4UHUA

W229d mutant of the last common ancestor of gram-negative bacteria (gnca) beta-lactamase class a
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
264
structure length
264
Chain Sequence
QLSEQLAELEKRSGGRLGVAVLDTATGRRIAYRGDERFPMCSTFKALLAAAVLARVDQGKERLDRRITYGKEDLVDYSPVTEKHVGDGMTVAELCEAAITLSDNTAANLLLEALGGPAALTAFLRSIGDEVTRLDRWEPELNEAAPGDPRDTTTPAAMAATLRTLLLGDALSPASRQQLVDWLVANKTGDKRLRAGLPADDRVGDKTGTGGHGTTNDIAVIWPPGRAPIVVTVYLTESQVDADARDAVIAEVGRLVVEAFHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title De novo active sites for resurrected Precambrian enzymes.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Hydrolase
molecule keywords GNCA LACTAMASE W229D
total genus 99
structure length 264
sequence length 264
ec nomenclature ec 3.5.2.6: Beta-lactamase.
pdb deposition date 2015-03-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 4uhuA00
4GNUA 5KMWA 2X71A 5CRFA 5JYPA 3VSKA 5BOHA 2Z2LB 1BT5A 5CGWA 2Y2NA 4OOLA 1WYCA 3FYZA 4JF4A 4MBHA 4R3JA 2J9PA 1PW8A 2P9VB 5F1GA 3G2YA 1H5XA 2WYXA 3OZHA 3A3DA 4OQIA 1FOFA 3HL9A 5CXWA 3WWXA 2JCHA 2HP6A 1HVBA 1IYSA 1N9BA 1K55A 1K6RA 2HPBA 1M6KA 5D3OA 3C4OA 3FKVA 4FH2A 2H10A 5CHJA 3C5AA 1K4FA 2I72A 3W4PA 4X68A 1XKZA 3BM6A 3PBOA 1QMFA 1YLWA 2X01A 3ITAA 4WMCA 2Y2OA 3O87A 4E3MA 2H0TA 1KE4A 2V2FF 3G31A 4KZ8A 3ZVTA 5FQJA 3HVFA 2R9XA 2Y2IA 3VFFA 1ES3A 1YLYA 4EV4A 4Y0TA 2QMIA 2XFTA 1E3UA 1YQSA 3BFDA 3C7UA 3W8KA 5DTTA 3LY3A 3HLFA 2ZC7A 5KSHA 2Y2LA 4R4SA 2Y55A 5A92A 2QZ6A 4ZBEA 5FAQA 1W79A 3B3XA 1S6RA 2ZQ7A 4GDBA 4KQRA 5HX9A 3HLGA 1BULA 4P85A 4L0LA 4KENB 3HUMA 2WZXA 4HBUA 1BLPA 4GN2A 3VOYA 3N6IA 3ZNTA 1WYBA 1EROA 2ZJ9A 3MZEA 4ZAMA 4BD0A 4E3IA 1Q2QA 3VP3A 4LCMA 3RXWA 3A3JA 4PM8A 4GDNA 2EFUA 5FATA 3VMAA 5CTNA 1SDNA 4N1HA 4OVDA 5EPHA 4C6YA 4BL3A 5TR7A 3M6HA 1ESIA 3AGFA 1K4EA 4S2NC 1YMSA 3IXHA 2XEPA 3O3VA 4E3LA 2Y2GA 4S2LA 1K57A 2Y2KA 5CHUA 1KDSA 3IWOA 4N1XA 1MKIA 1KVLA 4OQHA 5FA7A 1AXBA 2Y2QA 4QY5A 4ZJ2A 4KZ6A 1NRFA 4DKIA 4K0XA 5GHZA 2OLUA 3SH7A 1IYOA 3PAEA 3RJUA 3NIAA 5HAQA 3WS5A 5DF9A 4BENA 2WKEA 3SS4A 1SCWA 2WK0A 5HAIA 4B4ZA 4EUZA 3FZCA 4MBKA 3HLDA 5AQ9A 3BFCA 4K91A 4R1GA 4JBFA 5EVIC 1KGEA 3HLBA 5EOOA 3G2ZA 4CPKA 2XF3A 4KQQA 1K54C 1NZUA 5KZHA 3O88A 1DJCA 2ZQ8A 3VSLA 3V39A 4YFMA 3OCNA 1H8YA 2P9VA 4LV2A 1LL9A 4OLGA 5G18A 4KZ7A 3N4IA 3CG5A 4Y0OA 4NETA 3OC2A 5FAPA 2WGWA 4QJGA 1MPLA 2EX9A 5A93A 1RGYA 3FKWA 1NJ4A 3CMZA 5CTMA 4OOMA 4FSFA 2OLVA 2JC7A 1Q2PA 2Y2HA 3UE0A 3SS5A 2QPNA 3W4OA 3MKEA 3V5MA 4EBNA 1K57C 3O86A 2WADA 2WGIA 1TEMA 2FFFB 2XK1A 2ZQAA 5JYOA 1OMEA 3UE1A 2Z2MB 3EQUA 5M19A 1XA7A 2Q9MA 3P98A 2XD1A 3OPPA 4DE0A 1ESUA 4IEDA 4MLLA 1GHPA 3G34A 4PMAA 1ONGA 3Q1FA 1XX2A 4MEZA 4DDSA 1ES4A 1KGGA 1VQQA 1GA9A 3MKFA 5EVIA 3UY6A 3WS0A 4QY6A 5DTKA 5EVID 3UN7A 1K25A 3LY4A 1SKFA 4OPZA 2C6WB 4WZ5A 4JXGA 2IWBA 3ZFZA 2HDRA 3IF5A 3N8SA 5EE8A 3UDXA 5FQIA 3SS3A 4GKUA 2ZLYA 4N9LA 3IXGA 3G35A 2UWXA 5E2FA 1KE0A 3W4QA 1XA1A 2P74A 4QD4A 3VP2A 1BTLA 4IBRA 4OH0A 1G68A 4E3OA 1NZOA 3NI9A 1IKGA 3N8LA 2V20A 4RYEA 4YINA 3GMWA 1O07A 1BLHA 4WEJA 1M40A 2XDMA 2C5WB 1IEMA 1L0EA 1SHVA 3MZDA 4S2PA 1N4OA 1J9MA 3OCLA 4FD8A 4WELA 2ZC6B 1E25A 3GR2A 4E3JA 4DRTA 3SH8A 1PZOA 1PIOA 3MBZA 3MXRA 1MWUA 1NYYA 4KZAA 4LV3A 5F82A 1IYPA 2HDSA 3GV9A 3ISGA 5CEBA 3NDEA 4MNRA 4B88A 4E3KA 5FI7A 1NY0A 3V3RA 4N92A 3N7WA 4GD8A 4EBLA 3MXSA 5I94A 5AQBA 3G32A 5DVAA 1JTGA 4UA9A 2BG1A 4KZ9A 4Z9QA 5IHVA 4A5RA 2ZM8A 1W7FA 4OQ0A 2WAEA 3HLCA 4UAAA 1BZAA 1YLTA 3VP1A 1QMEA 3ZG8B 5GLAA 1MWTA 4DDYA 1YT4A 3HLEA 4D2OA 2RL3A 4JF6A 5GLCA 3PBSA 1GA0A 1ZG4A 4U0TA 3QHYA 4LV1A 3UPOA 5GLDA 2JE5A 3D4FA 5EUAA 1GHMA 5F83A 3PBQA 1TVFA 3PBNA 1L0FA 2Y2JA 2IWDA 2FFYA 2XGNA 1ZG6A 3VP0A 1DJAA 4S2KA 1XGJA 4OP5A 4GOGA 2DCFA 2ZM0A 2HDUA 3S22A 4E6XA 1MY8A 2XR0A 4U0XA 4KZBA 4X55A 5HFOA 3IWIA 2JBFA 2J9OA 3OPLA 4PM7A 5E2GA 3TG9A 1PYYA 2Y2PA 5CGSA 2ZC5B 4QB8A 5FDHA 1XXMA 4KG5A 4IBXA 3VFHA 3ZG9B 3ZG0A 1XP4A 4S2OA 4H8RA 4RX2A 2ZMAA 3NY4A 1LHYA 2A49A 3ZDJA 2B5RA 2G2WA 3GRJA 1E4DA 3A3FA 4JXSA 1MWSA 4WZ5C 1WE4A 3BFEA 5FQKA 3NCKA 3UO9A 3LO7A 2EX6A 5J8XA 3AGDA 5U47A 1PW1A 3OPHA 4XUXA 1PI5A 3IWQA 3JYIA 4JF5A 4WMCD 5FAOA 3M6BA 4EQIA 1I5QA 4QU3A 4QHCA 3DWKA 2Y59A 2X02A 1CEGA 1HD8A 4KG6A 3HLWA 1BUEA 1HZOA 3Q81A 2XQZA 4P6BA 2ZM2A 1SDEA 1YMXA 3BECA 4OKPA 4PPRA 4OPQA 3WRZA 1PWDA 3CZDA 2ZC4B 3UPNA 4DXCA 2VGJA 1LLBA 4B4XA 5FQQA 1RP5A 4LCLA 1ES5A 2HDQA 1ES2A 1CI8A 1W8QA 1FR6A 1YM1A 3MZFA 3IF6B 3Q7VB 4K0WA 5E2HA 1DY6A 4BQMA 2J8YA 3E2LA 5CGXA 5AQAA 2G2UA 2A3UA 4OLDA 4X6TA 2XFSA 1EI5A 5M1AA 3AGEA 2ZC3B 2E8IA 4S2JA 4S2NA 3A3EA 4BLMA 1H8ZA 2EXAA 5HARA 4HESA 1G6AA 1ERQA 1YLPA 4GZBA 3ZHHA 2WAFA 3LEZA 4UA6A 4C3QA 4P0MA 1ZC2A 3HUOA 4R0QA 2OV5A 4KZ3A 3S1YA 1MXOA 3WS4A 3DWZA 3IF6A 1BSGA 4M3KA 2ZQ9A 3V50A 1RCJA 3TOIA 4JXWA 4R3BA 1ZKJA 5E43A 1PWGA 5EECA 4DXBA 5FQ9A 2WKIA 1PI4A 2PU4A 3HUNA 3BLMA 5EVLA 3BFGA 3OPRA 1E3UD 2XLNA 5A91A 5A90A 2WUQA 1K54A 1JTDA 3BFFA 3CJMA 1LI9A 2Y91A 1JWPA 1L0GA 1RGZA 3I7JA 4JKTA 4E6WA 3HBRA 3GQZA 4Y7PA 1Y54A 4BD1A 2WGVA 3PTEA 1IYQA 1FCNA 4IVKA 1DJBA 3NBLA 1BLCA 1PWCA 4LENA 5EVIB 4LV0A 4KZ4A 3NC8A 4WZ4A 1YLJA 3UE3A 1IKIA 4OPYA 5AQ7A 4JPMA 1FQGA 1KVMA 3IHAA 3S4XA 5HAPA 4BJPA 5GHYA 4Y0UA 1KE3A 3PBRA 3Q07A 3BLSA 3IHBA 4OP8A 4RX3A 2XH9A 4OPRA 1NXYA 1HTZA 3Q7ZA 4R4RA 3ZCZA 4JXVA 5DTSA 1FCMA 3V3SA 1I2WA 4GB7A 4HEFA 4BL2A 4ZDXA 5L2FA 4UHUA 3G30A 4FH4A 3UPPA 2GDNA 3M2JA 4ZJ1A 3ZGAB 3RXXA 4FCFA 3QNBA 4PM9A 2WKHA 3EQVA 4EWFA 5FASA 2DRWA 4IVIA 3G4PA 4X56A 1CI9A 3VOZA 3PAGA 1ERMA 4WYYA 2H0YA 1JWZA 1BLSA 4PM5A 1MBLA 4F94A 1W5DA 1Z6FA 2WGWB 3BYDA 4X53A 4DE3A 1FCOA 2ZD8A 3ZG7B 5FQMA 1O7EA 2ZQCA 2EXBA 2H5SA 1K6SA 4GD6A 2VGKA 4OONA 3PBTA 4OQGA 3TSGA 1K56A 4WBGA 3SH9A 4NK3A 1U60A 2XD5A 2DNSA 4O7DA 2PU2A 4UA7A 3UDFA 1IELA 3GSGA 1ONHA 3GTCA 4OOYA 1KGFA 3HREA 5HL1A 1FR1A 3N8RA 5E2EA 4KQOA 3IF6C 5DF8A 1NYMA 2Q9NA 1GHIA 5GLBA 5HW3A 2R9WA 4XUZA 2HP9A 2J7VA 4RVAA 3SOIA 3UNWA 1L2SA 2Y4AA 3IH8A 3Q7VA 4ZTKA 3IH9A 1GCEA 4MBFA 3IT9A 5CECA 5CERA 3C7VA 1TDLA 1JVJA 4DE2A 5DF7A 3NDGA 3Q82A 5KSCA 1S0WA 1MWRA 1EWZA 4PM6A 4RA7A 3FV7A 3WS1A 5GHXA 2Y2MA 1VM1A 1YLZA 4KG2A 5FSRA 4U3TA 1LI0A 4R23A 2WZZA 3IQAA 1KDWA 3MFDA 2HP5A 4S2IA 4E3NA 1K38A 1K55C 2RCXA 5EOEA 3LCEA 2EX8A 3QNCA 3A3IA 1K56D 3ZG5A 4KZ5A 2ZQDA 1XGIA 4DF6A 4DE1A 3M2KA 2IWCA 3IXDA 3C4PA 3BRMA 3VP4A 5M18A 3WRTA 3DW0A 1FSWA 5FI6A 1CEFA 5F1FA 2V1ZA 4C75A 4ID4A 5TGFA 1LL5A 1FSYA 4XXRA 4CJNA 4HBTA 3ZNYA 4N9KA 5GL9A 4X69A 3IXBA 1XPBA 2EX2A 4JLFA 4EBPA 4Q8IA 4S2MA 3E2KA 3ITBA 3P09A 1W8YA 3FWLA 1CK3A 1ALQA 1JWVA 2OSUA 2PBYA 4ZJ3A 1L0DA 4WEKA 3WS2A 3GVBA 3BEBA 5CEDA 5FI2A 1C3BA 3ZVWA 4P87A 4WM9A 2CC1A 5TFQA 3UDIA 1PZPA 1TDGA 2BLSA 2EFXA 1I2SA 5CHMA 3DTMA
chains in the Genus database with same CATH superfamily
