4UI9L

Atomic structure of the human anaphase-promoting complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
182
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 31
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4ui9L00
3J7HA 1UZ0A 2W9XA 2BERA 5LA1A 2VTFA 1JZ2A 2Z4FA 1DLCA 2VQTA 3HEIA 1UXXX 1UYYA 4MADA 2KD7A 5I0DA 3PUHA 2WYSA 4DXTA 2VCCA 3HNBM 2VOTA 3LPFA 5G04L 1RYYA 3U37A 1K3IA 2BGOA 2XHNA 1JU4A 2J1AA 3GGLA 1NKGA 1O8SA 1W9SA 1W8NA 3VD5A 5C7GA 1W9WA 4DEQA 3CMGA 5EJ1B 4QB1A 3ACFA 4ET7A 4PQQA 1SG3A 1NUKA 1XPWA 2WAOA 3C7EA 3LEIA 3SKJE 3DECA 4JKLA 2JDAA 4DXSA 2VZTA 3A23A 3T08A 1XC6A 2J1VA 4JKMA 2QBXA 4LHSA 4JHZA 1OT5A 2ORZA 2ORXA 2E31A 2YB7A 2WZEA 3C7GA 3WF2A 3OEAA 1JHJA 4FI9A 5IFTA 1US2A 2R7EB 4DUWA 3T2QA 3MV01 4MGSA 1L7RA 3DYMA 2LS6A 2OKXA 1JYWA 2XONA 1W8OA 3I3DA 2VQUA 5B4NA 3THCA 3EB7A 5IHRA 2QQMA 2VCAA 4BK5A 1F4AA 2Y6KA 4ARYA 1DYOA 1UY4A 4P08A 2C9KA 4MOAA 1CX1A 2VJXA 1UMIA 2VZ1A 2XOMA 3FL7A 5DN2A 3WF3A 3BGAA 1K12A 3I2IA 1WKYA 2ZEZA 1L7QA 4BJ0A 3WNNA 2W5FA 3T2OA 3WQBA 2V72A 1O8PA 2W1WA 4XUOA 4DEVA 3JXSA 5DPNA 3MUZ1 2VZRA 3WNLA 5HXMA 2W47A 2VC9A 3CZUA 5J1XA 4QDRA 1NAEA 3NRUA 4ZXEA 1UMHA 4IUGA 2W1QA 3IB3A 1JZ8A 3VDAA 2BBAA 3HOBA 1SHWB 3BN6A 2J1TA 1H6XA 1I5PA 3AC0A 3GDBA 5C71A 1EUUA 1EUTA 4OMDA 4DUXA 3LPGA 3T0AA 3WF1A 1CIYA 1TG7A 2W3JA 3LEKA 1IQDC 1CZTA 3W5MA 2VMDA 1OF3A 3THDA 1XNTA 1K45A 3WF4A 1P8JA 2J1SA 4XUTA 1W9TA 3OEBA 1F4HA 4ZY9A 3T2PA 4A44A 3WEZA 4DUVA 3WSOA 2J22A 3IAPA 5G05L 2Y64A 3LEGA 1UY2A 2BZDA 4KMQA 4RYDA 3K46A 1HN1A 2W46A 2CDOA 2WAAA 3ABZA 4LQRA 1TVGA 3GXUA 3A7QA 3W5NA 2X10A 4KWUA 4LPLA 3LQCA 2B9VA 1R64A 2Y6JA 3NNGA 2WN3A 3I2HA 5EJZB 3WNPA 4L0PA 3OGSA 4TTGA 5B4XA 2PQSA 1BHGA 2XQXA 1WCQA 2YFZA 3K75B 1KGYA 1JZ7A 4CUBA 4UAPA 4A42A 3CIHA 3HN3A 1O59A 3SEPA 3P1IA 2W1SA 3I2KA 2E26A 2QQOA 3HPNA 5DMYA 2ID4A 2WBKA 4OZOA 2EICA 4CU9A 5JMOA 3WF0A 1T2XA 2RV9A 2LW8A 1OF4A 1NX9A 5JXHA 3OB8A 2J1RA 2J1EA 2VCBA 1W0NA 3OBAA 3VD3A 2HYXA 1J83A 1W99A 4YPJA 1GMMA 3I3EA 3NJXA 3ECQA 4XUNA 3K77A 4OUEA 4AG4A 1GUIA 2QQJA 2VMCA 3CKHA 4W50A 4P02B 1XNAA 4E8CA 5JR2A 2Y8KA 2VMEA 3T0DA 4LKSA 2J7MA 4CVUA 2X09A 4A45A 3ACIA 1JYVA 2RVAA 1GOHA 2VMFA 3ETPA 1GNYA 4BDVB 1JI6A 4DXRA 4CU8A 3I3BA 1PMHX 3K4AA 2DDUA 4XUPA 3T0BA 2WDBA 2VZUA 1GOGA 3IIIA 5F7UA 2W95A 3HJRA 3HNYM 5IFPA 4QPWA 3I2JA 5HPOA 3MUY1 2ZEXA 3C7HA 2DCJA 3MBWA 3CQOA 1GQPA 2Y6HA 4QX0A 2WUHA 4P00B 2VZVA 5JXGA 3FN9A 2WO2A 1H6YA 4ZZ8A 2L9LA 4JKKA 1UY1A 1OH4A 4TXWA 1PX4A 5JXIA 3HNMA 1DP0A 4CU7A 1JYXA 5LA2A 2Y6GA 3A22A 3OGVA 4QX2A 2W87A 2YC2A 3NQHA 2VZQA 2VZOA 1LNSA 5C70A 1MPXA 3K4ZA 4AAXA 5EIYB 3ZM8A 4BK4A 3ACGA 4UOJA 2RJ2A 2W91A 4QDQA 2JD9A 5A1AA 5IJRA 1GOFA 3UESA 2VZSA 2JKXA 3GM8A 4QX3A 2VZPA 4CU6A 2W1UA 1UX7A 1CZSA 3D3AA 2HLEA 1PX3A 5CZKA 4HG6B 3VD9A 3VDCA 3DYOA 1KEXA 1GU3A 4GZ9A 1CZVA 3IAQA 3ACHA 1D7PM 3CDZB 2WO3A 2CDPA 3VD7A 4OYUA 2VZ3A 4A4AA 4RN5A 3I2GA 4PT6A 2WQ8A 4PF1A 3A21A 4GWIA 2QQIA 3F2ZA 3MO4A 4KI5M 3WNMA 1ULOA 1US3A 1OD3A 2ZEWA 3WNOA 2E32A 4QB2A 2YC4A 3OGRA 4XURA 4CUAA 2X05A 3MV11 2VR4A 3C7OA 3WNKA 2J1UA 3P6BA 3I2FA 4ZZ5A 4M4RA 2E33A 2JE8A 3CZJA 3SKVA 4XZUG 1UYZA 2YFUA 3VD4A 4Z2AA 3EYPA 1JZ3A 5CYYA 4A41A 1UY0A 1JZ4A 2W92A 4CUCA 2C26A 2DCKA 5FUIA 1YQ2A 5LA0A 4QAWA 1UXZA 4A6OA 5JUVA 4ARXA 2Y6LA 2YG0A 4JX0A 4MGQA 2ZEYA 4W4ZA 2QQKA 4W8JA 4QDSA 2QQLA 3T09A 4QB6A 3SEEA 5IYYA 2WZ8A 3PUIA 4MO3M 5DQ0A 1UYXA 2EIBA 2B4KA 1J84A 2WO1A 1JZ6A 3LE0A 3K4DA 3OG2A 2C4XA 2W94A 2EIDA 3VDBA 1K42A 2WABA 4XVHA 4D8MA 4OMCA 3C8XA 4M4PA 3DYPA 3FHAA 1ULPA 3C7FA 4UI9L 1UWWA 3E1F1 4QX1A 5JXJA 3UNPA 2ZXQA 4A3ZA 2BGPA 2VL4A 1JYNA 1UY3A 4D0QA 2QQNA 2VO5A 3I97A 4XUQA 2EIEA 3IDAA 5LCWL 4BXSV 2V4VA 1JZ5A 4P5YA 2WN2A 1PMJX 4E8DA 3FHQA 1SDDB 1JU3A 3NJVA 4GWJA 3UETA 2V5DA 2VM9A
chains in the Genus database with same CATH superfamily
1OSGA 1POV0 1CESA 4CXWA 2WKKA 5C6CA 4R4ZA 4YGCA 2BERA 2ZGPA 1WLCA 1MVEA 1WW6A 1N1TA 1VMFA 1HLCA 4OUSA 1I9RA 2WS91 4JGZA 4QPIA 4OQ9A 1QH7A 3INAA 3S7IA 1AJOA 1BEV3 2TUNA 4CDWA 2F4LA 2Z69A 4W6WA 1AYM3 1C57A 4MADA 2WR9A 1KD7A 1K5MC 5CNAA 2QQPA 5DABA 2WYSA 3KM5A 3WP4A 3HNBM 3WNXA 4YNIA 3JU9A 4IV1A 1D0GA 2D97A 1DDLA 2CGPA 3WCSA 1U5XA 4L99A 4NHYA 3U37A 1Y4WA 2BGOA 1MEC1 3Q8CA 2HKXA 1O8SA 2FCVA 4GMP1 1OUXA 3HVDA 2GC0A 3DEMA 5LK7B 4AEDA 1W6PB 3OY8B 4XJAA 3VD5A 1NXD1 3H7JA 1OURA 2BDRA 4DEQA 5CFCA 1VBA1 2JG8C 3HQUA 3N7LA 3Q8FA 4UFJA 4NIHA 1TME1 1O5LA 4BE3A 4MGKE 3ACFA 2KR2A 4ET7A 2D40A 4FTSA 3POWA 1MS3A 3OSDA 3KB5A 1XPWA 2P37A 3C7EA 4XFFA 1RUF3 3V0AB 2JDAA 2WT1A 3DV8A 3RSJA 4D3WA 2WLPA 1Q8SA 1SLAA 1ND2C 1NLRA 4LTAA 3USUA 5E89A 3T08A 2D6MA 4YGBA 2J1VA 2PHLA 2XJUA 1Y7BA 5GZDA 1I3HA 2QBXA 1HX6A 4HN0A 1RUE1 5ABJC 3FFZA 2JDMA 5DUXA 4OLLA 1ALYA 2ADDA 4IGQA 4YVWA 3APBA 