 A;  3IWI A;  2ZM2 A;  3QNC A;  3ZNY A;  3MZF A;  4MNR A;  3IHA A;  1M6K A;  4QY5 A;  3Q82 A;  2JE5 A;  4PM7 A;  3DWZ A;  2V2F F;  2JC7 A;  4RX2 A;  1KDS A;  4BJP A;  3BEC A;  1DY6 A;  1PZP A;  1K54 C;  3HLE A;  4K0X A;  3VOZ A;  1IEL A;  3UE1 A;  4BD0 A;  4GB7 A;  4MEZ A;  4C3Q A;  1AXB A;  4R3J A;  1EI5 A;  3A3D A;  5TR7 A;  3UDX A;  1ERO A;  2Y2J A;  2WAE A;  5IHV A;  1NJ4 A;  5FAS A;  4GDB A;  4M3K A;  1J9M A;  1I2S A;  1MY8 A;  3QNB A;  3OZH A;  3S4X A;  5GL9 A;  3PBN A;  4K91 A;  5E2F A;  1ESI A;  4MBH A;  1L0G A;  1BUE A;  3O87 A;  4B4Z A;  3E2L A;  3OC2 A;  3ZCZ A;  4JXG A;  1I5Q A;  1ES5 A;  4EUZ A;  4LV0 A;  1XX2 A;  3VP2 A;  3UE3 A;  3HRE A;  3IWO A;  2V20 A;  1HD8 A;  4OP5 A;  3PBT A;  1RGZ A;  1U60 A;  4X69 A;  3HLD A;  2PU4 A;  4ZJ2 A;  2Z2M B;  2EXB A;  4KZ5 A;  4PM8 A;  3V3S A;  1G6A A;  4C6Y A;  4OQH A;  4H8R A;  1Q2Q A;  1LLB A;  2PU2 A;  3BEB A;  3LO7 A;  2XD5 A;  3LEZ A;  5GLB A;  4CJN A;  3NCK A;  5L2F A;  1K38 A;  2XFS A;  1HTZ A;  2EFX A;  3N4I A;  1CI8 A;  4BD1 A;  3UPP A;  2Z2L B;  4OPY A;  1FOF A;  3B3X A;  2EX2 A;  3IHB A;  4S2L A;  2FFF B;  1YLY A;  1YLP A;  3NC8 A;  4KZ6 A;  3LY3 A;  2Q9M A;  4OPZ A;  3C7V A;  4PM6 A;  1QME A;  3BRM A;  2J8Y A;  3WRZ A;  4GD6 A;  1RCJ A;  3N6I A;  4DE1 A;  4DF6 A;  1JWZ A;  2WAD A;  2Y91 A;  3PAG A;  4XUZ A;  5FI7 A;  1NY0 A;  2Y2G A;  5EVI A;  1KE4 A;  5FQM A;  3M6H A;  4DDS A;  3G2Y A;  4E3N A;  2ZLY A;  2ZC5 B;  4UHU A;  4QJG A;  4N1X A;  1BLP A;  1MBL A;  2QPN A;  3SS3 A;  2JCH A;  1BLS A;  3PTE A;  4R23 A;  2XGN A;  5E2E A;  3G32 A;  5CXW A;  2XQZ A;  4OQG A;  3GQZ A;  1IKG A;  5FQ9 A;  4UAA A;  5AQA A;  4GZB A;  1FCN A;  1L2S A;  1PI4 A;  2V1Z A;  3OPR A;  4KZ8 A;  4OOL A;  4D2O A;  4Y0T A;  2UWX A;  1JWP A;  1WYB A;  1ERM A;  3GVB A;  2OLV A;  5F1F A;  5EE8 A;  2ZC4 B;  2Q9N A;  3HVF A;  3P98 A;  4KQR A;  5TFQ A;  1NZO A;  2QMI A;  1YLJ A;  3PBO A;  1K25 A;  4WMC D;  3WS2 A;  1Q2P A;  3FWL A;  2J9O A;  3NDE A;  2FFY A;  1YM1 A;  5EUA A;  5A90 A;  3ZVT A;  5HAI A;  4WMC