2M7VA 5CRFA 3VSKA 2Z2LB 2Y2NA 4NG2A 2W1RA 3OZHA 3HL9A 3WWXA 4H6JA 1IYSA 1M6KA 2K7SA 3FKVA 3F1NA 1YLWA 2X01A 3ITAA 4WMCA 3O87A 3G31A 1KE4A 5HDCA 3ZVTA 5FQJA 3A0SA 3UB7A 3VFFA 2JKGA 2A24A 3MMHA 3B3XA 1SKOA 4GDBA 1OT9A 3HLGA 1BULA 2WZXA 3F1PA 3VOYA 1EROA 3MZEA 5HSQA 3A3JA 2EFUA 3VMAA 2J3TC 5TR7A 1ESIA 1K4EA 3IXHA 2XEPA 3O3VA 4MMNA 4E3LA 4GHIB 1BYWA 5CHUA 1XJ4A 3QP6A 1KVLA 3HCYA 4HNBA 2J3WA 3LEQA 4K0XA 2Q0OA 5HL6A 4BENA 5HAIA 2W27A 4XT2A 4MBKA 3HLDA 5AQ9A 1P97A 4F3LA 2XRNA 3HLBA 3G2ZA 3B33A 1NZUA 3G6OA 1DJCA 3VSLA 3E4PA 1H8YA 4O01A 3CG5A 5G4ZA 4NETA 2EX9A 1PRQA 3S7PA 5A93A 4FSFA 2QPNA 1K57C 2FFFB 5TBMB 2Q9MA 3OPPA 4FUWA 1GHPA 1ONGA 4MEZA 2VGLS 1VQQA 3MKFA 1CF0A 3WS0A 4QY6A 5DTKA 1OJGA 5F68A 3D72A 3MF0A 3SS3A 4N9LA 3G35A 5E2FA 3LR0A 3W4QA 2P74A 2PYRA 3NI9A 4YINA 2OWJA 3GMWA 4WEJA 2ZL1B 1M40A 3T4QA 1OTBA 1L0EA 4GW9A 3MZDA 4HP4A 2BASA 3GR2A 3P01A 1IYPA 3GV9A 5CEBA 4MNRA 4EBLA 3D9YA 3MXSA 2V8CA 3G32A 1JTGA 2UV0E 5IHVA 5HDSA 5IT5A 2WAEA 3VP1A 1Y4OA 4D2OA 4JF6A 3D4FA 2O99A 3PBNA 2L4RA 2QJ5A 2Y2JA 2FFYA 4I3JA 1DJAA 4OP5A 4GOGA 2DCFA 4E6XA 1F9IA 1F2KA 5F69A 2VKSA 3UE6A 5CGSA 1UGUA 2ZC5B 1SKOB 3GDIA 4IBXA 4S2OA 4H8RA 2A49A 3ZDJA 2G2WA 4HJ6A 4LRYC 4WZ5C 5FQKA 1TF1A 3AGDA 5U47A 4GHIA 3OPHA 4JF5A 4QHCA 3IX4A 3PXPA 2X02A 4KG6A 4ETZA 1HZOA 1YMXA 4PPRA 1PWDA 3CZDA 3UPNA 1OTDA 1LLBA 1TS6A 1RP5A 1H0MA 3FPVA 3IBRA 3IF6B 3IX8A 4BQMA 5M1AA 2VK3A 2XFSA 2E8IA 4S2JA 2EXAA 2ZOHA 3SZTA 2M1CA 4GZBA 2W0NA 4UA6A 4C3QA 3HUOA 3T4JA 4R0QA 4HOIA 3CLOA 4JXWA 1ZKJA 5E43A 2Z6DA 1PI4A 2PU4A 4YOFA 5EVLA 3L9KA 3C30A 1JTDA 2P04A 2VLGA 3CJMA 1JWPA 4E6WA 3HBRA 3T1SA 4BD1A 3NBLA 4LV0A 5FEFA 4KZ4A 3NC8A 1FQGA 4LGWA 1IFQA 4Y17A 3S4XA 2FH5A 1KE3A 2WKPA 2JKFA 4OPRA 1HTZA 3LIDA 1I2WA 4GB7A 3G30A 3UPPA 4R6LA 1T18A 3M2JA 4EU0A 1T1BA 3EQVA 1K0KA 4EERA 4X56A 2XA7M 2P08A 3VOZA 1JNUA 4WYYA 1JWZA 1BLSA 1Z09A 3CPTB 5FQMA 1K6SA 2VGKA 4WBGA 5J3WA 2JKRM 4NK3A 4Q0HA 3UDFA 4UA7A 3GSGA 2PAVP 4JGPA 3LIBA 5DF8A 5HW3A 4O8GA 3IH8A 1GCEA 4G3WA 5CERA 1JVJA 4DE2A 3BQAA 3KSIA 4PM6A 1EWZA 1PNEA 1VM1A 2WZZA 1T1AA 1K55C 2RCXA 2EX8A 3QNCA 3QP4A 3JVUA 3ZG5A 1G28A 4G3KA 4XT2B 4DF6A 4WF0A 3BRMA 2DMWA 1FSWA 5F1FA 2J80A 2V1ZA 4HP9A 4PKYG 4ID4A 4Q0IA 4CJNA 2QJ7A 1T19A 4N9KA 3IXBA 4Q8IA 4EBPA 5LBRA 3E2KA 1W8YA 1JWVA 2PBYA 5K5BA 4K08A 5IS1A 5CX7A 5TFQA 2CC1A 3UDIA 2PR5A 5CHMA 3UMEA 2ZMFA 5KMWA 1NLYA 5L07A 3RH8B 1WYCA 3FYZA 4JF4A 1LSXA 1PW8A 2P9VB 2CMNA 1S1YA 3A3DA 4OQIA 2WKRA 3U4LP 2JCHA 2HPBA 1K55A 1K6RA 5CHJA 1ODVA 3C5AA 4EEPA 1XKZA 3BM6A 4ME4A 2Y2OA 2V2FF 5L09A 3KYEA 4EXOA 1S4RA 1YLYA 4WLAA 2XFTA 1E3UA 3BFDA 3W8KA 2O0YA 3GECA 3LY3A 4I3IA 4R4SA 2QZ6A 5DJUA 4P85A 3LI9A 3NULA 4KENB 3HUMA 4HBUA 3FPWA 5F6AA 4ZAMA 4E3IA 1Q2QA 3RXWA 1D1JA 2NUTC 5FATA 2PRFA 1SDNA 4N1HA 5EPHA 4C6YA 5I5LA 3AGFA 1YMSA 2Y2GA 4NXGA 4BBVA 1DP8A 1KDSA 2ZOIA 1F98A 4OQHA 3E4OA 1NRFA 2KX6A 1FIKA 2D01A 3ULFA 4K91A 4R1GA 4CPKA 2XF3A 4KQQA 1NWZA 1STZA 2ZQ8A 3S7QA 3V39A 4YFMA 1YAXA 4GS9B 2P9VA 4KQDA 2AVXA 1LL9A 4LRXC 5G18A 4Y0OA 1XJ2A 3TRCA 2WGWA 2Z6CA 4CLCE 3MFXA 2V1AA 1RGYA 5CTMA 1LL8A 2OLVA 1Q2PA 1UWPX 2WADA 2Z2MB 1XA7A 1GSWA 3MSHA 3K3DA 1N9LA 3Q1FA 3T4SA 1XX2A 2EA9A 1N9OA 2KOIA 1ES4A 3UN7A 4OPZA 1TS8A 2HDRA 3IF5A 4Y3IA 1EW0A 2UWXA 1G5UA 2OAP1 2JKTM 2W1TB 1G68A 5L8MA 1IKGA 3N8LA 2V20A 1W63M 1NRJA 4S2PA 1SHVA 1N4OA 3OCLA 2W3EA 1E25A 3MQOA 1S67L 1MWUA 1NYYA 2L1MA 4LV3A 3S7NA 3A0VA 3NDEA 4B88A 3H9WA 5G4YA 5FI7A 4GD8A 5I94A 4UA9A 2BG1A 2NUPC 4PKYA 1VETB 4OQ0A 1YLTA 1QMEA 2LB9A 5GLAA 4DDYA 1YT4A 3B42A 1GA0A 4AFIA 1ZG4A 3QHYA 2PHYA 5GLDA 2JE5A 1TVFA 2VGLM 2IWDA 1ZG6A 1OT6A 3NHQA 4YWZA 4S2KA 3S22A 2OAQ1 3A0RA 1T1CA 1MY8A 2XR0A 4U0XA 4X55A 5EFWA 5HFOA 3IWIA 4PM7A 2Y2PA 3VE4A 4QB8A 4KG5A 3O5YA 3IX3A 3VFHA 3FG8A 1LHYA 2B5RA 2W3DA 2IA2A 1WE4A 3NCKA 3UO9A 1YSQA 4ESPA 1FILA 3IWQA 4WMCD 4EQIA 1DP6A 1I5QA 1HD8A 2YKFA 1S4SA 3T1QB 2ZM2A 4GCZA 5HWVA 4OPQA 1MZUA 4DXCA 5FQQA 4HI4A 3MJQA 3Q7VB 4QWOA 3C38A 3VOLA 3E2LA 5AQAA 4NXEA 3PR6A 3AGEA 2J3TD 4S2NA 5TJJA 2BTFP 1YPRA 3BJNA 1ERQA 1YLPA 1ACFA 4R38A 3IF6A 1XJ3A 5FQ9A 1XFQA 1E3UD 5A90A 3BFFA 1LI9A 3E4QA 1RGZA 3I7JA 2VEAA 3GQZA 1FCNA 4D60A 5EVIB 1YLJA 3UE3A 4JPMA 3IHAA 5HAPA 1F5MA 2V1BA 3Q07A 3BLSA 3JPUA 3IHBA 4RQ9A 1VEUB 4RX3A 2XH9A 4IJGA 3CITA 1NXYA 3ZCZA 1GSVA 1YKDA 2I9VA 4JXVA 5DTSA 4HEFA 4ZDXA 5L2FA 2A24B 3MXQA 3UB9A 1OTIA 3RXXA 4PM9A 3KO6A 5DJTA 3PAGA 1ERMA 1MBLA 4X53A 2WGWB 4IUHA 4DE3A 4H6JB 3NOUC 4JGRA 2H5SA 4OONA 4GD6A 4OQGA 3PBTA 1K56A 1CJFA 3SH9A 2XD5A 4O7DA 3QP5A 2PBDP 3N8RA 2JKRI 5E2EA 4IHQA 4KQOA 2Q9NA 5HWTA 2J7VA 1L2SA 4P6ZS 3F1OA 2PT7A 3Q7VA 5CECA 3VV4A 1TDLA 3Q82A 4BBUA 1MWRA 3FV7A 5GHXA 2Y2MA 4BBTA 1YLZA 1W63Q 1LI0A 4R23A 4NEED 4S2IA 4E3NA 5EOEA 2VJWA 2ZQDA 5IU1A 3IXDA 3DW0A 5EV0A 2PR6A 1LL5A 5MC7A 4YNRA 5GL9A 4X69A 1XPBA 2EX2A 4L9FA 4EW7A 5HZHA 3LI8A 1L0DA 5CEDA 4KUKA 4P87A 4WM9A 3F1OB 3JYIA 5BOHA 5CGWA 4R3JA 5F1GA 1H5XA 2WYXA 4HHDA 4LPZA 3KYZA 5D3OA 2H10A 1K4FA 2B18A 2I72A 4X68A 3PBOA 1QMFA 4E3MA 1YSPA 2H0TA 4KZ8A 4Y13A 3HVFA 4Y0TA 2QMIA 3C7UA 3HLFA 5KSHA 2Y55A 1S6RA 2ZQ7A 2FZ0A 3R7WB 4L0LA 1BLPA 3ZNTA 3MR0A 1WYBA 2ZJ9A 3F1NB 3VP3A 4LCMA 2WKQA 2JN7A 3MQ0A 4OVDA 4BL3A 1IOUA 5HPIA 3F1PB 1XFNA 2HV1A 4BWIA 3NECA 1MKIA 5HD5A 5FA7A 1AXBA 2Y2QA 4QY5A 3DAVA 2OLUA 3IBJA 3ZQ5A 1IYOA 3RJUA 3NIAA 5HAQA 3WS5A 2WKEA 1SCWA 4B4ZA 4EUZA 3FZCA 3BFCA 4CLCA 3ICYA 5J7EA 5EVIC 3RFBA 2O9BA 1K54C 5KZHA 2QHKA 4JGQA 1DP9A 3N4IA 3OC2A 1MPLA 1NJ4A 3CMZA 4OOMA 2Y2HA 3W4OA 3TW8A 3V5MA 4EBNA 3O86A 1TEMA 3LIEA 1OMEA 3T12B 2OWHA 1ESUA 4MLLA 4PHTA 3G34A 4PMAA 2HJ9C 5C5KA 1KGGA 4P6ZM 1GA9A 3UY6A 4PAUA 5EVID 1K25A 3LY4A 2VX8A 5TBMA 2IWBA 3ZFZA 3N8SA 5EE8A 3UDXA 5FQIA 2ZLYA 4HIAA 1XA1A 1WA9A 1BTLA 4OH0A 3CHWP 3QP1A 4MN7A 1NZOA 2VA0A 4Y2FA 2XDMA 2O9AA 2C5WB 1ZTUA 1J9MA 2ZC6B 4E3JA 3SH8A 1PZOA 1PIOA 3MBZA 2HDSA 3ISGA 3EEHA 4E3KA 4N92A 4WN5A 5DVAA 4UQIM 3DTKA 3TJZC 2ZM8A 2W3HA 4UAAA 1TD5A 4ARZB 1OTEA 3ZG8B 1MWTA 1J3WA 3HLEA 4HY8A 3PBSA 4U0TA 3UPOA 5EUAA 1GHMA 3BY8A 1L0FA 4I39A 3VP0A 3CWFA 1VB6A 3LICA 4CQHA 4KZBA 3V67A 2ACGA 2JBFA 2J9OA 1OPXA 3OPLA 3T4LA 3TG9A 2JHEA 5FDHA 1XXMA 3ZG0A 4RX2A 1LSWA 4G3VA 3KSGA 3H82A 2VV8A 1MWSA 1SZVA 3BFEA 1UWNX 1H8MA 3FC7A 2EX6A 5J8XA 1PI5A 2W1TA 5FAOA 3CUEC 3DWKA 2Y59A 4CLCD 4MDZA 3K2NA 3CPTA 3HLWA 3Q81A 4P6BA 4UEYA 2GX5A 3BECA 2ZC4B 4LCLA 1ES5A 3U2AA 2HDQA 2VZWA 3MZFA 3EGDC 4LLOB 5E2HA 3E98A 2A3UA 4OLDA 1EI5A 4BLMA 1H8ZA 5HARA 4HESA 2XROA 3BWLA 1G6AA 2WAFA 3LEZA 3S1YA 3DWZA 1BSGA 4M3KA 2ZQ9A 1OTAA 4R3BA 5EECA 2WKIA 4DJ3A 3BFGA 3OPRA 1K54A 2Y91A 1L0GA 4HJ4A 4HQAA 5HPFA 1Y54A 5AJGA 1P0ZA 1IYQA 3SW1A 2KDKA 1DJBA 4FTXA 3EGXC 1BLCA 1PWCA 3LIAA 3EEAA 4Y15A 4WZ4A 3CI6A 5AQ7A 1KVMA 2M7UA 5GHYA 4NXBA 3PBRA 4NXFA 4OP8A 1MC0A 3BQ8A 3CAXA 2KLIA 5EM0A 3V3SA 5AVEA 4BL2A 2GDNA 4ZJ1A 4FCFA 2R78A 4EWFA 3UB8A 2DRWA 4IVIA 3G4PA 2HF6A 1Z6FA 5A8BA 4KUOA 2ZD8A 1O7EA 4DMZA 1VEUA 2EXBA 3TSGA 4R70A 4DN0A 2O9CA 2K31A 3R7WA 1U60A 2DNSA 2PU2A 3GTCA 1KGFA 2HJEA 5HL1A 1FR1A 3IF6C 1NYMA 1GHIA 4ZRRA 4XUZA 1D7EA 2HP9A 3UNWA 3SOIA 1P9WA 1H3QA 4L9EA 2Y4AA 4GLQA 