2JD4A 3ZKUA 3WP6A 1AR63 2WNEA 1OT5A 1MZFA 3GJAA 3AVSA 2ORXA 4AGVA 1DFQA 1H9PA 1HB1A 1CAXB 1S55A 4NAOA 1X8EA 3LGRA 2HWC3 4ZU7A 5K0UC 1JHJA 4Q0UA 4B4QA 2FZ2A 1O3TA 3ZYBA 4M0HA 2N7GA 3RVHA 1JMUB 4WZCA 1LHUA 2PHFA 1ZBE2 3SCGA 1SLIA 2JG8B 4MGSA 1X82A 2XJPA 5DDJ3 1W6OB 3DYMA 2LS6A 1A3KA 5C8WA 1W3VA 2OKXA 1JYWA 3JBG2 3S5QA 3ROUA 5FXVA 2HWF3 3N9LA 3ZSLA 3AKPA 1W8OA 3I3DA 1AJKA 4QXBA 5FOBB 5KHGA 3H8OA 3N9PA 1XU1A 4CPBD 1MZEA 2WL1A 5FWEA 2HWE3 4YW2A 4N8MA 3TEXA 1XE0A 4Q27A 2LUWA 3DGTA 4IXLA 4RD7A 1ND2B 4XXPA 1UZWA 2VJXA 3K51A 2GAUA 2VZ1A 2XOMA 4DXZA 2JWPA 4J6GA 5GLTA 2WFF1 4XMAA 3B3QE 2A6WA 3AKQA 3Q8BA 3BGAA 1CD3G 3QACA 1RUG3 2B7YA 4FQZA 4LHNA 2LTNA 5ABJB 2UWCA 2JIJA 4XJ8A 4XF0A 4BU2A 4CZSA 4O7XA 1CQ9A 3ZDVA 1L7QA 4Y3OA 4OI1A 5BNOA 2WLQA 1O8PA 5FZFA 1XYPA 4YSFA 3JXSA 2P6CA 1AVBA 3MUZ1 3ON7A 4YZ3A 5JOXA 2VZRA 4Q0VA 1OUSA 3VHOA 2PN5A 3WDUA 4R9AA 4G4FA 5K0UB 4LNVA 2GH8A 4QKNA 2VXJA 1RIRA 3SCFA 4ASMB 2ZHLA 2R32A 4QDRA 3PVBB 4JDOA 3ZN4A 4FOWA 2BWAA 1XB9A 2IXIA 2RDRA 2QTWB 4LKEA 5EYYA 1O5UA 3TAYA 1YHFA 1RUC1 3H3LA 2JDKA 3KT7A 1YIPA 4EWEA 1KS4A 1A34A 4MGIE 2WNUA 1SHWB 4DRRA 1REFA 3U4SA 1AR91 2ZMKA 5H9RA 4BOWA 4XABA 3GDBA 2E6VA 3BVCA 1AR71 1SZBA 4OMDA 4BXFA 4FTEA 4YFWA 2W3JA 2QE3A 3LEKA 4L8QA 3LCPA 1IQDC 1CZTA 1SEFA 5GKAC 2VMDA 3FHIB 2O8QA 1W6QB 4FPJA 2HH9A 3THDA 2AUYA 3BB6A 3J7MA 4GMP3 4X8PA 1BZWA 4BLIA 1POQA 5FP9A 1X8MA 2UURA 2VGDA 1B35A 3KZ4C 5JZGB 4IGOA 1RUD2 1VBA3 2Z79A 4GD4A 1V6NA 4A44A 3MFAA 1N3PA 1PIV1 4N43B 1MS0A 4Q2FA 1NY71 2J22A 1HXS2 1RMU3 3GBGA 3LAGA 1LU2A 5A1LA 3E6DA 2WZR2 1B09A 1X9TA 2UYBA 2QDRA 3UK9A 2FDHA 1DF0A 3OTFA 2ENRA 4FP2A 1HN1A 1LULA 1R081 3AL6A 3NV2A 3HBKA 1SBFA 3O1UA 3VDDC 2GALA 3MIEA 4I0BA 3GXUA 1RUE3 1F5JA 3OCPA 5CG8A 2R062 1V9U3 4R4XA 3NNGA 1F15A 1W06A 2RS51 4CEYB 5D2AA 5KXBA 5FPZA 5H9QA 4NIDA 3N9QA 2IXKA 3OGSA 4CP2A 2PQSA 4D94A 1URXA 1NQDA 1BHGA 2XQXA 3N35A 2BNNA 2FZ1A 3PU3A 1VBB2 4HXCA 3AMHA 4Q8KA 1JZ7A 3AXEA 3CIHA 2G9GA 1UZYA 4YM0A 4K20A 2W1SA 3S7EA 4KWJA 3L2YA 1LAJA 2VVFA 4YG6A 1CVNA 3WW3A 5DMYA 2ID4A 1JODA 3ZR6A 2OQ6A 4F8AA 1YRZA 4G9SB 4XE9A 2RM21 3THPA 1DQ1A 4XFHA 1YFXA 2ZGMA 3AKTA 1WGPA 1TQ5A 2HEYF 4WM8A 1QJY2 1Y43B 4QX5A 1KJLA 5F39A 5BYNA 1PVC2 3VDDB 1SLLA 4NRQA 5FZ4A 3WDWA 2J1RA 5IK4A 5BNPA 1W0NA 5ACA3 1C5IA 3OBAA 1EPZA 5EYXA 2P1BA 1FMD2 3QH6A 4K8FA 3DPRA 2CV6A 2VQ0A 4QD2A 2OPKA 2R6QA 1GQHA 4I3GA 4UFIA 1CR7A 4FPGA 4Z07A 3NAPB 3ZKYA 5J96B 2UY9A 5ANNA 4RGAA 4Y5SA 4XUNA 1QXRA 3K77A 5FZCA 2WNVA 1GUIA 3EQEA 4YW5A 4PI0A 2R1DA 4P02B 1XNAA 2PLV2 3WW2A 5SV5A 1S1AA 5FQ0B 1OOPA 1RUH2 1BBT1 1JN2P 1N3OA 1RUC3 1RVF1 1BCXA 1KXGA 1RINA 1WZXA 2G19A 2RS11 3AVRA 4ISRA 5F5IA 1NA1B 4YW4A 3OF1A 2ZZJA 1IS6A 3AYAA 3ACIA 2RVAA 4AQ2A 5A3OA 3P3NA 1GNYA 1LRHA 1O4TA 3JD72 4P9XA 4QHBA 3L2HA 1JI6A 5DZGA 1AR73 2PFWA 4P14A 4NIGA 2A3YA 3VUOA 3I2DA 4N53A 1WCSA 2YBPA 4Q4W2 5FZKA 4HONA 4OHXA 3TN91 1KQRA 1HRV1 1RXGA 1D4M2 2AEYA 1GZWA 1VE0A 5KHIA 2PAMA 4JC1A 3AMQA 2ZA9A 2AC1A 4NN0A 3NV4A 2VXRA 2ZGRA 5KC6A 4IE7A 2QUOA 1CWPA 3I2JA 1ASJ1 3C7HA 5APAA 1FPN2 5FJHA 4CXYA 1O4ZA 1MZ5A 1PIV3 1H1AA 5EXOA 5M0TA 3AP6A 1OXCA 1QNYA 3R4DB 1S0FA 2VUDA 2VY0A 1SDWA 5GZGA 4P00B 1COV2 1C8M2 3MZHA 1NCQC 5F5AA 1X33A 3HD8B 4YW6A 5IUQA 3KHBA 4XDOA 5E1RA 4E4DX 3OGJA 1O91A 2EXKA 4CDXC 2Q1ZB 2XMLA 1VB4A 1R083 1OLMA 1GANA 3AZZA 5JXIA 1JHNA 4YGDA 2OW4A 1T6GC 2GN7A 5FZEA 3Q8EA 1H0BA 1H1IA 3N7MA 5F37A 5JMCA 3LSDA 2XBO1 4AVTA 4EN8B 5IT6A 1JYXA 5LEJA 1YFYA 2RS53 2AZ5A 3PURA 4LR4A 2D6KA 1WW7A 4LEJA 5IVCA 2W87A 2YC2A 3D8CA 2VZOA 2WQ4A 1LNSA 4Y26A 4BQWA 2OX0A 1D2QA 2VNGA 1LOFA 1WCDJ 3O0XA 2WWJA 2FQPA 5C8CA 1JYIA 2YGLA 4UT5A 4B1MA 1H30A 2YZ4A 4MGTA 4M3CA 4UOJA 3AKRA 1LHVA 3UKTA 1F8VA 1X9PA 1BYHA 2GNMA 2JD9A 3LF7A 2R042 5E88A 2PMWB 4XCBA 1GOFA 3BU7A 3UESA 2VZSA 2R16A 4KWKA 4AI9A 4PDWC 1PGL1 1WMXA 2TNFA 2C6SA 3AL5A 3M3IA 2JKXA 2RM23 2B46X 3B69A 4IV1C 4QX3A 2E7QA 3D0SA 2PTMA 3D3AA 3PVEA 4QKDA 3RI9A 3VBHC 1PX3A 4MG2A 4Q0QA 5CZKA 2AYHA 1YI7A 3WQ0A 3ENRA 2CTVA 3N9NA 3KT4A 1CZVA 4IEYA 5F3CA 1AL21 3CDZB 3BALA 1H2NA 1AZDA 3CJIB 3ILFA 3E6BA 3WINE 1W39A 3U75A 3MFCA 4I02A 1YNAA 2D6LX 2VAUA 3PJYA 4A4AA 2ZX4A 4D7TA 4ZXKA 5BNNA 4PT6A 5CFCC 3MW2A 1YI9A 4KWLA 4XFCA 1W28A 3S0MA 1W8FA 1DGRA 3ASIA 4DY3A 3A21A 3KD4A 2QQIA 3O0VA 3DN7A 1GWKA 3I54A 5T52A 4BCUA 3MO4A 3HT2A 1HIXA 4KI5M 1UU6A 1VLNA 4XCAA 4KGGA 1ULOA 1US3A 4QPIB 1FV3A 2PHWA 4JGZB 4CDQA 2NMOA 1CIWA 4Q29A 5FKBA 2ARAA 3WNOA 4C0HA 5JIAA 1BBT3 5A6XA 1DYPA 4NUBA 3SISA 3WHTA 2RS13 2YC4A 3AM2A 4XURA 3M8LA 1AXZA 1UU4A 5A7QA 3WD5A 2A3XA 1OPOA 2ARBA 3GZUC 5FLJA 5JI7A 2KXLA 3MGUA 3O1TA 3LOBA 5FYHA 3LDRA 5TSWA 3WNKA 4AE2A 3P6BA 3TNPB 4AVVA 3POIA 4YVWC 1O6UA 2A6YA 4DINB 4AZZA 2VPVA 3KV9A 4NO4A 4AL9A 4ZZ5A 4CCNA 2NQYA 3ZO0B 