A;  5CHM A;  3CMZ A;  2ZQ9 A;  1BT5 A;  2X02 A;  3UE0 A;  5CGW A;  4FCF A;  3SS4 A;  4E3K A;  5JYP A;  4R4S A;  4B88 A;  3Q7Z A;  4GKU A;  5EVL A;  2XR0 A;  3GR2 A;  5HAQ A;  1JVJ A;  2WGI A;  4Y7P A;  3WS4 A;  1ZG4 A;  2ZQ7 A;  3FKV A;  3ZG5 A;  1ES4 A;  1JTG A;  1LI0 A;  2Y55 A;  4OPR A;  3IF6 B;  1HVB A;  1ZKJ A;  2CC1 A;  1N4O A;  2H5S A;  1OME A;  1L0D A;  3S1Y A;  3WS0 A;  4C75 A;  4KZB A;  1IYO A;  1LL5 A;  1K4E A;  4WEK A;  1MWU A;  5GHX A;  3IH8 A;  3UY6 A;  4DE3 A;  1QMF A;  5FI6 A;  2ZM8 A;  4PM5 A;  2WKE A;  1ALQ A;  1BTL A;  1PW8 A;  3MFD A;  2DRW A;  1MPL A;  4P87 A;  4QB8 A;  1PWD A;  4KG5 A;  1CI9 A;  4ZJ3 A;  2HP6 A;  1I2W A;  4QHC A;  4EBL A;  3CZD A;  1IYQ A;  3FKW A;  4GNU A;  1GA9 A;  1TEM A;  3N7W A;  3CJM A;  1IYP A;  4X6T A;  5CHU A;  1BUL A;  1K6R A;  2Y2L A;  2WUQ A;  1MWS A;  1K57 C;  2DNS A;  5EPH A;  4MBF A;  2HPB A;  2ZC3 B;  2HP5 A;  5GHZ A;  3BM6 A;  4GN2 A;  4RA7 A;  4IBR A;  4JBF A;  1NZU A;  3WRT A;  1GA0 A;  4LV1 A;  1W5D A;  3ZFZ A;  3HBR A;  4KG6 A;  4WBG A;  5HAP A;  2WYX A;  1ONH A;  3C4P A;  3AGE A;  1IYS A;  3O3V A;  2OV5 A;  3V39 A;  3O86 A;  1PWC A;  5HL1 A;  4KZA A;  5CHJ A;  3DWK A;  3BFG A;  3PBR A;  3G4P A;  1HZO A;  4HBU A;  4LCL A;  5CEB A;  1FSY A;  4E6W A;  5FDH A;  2ZQA A;  4R1G A;  5DTK A;  2HP9 A;  4F94 A;  4GD8 A;  2EXA A;  3TSG A;  3W4O A;  4Z9Q A;  1K4F A;  2GDN A;  4QU3 A;  5CRF A;  3IF6 C;  2ZJ9 A;  4KZ3 A;  2OLU A;  4RVA A;  4JXW A;  4EQI A;  2H10 A;  4WZ5 A;  1FR6 A;  5HW3 A;  3FV7 A;  1ERQ A;  2P9V A;  3LCE A;  2WKI A;  4X56 A;  3SH8 A;  1VQQ A;  3A3E A;  3BLM A;  3UN7 A;  5I94 A;  1O7E A;  1YT4 A;  3MZD A;  2IWB A;  3VSL A;  2JBF A;  1K55 A;  3BFF A;  4OQ0 A;  5GHY A;  1ES2 A;  4N1H A;  1H8Z A;  2EX9 A;  1ESU A;  4JF4 A;  4P6B A;  4S2N C;  3PBS A;  1K6S A;  5E2G A;  2C6W B;  4DRT A;  4NET A;  4OOY A;  3WS5 A;  3BFC A;  4S2O A;  1IEM A;  2Y2H A;  1W8Y A;  2Y4A A;  3AGD A;  2XLN A;  2H0T A;  5EVI D;  4FD8 A;  3RXW A;  1KVL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...