2VV7A 4ZTKA 4MBFA 3IT9A 1V9YA 3OBFA 5DF7A 1Y28A 1S0WA 3WS1A 4RA7A 5EM1A 4B9OA 1TS7A 2ZMVA 4U3TA 1X0OA 2A2LA 1L3LA 3IQAA 4Z1WA 5HWWA 3UMDA 4KZ5A 5FL3A 3LGOA 3LYXA 4F3LB 3WRTA 4O0PA 1CEFA 4C75A 5TGFA 4I38A 1FSYA 3NJAA 4XXRA 3DTEA 4Y5FA 2LB5A 4JLFA 2GZAA 4S2MA 3ITBA 1CK3A 4IUKA 1ALQA 3NOTC 2QKPA 4WEKA 4MN5A 3GVBA 2EWWA 2B02A 1TDGA 4EETB 1I2SA 3DTMA 2XSSA 1AWIA 4GNUA 2X71A 4LFUA 5JYPA 1BT5A 4OOLA 4MBHA 2J9PA 1NLZA 3G2YA 1LSVA 1FOFA 3K3CA 5CXWA 4HH2A 2HP6A 1XJ6A 1HVBA 1N9BA 3KSHA 3C4OA 4FH2A 3W4PA 4Q0JA 2PDRA 2R9XA 2Y2IA 4EV4A 1ES3A 4EUVA 3R4KA 1YQSA 5DTTA 2P7JA 2ZC7A 2Y2LA 4E04A 5A92A 4ZBEA 5FAQA 3T1XA 1W79A 4KQRA 3PYPA 5HX9A 3NOPC 2JKTI 4GN2A 3N6IA 3OOVA 4BD0A 1ZHHB 2G7UA 5HDDA 4GJ4A 4PM8A 4GDNA 2Y79A 5CTNA 5L10A 3QP8A 4I3AA 3M6HA 4HH3A 4S2NC 3HJKA 4S2LA 1K57A 2Y2KA 3IWOA 4N1XA 2ZBBA 5HD3A 4ZJ2A 5J4EA 4KZ6A 4DKIA 5GHZA 3SH7A 3PAEA 5AVFA 5DF9A 3SS4A 4CLCC 2WK0A 1OJ5A 4JBFA 2W3GA 2PD8A 1N9NA 1KGEA 5EOOA 4HJ3A 3JVVA 3O88A 2B95A 3OCNA 4LV2A 1CQAA 4B93A 4ETXA 4OLGA 4KZ7A 2QWSA 3PHYA 5FAPA 4WUJA 4QJGA 2GJ3A 3LFVA 3FKWA 2JC7A 3UE0A 3SS5A 1KOUA 3MKEA 2PYPA 2WGIA 2XK1A 5JYOA 2ZQAA 5FDSA 3UE1A 2PD7A 4II7A 3EQUA 5M19A 4MCWA 3P98A 2XD1A 3H82B 4DE0A 1LT0A 4IEDA 3MQQA 3T1RA 4GS9A 4DDSA 5EVIA 1D06A 3T50A 1SKFA 2C6WB 4WZ5A 4JXGA 4GKUA 3IXGA 1KE0A 4QD4A 3VP2A 4IBRA 3W2ZA 4E3OA 3MS6A 4RYEA 2MJ6A 1O07A 1BLHA 1V9ZA 1IEMA 4FD8A 4WELA 4DRTA 3MXRA 4KZAA 5F82A 2INWA 1DRMA 2EWVA 1NY0A 3V3RA 3N7WA 5F5YA 5FEGA 5AQBA 4X1LA 3EWKA 3QP2A 4KZ9A 4Z9QA 4A5RA 2XA7S 1W7FA 3HLCA 1BZAA 4BMWA 3KX0X 2Y8HA 2RL3A 5GLCA 4LV1A 5F83A 3PBQA 2XGNA 3VE3A 1XGJA 3TE8A 2VV6A 2ZM0A 2HDUA 3E0YA 3UB5P 5E2GA 1PYYA 3C2WA 4L9GA 2V0UA 3RTYA 3ZG9B 1XP4A 2ZMAA 3NY4A 3GRJA 1E4DA 3A3FA 4JXSA 4I5SA 3ZYTA 3S7OA 3OLOA 3LO7A 4EESA 2K2NA 1PW1A 4XUXA 3L7HA 3M6BA 4QU3A 2E8JA 1CEGA 1BUEA 1MKMA 3LIFA 2XQZA 3KYQA 1SDEA 4OKPA 3WRZA 2VGJA 2V9AA 4B4XA 1ES2A 1CI8A 1W8QA 1FR6A 1YM1A 4K0WA 1DY6A 2J8YA 5CGXA 2G2UA 4LRZE 4X6TA 2ZC3B 3A3EA 2YKHA 1A0KA 3ZHHA 3IS2B 4P0MA 1ZC2A 2OV5A 4KZ3A 1MXOA 3WS4A 1GSXA 3V50A 1RCJA 3BY9A 3TOIA 4DXBA 1P9RA 1PWGA 4EEUA 3HUNA 3BLMA 3BW6A 2W3FA 3P7NA 2XLNA 5A91A 3B47A 3H7WA 2WUQA 1TS0A 4JGOA 3KSFA 4X1MA 4JKTA 3LR3A 4Y7PA 2WGVA 3PTEA 5DKKA 3LR5A 2D02A 4IVKA 1VETA 4LENA 4MN6A 1IKIA 4OPYA 2OOLA 5DFYA 3T4OA 3DTIA 4BJPA 4Y0UA 3Q7ZA 4R4RA 1FCMA 3CUEA 4UHUA 4FH4A 2HZ5A 3ZGAB 1VHMA 3QNBA 2QYBA 2WKHA 2V8FA 5FASA 3LUQA 1CI9A 3UB6A 2H0YA 4PM5A 4F94A 1S66L 3HJIA 1W5DA 2ZL1A 3BYDA 4QPRA 1G6OA 2GNXA 1FCOA 3ZG7B 2ZQCA 4WL9A 3DBAA 1IELA 5KIZA 1ONHA 4OOYA 4DJ2A 3HREA 4UQIS 4X25A 5GLBA 2R9WA 2V0WA 3EOIA 4RVAA 3H7WB 4M4XA 4ARZA 2H28A 4NKPA 3IH9A 3C7VA 3T4KA 3NDGA 5KSCA 1PFLA 3C8CA 4KG2A 5FSRA 3IS2A 1KDWA 3MFDA 2HP5A 1K38A 3LCEA 1HLUP 3A3IA 1K56D 3D3OA 1XGIA 4DE1A 3M2KA 2IWCA 3C4PA 3VP4A 4CLCB 5EVEA 5M18A 4R3AA 5FI6A 5DKLA 4HBTA 2L0WA 3ZNYA 3T4TA 3P09A 3FWLA 4EQ1A 2HGVA 2OSUA 4ZJ3A 3WS2A 4FOFA 3BEBA 3LR4A 5FI2A 1C3BA 3ZVWA 5DFXA 1S1ZA 1PZPA 2BLSA 2EFXA
chains in the Genus database with same CATH topology
4GNUA 5KMWA 2X71A 5CRFA 5JYPA 3VSKA 5BOHA 2Z2LB 1BT5A 5CGWA 2Y2NA 4OOLA 1WYCA 3FYZA 4JF4A 4MBHA 4R3JA 2J9PA 1PW8A 2P9VB 5F1GA 3G2YA 1H5XA 2WYXA 3OZHA 3A3DA 4OQIA 1FOFA 3HL9A 5CXWA 3WWXA 2JCHA 2HP6A 1HVBA 1IYSA 1N9BA 1K55A 1K6RA 2HPBA 1M6KA 5D3OA 3C4OA 3FKVA 4FH2A 2H10A 5CHJA 3C5AA 1K4FA 2I72A 3W4PA 4X68A 1XKZA 3BM6A 3PBOA 1QMFA 1YLWA 2X01A 3ITAA 4WMCA 2Y2OA 3O87A 4E3MA 2H0TA 1KE4A 2V2FF 3G31A 4KZ8A 3ZVTA 5FQJA 3HVFA 2R9XA 2Y2IA 3VFFA 1ES3A 1YLYA 4EV4A 4Y0TA 2QMIA 2XFTA 1E3UA 1YQSA 3BFDA 3C7UA 3W8KA 5DTTA 3LY3A 3HLFA 2ZC7A 5KSHA 2Y2LA 4R4SA 2Y55A 5A92A 2QZ6A 4ZBEA 5FAQA 1W79A 3B3XA 1S6RA 2ZQ7A 4GDBA 4KQRA 5HX9A 3HLGA 1BULA 4P85A 4L0LA 4KENB 3HUMA 2WZXA 4HBUA 1BLPA 4GN2A 3VOYA 3N6IA 3ZNTA 1WYBA 1EROA 2ZJ9A 3MZEA 4ZAMA 4BD0A 4E3IA 1Q2QA 3VP3A 4LCMA 3RXWA 3A3JA 4PM8A 4GDNA 2EFUA 5FATA 3VMAA 5CTNA 1SDNA 4N1HA 4OVDA 5EPHA 4C6YA 4BL3A 5TR7A 3M6HA 1ESIA 3AGFA 1K4EA 4S2NC 1YMSA 3IXHA 2XEPA 3O3VA 4E3LA 2Y2GA 4S2LA 1K57A 2Y2KA 5CHUA 1KDSA 3IWOA 4N1XA 1MKIA 1KVLA 4OQHA 5FA7A 1AXBA 2Y2QA 4QY5A 4ZJ2A 4KZ6A 1NRFA 4DKIA 4K0XA 5GHZA 2OLUA 3SH7A 1IYOA 3PAEA 3RJUA 3NIAA 5HAQA 3WS5A 5DF9A 4BENA 2WKEA 3SS4A 1SCWA 2WK0A 5HAIA 4B4ZA 4EUZA 3FZCA 4MBKA 3HLDA 5AQ9A 3BFCA 4K91A 4R1GA 4JBFA 5EVIC 1KGEA 3HLBA 5EOOA 3G2ZA 4CPKA 2XF3A 4KQQA 1K54C 1NZUA 5KZHA 3O88A 1DJCA 2ZQ8A 3VSLA 3V39A 4YFMA 3OCNA 1H8YA 2P9VA 4LV2A 1LL9A 4OLGA 5G18A 4KZ7A 3N4IA 3CG5A 4Y0OA 4NETA 3OC2A 5FAPA 2WGWA 4QJGA 1MPLA 2EX9A 5A93A 1RGYA 3FKWA 1NJ4A 3CMZA 5CTMA 4OOMA 4FSFA 2OLVA 2JC7A 1Q2PA 2Y2HA 3UE0A 3SS5A 2QPNA 3W4OA 3MKEA 3V5MA 4EBNA 1K57C 3O86A 2WADA 2WGIA 1TEMA 2FFFB 2XK1A 2ZQAA 5JYOA 1OMEA 3UE1A 2Z2MB 3EQUA 5M19A 1XA7A 2Q9MA 3P98A 2XD1A 3OPPA 4DE0A 1ESUA 4IEDA 4MLLA 1GHPA 3G34A 4PMAA 1ONGA 3Q1FA 1XX2A 4MEZA 4DDSA 1ES4A 1KGGA 1VQQA 1GA9A 3MKFA 5EVIA 3UY6A 3WS0A 4QY6A 5DTKA 5EVID 3UN7A 1K25A 3LY4A 1SKFA 4OPZA 2C6WB 4WZ5A 4JXGA 2IWBA 3ZFZA 2HDRA 3IF5A 3N8SA 5EE8A 3UDXA 5FQIA 3SS3A 4GKUA 2ZLYA 4N9LA 3IXGA 3G35A 2UWXA 5E2FA 1KE0A 3W4QA 1XA1A 2P74A 4QD4A 3VP2A 1BTLA 4IBRA 4OH0A 1G68A 4E3OA 1NZOA 3NI9A 1IKGA 3N8LA 2V20A 4RYEA 4YINA 3GMWA 1O07A 1BLHA 4WEJA 1M40A 2XDMA 2C5WB 1IEMA 1L0EA 1SHVA 3MZDA 4S2PA 1N4OA 1J9MA 3OCLA 4FD8A 4WELA 2ZC6B 1E25A 3GR2A 4E3JA 4DRTA 3SH8A 1PZOA 1PIOA 3MBZA 3MXRA 1MWUA 1NYYA 4KZAA 4LV3A 5F82A 1IYPA 2HDSA 3GV9A 3ISGA 5CEBA 3NDEA 4MNRA 4B88A 4E3KA 5FI7A 1NY0A 3V3RA 4N92A 3N7WA 4GD8A 4EBLA 3MXSA 5I94A 5AQBA 3G32A 5DVAA 1JTGA 4UA9A 2BG1A 4KZ9A 4Z9QA 5IHVA 4A5RA 2ZM8A 1W7FA 4OQ0A 2WAEA 3HLCA 4UAAA 1BZAA 1YLTA 3VP1A 1QMEA 3ZG8B 5GLAA 1MWTA 4DDYA 1YT4A 3HLEA 4D2OA 2RL3A 4JF6A 5GLCA 3PBSA 1GA0A 1ZG4A 4U0TA 3QHYA 4LV1A 3UPOA 5GLDA 2JE5A 3D4FA 5EUAA 1GHMA 5F83A 3PBQA 1TVFA 3PBNA 1L0FA 2Y2JA 2IWDA 2FFYA 2XGNA 1ZG6A 3VP0A 1DJAA 4S2KA 1XGJA 4OP5A 4GOGA 2DCFA 2ZM0A 2HDUA 3S22A 4E6XA 1MY8A 2XR0A 4U0XA 4KZBA 4X55A 5HFOA 3IWIA 2JBFA 2J9OA 3OPLA 4PM7A 5E2GA 3TG9A 1PYYA 2Y2PA 5CGSA 2ZC5B 4QB8A 5FDHA 1XXMA 4KG5A 4IBXA 3VFHA 3ZG9B 3ZG0A 1XP4A 4S2OA 4H8RA 4RX2A 2ZMAA 3NY4A 1LHYA 2A49A 3ZDJA 2B5RA 2G2WA 3GRJA 1E4DA 3A3FA 4JXSA 1MWSA 4WZ5C 1WE4A 3BFEA 5FQKA 3NCKA 3UO9A 3LO7A 2EX6A 5J8XA 3AGDA 5U47A 1PW1A 3OPHA 4XUXA 1PI5A 3IWQA 3JYIA 4JF5A 4WMCD 5FAOA 3M6BA 4EQIA 1I5QA 4QU3A 4QHCA 3DWKA 2Y59A 2X02A 1CEGA 1HD8A 4KG6A 3HLWA 1BUEA 1HZOA 3Q81A 2XQZA 4P6BA 2ZM2A 1SDEA 1YMXA 3BECA 4OKPA 4PPRA 4OPQA 3WRZA 1PWDA 3CZDA 2ZC4B 3UPNA 4DXCA 2VGJA 1LLBA 4B4XA 5FQQA 1RP5A 4LCLA 1ES5A 2HDQA 1ES2A 1CI8A 1W8QA 1FR6A 1YM1A 3MZFA 3IF6B 3Q7VB 4K0WA 5E2HA 1DY6A 4BQMA 2J8YA 3E2LA 5CGXA 5AQAA 2G2UA 2A3UA 4OLDA 4X6TA 2XFSA 1EI5A 5M1AA 3AGEA 2ZC3B 2E8IA 4S2JA 4S2NA 3A3EA 4BLMA 1H8ZA 2EXAA 5HARA 4HESA 1G6AA 1ERQA 1YLPA 4GZBA 3ZHHA 2WAFA 3LEZA 4UA6A 4C3QA 4P0MA 1ZC2A 3HUOA 4R0QA 2OV5A 4KZ3A 3S1YA 1MXOA 3WS4A 3DWZA 3IF6A 1BSGA 4M3KA 2ZQ9A 3V50A 1RCJA 3TOIA 4JXWA 