4ORFA 4XZUG 3FE5A 4Q4X2 4XTPA 3VD4A 4Z2AA 1HRV3 2HWB2 4AEDB 4LMFA 4XFGA 2NMNA 5CYYA 3SMHA 4DO0A 2Q0AA 4IGPA 2W92A 4QPGC 5FXWA 2H6BA 5FUIA 1YQ2A 4QGNA 3TYJA 4EE2A 2FCTA 4PQ9A 2Y34A 1ASJ3 4BQ2A 5JUVA 3R0RA 1PO23 1VBC1 4MV2A 3WVJA 2PXJA 5LY1A 5T5OA 2P3YA 1HW5A 2YG0A 3IMMA 2WINB 3MF9A 3MLLA 5K8SA 1FATA 1W2TA 5KHHA 4YM1A 1S2BA 1DQ0A 2ZX1A 3USUB 4DS0A 4QDSA 4P5HA 4KQ7A 5FCCA 3MIFA 4I3PA 4A3XA 4O65A 2X8KA 4O9EA 2Y0OA 1OFSA 3OUIA 3E5QA 3MW4A 2RG4A 1S0CA 2B4KA 1J84A 4BISA 1Q8PA 3WQ7A 1JZ6A 4KBZA 1N1YA 1KRIA 1VR3A 2WWSA 5FV3A 1C3HA 3LE0A 3U10A 1RUJ1 3OG2A 2C4XA 2UYAA 3ZYPA 1F31A 1K42A 1Z0HA 2EA7A 3N7KA 3RYPA 2V09A 1GLHA 2EXIA 4GJZA 4XVHA 1IG3A 4Y1UA 1LJ7A 4OHZA 2RDNA 2GH2A 2R072 4PIZA 4S2GA 4CEYA 3NWKA 3C8XA 3DYPA 3FHAA 4UFLA 1VALA 1NQJA 2RR11 4NE9A 1UN1A 2Z5WA 2VBBA 2WIIB 4LA3A 1PM4A 2ERFA 4RHV1 4AYUA 3B9IA 4BM8A 4HBNA 2Q30A 5CFDC 4BMBA 4A7ZA 2WNUC 2MNGA 3HT1A 4A3ZA 1HQNA 2BVVA 1KS5A 1R1A2 3ZXFA 4IE4A 4D0QA 3R4SA 4XPVA 4XTMA 2XR4A 4Q1PA 3M4FA 4AI3A 3I4IA 2E63A 2AREA 5BV6A 5JDBA 1FV2A 4CEWA 3EMRA 4V1PA 5DUUA 1JU3A 3OJBA 3UKVA 3N4MA 2OPWA 4QHZA 3U07A 2FBEA 2NN8A 2V5DA 2WC2A 3IDCB 2RDQA 5F32A 2HWD1 5E16A 3J7HA 1QOSA 5JSOA 1UZ0A 3L9JT 2ZJCA 4WM7A 5CIRA 5BNOB 4DRVA 2VTFA 4G3YC 2D6NA 4K3UA 4CSWA 1JOPA 1B35C 1PO12 3VN4A 4DB5A 4KG8A 1JYTA 4J1XA 3E5UA 4E2GA 4CDUA 1UYYA 1CJDA 1WW5A 2KD7A 1IQAA 5FK8A 5GALA 5FP4A 5LBBA 2FHRA 3JQWA 3IWZA 4NR1A 1RUNA 2WZR3 1ULDA 5HI0A 3V65A 3ZSKA 4TLFA 1L3JA 4COVA 1BMV1 2XHNA 1JU4A 2J1AA 3GGLA 2WNUB 2NYYA 3BODA 4KU8A 2BEOA 2ZAHA 1W8NA 2IFWA 2DCTA 1UX6A 4BZ4A 3M2MA 1TMF1 3PUAA 1IGOA 1VBE1 1RUOA 4AHZA 1E57A 2D98A 1NA1A 5T5LA 1W8WA 1XQNA 5A3LA 5J48A 5EJ1B 5JPMB 2ILMA 1YQ6A 1DIWA 1VRH1 5J98B 4AGRA 5AC92 5T3NA 2FDIA 1V6MA 4M0NA 4PQQA 2GNTA 2WWUA 5LBCA 5FZ9A 1AR82 4FPEA 4LHLA 1VMHA 1WMFA 4NRPA 3SKJE 4F7ZA 3BIWE 1AX1A 1B35B 3SNMA 1S2KA 1CPNA 1DBNA 2CWMA 2VW1A 1V0AA 5LK5A 4XZPA 4MHRA 4JKMA 4CCJA 1QJU2 5FPUA 3G6JB 1REDA 4FCAA 1VBC3 2GC3A 2O1QA 3ZYIB 4JCKA 1HV1A 4V2VA 5FUPA 5D8AA 4AF9A 4XXAA 4CP0A 2NLRA 1QJY3 4Y1VA 4MVTA 2ORZA 4HVOA 2BVBA 1ZZBA 3B01A 1ZRRA 1RUI1 3IBMA 4EN7B 3IDBB 1PVC3 1LCLA 4JTOA 2D3SA 4XFAA 5BNPC 5LRSA 5FZ6A 3T2QA 1L7LA 1PGW2 3MV01 2ZCWA 4L2NA 3WZ1A 5LZ6A 3KCYA 5I0RA 3DPRC 2I45A 1DQ2A 5FR3A 4P9LA 4AHXA 1HB2A 1RUJ3 2XONA 4DOUA 4QU1A 4N90A 1ZX5A 2RS31 3BTYA 2WNVC 4ZS2A 2A1XA 3Q8AA 4QXKA 4NWVA 5IHRA 4GWNA 2JICA 2VG9A 2P34A 1LODA 3H3UA 1LENA 1DYOA 1UY4A 5B2GB 1LECA 4RSUA 4CCMA 3NKGA 2IWGB 1Z7S2 1OOPC 2RR13 2W52A 2O0OA 1W03A 2HWC1 3DXUA 4RHV3 5DN2A 4YW1A 4TZDA 3WF3A 4RQPA 3VBRA 2YGMA 1X50A 5FZDA 1HRI1 2YHJA 1QOOA 2DUQA 4GKXA 3WR0A 1PK6A 4WVZA 4YM2A 3KSCA 3AB0A 3IPVA 3OD0A 3MHZA 1E5IA 4WM8B 2V72A 1WWYA 5H9PA 1CN1A 2W1WA 2HWF1 4IE6A 5EQUA 3EHKA 3LA2A 2D93A 2VU9A 4N53C 2BV4A 2GMPA 4Q4W3 3TBDA 3U11A 1VMJA 3WNLA 4CA9A 3BPZA 1MQTA 5J1XA 1POV3 2HWD3 2VNRA 5EV7A 3UGFA 4ZS3A 1W04A 1NAEA 3NL1A 3NRUA 3WCRA 1PGSA 1I5ZA 4MGZE 2GC1A 4IUGA 3DPRB 3DKWA 3O14A 4B8EA 3WHUA 5FY8A 5CBLA 3CEWA 5A7SA 1Y9MA 2DBIA 2J1TA 2XH6A 4IEWA 4EWAA 1U5IA 2WNVB 1H6XA 3M1HA 1I5PA 2C1FA 3GALA 3BTZA 1ULGA 4Z8BA 4KH9A 1ENQA 1EUUA 1OPMA 4OCTA 5C71A 1ZBA3 2YYOA 5DAXA 1TG7A 2BNOA 3VZJA 2F17A 2C24A 4LBLA 1ZM1A 2ZGSA 1OF3A 2YU1A 3AMMA 4OI2A 4GAZA 4WVMA 3SXWA 3WF4A 2J1SA 3S30A 1YEWA 4XUTA 1ULEA 1TMF3 2QFEA 3FC0A 3OEBA 4LBQA 4HZFA 4IEXA 1VBE3 4JGYA 4N53B 3ZMNA 2EIGA 4U36A 1NT0A 4DUVA 1VRH3 5BPXA 3QCWA 3WDXA 1A8MA 3KV6A 2PELA 3FBYA 5D21A 4LBMA 1GZWB 2GU9A 3ZYHA 1RJ7A 4LXLA 1U0AA 3U14A 4DZGA 3PMEA 1LOFC 1N1VA 2LRPA 2R0HA 5C8CC 2H6CA 5KXCA 2BTVC 1PMIA 2E7AA 4XEZA 3ZR5A 2CDOA 4QGMA 2FMYA 4D7SA 4LQRA 3WDVA 3RZMA 3N9MA 3A7QA 4Q26A 4TYSA 1HV0A 4KWUA 4JQTA 3FUOA 4SBVA 3GBWA 3J8F1 1ZA7A 2B9VA 2PHUA 2Y6JA 4C91A 2WN3A 3FZ3A 4FPLA 1AX0A 5EJZB 1W05A 3H3ZA 1OD5A 1RMU1 1LGBA 1UOBA 1AYN1 3WNPA 5B4XA 1RUI3 3QD6A 2XB6C 1JTZX 4C1XA 4GQ7A 3AYEA 4C0BA 4IEUA 1YQ5A 1J3PA 4JZRA 3O1VA 3BUCA 2A73B 4UAPA 5L9RA 1ENRA 4HK9A 3ZFFA 5FZ3A 3ZFEA 2D6PA 3I2KA 5T50A 4XETA 5LRRA 2P3KA 4PLOA 3FBMA 5JOYA 2RS33 4FXKB 2EICA 1XRUA 2OT7A 5FP7A 1V9U1 5KC5A 1V6OA 4CU9A 2EXJA 1I6XA 5C8CB 3ME2A 3ZIWA 2R1BA 4URAA 2FCUA 4COYA 5JMOA 2V5YA 3O0WA 1IHMA 4M3CB 3T1MA 1NCRB 3VBFA 1MVQA 3WUDA 4CDQC 4ZU4A 3ORJA 2RV9A 3OPZA 4FXGB 5FZBA 2DUOA 1LOAA 4CP9B 1HRI3 4L9BA 2A6XA 4IEZA 1W90A 2GP5A 1XYOA 4QX7A 2OVUA 2VCBA 2IVIB 1W2UA 1FOD1 4HKOA 5IVFA 5DXDA 4IE5A 4BPZA 1J83A 1W99A 3FJSA 4IV3A 3OBRA 4XJUA 5A7OA 2XJTA 4R52A 1QIQA 1OBNA 3NJXA 3ECQA 1HKDA 1Q3EA 2Y26A 4GA9A 2XVLA 1R092 4FFIA 2HWB3 4P9JA 3CKHA 3E6CC 2PQQA 3LFMA 3RDIA 1LHOA 5GZFA 5KXDA 1AXYA 2CAUA 4GH4A 3VBUA 3P3PA 4B29A 5BNNB 2OA2A 1UKGA 4PI2A 4AFBA 4CE8A 5K7PA 2J7MA 3SCHA 3KF5A 1F2NA 1OI6A 4DMIA 4QQOA 5AVAA 2VMFA 1GOHA 5ACA1 5L9BA 2B5HA 1KDKA 3RZKA 2HBUA 2OZ6A 5JZGC 5FBJA 4CU8A 1CX4A 1MS8A 4I01A 4CDQB 3HBZA 3RMYA 1SPPA 4UBHA 1QGLA 4N43C 2QQWA 1UW8A 1XU2A 3TNQA 2DDUA 1KFXL 4XUPA 2VZUA 3TOJA 4P9WA 4QX8A 5F7UA 2W95A 4RS5A 3HJRA 3HNYM 1JYCA 1DGRN 4QQLA 3WV6A 4Y5TA 2JE9A 3MUY1 1WUVA 3QOPA 3MBWA 5C3QA 2WA4A 1WD4A 4P9GA 1QDOA 3DUIA 4QX0A 2I2SA 1S0JA 3NNFA 1D0HA 2PAEA 4CEYC 4NMIA 4S2HA 5FFOC 1IKQA 3KWVA 3KV5A 3U0ZA 1DZQA 3AXDA 2BFUL 3POSA 1BXHA 4JKKA 3LSEA 1OH4A 4TXWA 1PX4A 1AL0G 1ULCA 4OHYA 5F6KA 3NW4A 3VBOB 3ZN6B 4OQ8A 3I59A 1DP0A 4FPKA 4SLIA 4CU7A 4CRQA 1W2NA 2PHTA 3J8F3 1R1ZA 3VBSA 2ZABA 4QQ2A 3K48A 4HVRA 5LA2A 2MEV2 4CEWC 3A22A 2HYKA 1NG0A 1AYN3 4AOCA 2LM3A 1ZZ9A 3NQHA 4PBOA 2VZQA 2WRAA 1EPWA 1QQP2 1NE4A 2ES3A 3NV3A 3T3YA 3ZFGA 3B9CA 4BIOA 1I1EA 3GCXA 2ET7A 3AK0A 2JKBA 4WM7C 3RI8A 1AL22 3ZXAC 3K3NA 3IDEA 2XG3A 2XJVA 3ZM8A 3H1YA 2VUAA 3ACGA 3KCXA 4H2AA 1OA3A 1XNKA 3E5XA 4OHWA 2RJ2A 4WBBA 2W91A 1UAIA 2VTXJ 2UU8A 4AXOA 5A1AA 4XIKA 4CDUC 5EP9A 3MLKA 1SFPA 2IXCA 4UF0A 1Y9GA 3BTAA 2Q8CA 1UU5A 2ZGTA 3OPWA 2IUWA 2DYCA 3KLSA 1ZZ7A 1SMVA 5DG2A 4HVQA 5E8AA 4AI0A 4B3NA 2XXZA 1G86A 1O4YA 1HB4A 3AFKA 3NAPC 3QBQA 4HG6B 5T55A 4XJZA 3DYOA 4Q4V1 1GU3A 3WG3A 4BQ3A 1ZRDA 4D7YA 1O3QA 5C3PA 1D7PM 4W6YA 3ZYRA 3VD7A 4MLOA 2VZ3A 4HLTA 3FFQA 4NROA 4AR2A 5C5UA 1GNZA 1ZVFA 1FOD3 3IMNA 1PNGA 5FMCA 3IIAA 5LBEA 4YGEA 4CEWB 2VCMA 1NA1C 2WQ8A 3AZXA 5FPAA 4GXLA 5BXXA 3VZNA 2XLAA 5LW9A 1Q8OA 1VJ2A 4GWIA 5EFUA 5FYMA 4HFSA 1V00A 1SBEA 1RL3A 2C0ZA 4UW6A 4WM7B 1AR83 3WNMA 1KDMA 1G9FA 1OD3A 5A7PA 4ISQA 3POJA 4CYDA 2E32A 2BGCA 3RJ2X 1MR5A 4TN7A 1W2AX 4CDUB 4HK8A 4CUAA 2EVXA 2JDYA 1QJU3 2X05A 5FZ7A 5FLHA 3VL9A 2P5BA 2VR4A 4KG0A 4GJYA 5LWBA 2IXLA 5GJ6A 3BU0A 1TNRA 4PBPA 2XVKA 5D8AC 3UGHA 1Q56A 4INDA 3I2FA 2OQ7A 1CAWA 3KT1A 4GB32 4NIAA 3POYA 3BYWA 4ZHNA 1VBD2 4Y1ZA 1G9CA 1UYZA 1QDCA 3H8XA 1FT9A 1NZIA 1DU3D 4CUCA 1EV12 2DCKA 4ITCA 5CVRA 5C4WA 3S6PA 1VIWB 2EAKA 4QAWA 4A6OA 3RWKX 2D5HA 2RMU2 3QH7A 2A3WA 2EALA 3A0NA 3G7DA 1MACA 4HKLA 4MXWA 4B4PA 2LALA 3SH5A 3DF0A 5JOZA 5I8YA 1VPHA 5A3NA 3GZAA 4HPKA 3T30A 4MGQA 2JG9A 1SCRA 3TEWA 1BVVA 4ASKA 4OI0A 2VOKA 1F35A 3JB4C 3MI8A 2CY6A 4CUGA 5HCAA 1QWRA 4Q1RA 4QB6A 1J3QA 1WCUA 4J25A 4RQPC 1O3SA 4RR3A 2RDSA 4AWDA 1EAH2 5FY7A 4D6SA 1ZBE1 2E7TA 2EXHA 1PK6C 1N47A 5D8AB 2EIBA 2LROA 5FO9B 1GKBA 1GZ9A 2WO1A 4XHBA 3JBG1 4CCDA 1PO21 1PNFA 2NZ9A 5J3UA 3K4DA 1V6IA 5BY5A 5FMOS 5A6ZA 1S0DA 3VDBA 4YZ2A 2WABA 1LGNA 1MQTC 5T5PA 2VULA 5FZLA 5K4LA 4EN0A 4JV4A 4OMCA 2P4EA 4XF4A 4Y1YA 5KHJA 4M4PA 1HJGA 1ULPA 2DU1A 3I8TA 3VZMA 4META 1QJX2 2ZPXA 2ZXQA 5FMDA 4QGLA 2ADEA 4NVPA 2BGPA 2VL4A 3CJIC 2V4AA 4LBJA 2P3IA 1C1LA 1UY3A 2QQNA 3NJYA 1PVXA 3A0KA 2EIEA 1OKQA 3IDAA 4BXSV 1DGLA 2BP6A 4Y4YA 4FAHA 1DLLA 2TBVA 2ZGKA 2VW2A 4YARA 3CO2A 5EPAA 4P9YA 2MPFA 2JDZA 1SDDB 2Q8DA 4N7IA 4Q4V3 5A3TA 3UETA 1JOBA 2CNAA 1DCSA 4RQPB 3VBRB 3BOWA 2VM9A 5DG1A 5KR7A 1CAVA 3UJOA 1YC61 3SH3A 2W9XA 3D6EA 2I74A 4QPIC 1PK6B 3RZHA 1EY2A 2R30A 4JGZC 4HKWA 3IPVB 4C8DA 5JSPA 1NCRA 1J3RA 2P3JA 1JZ2A 2BJSA 4CDWC 1UZVA 2A6VA 4NRMA 1DLCA 4AVAA 5EHDA 3GBFA 1BEV2 1C4RA 3HEIA 1UXXX 4CP9A 1H4HA 1MQTB 3FX3A 1AYM2 2BQPA 5FO8B 2RJKA 1HDKA 1OHFA 1DYKA 2D44A 4XYXA 3LPFA 5HV0A 2K0GA 1E5RA 5G04L 3SHRA 3SQOA 3NO8A 1RYYA 3UGGA 2XUMA 4Y20A 4E4HA 3AZYA 2X5IA 4MUVA 3SITA 1WD3A 1NKGA 1DQ4A 3VKLA 2JXAA 3AYDA 1W9SA 4AEDC 1SACA 4AI8A 5FAXA 4X8NA 3GJBA 5C3SA 2IXJA 3M7AA 1DG6A 1VB2A 1W9WA 2QQVA 1GZCA 1ONAA 1RUD1 4LHKA 2F4PA 1IPKA 2QDNA 5F2WA 3CMGA 4LBKA 1GFF2 1HXS1 4QB1A 1CPMA 4FPYA 1VRBA 4WVMB 4FTBA 4XJWA 4I30A 2WAOA 2WZR1 4KNCA 5GZCA 3LEIA 3DECA 4LBQB 2DVGA 3LB9A 1S0IA 4KL1A 3NNLA 1W6MA 1RUF2 5FYSA 2VZTA 4DXSA 4JGYB 5F9TA 2E9QA 4JDMA 2VVDA 2XL9A 4I0AA 3EJKA 2PYTA 3I49A 5K9YA 5FYIA 4YZ5A 2GNBA 2I07B 3POEA 4HN1A 4XC9A 3BI3A 3OBZA 5JVVA 1DGWX 2JDUA 2R061 4LE4A 4JHZA 4LBQD 4QQPA 3ZXJA 2B9UA 4I0WB 4F83A 1XYNA 2D5FA 2ATFA 4U2AA 4LA2A 1BVP1 5HCBA 1AR62 2GNDA 3P5BA 5DZFA 5F3GA 2WZEA 2ZZQA 3C7GA 2ET1A 2OYZA 3WF2A 4EV0A 1WBLA 1RHI2 1W9YA 4CCCA 3PUSA 1GYKA 3LIGA 4DY5A 1VBB1 4LOTA 3KHCA 2TEPA 5IFTA 1J58A 3RWNA 1ZBE3 4DUWA 4UBGA 1NE6A 1STMA 4UYBA 2Q5TA 3JBG3 4IV3C 4NHKA 4D6QA 1GQGA 5DDJ2 4W6XA 3VBOA 3ZN6A 3VZLA 5FKCA 5KHKA 4XFBA 4Q4Y2 2BW8A 3THCA 3WG1A 3PLQA 4TLGA 1XSQA 2Q8OA 4CCOA 1QJY1 2QQMA 2HWE2 2VCAA 2YPDA 3WT3A 4BK5A 4ARYA 5C3OA 1GP4A 4P08A 4KBBA 2C9KA 2BOIA 4MOAA 5A33A 3ZFFB 4CTEA 1CX1A 3ZFEB 3FL7A 3VBUC 1PVC1 5A1FA 2YC0A 1JXNA 1A78A 2ZGUA 1Y3TA 5A6YA 1RUG2 4BQYA 3KV4A 5IW0A 3ZLIA 5BNOC 5ISLA 1FMD1 3MPPG 4BJ0A 2W5FA 4LUMA 3WQBA 2D3PA 1IKPA 1BQPA 2VNOA 1ENSA 4XAAA 4XUOA 4BQXA 4CCKA 2DTYA 1XBFA 5FPVA 3VBFB 4AQ6A 5DPNA 4DEVA 5HCHA 3EXUA 1GR3A 3ZOIA 2NPIA 3O1PA 2XL7A 4COUA 3UKNA 2VC9A 3ETQA 5IVBA 1KITA 2DVDA 4Y22A 2PLV1 3TB0A 