4R3BA 1ZKJA 5E43A 1PWGA 5EECA 4DXBA 5FQ9A 2WKIA 1PI4A 2PU4A 3HUNA 3BLMA 5EVLA 3BFGA 3OPRA 1E3UD 2XLNA 5A91A 5A90A 2WUQA 1K54A 1JTDA 3BFFA 3CJMA 1LI9A 2Y91A 1JWPA 1L0GA 1RGZA 3I7JA 4JKTA 4E6WA 3HBRA 3GQZA 4Y7PA 1Y54A 4BD1A 2WGVA 3PTEA 1IYQA 1FCNA 4IVKA 1DJBA 3NBLA 1BLCA 1PWCA 4LENA 5EVIB 4LV0A 4KZ4A 3NC8A 4WZ4A 1YLJA 3UE3A 1IKIA 4OPYA 5AQ7A 4JPMA 1FQGA 1KVMA 3IHAA 3S4XA 5HAPA 4BJPA 5GHYA 4Y0UA 1KE3A 3PBRA 3Q07A 3BLSA 3IHBA 4OP8A 4RX3A 2XH9A 4OPRA 1NXYA 1HTZA 3Q7ZA 4R4RA 3ZCZA 4JXVA 5DTSA 1FCMA 3V3SA 1I2WA 4GB7A 4HEFA 4BL2A 4ZDXA 5L2FA 4UHUA 3G30A 4FH4A 3UPPA 2GDNA 3M2JA 4ZJ1A 3ZGAB 3RXXA 4FCFA 3QNBA 4PM9A 2WKHA 3EQVA 4EWFA 5FASA 2DRWA 4IVIA 3G4PA 4X56A 1CI9A 3VOZA 3PAGA 1ERMA 4WYYA 2H0YA 1JWZA 1BLSA 4PM5A 1MBLA 4F94A 1W5DA 1Z6FA 2WGWB 3BYDA 4X53A 4DE3A 1FCOA 2ZD8A 3ZG7B 5FQMA 1O7EA 2ZQCA 2EXBA 2H5SA 1K6SA 4GD6A 2VGKA 4OONA 3PBTA 4OQGA 3TSGA 1K56A 4WBGA 3SH9A 4NK3A 1U60A 2XD5A 2DNSA 4O7DA 2PU2A 4UA7A 3UDFA 1IELA 3GSGA 1ONHA 3GTCA 4OOYA 1KGFA 3HREA 5HL1A 1FR1A 3N8RA 5E2EA 4KQOA 3IF6C 5DF8A 1NYMA 2Q9NA 1GHIA 5GLBA 5HW3A 2R9WA 4XUZA 2HP9A 2J7VA 4RVAA 3SOIA 3UNWA 1L2SA 2Y4AA 3IH8A 3Q7VA 4ZTKA 3IH9A 1GCEA 4MBFA 3IT9A 5CECA 5CERA 3C7VA 1TDLA 1JVJA 4DE2A 5DF7A 3NDGA 3Q82A 5KSCA 1S0WA 1MWRA 1EWZA 4PM6A 4RA7A 3FV7A 3WS1A 5GHXA 2Y2MA 1VM1A 1YLZA 4KG2A 5FSRA 4U3TA 1LI0A 4R23A 2WZZA 3IQAA 1KDWA 3MFDA 2HP5A 4S2IA 4E3NA 1K38A 1K55C 2RCXA 5EOEA 3LCEA 2EX8A 3QNCA 3A3IA 1K56D 3ZG5A 4KZ5A 2ZQDA 1XGIA 4DF6A 4DE1A 3M2KA 2IWCA 3IXDA 3C4PA 3BRMA 3VP4A 5M18A 3WRTA 3DW0A 1FSWA 5FI6A 1CEFA 5F1FA 2V1ZA 4C75A 4ID4A 5TGFA 1LL5A 1FSYA 4XXRA 4CJNA 4HBTA 3ZNYA 4N9KA 5GL9A 4X69A 3IXBA 1XPBA 2EX2A 4JLFA 4EBPA 4Q8IA 4S2MA 3E2KA 3ITBA 3P09A 1W8YA 3FWLA 1CK3A 1ALQA 1JWVA 2OSUA 2PBYA 4ZJ3A 1L0DA 4WEKA 3WS2A 3GVBA 3BEBA 5CEDA 5FI2A 1C3BA 3ZVWA 4P87A 4WM9A 2CC1A 5TFQA 3UDIA 1PZPA 1TDGA 2BLSA 2EFXA 1I2SA 5CHMA 3DTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GNU A;  5KMW A;  2X71 A;  5CRF A;  5JYP A;  3VSK A;  5BOH A;  2Z2L B;  1BT5 A;  5CGW A;  2Y2N A;  4OOL A;  1WYC A;  3FYZ A;  4JF4 A;  4MBH A;  4R3J A;  2J9P A;  1PW8 A;  2P9V B;  5F1G A;  3G2Y A;  1H5X A;  2WYX A;  3OZH A;  3A3D A;  4OQI A;  1FOF A;  3HL9 A;  5CXW A;  3WWX A;  2JCH A;  2HP6 A;  1HVB A;  1IYS A;  1N9B A;  1K55 A;  1K6R A;  2HPB A;  1M6K A;  5D3O A;  3C4O A;  3FKV A;  4FH2 A;  2H10 A;  5CHJ A;  3C5A A;  1K4F A;  2I72 A;  3W4P A;  4X68 A;  1XKZ A;  3BM6 A;  3PBO A;  1QMF A;  1YLW A;  2X01 A;  3ITA A;  4WMC A;  2Y2O A;  3O87 A;  4E3M A;  2H0T A;  1KE4 A;  2V2F F;  3G31 A;  4KZ8 A;  3ZVT A;  5FQJ A;  3HVF A;  2R9X A;  2Y2I A;  3VFF A;  1ES3 A;  1YLY A;  4EV4 A;  4Y0T A;  2QMI A;  2XFT A;  1E3U A;  1YQS A;  3BFD A;  3C7U A;  3W8K A;  5DTT A;  3LY3 A;  3HLF A;  2ZC7 A;  5KSH A;  2Y2L A;  4R4S A;  2Y55 A;  5A92 A;  2QZ6 A;  4ZBE A;  5FAQ A;  1W79 A;  3B3X A;  1S6R A;  2ZQ7 A;  4GDB A;  4KQR A;  5HX9 A;  3HLG A;  1BUL A;  4P85 A;  4L0L A;  4KEN B;  3HUM A;  2WZX A;  4HBU A;  1BLP A;  4GN2 A;  3VOY A;  3N6I A;  3ZNT A;  1WYB A;  1ERO A;  2ZJ9 A;  3MZE A;  4ZAM A;  4BD0 A;  4E3I A;  1Q2Q A;  3VP3 A;  4LCM A;  3RXW A;  3A3J A;  4PM8 A;  4GDN A;  2EFU A;  5FAT A;  3VMA A;  5CTN A;  1SDN A;  4N1H A;  4OVD A;  5EPH A;  4C6Y A;  4BL3 A;  5TR7 A;  3M6H A;  1ESI A;  3AGF A;  1K4E A;  4S2N C;  1YMS A;  3IXH A;  2XEP A;  3O3V A;  4E3L A;  2Y2G A;  4S2L A;  1K57 A;  2Y2K A;  5CHU A;  1KDS A;  3IWO A;  4N1X A;  1MKI A;  1KVL A;  4OQH A;  5FA7 A;  1AXB A;  2Y2Q A;  4QY5 A;  4ZJ2 A;  4KZ6 A;  1NRF A;  4DKI A;  4K0X A;  5GHZ A;  2OLU A;  3SH7 A;  1IYO A;  3PAE A;  3RJU A;  3NIA A;  5HAQ A;  3WS5 A;  5DF9 A;  4BEN A;  2WKE A;  3SS4 A;  1SCW A;  2WK0 A;  5HAI A;  4B4Z A;  4EUZ A;  3FZC A;  4MBK A;  3HLD A;  5AQ9 A;  3BFC A;  4K91 A;  4R1G A;  4JBF A;  5EVI C;  1KGE A;  3HLB A;  5EOO A;  3G2Z A;  4CPK A;  2XF3 A;  4KQQ A;  1K54 C;  1NZU A;  5KZH A;  3O88 A;  1DJC A;  2ZQ8 A;  3VSL A;  3V39 A;  4YFM A;  3OCN A;  1H8Y A;  2P9V A;  4LV2 A;  1LL9 A;  4OLG A;  5G18 A;  4KZ7 A;  3N4I A;  3CG5 A;  4Y0O A;  4NET A;  3OC2 A;  5FAP A;  2WGW A;  4QJG A;  1MPL A;  2EX9 A;  5A93 A;  1RGY A;  3FKW A;  1NJ4 A;  3CMZ A;  5CTM A;  4OOM A;  4FSF A;  2OLV A;  2JC7 A;  1Q2P A;  2Y2H A;  3UE0 A;  3SS5 A;  2QPN A;  3W4O A;  3MKE A;  3V5M A;  4EBN A;  1K57 C;  3O86 A;  2WAD A;  2WGI A;  1TEM A;  2FFF B;  2XK1 A;  2ZQA A;  5JYO A;  1OME A;  3UE1 A;  2Z2M B;  3EQU A;  5M19 A;  1XA7 A;  2Q9M A;  3P98 A;  2XD1 A;  3OPP A;  4DE0 A;  1ESU A;  4IED A;  4MLL A;  1GHP A;  3G34 A;  4PMA A;  1ONG A;  3Q1F A;  1XX2 A;  4MEZ A;  4DDS A;  1ES4 A;  1KGG A;  1VQQ A;  1GA9 A;  3MKF A;  5EVI A;  3UY6 A;  3WS0 A;  4QY6 A;  5DTK A;  5EVI D;  3UN7 A;  1K25 A;  3LY4 A;  1SKF A;  4OPZ A;  2C6W B;  4WZ5 A;  4JXG A;  2IWB A;  3ZFZ A;  2HDR A;  3IF5 A;  3N8S A;  5EE8 A;  3UDX A;  5FQI A;  3SS3 A;  4GKU A;  2ZLY A;  4N9L A;  3IXG A;  3G35 A;  2UWX A;  5E2F A;  1KE0 A;  3W4Q A;  1XA1 A;  2P74 A;  4QD4 A;  3VP2 A;  1BTL A;  4IBR A;  4OH0 A;  1G68 A;  4E3O A;  1NZO A;  3NI9 A;  1IKG A;  3N8L A;  2V20 A;  4RYE A;  4YIN A;  3GMW A;  1O07 A;  1BLH A;  4WEJ A;  1M40 A;  2XDM A;  2C5W B;  1IEM A;  1L0E A;  1SHV A;  3MZD A;  4S2P A;  1N4O A;  1J9M A;  3OCL A;  4FD8 A;  4WEL A;  2ZC6 B;  1E25 A;  3GR2 A;  4E3J A;  4DRT A;  3SH8 A;  1PZO A;  1PIO A;  3MBZ A;  3MXR A;  1MWU A;  1NYY A;  4KZA A;  4LV3 A;  5F82 A;  1IYP A;  2HDS A;  3GV9 A;  3ISG A;  5CEB A;  3NDE A;  4MNR A;  4B88 A;  4E3K A;  5FI7 A;  1NY0 A;  3V3R A;  4N92 A;  3N7W A;  4GD8 A;  4EBL A;  3MXS A;  5I94 A;  5AQB A;  3G32 A;  5DVA A;  1JTG A;  4UA9 A;  2BG1 A;  4KZ9 A;  4Z9Q A;  5IHV A;  4A5R A;  2ZM8 A;  1W7F A;  4OQ0 A;  2WAE A;  3HLC A;  4UAA A;  1BZA A;  1YLT A;  3VP1 A;  1QME A;  3ZG8 B;  5GLA A;  1MWT A;  4DDY A;  1YT4 A;  3HLE A;  4D2O A;  2RL3 A;  4JF6 A;  5GLC A;  3PBS A;  1GA0 A;  1ZG4 A;  4U0T A;  3QHY A;  4LV1 A;  3UPO A;  5GLD A;  2JE5 A;  3D4F A;  5EUA A;  1GHM A;  5F83 A;  3PBQ A;  1TVF A;  3PBN A;  1L0F A;  2Y2J A;  2IWD A;  2FFY A;  2XGN A;  1ZG6 A;  3VP0 A;  1DJA A;  4S2K A;  1XGJ A;  4OP5 A;  4GOG A;  2DCF A;  2ZM0 A;  2HDU A;  3S22 A;  4E6X A;  1MY8 A;  2XR0 A;  4U0X A;  4KZB A;  4X55 A;  5HFO A;  3IWI A;  2JBF A;  2J9O A;  3OPL A;  4PM7 A;  5E2G A;  3TG9 A;  1PYY A;  2Y2P A;  5CGS A;  2ZC5 B;  4QB8 A;  5FDH A;  1XXM A;  4KG5 A;  4IBX A;  3VFH A;  3ZG9 B;  3ZG0 A;  1XP4 A;  4S2O A;  4H8R A;  4RX2 A;  2ZMA A;  3NY4 A;  1LHY A;  2A49 A;  3ZDJ A;  2B5R A;  2G2W A;  3GRJ A;  1E4D A;  3A3F A;  4JXS A;  1MWS A;  4WZ5 C;  1WE4 A;  3BFE A;  5FQK A;  3NCK A;  3UO9 A;  3LO7 A;  2EX6 A;  5J8X A;  3AGD A;  5U47 A;  1PW1 A;  3OPH A;  4XUX A;  1PI5 A;  3IWQ A;  3JYI A;  4JF5 A;  4WMC D;  5FAO A;  3M6B A;  4EQI A;  1I5Q A;  4QU3 A;  4QHC A;  3DWK A;  2Y59 A;  2X02 A;  1CEG A;  1HD8 A;  