2CSGA 4GIQA 4LO7A 1UPSA 3B93A 4ZXEA 1RUH1 2VW0A 4RS5C 5BUVA 3ZSEA 2BBVA 4IV3B 2W1QA 2WS92 3VGIA 1TE1B 2BBAA 3VDAA 4DNYA 3POFA 3KVBA 1CAUA 1UO9A 3BN6A 4QXHA 3JD71 4EN9B 4FFFA 5FP3A 2YPJA 2ZOEB 1HQWA 2P17A 3BOPA 2AACA 3OPTA 4DUXA 3LPGA 3J7NA 4IETA 1AX2A 1BJQA 1CIYA 2K2SA 4GH4B 4L97A 4Q4W1 3T0AA 3VBUB 1POV1 1UCXA 1D4M1 4YZ1A 4FFGA 1OVPA 1MEC2 1H2LA 5FOJB 2VECA 1P8JA 2W2IA 4N7UA 1J1LA 1W9TA 1QF3A 1YJKA 4LKFA 3J26N 1IOAA 1DQ6A 3HN1A 4MYEA 2SBAA 4ZY9A 2Q8EA 1RUD3 2GDFA 3U78A 3VBSC 3T2PA 1FPN1 1SPPB 4FFHA 1TEIA 4EJRA 2MEV3 1VBA2 4IEPA 3ZSMA 1HXS3 1BK1A 4OVEA 1TME2 5GLWA 1PM7A 4L11A 2QJVA 3ZYJB 1COV1 1C8M1 1QQP3 1NOVA 1ZBA1 2DCZA 5G05L 5C5TA 3LIHA 3ZFGC 4LITA 4LLFA 4UWDA 1UY2A 2RJLA 4RS5B 2BZDA 4K6BA 3DKQA 3IT8A 4KMQA 1RITA 1APNA 4RYDA 5F1RA 2FDFA 3NVCA 2EAAA 4NPMA 2WAAA 3H8RA 3N7JA 3ABZA 1JW6A 4AGGA 3CL1A 4CXXA 1SBDA 1TVGA 4Y5Z0 5FLIA 3WDYA 3T4HB 2D3RA 3W5NA 3J7LA 1AUYA 1RUE2 1ZYBA 2R063 4FQ4A 2BRTA 4LPLA 5GLUA 2W39A 3BPSA 2QZ2A 3X29B 1R64A 2YBSA 1V9U2 3CBNA 5A3PA 3PL0A 1W3XA 5FMBA 4L0PA 5J36A 4BMEA 4TTGA 4K7JA 1YJLA 2HJIA 2ARCA 1UYPA 2ZBJA 3I59B 3K3OA 5A80A 1U5ZA 1MS9A 1HN0A 1SFNA 1VBB3 1WCQA 2YFZA 1YQ8A 1W0OA 2CYFA 2SLIA 3K75B 4FOVA 3W58A 4E4ZA 3LA3A 3PIJA 4CUBA 5CEHA 3VBSB 3RQ0A 2WYFA 1O59A 3SEPA 2J42A 3P1IA 1VP6A 1LKNA 1QHDA 1OKOA 2CHHA 2R041 2XGXA 4XF1A 2QCSB 5LASA 2GSYA 1UL9A 3BCWA 3HPNA 4EN6B 4FP3A 4XAEA 2GC2A 2WBKA 4AHWA 2GZWA 3T1LA 1W8UA 2F6BA 3ZFGB 2WSUA 1PHMA 3OBTA 4WM8C 3MIHA 3ZYFA 1LTEA 3RYRA 1VAMA 4PJYA 5F2SA 3B7MA 2IFRA 3WX5A 5FZOA 3O1OA 3WF0A 3PTYA 2UWAA 1OF4A 2BNMA 5DAVA 1NX9A 1F5FA 2WFF2 2WSVA 4XBNA 2XWBB 3T2TA 4YLZA 4UF0B 5JXHA 2ZS6B 1MS4A 5L7OA 1O7FA 3W59A 4HETA 1JOJA 2FDGA 1YXWA 1FMD3 1JBCA 2HYXA 1PZ9A 3B94A 3K2OA 4YPJA 4AI1A 1GMMA 3I3EA 4XILA 4FSJA 4PCRA 4LK6A 1VBD3 2BFUS 4KU7A 4AG4A 5FRAA 4AEKA 4FO9A 2QQJA 4Q5OA 3Q9OA 4XJ9A 2PLV3 4W50A 3USSA 4BH9A 2Y38A 4I2OA 3H8UA 4E8CA 1FX5A 5JR2A 1RUH3 5DUWA 4RFT0 1TZOA 3PUQA 3OYWA 3VKOA 3T0DA 3W21A 5HBAA 5FDBA 1RUC2 4QKFA 4Z2WA 5FUNA 4CVUA 4A45A 1JYVA 3JD73 2PHDA 3ETPA 1AR92 3EBRA 3H7YA 4XDPA 4XQDA 2VOVA 3RNSA 3ZYGA 2X29A 4DXRA 2DFBA 2AENA 1OFNA 1YIFA 4K40A 1AR72 5FYYA 4BLJA 3ZXLA 3RYKA 2VVEA 5AVPA 3V56A 2ETEA 4Q4X1 2HEWF 1GNHA 3I3BA 5HCFA 1D4M3 2JDNA 4M00A 4AVBA 4H55A 2HWB1 2DCYA 3AP5A 4Y1XA 4ONUA 1NLSA 3I3QA 1Z78A 1U5YA 3IIIA 1G9BA 5JI9A 3AX4A 2VQAA 4XHXA 5IFPA 3IM0A 3W9AA 1CAWB 3JCIA 4QPWA 1GZTA 1FPN3 3DCQA 3CF6E 3PIGA 2W08A 5L19A 4OFGA 3MYXA 2GMEA 5KBFA 1PIV2 1GQPA 1LOBA 1T6BX 1NY72 1COV3 1C8M3 1QJEA 4JDNA 2WUHA 4H7LA 2VZVA 3LKJA 1Q5OA 4JTNA 1REEA 1UOFA 5FO7B 1WCKA 4ATFA 4AFDA 3OD4A 3VKFC 5JXGA 2H0BA 1NCQA 1H6YA 1SLBA 2IVJA 2P2KA 4GALA 4ZZ8A 5I0UA 5C4WB 2L9LA 5A32A 4BIFA 2DBNA 4S2DA 5FK7A 4CDXA 3SH4A 3JB8A 4MXWB 3NV1A 1R082 1V70A 4OHVA 2W68A 3DXTA 3HNMA 3O5SA 3AP9A 1VAKA 4NHMA 4HMZA 4HPKB 1GBGA 3PJQA 4P9IA 1XOYA 5GLZA 4LLOA 2JG9B 1SCSA 3RMXA 3WG2A 2Y60A 2X53S 2RS52 3KCCA 2XKOA 2Y6GA 3TRSB 2BPA2 3OGVA 4QX2A 1WA4A 4YRDA 5CB7A 4LK7A 2Q4SA 4RR3B 4H14A 4D69A 5A3MA 1LESA 2R071 3FLPA 2IZWA 2ZHMA 4LO5B 5C70A 3UT0A 4UFKA 3PTRB 3K4ZA 5EIYB 5D1IA 1QY4A 2JECA 1NCRC 4GKYA 4BK4A 4Z92B 2R043 4QPYA 5AFBA 5IJRA 4E4SA 4WZFA 2DUPA 1R1A1 4N9IA 5LB6A 2ZHKA 1V6JA 4PDWA 1XNCA 3GM8A 3GYDA 4BQ1A 1ND3B 2PHRA 2VZPA 4CU6A 4PIYA 2RM22 3FLRA 1CZSA 2HLEA 3FWEA 3GCWA 2RHPA 3VBHA 4AVCA 4C90A 2Z2SB 2X5IC 3HWJA 4B4RA 1KEXA 4FPCA 5CKQA 4GZ9A 5FXXA 4IEOA 2WO3A 1OVSA 4CDWB 5J37A 2VTXA 1PO11 4UFHA 5BNNC 1H8TB 2OIIA 5EJ3A 2ZKLA 5FXZA 4Y4RA 2G9ZA 4CCLA 1LOEA 2ZGLA 2C9AA 2WT2A 3F2ZA 1JH5A 1CAVB 1S0GA 2XQRA 4FOYA 4MSVA 5F3EA 1Y9QA 5FTTC 4BHPA 1UF2C 4E2QA 1RGSA 2FDJA 3RZLA 3ELNA 2Y0IA 3IZOA 2ZEWA 1IS3A 2XKPA 1ST8A 4AW7A 3AZWA 2ZACA 3JUUA 1NZCA 2XVGA 4JRLA 1QEXA 1BBT2 1FAYA 1RVF2 2DF7A 5FZ1A 2RS12 2XJSA 3ATGA 3D5OA 5A6QA 2XWJB 3MV11 1K5MB 3POGA 5HV4A 3C7OA 3MICA 1SLCA 3N9OA 3UJQA 2JIGA 4L92A 4Y20B 5FYUA 1O3RA 4M4RA 2X5IB 2BOJA 3FLTA 5AC91 5LATA 4R9DA 4Q4X3 2XHKA 4PF5A 3B00A 3SKVA 5KXEA 4OUMA 2YFUA 3O1RA 4YWAA 2W0XA 3EYPA 3TN92 1AR81 5CAZA 1JZ3A 3BKZA 1RHI3 1HRV2 1ZNPA 5FJKA 1MZ6A 1UY0A 2BUKA 2OS2A 5FY5A 4A41A 3ZSJA 4AQTA 1N1SA 2C26A 4QPGA 4X6RB 2B8MA 5LA0A 1UXZA 4IE0A 3D4KA 1QJU1 3NJZA 4ARXA 4NJ4A 5JSRA 1ASJ2 3VBOC 4YW3A 3VHRA 4QWNA 1D4VB 1PO22 4Q4Y3 3ITQA 2VE1A 3V0BA 1YUDA 4QU2A 1W6MB 4W4ZA 4RFRB 1NXMA 2D7FA 3T09A 4FAGA 1E5HA 4ZU5A 4NOTA 2CU5A 3SEEA 4Z1VA 3WUCA 4UXAA 5A7NA 2JDPA 3PUIA 1QNWA 3PNAA 4YYOA 3S57A 4C1WA 5HXVA 1PGW1 5DQ0A 1C1FA 5FYCA 1ZZCA 5JWPA 2G4IA 1UYXA 3HAGA 1SQ4A 4HL0A 4F3JA 3WQ1A 2XBO2 3WDTA 1FNYA 4LUKA 4ZPIA 1V6LA 4UW4A 2W94A 2Y33A 4AEMA 2EIDA 1CONA 2KM2A 2R073 1Q8QA 4K8RB 2B42B 1UKRA 3HQRA 3LZZA 3LWCA 3MDPA 4QHOA 1Z7S1 1XE7A 2HEVF 4HANA 4EZHA 4UI9L 1UWWA 3PMSA 3UYJA 1EP0A 1V6KA 2VMGA 2WS93 3H0OA 4LE3A 4LO6B 4QX1A 1UZZA 3O1SA 2ZX2A 1R1A3 1C8NA 5CFDA 3RFRA 1JYNA 2ZAAA 4QKBA 1DGWA 5LCWL 2VO5A 3I97A 4Q8LA 5L9VA 1PGL2 4UW5A 2XJRA 2V4VA 4P5YA 4GWMA 4Q4V2 1MS5A 3ILNA 1G9AA 4IESA 3VKMA 5A33B 4Q0SA 3FHQA 2JDHA 5L36A 4GWJA 3W20A 3KMHA 1OC1A 5CU1A 1OA4A 3WW4A 1MEC3 4AFMA 2Z42A 2DVBA 5LA1A 2VOXA 1TNFA 1PO13 5CKMA 1JS9A 2Z4FA 3KGZA 5FYTA 2R0FA 4A7KA 2VQTA 1LGCA 2ZMNA 5BNQA 1PZ7A 2VMHA 4XW3A 5IVEA 5I0DA 2EF6A 4GULA 1TME3 4QM9A 4QMAA 3PUHA 4DXTA 5IK7A 2VCCA 4Y22B 3PVNA 3U1XA 1BLZA 2VOTA 3OGGA 4QXCA 5DAQA 2A71A 5JOWA 4LT5A 3C3VA 3AKSA 1K3IA 5C9AA 2ZHNA 1CAUB 4HSJA 1GWLA 2A6ZA 2V73A 4GMP0 1HJFA 3VZKA 4R9BA 4DQAA 1OLME 2CGOA 4ZKTB 2XLFA 3UNPA 2ZGQA 5C7GA 4QQHA 4XIOA 5FY1A 5C3RA 4IDZA 2BU9A 2VBPA 3UL2A 4PLNA 5AC93 5CKNA 1W8TA 5CA6A 3ACLA 3V64A 2DFCA 3O7OA 5F6LB 2XDVA 1SG3A 3B02A 1NUKA 1BKZA 1SFYA 4QT6A 3M3OA 1UQXA 1E5SA 4XQWA 4LOSA 3WOGA 4JKLA 2AR6A 2PA7A 5JAXA 3LD8A 3OOXA 3A23A 3NNMA 5AFEA 4J1WA 2WZPP 1XC6A 1XXNA 4PIXA 5ERLA 2VMIA 2E53A 2FD8A 3ST7A 1FI2A 4LHSA 4M3CE 1Q43A 1VBC2 3H50A 4MH0E 3VLBB 1ZZ8A 3LA7A 1ENXA 4A2UA 1GSLA 1SLTA 1W8HA 1W6NA 5FY9A 2QNKA 2E31A 5CADA 2WT0A 4E9KA 4HT1T 2YB7A 4O61A 1W8ZA 1KFUL 3OEAA 4I09A 5FWJA 2WFF3 4WV8A 2D43A 4FPOB 1QH6A 4FI9A 5A7WA 1UD1A 5L7OC 1J59A 4AFAA 1US2A 2VBDA 2R7EB 3ALQA 3THTA 1LHNA 1L7RA 1A6CA 1UOJA 5FYVA 2A5ZA 3RRDA 1ZZ6A 3UV9A 1LB2A 4YVSA 1AXKA 3O1MA 2JX9A 5F3IA 1RUJ2 2VQUA 1QKQA 2RE9A 1OLRA 5FZ0A 2B45X 5B4NA 2YY1A 1QJFA 3EB7A 4NAMA 4RA0A 3GHMA 1H2KA 1F4AA 2A75A 2Y6KA 2IC1A 3WP3A 1Z7S3 4A6SA 5I93A 2FDKA 1ZA4A 1RC6A 2GP3A 1UMIA 3KVAA 5LBFA 2DV9A 3VBRC 2RR12 4WVWA 4RHV2 5T54A 1K12A 3T4VA 3IN9A 1YCIA 3N36A 1G8WA 1AR93 3I2IA 1WKYA 4BYYA 2ZEZA 4K1ZA 2DTWA 5FPLA 3WNNA 2VD7A 3T2OA 3I3MA 1ZREA 2GMMA 2JJ6A 5FZOB 1ULFA 2H0VA 4OI4A 1VAVA 4YG0A 4Z82A 2YUEA 1R091 5F5CA 5FBZA 5HXMA 2W47A 4AFCA 3FUQA 3ZPYA 3CZUA 4B7KA 1ND3A 5I91A 5IVVA 3CJXA 5L7OB 2HWD2 1QOTA 3AZVA 3SLIA 4E27A 1UMHA 4ES8A 3IB3A 3H42B 4PLMA 1JZ8A 3BTXA 3HOBA 3TEZA 3VKNA 2NP0A 1WW4A 2PHXA 1FXZA 1W6PA 1HQLA 3OY8A 3AC0A 5DZEA 3BIEA 1H8TA 4MX3A 4AI2A 1EUTA 3LOIA 3B5LB 3M70A 3WF1A 1ZBA2 1CJPA 2JB4A 4LBOA 3I7DA 3AJZA 3OYWB 3VB9A 5JLVA 1IG0A 3JQXA 3W5MA 4DPNA 3PU8A 3NMBA 4D6RA 1BMV2 1XNTA 1K45A 4X6QB 1J1TA 2QZ3A 4H3WA 1OMIA 5FREA 5FIXA 1ACCA 1F4HA 1TMF2 1UPIA 4JGYC 4LBNA 3V0AA 1OA2A 3AMNA 1G6NA 1VBE2 1M4WA 4RGKA 3WEZA 1QXJA 3GZEA 1K5MA 5IATA 3CNAA 3WSOA 1VRH2 2ZKNA 3IAPA 3RJRA 2NM1A 4EYUA 3RZJA 2WA3A 2UY8A 4NPLA 2Y64A 3MIBA 3LEGA 1OQEA 1GP6A 1FYUA 5L73A 4CCEA 4IL7A 5FPBA 3K46A 3PVOA 4ASLA 2W46A 1CAXA 5JPNB 2VH9A 2X10A 2DVFA 4CPBA 5LY2A 2XUEA 5LA9A 5FZGA 2YMZA 3LQCA 1KJRA 1LOCA 1NCQB 3KGLA 2MEV1 2JG8A 3O12A 3POBA 3AMPA 3I2HA 1W6OA 4HSLA 5A32B 4CDXB 2O14A 1C28A 5FZAA 5IWFA 3C2UA 1JUIA 1QQP1 2QKDA 2JENA 4FVVA 1RUI2 1LEDA 1WMEA 3ZMOA 1ZRCA 3M3CA 3RGBA 4JQRA 3RZGA 2R49A 1KGYA 1H8VA 4A42A 1LOGA 2ZX0A 3HN3A 3ZFEC 3NNJA 3ZFFC 1ND2A 1YYNA 4FPHA 1X7NA 3LDBA 4IQPA 4YFZA 2E26A 5GZEA 2A7AA 2QQOA 3MLJA 4FPFA 4WVVA 4BB3A 4COWA 1QXPA 3AP7A 1H9WA 2ZGNA 4OZOA 4XBQA 5ABJA 2RS32 4QM8A 3DL3A 1QU0A 5I8SA 1ODMA 4IEVA 2YROA 1XNDA 2ZGOA 4MHUA 1XJAA 3M3QA 2A70A 4XBLA 3VBFC 3HMYA 5FY0A 4JVAA 4AQSA 1T2XA 2LW8A 1RVF3 1S4CA 2HWC2 5K0UA 1H2MA 5KWRA 3D82A 4H7MA 3OB8A 4A7YA 5A70A 5IK5A 4PDWB 1HRI2 1LEMA 2VOWA 1C5HA 2J1EA 4LIUA 2JB8A 4AVSA 3VD3A 2ZTNA 2Q1MA 3NSTA 4IV1B 1AF9A 3NKTA 2Q1FA 2VUCA 4NHLA 3EO6A 3VBHB 1YFUA 1IPSA 2O8OA 2WO7A 2AEZA 3ZXDA 1WBFA 2HWF2 2DWRA 2OZJA 1R093 4AAPA 4OUEA 4OZXA 1XNBA 3TN93 5LEKA 2VMCA 4K1YA 5F5QA 1LHWA 2C5DA 4IEQA 4GH4C 1YFWA 2Y8KA 2VMEA 5DUVA 1N3QA 3AYCA 2WQZC 4LKSA 4HOOA 4XF9A 5CFCB 3MEPA 4IERA 3CLPA 1W6QA 2X09A 3HIFA 4R9CA 1XSRA 5FZMA 2OXBA 1YWKA 3MIDA 5C33A 1F9KA 4BDVB 4W65A 1K5JA 4GB31 5EZWA 2VUJA 2CAVA 5JZGA 4YM3A 5JR7B 1VBD1 4JAAA 3LEMA 4N43A 1DZTA 1PMHX 1D2SA 4M01A 3K4AA 4EWDA 3SC7X 1OQ1A 3FMGA 3T0BA 2WDBA 1GOGA 1EV11 3RG0A 4YZ4A 5FZ8A 3ES4A 5J09A 3WW1A 5I0SA 4E2SA 3ZN5A 2RMU1 1BK0A 3ES1A 4YVWB 3GNEA 2XBO3 5HPOA 2YV8A 2ZEXA 4K21A 2DCJA 3CQOA 4LO4B 3KF3A 2P6HA 3JZVA 2IXHA 2Y6HA 1ZRIA 3RZZA 4BQ4A 5CG9A 2WFPA 1YO8A 3FN9A 1S0BA 3WLUA 4QPGB 1M06G 2WO2A 4M3CF 3A4UA 3KQRA 1DZRA 1UY1A 4XQ4A 3LDKA 5FZHA 1YQCA 4COZA 1EAH1 1PZ8A 1IPJA 2BYVE 3V0BB 4URTA 4BQ5A 3I2OA 1UMZA 1OLQA 3J8F2 1W9FA 4NWWA 2WJSA 4B7EA 1GICA 2JEMA 1RMU2 3M3EA 3R4UA 1AYN2 5IVJA 3H1WA 3HQXA 4FT8A 4ATEA 3CHXA 5J7MA 4RGGA 1G9DA 1AL23 1MPXA 4ES9A 2QQUA 1GWMA 2YBKA 4AAXA 3WY6A 1H4GA 1QJX1 1CGPA 4QDQA 4NPRA 5A3WA 3U4XA 3LFIA 4TWTA 3VDDA 2DU0A 2XJQA 3CU7A 4S2FA 5IAXA 2DVAA 1W2OA 4YG3A 4CP1A 1UOGA 4XDQA 2JE7A 3GZTB 4DFSA 5H9SA 1IZ3A 4NHXA 2W1UA 4EZ4A 1LR5A 1UIJA 1UX7A 5JIUA 3J4UH 4V2WA 5DAPA 3VD9A 1GV9A 3VDCA 3WXPA 3NAPA 5C9AC 