4KG6 A;  3HLW A;  1BUE A;  1HZO A;  3Q81 A;  2XQZ A;  4P6B A;  2ZM2 A;  1SDE A;  1YMX A;  3BEC A;  4OKP A;  4PPR A;  4OPQ A;  3WRZ A;  1PWD A;  3CZD A;  2ZC4 B;  3UPN A;  4DXC A;  2VGJ A;  1LLB A;  4B4X A;  5FQQ A;  1RP5 A;  4LCL A;  1ES5 A;  2HDQ A;  1ES2 A;  1CI8 A;  1W8Q A;  1FR6 A;  1YM1 A;  3MZF A;  3IF6 B;  3Q7V B;  4K0W A;  5E2H A;  1DY6 A;  4BQM A;  2J8Y A;  3E2L A;  5CGX A;  5AQA A;  2G2U A;  2A3U A;  4OLD A;  4X6T A;  2XFS A;  1EI5 A;  5M1A A;  3AGE A;  2ZC3 B;  2E8I A;  4S2J A;  4S2N A;  3A3E A;  4BLM A;  1H8Z A;  2EXA A;  5HAR A;  4HES A;  1G6A A;  1ERQ A;  1YLP A;  4GZB A;  3ZHH A;  2WAF A;  3LEZ A;  4UA6 A;  4C3Q A;  4P0M A;  1ZC2 A;  3HUO A;  4R0Q A;  2OV5 A;  4KZ3 A;  3S1Y A;  1MXO A;  3WS4 A;  3DWZ A;  3IF6 A;  1BSG A;  4M3K A;  2ZQ9 A;  3V50 A;  1RCJ A;  3TOI A;  4JXW A;  4R3B A;  1ZKJ A;  5E43 A;  1PWG A;  5EEC A;  4DXB A;  5FQ9 A;  2WKI A;  1PI4 A;  2PU4 A;  3HUN A;  3BLM A;  5EVL A;  3BFG A;  3OPR A;  1E3U D;  2XLN A;  5A91 A;  5A90 A;  2WUQ A;  1K54 A;  1JTD A;  3BFF A;  3CJM A;  1LI9 A;  2Y91 A;  1JWP A;  1L0G A;  1RGZ A;  3I7J A;  4JKT A;  4E6W A;  3HBR A;  3GQZ A;  4Y7P A;  1Y54 A;  4BD1 A;  2WGV A;  3PTE A;  1IYQ A;  1FCN A;  4IVK A;  1DJB A;  3NBL A;  1BLC A;  1PWC A;  4LEN A;  5EVI B;  4LV0 A;  4KZ4 A;  3NC8 A;  4WZ4 A;  1YLJ A;  3UE3 A;  1IKI A;  4OPY A;  5AQ7 A;  4JPM A;  1FQG A;  1KVM A;  3IHA A;  3S4X A;  5HAP A;  4BJP A;  5GHY A;  4Y0U A;  1KE3 A;  3PBR A;  3Q07 A;  3BLS A;  3IHB A;  4OP8 A;  4RX3 A;  2XH9 A;  4OPR A;  1NXY A;  1HTZ A;  3Q7Z A;  4R4R A;  3ZCZ A;  4JXV A;  5DTS A;  1FCM A;  3V3S A;  1I2W A;  4GB7 A;  4HEF A;  4BL2 A;  4ZDX A;  5L2F A;  4UHU A;  3G30 A;  4FH4 A;  3UPP A;  2GDN A;  3M2J A;  4ZJ1 A;  3ZGA B;  3RXX A;  4FCF A;  3QNB A;  4PM9 A;  2WKH A;  3EQV A;  4EWF A;  5FAS A;  2DRW A;  4IVI A;  3G4P A;  4X56 A;  1CI9 A;  3VOZ A;  3PAG A;  1ERM A;  4WYY A;  2H0Y A;  1JWZ A;  1BLS A;  4PM5 A;  1MBL A;  4F94 A;  1W5D A;  1Z6F A;  2WGW B;  3BYD A;  4X53 A;  4DE3 A;  1FCO A;  2ZD8 A;  3ZG7 B;  5FQM A;  1O7E A;  2ZQC A;  2EXB A;  2H5S A;  1K6S A;  4GD6 A;  2VGK A;  4OON A;  3PBT A;  4OQG A;  3TSG A;  1K56 A;  4WBG A;  3SH9 A;  4NK3 A;  1U60 A;  2XD5 A;  2DNS A;  4O7D A;  2PU2 A;  4UA7 A;  3UDF A;  1IEL A;  3GSG A;  1ONH A;  3GTC A;  4OOY A;  1KGF A;  3HRE A;  5HL1 A;  1FR1 A;  3N8R A;  5E2E A;  4KQO A;  3IF6 C;  5DF8 A;  1NYM A;  2Q9N A;  1GHI A;  5GLB A;  5HW3 A;  2R9W A;  4XUZ A;  2HP9 A;  2J7V A;  4RVA A;  3SOI A;  3UNW A;  1L2S A;  2Y4A A;  3IH8 A;  3Q7V A;  4ZTK A;  3IH9 A;  1GCE A;  4MBF A;  3IT9 A;  5CEC A;  5CER A;  3C7V A;  1TDL A;  1JVJ A;  4DE2 A;  5DF7 A;  3NDG A;  3Q82 A;  5KSC A;  1S0W A;  1MWR A;  1EWZ A;  4PM6 A;  4RA7 A;  3FV7 A;  3WS1 A;  5GHX A;  2Y2M A;  1VM1 A;  1YLZ A;  4KG2 A;  5FSR A;  4U3T A;  1LI0 A;  4R23 A;  2WZZ A;  3IQA A;  1KDW A;  3MFD A;  2HP5 A;  4S2I A;  4E3N A;  1K38 A;  1K55 C;  2RCX A;  5EOE A;  3LCE A;  2EX8 A;  3QNC A;  3A3I A;  1K56 D;  3ZG5 A;  4KZ5 A;  2ZQD A;  1XGI A;  4DF6 A;  4DE1 A;  3M2K A;  2IWC A;  3IXD A;  3C4P A;  3BRM A;  3VP4 A;  5M18 A;  3WRT A;  3DW0 A;  1FSW A;  5FI6 A;  1CEF A;  5F1F A;  2V1Z A;  4C75 A;  4ID4 A;  5TGF A;  1LL5 A;  1FSY A;  4XXR A;  4CJN A;  4HBT A;  3ZNY A;  4N9K A;  5GL9 A;  4X69 A;  3IXB A;  1XPB A;  2EX2 A;  4JLF A;  4EBP A;  4Q8I A;  4S2M A;  3E2K A;  3ITB A;  3P09 A;  1W8Y A;  3FWL A;  1CK3 A;  1ALQ A;  1JWV A;  2OSU A;  2PBY A;  4ZJ3 A;  1L0D A;  4WEK A;  3WS2 A;  3GVB A;  3BEB A;  5CED A;  5FI2 A;  1C3B A;  3ZVW A;  4P87 A;  4WM9 A;  2CC1 A;  5TFQ A;  3UDI A;  1PZP A;  1TDG A;  2BLS A;  2EFX A;  1I2S A;  5CHM A;  3DTM A; 
#chains in the Genus database with same CATH topology
 2M7V A;  5CRF A;  3VSK A;  2Z2L B;  2Y2N A;  4NG2 A;  2W1R A;  3OZH A;  3HL9 A;  3WWX A;  4H6J A;  1IYS A;  1M6K A;  2K7S A;  3FKV A;  3F1N A;  1YLW A;  2X01 A;  3ITA A;  4WMC A;  3O87 A;  3G31 A;  1KE4 A;  5HDC A;  3ZVT A;  5FQJ A;  3A0S A;  3UB7 A;  3VFF A;  2JKG A;  2A24 A;  3MMH A;  3B3X A;  1SKO A;  4GDB A;  1OT9 A;  3HLG A;  1BUL A;  2WZX A;  3F1P A;  3VOY A;  1ERO A;  3MZE A;  5HSQ A;  3A3J A;  2EFU A;  3VMA A;  2J3T C;  5TR7 A;  1ESI A;  1K4E A;  3IXH A;  2XEP A;  3O3V A;  4MMN A;  4E3L A;  4GHI B;  1BYW A;  5CHU A;  1XJ4 A;  3QP6 A;  1KVL A;  3HCY A;  4HNB A;  2J3W A;  3LEQ A;  4K0X A;  2Q0O A;  5HL6 A;  4BEN A;  5HAI A;  2W27 A;  4XT2 A;  4MBK A;  3HLD A;  5AQ9 A;  1P97 A;  4F3L A;  2XRN A;  3HLB A;  3G2Z A;  3B33 A;  1NZU A;  3G6O A;  1DJC A;  3VSL A;  3E4P A;  1H8Y A;  4O01 A;  3CG5 A;  5G4Z A;  4NET A;  2EX9 A;  1PRQ A;  3S7P A;  5A93 A;  4FSF A;  2QPN A;  1K57 C;  2FFF B;  5TBM B;  2Q9M A;  3OPP A;  4FUW A;  1GHP A;  1ONG A;  4MEZ A;  2VGL S;  1VQQ A;  3MKF A;  1CF0 A;  3WS0 A;  4QY6 A;  5DTK A;  1OJG A;  5F68 A;  3D72 A;  3MF0 A;  3SS3 A;  4N9L A;  3G35 A;  5E2F A;  3LR0 A;  3W4Q A;  2P74 A;  2PYR A;  3NI9 A;  4YIN A;  2OWJ A;  3GMW A;  4WEJ A;  2ZL1 B;  1M40 A;  3T4Q A;  1OTB A;  1L0E A;  4GW9 A;  3MZD A;  4HP4 A;  2BAS A;  3GR2 A;  3P01 A;  1IYP A;  3GV9 A;  5CEB A;  4MNR A;  4EBL A;  3D9Y A;  3MXS A;  2V8C A;  3G32 A;  1JTG A;  2UV0 E;  5IHV A;  5HDS A;  5IT5 A;  2WAE A;  3VP1 A;  1Y4O A;  4D2O A;  4JF6 A;  3D4F A;  2O99 A;  3PBN A;  2L4R A;  2QJ5 A;  2Y2J A;  2FFY A;  4I3J A;  1DJA A;  4OP5 A;  4GOG A;  2DCF A;  4E6X A;  1F9I A;  1F2K A;  5F69 A;  2VKS A;  3UE6 A;  5CGS A;  1UGU A;  2ZC5 B;  1SKO B;  3GDI A;  4IBX A;  4S2O A;  4H8R A;  2A49 A;  3ZDJ A;  2G2W A;  4HJ6 A;  4LRY C;  4WZ5 C;  5FQK A;  1TF1 A;  3AGD A;  5U47 A;  4GHI A;  3OPH A;  4JF5 A;  4QHC A;  3IX4 A;  3PXP A;  2X02 A;  4KG6 A;  4ETZ A;  1HZO A;  1YMX A;  4PPR A;  1PWD A;  3CZD A;  3UPN A;  1OTD A;  1LLB A;  1TS6 A;  1RP5 A;  1H0M A;  3FPV A;  3IBR A;  3IF6 B;  3IX8 A;  4BQM A;  5M1A A;  2VK3 A;  2XFS A;  2E8I A;  4S2J A;  2EXA A;  2ZOH A;  3SZT A;  2M1C A;  4GZB A;  2W0N A;  4UA6 A;  4C3Q A;  3HUO A;  3T4J A;  4R0Q A;  4HOI A;  3CLO A;  4JXW A;  1ZKJ A;  5E43 A;  2Z6D A;  1PI4 A;  2PU4 A;  4YOF A;  5EVL A;  3L9K A;  3C30 A;  1JTD A;  2P04 A;  2VLG A;  3CJM A;  1JWP A;  4E6W A;  3HBR A;  3T1S A;  4BD1 A;  3NBL A;  4LV0 A;  5FEF A;  4KZ4 A;  3NC8 A;  1FQG A;  4LGW A;  1IFQ A;  4Y17 A;  3S4X A;  2FH5 A;  1KE3 A;  2WKP A;  2JKF A;  4OPR A;  1HTZ A;  3LID A;  1I2W A;  4GB7 A;  3G30 A;  3UPP A;  4R6L A;  1T18 A;  3M2J A;  4EU0 A;  1T1B A;  3EQV A;  1K0K A;  4EER A;  4X56 A;  2XA7 M;  2P08 A;  3VOZ A;  1JNU A;  4WYY A;  1JWZ A;  1BLS A;  1Z09 A;  3CPT B;  5FQM A;  1K6S A;  2VGK A;  4WBG A;  5J3W A;  2JKR M;  4NK3 A;  4Q0H A;  3UDF A;  4UA7 A;  3GSG A;  2PAV P;  4JGP A;  3LIB A;  5DF8 A;  5HW3 A;  4O8G A;  3IH8 A;  1GCE A;  4G3W A;  5CER A;  1JVJ A;  4DE2 A;  3BQA A;  3KSI A;  4PM6 A;  1EWZ A;  1PNE A;  1VM1 A;  2WZZ A;  1T1A A;  1K55 