5GLVA 4EROA 4MGYE 4XMIA 1YLLA 2CGNA 3ACHA 3IAQA 5FMOL 5CFDB 3VHPA 3IKWA 5EWSA 4ZONA 4FBFA 2CDPA 4XFIA 4OYUA 3D0JA 4NIIA 4Q0PA 3WG4A 5FQ0A 3E97A 1OQDA 3ZDSA 4RN5A 1FOD2 1JUHA 3I2GA 1BEV1 2ZMLA 1FNZA 1HB3A 3H9AA 3RS6A 1AYM1 4PF1A 3VZOA 3ZXEA 2E51A 3QLQA 3AJYA 3MIGA 4EQVA 4LKDA 4O9GA 4AHYA 1WMDA 4LO8A 4N9HA 2YU2A 3AFGA 4OULA 3VV1A 1ODNA 2AH2A 4QB2A 3OGRA 5F8PA 2ZX3A 3ZX7A 1RJ8A 4MZUA 4AEJA 2ARXA 3URFA 3R05A 4FOQA 3RPQA 1NLQA 2J1UA 5ACA2 4PHZA 2DURA 2G1MA 4GB33 2K9ZA 2YDEA 3ILRA 4YW7A 2E33A 2JE8A 5C9AB 5FPXA 2FMDA 3CZJA 2KA3A 3ZVXA 1QJZA 5I8TA 4RL7A 4R8HA 3TEYA 1ZRFA 5GM0A 1EV13 1Q8VA 2GN3A 1JZ4A 1RUF1 5C4WC 1AHSA 2G9FA 2K46A 3KS7A 2D6OX 3MW3A 2RMU3 5E6HA 4JRAA 1W0PA 1XE8A 3ZIXA 1UIKA 5A3UA 2WNOA 4K9SA 4YVSC 1WLTA 4XF3A 3MF6A 3WP5A 2XLGA 2Y6LA 5ANQA 4JHTA 3VL8A 4DIQA 4Y24A 3R6SA 4BA6A 5FYZA 1G7YA 4JX0A 2JG9C 1MS1A 2OUJA 4B1LA 2ZEYA 3TWIA 3ZPOA 3J9SA 1AR61 2XPJA 4XACA 1S2EA 2QQKA 3F95A 2QVSB 1A8DA 2QQLA 1S0EA 3GHNA 4W8JA 1WLDA 2AGSA 5SV8A 3KQ4B 1RHI1 1QMJA 4RR3C 5IYYA 2WZ8A 1EAH3 5IK8A 3PDQA 4MO3M 3N3HA 1X36A 4LULA 3MPBA 4MXVA 4Y33A 3ZXGA 1IS4A 5FP8A 1RTVA 1EYBA 1W6NB 5DDJ1 3PHMA 5DAWA 1U12A 4Q4Y1 4UFMA 4AK3A 2CWSA 4LJHA 3HR9A 1DHKB 2HWE1 1H1MA 1ND3C 2MHFA 5A7WB 4D8MA 1UNBA 3S5AA 5T5JA 1RB8G 4IW3A 3AP4A 1WLWA 2B39A 5JCTA 3H1MA 5BNPB 2CL2A 1RXFA 3C7FA 1LU1A 4LIVA 3E1F1 4XOGA 5CISA 1QJX3 2Y6FA 5FY4A 3VHNA 5JXJA 4YVSB 1OH3A 2OUHA 1RUG1 2PAKA 2VNVA 5I0TA 1WA6X 2HBTA 4KGQA 3ZXKA 1NYWA 3CJIA 4XUQA 4TSVA 4BWOA 5FYBA 5IVYA 1H8TC 1JZ5A 2WN2A 2BWCA 2UWBA 2YXSA 1PMJX 1GP5A 4UW3A 4E8DA 3GF6A 3NJVA 1OOPB 3OUJA 5FZIA 3OUHA 5IAVA 4LORA 1IS5A 1DQ5A
chains in the Genus database with same CATH topology
3J7HA 1UZ0A 2W9XA 2BERA 5LA1A 2VTFA 1JZ2A 2Z4FA 1DLCA 2VQTA 3HEIA 1UXXX 1UYYA 4MADA 2KD7A 5I0DA 3PUHA 2WYSA 4DXTA 2VCCA 3HNBM 2VOTA 3LPFA 5G04L 1RYYA 3U37A 1K3IA 2BGOA 2XHNA 1JU4A 2J1AA 3GGLA 1NKGA 1O8SA 1W9SA 1W8NA 3VD5A 5C7GA 1W9WA 4DEQA 3CMGA 5EJ1B 4QB1A 3ACFA 4ET7A 4PQQA 1SG3A 1NUKA 1XPWA 2WAOA 3C7EA 3LEIA 3SKJE 3DECA 4JKLA 2JDAA 4DXSA 2VZTA 3A23A 3T08A 1XC6A 2J1VA 4JKMA 2QBXA 4LHSA 4JHZA 1OT5A 2ORZA 2ORXA 2E31A 2YB7A 2WZEA 3C7GA 3WF2A 3OEAA 1JHJA 4FI9A 5IFTA 1US2A 2R7EB 4DUWA 3T2QA 3MV01 4MGSA 1L7RA 3DYMA 2LS6A 2OKXA 1JYWA 2XONA 1W8OA 3I3DA 2VQUA 5B4NA 3THCA 3EB7A 5IHRA 2QQMA 2VCAA 4BK5A 1F4AA 2Y6KA 4ARYA 1DYOA 1UY4A 4P08A 2C9KA 4MOAA 1CX1A 2VJXA 1UMIA 2VZ1A 2XOMA 3FL7A 5DN2A 3WF3A 3BGAA 1K12A 3I2IA 1WKYA 2ZEZA 1L7QA 4BJ0A 3WNNA 2W5FA 3T2OA 3WQBA 2V72A 1O8PA 2W1WA 4XUOA 4DEVA 3JXSA 5DPNA 3MUZ1 2VZRA 3WNLA 5HXMA 2W47A 2VC9A 3CZUA 5J1XA 4QDRA 1NAEA 3NRUA 4ZXEA 1UMHA 4IUGA 2W1QA 3IB3A 1JZ8A 3VDAA 2BBAA 3HOBA 1SHWB 3BN6A 2J1TA 1H6XA 1I5PA 3AC0A 3GDBA 5C71A 1EUUA 1EUTA 4OMDA 4DUXA 3LPGA 3T0AA 3WF1A 1CIYA 1TG7A 2W3JA 3LEKA 1IQDC 1CZTA 3W5MA 2VMDA 1OF3A 3THDA 1XNTA 1K45A 3WF4A 1P8JA 2J1SA 4XUTA 1W9TA 3OEBA 1F4HA 4ZY9A 3T2PA 4A44A 3WEZA 4DUVA 3WSOA 2J22A 3IAPA 5G05L 2Y64A 3LEGA 1UY2A 2BZDA 4KMQA 4RYDA 3K46A 1HN1A 2W46A 2CDOA 2WAAA 3ABZA 4LQRA 1TVGA 3GXUA 3A7QA 3W5NA 2X10A 4KWUA 4LPLA 3LQCA 2B9VA 1R64A 2Y6JA 3NNGA 2WN3A 3I2HA 5EJZB 3WNPA 4L0PA 3OGSA 4TTGA 5B4XA 2PQSA 1BHGA 2XQXA 1WCQA 2YFZA 3K75B 1KGYA 1JZ7A 4CUBA 4UAPA 4A42A 3CIHA 3HN3A 1O59A 3SEPA 3P1IA 2W1SA 3I2KA 2E26A 2QQOA 3HPNA 5DMYA 2ID4A 2WBKA 4OZOA 2EICA 4CU9A 5JMOA 3WF0A 1T2XA 2RV9A 2LW8A 1OF4A 1NX9A 5JXHA 3OB8A 2J1RA 2J1EA 2VCBA 1W0NA 3OBAA 3VD3A 2HYXA 1J83A 1W99A 4YPJA 1GMMA 3I3EA 3NJXA 3ECQA 4XUNA 3K77A 4OUEA 4AG4A 1GUIA 2QQJA 2VMCA 3CKHA 4W50A 4P02B 1XNAA 4E8CA 5JR2A 2Y8KA 2VMEA 3T0DA 4LKSA 2J7MA 4CVUA 2X09A 4A45A 3ACIA 1JYVA 2RVAA 1GOHA 2VMFA 3ETPA 1GNYA 4BDVB 1JI6A 4DXRA 4CU8A 3I3BA 1PMHX 3K4AA 2DDUA 4XUPA 3T0BA 2WDBA 2VZUA 1GOGA 3IIIA 5F7UA 2W95A 3HJRA 3HNYM 5IFPA 4QPWA 3I2JA 5HPOA 3MUY1 2ZEXA 3C7HA 2DCJA 3MBWA 3CQOA 1GQPA 2Y6HA 4QX0A 2WUHA 4P00B 2VZVA 5JXGA 3FN9A 2WO2A 1H6YA 4ZZ8A 2L9LA 4JKKA 1UY1A 1OH4A 4TXWA 1PX4A 5JXIA 3HNMA 1DP0A 4CU7A 1JYXA 5LA2A 2Y6GA 3A22A 3OGVA 4QX2A 2W87A 2YC2A 3NQHA 2VZQA 2VZOA 1LNSA 5C70A 1MPXA 3K4ZA 4AAXA 5EIYB 3ZM8A 4BK4A 3ACGA 4UOJA 2RJ2A 2W91A 4QDQA 2JD9A 5A1AA 5IJRA 1GOFA 3UESA 2VZSA 2JKXA 3GM8A 4QX3A 2VZPA 4CU6A 2W1UA 1UX7A 1CZSA 3D3AA 2HLEA 1PX3A 5CZKA 4HG6B 3VD9A 3VDCA 3DYOA 1KEXA 1GU3A 4GZ9A 1CZVA 3IAQA 3ACHA 1D7PM 3CDZB 2WO3A 2CDPA 3VD7A 4OYUA 2VZ3A 4A4AA 4RN5A 3I2GA 4PT6A 2WQ8A 4PF1A 3A21A 4GWIA 2QQIA 3F2ZA 3MO4A 4KI5M 3WNMA 1ULOA 1US3A 1OD3A 2ZEWA 3WNOA 2E32A 4QB2A 2YC4A 3OGRA 4XURA 4CUAA 2X05A 3MV11 2VR4A 3C7OA 3WNKA 2J1UA 3P6BA 3I2FA 4ZZ5A 4M4RA 2E33A 2JE8A 3CZJA 3SKVA 4XZUG 1UYZA 2YFUA 3VD4A 4Z2AA 3EYPA 1JZ3A 5CYYA 4A41A 1UY0A 1JZ4A 2W92A 4CUCA 2C26A 2DCKA 5FUIA 1YQ2A 5LA0A 4QAWA 1UXZA 4A6OA 5JUVA 4ARXA 2Y6LA 