C;  2RCX A;  2EX8 A;  3QNC A;  3QP4 A;  3JVU A;  3ZG5 A;  1G28 A;  4G3K A;  4XT2 B;  4DF6 A;  4WF0 A;  3BRM A;  2DMW A;  1FSW A;  5F1F A;  2J80 A;  2V1Z A;  4HP9 A;  4PKY G;  4ID4 A;  4Q0I A;  4CJN A;  2QJ7 A;  1T19 A;  4N9K A;  3IXB A;  4Q8I A;  4EBP A;  5LBR A;  3E2K A;  1W8Y A;  1JWV A;  2PBY A;  5K5B A;  4K08 A;  5IS1 A;  5CX7 A;  5TFQ A;  2CC1 A;  3UDI A;  2PR5 A;  5CHM A;  3UME A;  2ZMF A;  5KMW A;  1NLY A;  5L07 A;  3RH8 B;  1WYC A;  3FYZ A;  4JF4 A;  1LSX A;  1PW8 A;  2P9V B;  2CMN A;  1S1Y A;  3A3D A;  4OQI A;  2WKR A;  3U4L P;  2JCH A;  2HPB A;  1K55 A;  1K6R A;  5CHJ A;  1ODV A;  3C5A A;  4EEP A;  1XKZ A;  3BM6 A;  4ME4 A;  2Y2O A;  2V2F F;  5L09 A;  3KYE A;  4EXO A;  1S4R A;  1YLY A;  4WLA A;  2XFT A;  1E3U A;  3BFD A;  3W8K A;  2O0Y A;  3GEC A;  3LY3 A;  4I3I A;  4R4S A;  2QZ6 A;  5DJU A;  4P85 A;  3LI9 A;  3NUL A;  4KEN B;  3HUM A;  4HBU A;  3FPW A;  5F6A A;  4ZAM A;  4E3I A;  1Q2Q A;  3RXW A;  1D1J A;  2NUT C;  5FAT A;  2PRF A;  1SDN A;  4N1H A;  5EPH A;  4C6Y A;  5I5L A;  3AGF A;  1YMS A;  2Y2G A;  4NXG A;  4BBV A;  1DP8 A;  1KDS A;  2ZOI A;  1F98 A;  4OQH A;  3E4O A;  1NRF A;  2KX6 A;  1FIK A;  2D01 A;  3ULF A;  4K91 A;  4R1G A;  4CPK A;  2XF3 A;  4KQQ A;  1NWZ A;  1STZ A;  2ZQ8 A;  3S7Q A;  3V39 A;  4YFM A;  1YAX A;  4GS9 B;  2P9V A;  4KQD A;  2AVX A;  1LL9 A;  4LRX C;  5G18 A;  4Y0O A;  1XJ2 A;  3TRC A;  2WGW A;  2Z6C A;  4CLC E;  3MFX A;  2V1A A;  1RGY A;  5CTM A;  1LL8 A;  2OLV A;  1Q2P A;  1UWP X;  2WAD A;  2Z2M B;  1XA7 A;  1GSW A;  3MSH A;  3K3D A;  1N9L A;  3Q1F A;  3T4S A;  1XX2 A;  2EA9 A;  1N9O A;  2KOI A;  1ES4 A;  3UN7 A;  4OPZ A;  1TS8 A;  2HDR A;  3IF5 A;  4Y3I A;  1EW0 A;  2UWX A;  1G5U A;  2OAP 1;  2JKT M;  2W1T B;  1G68 A;  5L8M A;  1IKG A;  3N8L A;  2V20 A;  1W63 M;  1NRJ A;  4S2P A;  1SHV A;  1N4O A;  3OCL A;  2W3E A;  1E25 A;  3MQO A;  1S67 L;  1MWU A;  1NYY A;  2L1M A;  4LV3 A;  3S7N A;  3A0V A;  3NDE A;  4B88 A;  3H9W A;  5G4Y A;  5FI7 A;  4GD8 A;  5I94 A;  4UA9 A;  2BG1 A;  2NUP C;  4PKY A;  1VET B;  4OQ0 A;  1YLT A;  1QME A;  2LB9 A;  5GLA A;  4DDY A;  1YT4 A;  3B42 A;  1GA0 A;  4AFI A;  1ZG4 A;  3QHY A;  2PHY A;  5GLD A;  2JE5 A;  1TVF A;  2VGL M;  2IWD A;  1ZG6 A;  1OT6 A;  3NHQ A;  4YWZ A;  4S2K A;  3S22 A;  2OAQ 1;  3A0R A;  1T1C A;  1MY8 A;  2XR0 A;  4U0X A;  4X55 A;  5EFW A;  5HFO A;  3IWI A;  4PM7 A;  2Y2P A;  3VE4 A;  4QB8 A;  4KG5 A;  3O5Y A;  3IX3 A;  3VFH A;  3FG8 A;  1LHY A;  2B5R A;  2W3D A;  2IA2 A;  1WE4 A;  3NCK A;  3UO9 A;  1YSQ A;  4ESP A;  1FIL A;  3IWQ A;  4WMC D;  4EQI A;  1DP6 A;  1I5Q A;  1HD8 A;  2YKF A;  1S4S A;  3T1Q B;  2ZM2 A;  4GCZ A;  5HWV A;  4OPQ A;  1MZU A;  4DXC A;  5FQQ A;  4HI4 A;  3MJQ A;  3Q7V B;  4QWO A;  3C38 A;  3VOL A;  3E2L A;  5AQA A;  4NXE A;  3PR6 A;  3AGE A;  2J3T D;  4S2N A;  5TJJ A;  2BTF P;  1YPR A;  3BJN A;  1ERQ A;  1YLP A;  1ACF A;  4R38 A;  3IF6 A;  1XJ3 A;  5FQ9 A;  1XFQ A;  1E3U D;  5A90 A;  3BFF A;  1LI9 A;  3E4Q A;  1RGZ A;  3I7J A;  2VEA A;  3GQZ A;  1FCN A;  4D60 A;  5EVI B;  1YLJ A;  3UE3 A;  4JPM A;  3IHA A;  5HAP A;  1F5M A;  2V1B A;  3Q07 A;  3BLS A;  3JPU A;  3IHB A;  4RQ9 A;  1VEU B;  4RX3 A;  2XH9 A;  4IJG A;  3CIT A;  1NXY A;  3ZCZ A;  1GSV A;  1YKD A;  2I9V A;  4JXV A;  5DTS A;  4HEF A;  4ZDX A;  5L2F A;  2A24 B;  3MXQ A;  3UB9 A;  1OTI A;  3RXX A;  4PM9 A;  3KO6 A;  5DJT A;  3PAG A;  1ERM A;  1MBL A;  4X53 A;  2WGW B;  4IUH A;  4DE3 A;  4H6J B;  3NOU C;  4JGR A;  2H5S A;  4OON A;  4GD6 A;  4OQG A;  3PBT A;  1K56 A;  1CJF A;  3SH9 A;  2XD5 A;  4O7D A;  3QP5 A;  2PBD P;  3N8R A;  2JKR I;  5E2E A;  4IHQ A;  4KQO A;  2Q9N A;  5HWT A;  2J7V A;  1L2S A;  4P6Z S;  3F1O A;  2PT7 A;  3Q7V A;  5CEC A;  3VV4 A;  1TDL A;  3Q82 A;  4BBU A;  1MWR A;  3FV7 A;  5GHX A;  2Y2M A;  4BBT A;  1YLZ A;  1W63 Q;  1LI0 A;  4R23 A;  4NEE D;  4S2I A;  4E3N A;  5EOE A;  2VJW A;  2ZQD A;  5IU1 A;  3IXD A;  3DW0 A;  5EV0 A;  2PR6 A;  1LL5 A;  5MC7 A;  4YNR A;  5GL9 A;  4X69 A;  1XPB A;  2EX2 A;  4L9F A;  4EW7 A;  5HZH A;  3LI8 A;  1L0D A;  5CED A;  4KUK A;  4P87 A;  4WM9 A;  3F1O B;  3JYI A;  5BOH A;  5CGW A;  4R3J A;  5F1G A;  1H5X A;  2WYX A;  4HHD A;  4LPZ A;  3KYZ A;  5D3O A;  2H10 A;  1K4F A;  2B18 A;  2I72 A;  4X68 A;  3PBO A;  1QMF A;  4E3M A;  1YSP A;  2H0T A;  4KZ8 A;  4Y13 A;  3HVF A;  4Y0T A;  2QMI A;  3C7U A;  3HLF A;  5KSH A;  2Y55 A;  1S6R A;  2ZQ7 A;  2FZ0 A;  3R7W B;  4L0L A;  1BLP A;  3ZNT A;  3MR0 A;  1WYB A;  2ZJ9 A;  3F1N B;  3VP3 A;  4LCM A;  2WKQ A;  2JN7 A;  3MQ0 A;  4OVD A;  4BL3 A;  1IOU A;  5HPI A;  3F1P B;  1XFN A;  2HV1 A;  4BWI A;  3NEC A;  1MKI A;  5HD5 A;  5FA7 A;  1AXB A;  2Y2Q A;  4QY5 A;  3DAV A;  2OLU A;  3IBJ A;  3ZQ5 A;  1IYO A;  3RJU A;  3NIA A;  5HAQ A;  3WS5 A;  2WKE A;  1SCW A;  4B4Z A;  4EUZ A;  3FZC A;  3BFC A;  4CLC A;  3ICY A;  5J7E A;  5EVI C;  3RFB A;  2O9B A;  1K54 C;  5KZH A;  2QHK A;  4JGQ A;  1DP9 A;  3N4I A;  3OC2 A;  1MPL A;  1NJ4 A;  3CMZ A;  4OOM A;  2Y2H A;  3W4O A;  3TW8 A;  3V5M A;  4EBN A;  3O86 A;  1TEM A;  3LIE A;  1OME A;  3T12 B;  2OWH A;  1ESU A;  4MLL A;  4PHT A;  3G34 A;  4PMA A;  2HJ9 C;  5C5K A;  1KGG A;  4P6Z M;  1GA9 A;  3UY6 A;  4PAU A;  5EVI D;  1K25 A;  3LY4 A;  2VX8 A;  5TBM A;  2IWB A;  3ZFZ A;  3N8S A;  5EE8 A;  3UDX A;  5FQI A;  2ZLY A;  4HIA A;  1XA1 A;  1WA9 A;  1BTL A;  4OH0 A;  3CHW P;  3QP1 A;  4MN7 A;  1NZO A;  2VA0 A;  4Y2F A;  2XDM A;  2O9A A;  2C5W B;  1ZTU A;  1J9M A;  2ZC6 B;  4E3J A;  3SH8 A;  1PZO A;  1PIO A;  3MBZ A;  2HDS A;  3ISG A;  3EEH A;  4E3K A;  4N92 A;  4WN5 A;  5DVA A;  4UQI M;  3DTK A;  3TJZ C;  2ZM8 A;  2W3H A;  4UAA A;  1TD5 A;  4ARZ B;  1OTE A;  3ZG8 B;  1MWT A;  1J3W A;  3HLE A;  4HY8 A;  3PBS A;  4U0T A;  3UPO A;  5EUA A;  1GHM A;  3BY8 A;  1L0F A;  4I39 A;  3VP0 A;  3CWF A;  1VB6 A;  3LIC A;  4CQH A;  4KZB A;  3V67 A;  2ACG A;  2JBF A;  2J9O A;  1OPX A;  3OPL A;  3T4L A;  3TG9 A;  2JHE A;  5FDH A;  1XXM A;  3ZG0 A;  4RX2 A;  1LSW A;  4G3V A;  3KSG A;  3H82 A;  2VV8 A;  1MWS A;  1SZV A;  3BFE A;  1UWN X;  1H8M A;  3FC7 A;  2EX6 A;  5J8X A;  1PI5 A;  2W1T A;  5FAO A;  3CUE C;  3DWK A;  2Y59 A;  4CLC D;  4MDZ A;  3K2N A;  3CPT A;  3HLW A;  3Q81 A;  4P6B A;  4UEY A;  2GX5 A;  3BEC A;  2ZC4 B;  4LCL A;  1ES5 A;  3U2A A;  2HDQ A;  2VZW A;  3MZF A;  3EGD C;  4LLO B;  5E2H A;  3E98 A;  2A3U A;  4OLD A;  1EI5 A;  4BLM A;  1H8Z A;  5HAR A;  4HES A;  2XRO A;  3BWL A;  1G6A A;  2WAF A;  3LEZ A;  3S1Y A;  3DWZ A;  1BSG A;  4M3K A;  2ZQ9 A;  1OTA A;  4R3B A;  5EEC A;  2WKI A;  4DJ3 A;  3BFG A;  3OPR A;  1K54 A;  2Y91 A;  1L0G A;  4HJ4 A;  4HQA A;  5HPF A;  1Y54 A;  5AJG A;  1P0Z A;  1IYQ A;  3SW1 A;  2KDK A;  1DJB A;  4FTX A;  3EGX C;  1BLC A;  1PWC A;  3LIA A;  3EEA A;  4Y15 A;  4WZ4 A;  3CI6 A;  5AQ7 A;  1KVM A;  2M7U A;  5GHY A;  4NXB A;  3PBR A;  4NXF A;  4OP8 A;  1MC0 A;  3BQ8 A;  3CAX A;  2KLI A;  5EM0 A;  3V3S A;  5AVE A;  4BL2 A;  2GDN A;  4ZJ1 A;  4FCF A;  2R78 A;  4EWF A;  3UB8 A;  2DRW A;  4IVI A;  3G4P A;  2HF6 A;  1Z6F A;  5A8B A;  4KUO A;  2ZD8 A;  1O7E A;  4DMZ A;  1VEU A;  2EXB A;  3TSG A;  4R70 A;  4DN0 A;  2O9C A;  2K31 A;  3R7W A;  1U60 A;  2DNS A;  2PU2 A;  3GTC A;  1KGF A;  2HJE A;  5HL1 A;  1FR1 A;  3IF6 C;  1NYM A;  1GHI A;  4ZRR A;  4XUZ A;  1D7E A;  2HP9 A;  3UNW A;  3SOI A;  1P9W A;  1H3Q A;  4L9E A;  2Y4A A;  4GLQ A;  2VV7 A;  4ZTK A;  4MBF A;  3IT9 A;  1V9Y A;  3OBF A;  5DF7 A;  1Y28 A;  1S0W A;  3WS1 A;  4RA7 A;  5EM1 A;  4B9O A;  1TS7 A;  2ZMV A;  4U3T A;  1X0O A;  2A2L A;  1L3L A;  3IQA A;  4Z1W A;  5HWW A;  3UMD A;  4KZ5 A;  5FL3 A;  3LGO A;  3LYX A;  4F3L B;  3WRT A;  4O0P A;  1CEF A;  4C75 A;  5TGF A;  4I38 A;  1FSY A;  3NJA A;  4XXR A;  3DTE A;  4Y5F A;  2LB5 A;  4JLF A;  2GZA A;  4S2M A;  3ITB A;  1CK3 A;  4IUK A;  1ALQ A;  3NOT C;  2QKP A;  4WEK A;  4MN5 A;  3GVB A;  2EWW A;  2B02 A;  1TDG A;  4EET B;  1I2S A;  3DTM A;  2XSS A;  1AWI A;  4GNU A;  2X71 A;  4LFU A;  5JYP A;  1BT5 A;  4OOL A;  4MBH A;  2J9P A;  1NLZ A;  3G2Y A;  1LSV A;  1FOF A;  3K3C A;  5CXW A;  4HH2 A;  2HP6 A;  1XJ6 A;  1HVB A;  1N9B A;  3KSH A;  3C4O A;  4FH2 A;  3W4P A;  4Q0J A;  2PDR A;  2R9X A;  2Y2I A;  4EV4 A;  1ES3 A;  4EUV A;  3R4K A;  1YQS A;  5DTT A;  2P7J A;  2ZC7 A;  2Y2L A;  4E04 A;  5A92 A;  4ZBE A;  5FAQ A;  3T1X A;  1W79 A;  4KQR A;  3PYP A;  5HX9 A;  3NOP C;  2JKT I;  4GN2 A;  3N6I A;  3OOV A;  4BD0 A;  1ZHH B;  2G7U A;  5HDD A;  4GJ4 A;  4PM8 A;  4GDN A;  2Y79 A;  5CTN A;  5L10 A;  3QP8 A;  4I3A A;  3M6H A;  4HH3 A;  4S2N C;  3HJK A;  4S2L A;  1K57 A;  2Y2K A;  3IWO A;  4N1X A;  2ZBB A;  5HD3 A;  4ZJ2 A;  5J4E A;  4KZ6 A;  4DKI A;  5GHZ A;  3SH7 A;  3PAE A;  5AVF A;  5DF9 A;  3SS4 A;  4CLC C;  2WK0 A;  1OJ5 A;  4JBF A;  2W3G A;  2PD8 A;  1N9N A;  1KGE A;  5EOO A;  4HJ3 A;  3JVV A;  3O88 A;  2B95 A;  3OCN A;  4LV2 A;  1CQA A;  4B93 A;  4ETX A;  4OLG A;  4KZ7 A;  2QWS A;  3PHY A;  5FAP A;  4WUJ A;  4QJG A;  2GJ3 A;  3LFV A;  3FKW A;  2JC7 A;  3UE0 A;  3SS5 A;  1KOU A;  3MKE A;  2PYP A;  2WGI A;  2XK1 A;  5JYO A;  2ZQA A;  5FDS A;  3UE1 A;  2PD7 A;  4II7 A;  3EQU A;  5M19 A;  4MCW A;  3P98 A;  2XD1 A;  3H82 B;  4DE0 A;  1LT0 A;  4IED A;  3MQQ A;  3T1R A;  4GS9 A;  4DDS A;  5EVI A;  1D06 A;  3T50 A;  1SKF A;  2C6W B;  4WZ5 A;  4JXG A;  4GKU A;  3IXG A;  1KE0 A;  4QD4 A;  3VP2 A;  4IBR A;  3W2Z A;  4E3O A;  3MS6 A;  4RYE A;  2MJ6 A;  1O07 A;  1BLH A;  1V9Z A;  1IEM A;  4FD8 A;  4WEL A;  4DRT A;  3MXR A;  4KZA A;  5F82 A;  2INW A;  1DRM A;  2EWV A;  1NY0 A;  3V3R A;  3N7W A;  5F5Y A;  5FEG A;  5AQB A;  4X1L A;  3EWK A;  3QP2 A;  4KZ9 A;  4Z9Q A;  4A5R A;  2XA7 S;  1W7F A;  3HLC A;  1BZA A;  4BMW A;  3KX0 X;  2Y8H A;  2RL3 A;  5GLC A;  4LV1 A;  5F83 A;  3PBQ A;  2XGN A;  3VE3 A;  1XGJ A;  3TE8 A;  2VV6 A;  2ZM0 A;  2HDU A;  3E0Y A;  3UB5 P;  5E2G A;  1PYY A;  3C2W A;  4L9G A;  2V0U A;  3RTY A;  3ZG9 B;  1XP4 A;  2ZMA A;  3NY4 A;  3GRJ A;  1E4D A;  3A3F A;  4JXS A;  4I5S A;  3ZYT A;  3S7O A;  3OLO A;  3LO7 A;  4EES A;  2K2N A;  1PW1 A;  4XUX A;  3L7H A;  3M6B A;  4QU3 A;  2E8J A;  1CEG A;  1BUE A;  1MKM A;  3LIF A;  2XQZ A;  3KYQ A;  1SDE A;  4OKP A;  3WRZ A;  2VGJ A;  2V9A A;  4B4X A;  1ES2 A;  1CI8 A;  1W8Q A;  1FR6 A;  1YM1 A;  4K0W A;  1DY6 A;  2J8Y A;  5CGX A;  2G2U A;  4LRZ E;  4X6T A;  2ZC3 B;  3A3E A;  2YKH A;  1A0K A;  3ZHH A;  3IS2 B;  4P0M A;  1ZC2 A;  2OV5 A;  4KZ3 A;  1MXO A;  3WS4 A;  1GSX A;  3V50 A;  1RCJ A;  3BY9 A;  3TOI A;  4DXB A;  1P9R A;  1PWG A;  4EEU A;  3HUN A;  3BLM A;  3BW6 A;  2W3F A;  3P7N A;  2XLN A;  5A91 A;  3B47 A;  3H7W A;  2WUQ A;  1TS0 A;  4JGO A;  3KSF A;  4X1M A;  4JKT A;  3LR3 A;  4Y7P A;  2WGV A;  3PTE A;  5DKK A;  3LR5 A;  2D02 A;  4IVK A;  1VET A;  4LEN A;  4MN6 A;  1IKI A;  4OPY A;  2OOL A;  5DFY A;  3T4O A;  3DTI A;  4BJP A;  4Y0U A;  3Q7Z A;  4R4R A;  1FCM A;  3CUE A;  4UHU A;  4FH4 A;  2HZ5 A;  3ZGA B;  1VHM A;  3QNB A;  2QYB A;  2WKH A;  2V8F A;  5FAS A;  3LUQ A;  1CI9 A;  3UB6 A;  2H0Y A;  4PM5 A;  4F94 A;  1S66 L;  3HJI A;  1W5D A;  2ZL1 A;  3BYD A;  4QPR A;  1G6O A;  2GNX A;  1FCO A;  3ZG7 B;  2ZQC A;  4WL9 A;  3DBA A;  1IEL A;  5KIZ A;  1ONH A;  4OOY A;  4DJ2 A;  3HRE A;  4UQI S;  4X25 A;  5GLB A;  2R9W A;  2V0W A;  3EOI A;  4RVA A;  3H7W B;  4M4X A;  4ARZ A;  2H28 A;  4NKP A;  3IH9 A;  3C7V A;  3T4K A;  3NDG A;  5KSC A;  1PFL A;  3C8C A;  4KG2 A;  5FSR A;  3IS2 A;  1KDW A;  3MFD A;  2HP5 A;  1K38 A;  3LCE A;  1HLU P;  3A3I A;  1K56 D;  3D3O A;  1XGI A;  4DE1 A;  3M2K A;  2IWC A;  3C4P A;  3VP4 A;  4CLC B;  5EVE A;  5M18 A;  4R3A A;  5FI6 A;  5DKL A;  4HBT A;  2L0W A;  3ZNY A;  3T4T A;  3P09 A;  3FWL A;  4EQ1 A;  2HGV A;  2OSU A;  4ZJ3 A;  3WS2 A;  4FOF A;  3BEB A;  3LR4 A;  5FI2 A;  1C3B A;  3ZVW A;  5DFX A;  1S1Z A;  1PZP A;  2BLS A;  2EFX A; 
#chains in the Genus database with same CATH homology
 4GNU A;  5KMW A;  2X71 A;  5CRF A;  5JYP A;  3VSK A;  5BOH A;  2Z2L B;  1BT5 A;  5CGW A;  2Y2N A;  4OOL A;  1WYC A;  3FYZ A;  4JF4 A;  4MBH A;  4R3J A;  2J9P A;  1PW8 A;  2P9V B;  5F1G A;  3G2Y A;  1H5X A;  2WYX A;  3OZH A;  3A3D A;  4OQI A;  1FOF A;  3HL9 A;  5CXW A;  3WWX A;  2JCH A;  2HP6 A;  1HVB A;  1IYS A;  1N9B A;  1K55 A;  1K6R A;  2HPB A;  1M6K A;  5D3O A;  3C4O A;  3FKV A;  4FH2 A;  2H10 A;  5CHJ A;  3C5A A;  1K4F A;  2I72 A;  3W4P A;  4X68 A;  1XKZ A;  3BM6 A;  3PBO A;  1QMF A;  1YLW A;  2X01 A;  3ITA A;  4WMC A;  2Y2O A;  3O87 A;  4E3M A;  2H0T A;  1KE4 A;  2V2F F;  3G31 A;  4KZ8 A;  3ZVT A;  5FQJ A;  3HVF A;  2R9X A;  2Y2I A;  3VFF A;  1ES3 A;  1YLY A;  4EV4 A;  4Y0T A;  2QMI A;  2XFT A;  1E3U A;  1YQS A;  3BFD A;  3C7U A;  3W8K A;  5DTT A;  3LY3 A;  3HLF A;  2ZC7 A;  5KSH A;  2Y2L A;  4R4S A;  2Y55 A;  5A92 A;  2QZ6 A;  4ZBE A;  5FAQ A;  1W79 A;  3B3X A;  1S6R A;  2ZQ7 A;  4GDB A;  4KQR A;  5HX9 A;  3HLG A;  1BUL A;  4P85 A;  4L0L A;  4KEN B;  3HUM A;  2WZX A;  4HBU A;  1BLP A;  4GN2 A;  3VOY A;  3N6I A;  3ZNT A;  1WYB A;  1ERO A;  2ZJ9 A;  3MZE A;  4ZAM A;  4BD0 A;  4E3I A;  1Q2Q A;  3VP3 A;  4LCM A;  3RXW A;  3A3J A;  4PM8 A;  4GDN A;  2EFU A;  5FAT A;  3VMA A;  5CTN A;  1SDN A;  4N1H A;  4OVD A;  5EPH A;  4C6Y A;  4BL3 A;  5TR7 A;  3M6H A;  1ESI A;  3AGF A;  1K4E A;  4S2N C;  1YMS A;  3IXH A;  2XEP A;  3O3V A;  4E3L A;  2Y2G A;  4S2L A;  1K57 A;  2Y2K A;  5CHU A;  1KDS A;  3IWO A;  4N1X A;  1MKI A;  1KVL A;  4OQH A;  5FA7 A;  1AXB A;  2Y2Q A;  4QY5 A;  4ZJ2 A;  4KZ6 A;  1NRF A;  4DKI A;  4K0X A;  5GHZ A;  2OLU A;  3SH7 A;  1IYO A;  3PAE A;  3RJU A;  3NIA A;  5HAQ A;  3WS5 A;  5DF9 A;  4BEN A;  2WKE A;  3SS4 A;  1SCW A;  2WK0 A;  5HAI A;  4B4Z A;  4EUZ A;  3FZC A;  4MBK A;  3HLD A;  5AQ9 A;  3BFC A;  4K91 A;  4R1G A;  4JBF A;  5EVI C;  1KGE A;  3HLB A;  5EOO A;  3G2Z A;  4CPK A;  2XF3 A;  4KQQ A;  1K54 C;  1NZU A;  5KZH A;  3O88 A;  1DJC A;  2ZQ8 A;  3VSL A;  3V39 A;  4YFM A;  3OCN A;  1H8Y A;  2P9V A;  4LV2 A;  1LL9 A;  4OLG A;  5G18 A;  4KZ7 A;  3N4I A;  3CG5 A;  4Y0O A;  4NET A;  3OC2 A;  5FAP A;  2WGW A;  4QJG A;  1MPL A;  2EX9 A;  5A93 A;  1RGY A;  3FKW A;  1NJ4 A;  3CMZ A;  5CTM A;  4OOM A;  4FSF A;  2OLV A;  2JC7 A;  1Q2P A;  2Y2H A;  3UE0 A;  3SS5 A;  2QPN A;  3W4O A;  3MKE A;  3V5M A;  4EBN A;  1K57 C;  3O86 A;  2WAD A;  2WGI A;  1TEM A;  2FFF B;  2XK1 A;  2ZQA A;  5JYO A;  1OME A;  3UE1 A;  2Z2M B;  3EQU A;  5M19 A;  1XA7 A;  2Q9M A;  3P98 A;  2XD1 A;  3OPP A;  4DE0 A;  1ESU A;  4IED A;  4MLL A;  1GHP A;  3G34 A;  4PMA A;  1ONG A;  3Q1F A;  1XX2 A;  4MEZ A;  4DDS A;  1ES4 A;  1KGG A;  1VQQ A;  1GA9 A;  3MKF A;  5EVI A;  3UY6 A;  3WS0 A;  4QY6 A;  5DTK A;  5EVI D;  3UN7 A;  1K25 A;  3LY4 A;  1SKF A;  4OPZ A;  2C6W B;  4WZ5 A;  4JXG A;  2IWB A;  3ZFZ A;  2HDR A;  3IF5 A;  3N8S A;  5EE8 A;  3UDX A;  5FQI A;  3SS3 A;  4GKU A;  2ZLY A;  4N9L A;  3IXG A;  3G35 A;  2UWX A;  5E2F A;  1KE0 A;  3W4Q A;  1XA1 A;  2P74 A;  4QD4 A;  3VP2 A;  1BTL A;  4IBR A;  4OH0 A;  1G68 A;  4E3O A;  1NZO A;  3NI9 A;  1IKG A;  3N8L A;  2V20 A;  4RYE A;  4YIN A;  3GMW A;  1O07 A;  1BLH A;  4WEJ A;  1M40 A;  2XDM A;  2C5W B;  1IEM A;  1L0E A;  1SHV A;  3MZD A;  4S2P A;  1N4O A;  1J9M A;  3OCL A;  4FD8 A;  4WEL A;  2ZC6 B;  1E25 A;  3GR2 A;  4E3J A;  4DRT A;  3SH8 A;  1PZO A;  1PIO A;  3MBZ A;  3MXR A;  1MWU A;  1NYY A;  4KZA A;  4LV3 A;  5F82 A;  1IYP A;  2HDS A;  3GV9 A;  3ISG A;  5CEB A;  3NDE A;  4MNR A;  4B88 A;  4E3K A;  5FI7 A;  1NY0 A;  3V3R A;  4N92 A;  3N7W A;  4GD8 A;  4EBL A;  3MXS A;  5I94 A;  5AQB A;  3G32 A;  5DVA A;  1JTG A;  4UA9 A;  2BG1 A;  4KZ9 A;  4Z9Q A;  5IHV A;  4A5R A;  2ZM8 A;  1W7F A;  4OQ0 A;  2WAE A;  3HLC A;  4UAA A;  1BZA A;  1YLT A;  3VP1 A;  1QME A;  3ZG8 B;  5GLA A;  1MWT A;  4DDY A;  1YT4 A;  3HLE A;  4D2O A;  2RL3 A;  4JF6 A;  5GLC A;  3PBS A;  1GA0 A;  1ZG4 A;  4U0T A;  3QHY A;  4LV1 A;  3UPO A;  5GLD A;  2JE5 A;  3D4F A;  5EUA A;  1GHM A;  5F83 A;  3PBQ A;  1TVF A;  3PBN A;  1L0F A;  2Y2J A;  2IWD A;  2FFY A;  2XGN A;  1ZG6 A;  3VP0 A;  1DJA A;  4S2K A;  1XGJ A;  4OP5 A;  4GOG A;  2DCF A;  2ZM0 A;  2HDU A;  3S22 A;  4E6X A;  1MY8 A;  2XR0 A;  4U0X A;  4KZB A;  4X55 A;  5HFO A;  3IWI A;  2JBF A;  2J9O A;  3OPL A;  4PM7 A;  5E2G A;  3TG9 A;  1PYY A;  2Y2P A;  5CGS A;  2ZC5 B;  4QB8 A;  5FDH A;  1XXM A;  4KG5 A;  4IBX A;  3VFH A;  3ZG9 B;  3ZG0 A;  1XP4 A;  4S2O A;  4H8R A;  4RX2 A;  2ZMA A;  3NY4 A;  1LHY A;  2A49 A;  3ZDJ A;  2B5R A;  2G2W A;  3GRJ A;  1E4D A;  3A3F A;  4JXS A;  1MWS A;  4WZ5 C;  1WE4 A;  3BFE A;  5FQK A;  3NCK A;  3UO9 A;  3LO7 A;  2EX6 A;  5J8X A;  3AGD A;  5U47 A;  1PW1 A;  3OPH A;  4XUX A;  1PI5 A;  3IWQ A;  3JYI A;  4JF5 A;  4WMC D;  5FAO A;  3M6B A;  4EQI A;  1I5Q A;  4QU3 A;  4QHC A;  3DWK A;  2Y59 A;  2X02 A;  1CEG A;  1HD8 A;  4KG6 A;  3HLW A;  1BUE A;  1HZO A;  3Q81 A;  2XQZ A;  4P6B A;  2ZM2 A;  1SDE A;  1YMX A;  3BEC A;  4OKP A;  4PPR A;  4OPQ A;  3WRZ A;  1PWD A;  3CZD A;  2ZC4 B;  3UPN A;  4DXC A;  2VGJ A;  1LLB A;  4B4X A;  5FQQ A;  1RP5 A;  4LCL A;  1ES5 A;  2HDQ A;  1ES2 A;  1CI8 A;  1W8Q A;  1FR6 A;  1YM1 A;  3MZF A;  3IF6 B;  3Q7V B;  4K0W A;  5E2H A;  1DY6 A;  4BQM A;  2J8Y A;  3E2L A;  5CGX A;  5AQA A;  2G2U A;  2A3U A;  4OLD A;  4X6T A;  2XFS A;  1EI5 A;  5M1A A;  3AGE A;  2ZC3 B;  2E8I A;  4S2J A;  4S2N A;  3A3E A;  4BLM A;  1H8Z A;  2EXA A;  5HAR A;  4HES A;  1G6A A;  1ERQ A;  1YLP A;  4GZB A;  3ZHH A;  2WAF A;  3LEZ A;  4UA6 A;  4C3Q A;  4P0M A;  1ZC2 A;  3HUO A;  4R0Q A;  2OV5 A;  4KZ3 A;  3S1Y A;  1MXO A;  3WS4 A;  3DWZ A;  3IF6 A;  1BSG A;  4M3K A;  2ZQ9 A;  3V50 A;  1RCJ A;  3TOI A;  4JXW A;  4R3B A;  1ZKJ A;  5E43 A;  1PWG A;  5EEC A;  4DXB A;  5FQ9 A;  2WKI A;  1PI4 A;  2PU4 A;  3HUN A;  3BLM A;  5EVL A;  3BFG A;  3OPR A;  1E3U D;  2XLN A;  5A91 A;  5A90 A;  2WUQ A;  1K54 A;  1JTD A;  3BFF A;  3CJM A;  1LI9 A;  2Y91 A;  1JWP A;  1L0G A;  1RGZ A;  3I7J A;  4JKT A;  4E6W A;  3HBR A;  3GQZ A;  4Y7P A;  1Y54 A;  4BD1 A;  2WGV A;  3PTE A;  1IYQ A;  1FCN A;  4IVK A;  1DJB A;  3NBL A;  1BLC A;  1PWC A;  4LEN A;  5EVI B;  4LV0 A;  4KZ4 A;  3NC8 A;  4WZ4 A;  1YLJ A;  3UE3 A;  1IKI A;  4OPY A;  5AQ7 A;  4JPM A;  1FQG A;  1KVM A;  3IHA A;  3S4X A;  5HAP A;  4BJP A;  5GHY A;  4Y0U A;  1KE3 A;  3PBR A;  3Q07 A;  3BLS A;  3IHB A;  4OP8 A;  4RX3 A;  2XH9 A;  4OPR A;  1NXY A;  1HTZ A;  3Q7Z A;  4R4R A;  3ZCZ A;  4JXV A;  5DTS A;  1FCM A;  3V3S A;  1I2W A;  4GB7 A;  4HEF A;  4BL2 A;  4ZDX A;  5L2F A;  4UHU A;  3G30 A;  4FH4 A;  3UPP A;  2GDN A;  3M2J A;  4ZJ1 A;  3ZGA B;  3RXX A;  4FCF A;  3QNB A;  4PM9 A;  2WKH A;  3EQV A;  4EWF A;  5FAS A;  2DRW A;  4IVI A;  3G4P A;  4X56 A;  1CI9 A;  3VOZ A;  3PAG A;  1ERM A;  4WYY A;  2H0Y A;  1JWZ A;  1BLS A;  4PM5 A;  1MBL A;  4F94 A;  1W5D A;  1Z6F A;  2WGW B;  3BYD A;  4X53 A;  4DE3 A;  1FCO A;  2ZD8 A;  3ZG7 B;  5FQM A;  1O7E A;  2ZQC A;  2EXB A;  2H5S A;  1K6S A;  4GD6 A;  2VGK A;  4OON A;  3PBT A;  4OQG A;  3TSG A;  1K56 A;  4WBG A;  3SH9 A;  4NK3 A;  1U60 A;  2XD5 A;  2DNS A;  4O7D A;  2PU2 A;  4UA7 A;  3UDF A;  1IEL A;  3GSG A;  1ONH A;  3GTC A;  4OOY A;  1KGF A;  3HRE A;  5HL1 A;  1FR1 A;  3N8R A;  5E2E A;  4KQO A;  3IF6 C;  5DF8 A;  1NYM A;  2Q9N A;  1GHI A;  5GLB A;  5HW3 A;  2R9W A;  4XUZ A;  2HP9 A;  2J7V A;  4RVA A;  3SOI A;  3UNW A;  1L2S A;  2Y4A A;  3IH8 A;  3Q7V A;  4ZTK A;  3IH9 A;  1GCE A;  4MBF A;  3IT9 A;  5CEC A;  5CER A;  3C7V A;  1TDL A;  1JVJ A;  4DE2 A;  5DF7 A;  3NDG A;  3Q82 A;  5KSC A;  1S0W A;  1MWR A;  1EWZ A;  4PM6 A;  4RA7 A;  3FV7 A;  3WS1 A;  5GHX A;  2Y2M A;  1VM1 A;  1YLZ A;  4KG2 A;  5FSR A;  4U3T A;  1LI0 A;  4R23 A;  2WZZ A;  3IQA A;  1KDW A;  3MFD A;  2HP5 A;  4S2I A;  4E3N A;  1K38 A;  1K55 C;  2RCX A;  5EOE A;  3LCE A;  2EX8 A;  3QNC A;  3A3I A;  1K56 D;  3ZG5 A;  4KZ5 A;  2ZQD A;  1XGI A;  4DF6 A;  4DE1 A;  3M2K A;  2IWC A;  3IXD A;  3C4P A;  3BRM A;  3VP4 A;  5M18 A;  3WRT A;  3DW0 A;  1FSW A;  5FI6 A;  1CEF A;  5F1F A;  2V1Z A;  4C75 A;  4ID4 A;  5TGF A;  1LL5 A;  1FSY A;  4XXR A;  4CJN A;  4HBT A;  3ZNY A;  4N9K A;  5GL9 A;  4X69 A;  3IXB A;  1XPB A;  2EX2 A;  4JLF A;  4EBP A;  4Q8I A;  4S2M A;  3E2K A;  3ITB A;  3P09 A;  1W8Y A;  3FWL A;  1CK3 A;  1ALQ A;  1JWV A;  2OSU A;  2PBY A;  4ZJ3 A;  1L0D A;  4WEK A;  3WS2 A;  3GVB A;  3BEB A;  5CED A;  5FI2 A;  1C3B A;  3ZVW A;  4P87 A;  4WM9 A;  2CC1 A;  5TFQ A;  3UDI A;  1PZP A;  1TDG A;  2BLS A;  2EFX A;  1I2S A;  5CHM A;  3DTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...