2YG0A 4JX0A 4MGQA 2ZEYA 4W4ZA 2QQKA 4W8JA 4QDSA 2QQLA 3T09A 4QB6A 3SEEA 5IYYA 2WZ8A 3PUIA 4MO3M 5DQ0A 1UYXA 2EIBA 2B4KA 1J84A 2WO1A 1JZ6A 3LE0A 3K4DA 3OG2A 2C4XA 2W94A 2EIDA 3VDBA 1K42A 2WABA 4XVHA 4D8MA 4OMCA 3C8XA 4M4PA 3DYPA 3FHAA 1ULPA 3C7FA 4UI9L 1UWWA 3E1F1 4QX1A 5JXJA 3UNPA 2ZXQA 4A3ZA 2BGPA 2VL4A 1JYNA 1UY3A 4D0QA 2QQNA 2VO5A 3I97A 4XUQA 2EIEA 3IDAA 5LCWL 4BXSV 2V4VA 1JZ5A 4P5YA 2WN2A 1PMJX 4E8DA 3FHQA 1SDDB 1JU3A 3NJVA 4GWJA 3UETA 2V5DA 2VM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J7H A;  1UZ0 A;  2W9X A;  2BER A;  5LA1 A;  2VTF A;  1JZ2 A;  2Z4F A;  1DLC A;  2VQT A;  3HEI A;  1UXX X;  1UYY A;  4MAD A;  2KD7 A;  5I0D A;  3PUH A;  2WYS A;  4DXT A;  2VCC A;  3HNB M;  2VOT A;  3LPF A;  5G04 L;  1RYY A;  3U37 A;  1K3I A;  2BGO A;  2XHN A;  1JU4 A;  2J1A A;  3GGL A;  1NKG A;  1O8S A;  1W9S A;  1W8N A;  3VD5 A;  5C7G A;  1W9W A;  4DEQ A;  3CMG A;  5EJ1 B;  4QB1 A;  3ACF A;  4ET7 A;  4PQQ A;  1SG3 A;  1NUK A;  1XPW A;  2WAO A;  3C7E A;  3LEI A;  3SKJ E;  3DEC A;  4JKL A;  2JDA A;  4DXS A;  2VZT A;  3A23 A;  3T08 A;  1XC6 A;  2J1V A;  4JKM A;  2QBX A;  4LHS A;  4JHZ A;  1OT5 A;  2ORZ A;  2ORX A;  2E31 A;  2YB7 A;  2WZE A;  3C7G A;  3WF2 A;  3OEA A;  1JHJ A;  4FI9 A;  5IFT A;  1US2 A;  2R7E B;  4DUW A;  3T2Q A;  3MV0 1;  4MGS A;  1L7R A;  3DYM A;  2LS6 A;  2OKX A;  1JYW A;  2XON A;  1W8O A;  3I3D A;  2VQU A;  5B4N A;  3THC A;  3EB7 A;  5IHR A;  2QQM A;  2VCA A;  4BK5 A;  1F4A A;  2Y6K A;  4ARY A;  1DYO A;  1UY4 A;  4P08 A;  2C9K A;  4MOA A;  1CX1 A;  2VJX A;  1UMI A;  2VZ1 A;  2XOM A;  3FL7 A;  5DN2 A;  3WF3 A;  3BGA A;  1K12 A;  3I2I A;  1WKY A;  2ZEZ A;  1L7Q A;  4BJ0 A;  3WNN A;  2W5F A;  3T2O A;  3WQB A;  2V72 A;  1O8P A;  2W1W A;  4XUO A;  4DEV A;  3JXS A;  5DPN A;  3MUZ 1;  2VZR A;  3WNL A;  5HXM A;  2W47 A;  2VC9 A;  3CZU A;  5J1X A;  4QDR A;  1NAE A;  3NRU A;  4ZXE A;  1UMH A;  4IUG A;  2W1Q A;  3IB3 A;  1JZ8 A;  3VDA A;  2BBA A;  3HOB A;  1SHW B;  3BN6 A;  2J1T A;  1H6X A;  1I5P A;  3AC0 A;  3GDB A;  5C71 A;  1EUU A;  1EUT A;  4OMD A;  4DUX A;  3LPG A;  3T0A A;  3WF1 A;  1CIY A;  1TG7 A;  2W3J A;  3LEK A;  1IQD C;  1CZT A;  3W5M A;  2VMD A;  1OF3 A;  3THD A;  1XNT A;  1K45 A;  3WF4 A;  1P8J A;  2J1S A;  4XUT A;  1W9T A;  3OEB A;  1F4H A;  4ZY9 A;  3T2P A;  4A44 A;  3WEZ A;  4DUV A;  3WSO A;  2J22 A;  3IAP A;  5G05 L;  2Y64 A;  3LEG A;  1UY2 A;  2BZD A;  4KMQ A;  4RYD A;  3K46 A;  1HN1 A;  2W46 A;  2CDO A;  2WAA A;  3ABZ A;  4LQR A;  1TVG A;  3GXU A;  3A7Q A;  3W5N A;  2X10 A;  4KWU A;  4LPL A;  3LQC A;  2B9V A;  1R64 A;  2Y6J A;  3NNG A;  2WN3 A;  3I2H A;  5EJZ B;  3WNP A;  4L0P A;  3OGS A;  4TTG A;  5B4X A;  2PQS A;  1BHG A;  2XQX A;  1WCQ A;  2YFZ A;  3K75 B;  1KGY A;  1JZ7 A;  4CUB A;  4UAP A;  4A42 A;  3CIH A;  3HN3 A;  1O59 A;  3SEP A;  3P1I A;  2W1S A;  3I2K A;  2E26 A;  2QQO A;  3HPN A;  5DMY A;  2ID4 A;  2WBK A;  4OZO A;  2EIC A;  4CU9 A;  5JMO A;  3WF0 A;  1T2X A;  2RV9 A;  2LW8 A;  1OF4 A;  1NX9 A;  5JXH A;  3OB8 A;  2J1R A;  2J1E A;  2VCB A;  1W0N A;  3OBA A;  3VD3 A;  2HYX A;  1J83 A;  1W99 A;  4YPJ A;  1GMM A;  3I3E A;  3NJX A;  3ECQ A;  4XUN A;  3K77 A;  4OUE A;  4AG4 A;  1GUI A;  2QQJ A;  2VMC A;  3CKH A;  4W50 A;  4P02 B;  1XNA A;  4E8C A;  5JR2 A;  2Y8K A;  2VME A;  3T0D A;  4LKS A;  2J7M A;  4CVU A;  2X09 A;  4A45 A;  3ACI A;  1JYV A;  2RVA A;  1GOH A;  2VMF A;  3ETP A;  1GNY A;  4BDV B;  1JI6 A;  4DXR A;  4CU8 A;  3I3B A;  1PMH X;  3K4A A;  2DDU A;  4XUP A;  3T0B A;  2WDB A;  2VZU A;  1GOG A;  3III A;  5F7U A;  2W95 A;  3HJR A;  3HNY M;  5IFP A;  4QPW A;  3I2J A;  5HPO A;  3MUY 1;  2ZEX A;  3C7H A;  2DCJ A;  3MBW A;  3CQO A;  1GQP A;  2Y6H A;  4QX0 A;  2WUH A;  4P00 B;  2VZV A;  5JXG A;  3FN9 A;  2WO2 A;  1H6Y A;  4ZZ8 A;  2L9L A;  4JKK A;  1UY1 A;  1OH4 A;  4TXW A;  1PX4 A;  5JXI A;  3HNM A;  1DP0 A;  4CU7 A;  1JYX A;  5LA2 A;  2Y6G A;  3A22 A;  3OGV A;  4QX2 A;  2W87 A;  2YC2 A;  3NQH A;  2VZQ A;  2VZO A;  1LNS A;  5C70 A;  1MPX A;  3K4Z A;  4AAX A;  5EIY B;  3ZM8 A;  4BK4 A;  3ACG A;  4UOJ A;  2RJ2 A;  2W91 A;  4QDQ A;  2JD9 A;  5A1A A;  5IJR A;  1GOF A;  3UES A;  2VZS A;  2JKX A;  3GM8 A;  4QX3 A;  2VZP A;  4CU6 A;  2W1U A;  1UX7 A;  1CZS A;  3D3A A;  2HLE A;  1PX3 A;  5CZK A;  4HG6 B;  3VD9 A;  3VDC A;  3DYO A;  1KEX A;  1GU3 A;  4GZ9 A;  1CZV A;  3IAQ A;  3ACH A;  1D7P M;  3CDZ B;  2WO3 A;  2CDP A;  3VD7 A;  4OYU A;  2VZ3 A;  4A4A A;  4RN5 A;  3I2G A;  4PT6 A;  2WQ8 A;  4PF1 A;  3A21 A;  4GWI A;  2QQI A;  3F2Z A;  3MO4 A;  4KI5 M;  3WNM A;  1ULO A;  1US3 A;  1OD3 A;  2ZEW A;  3WNO A;  2E32 A;  4QB2 A;  2YC4 A;  3OGR A;  4XUR A;  4CUA A;  2X05 A;  3MV1 1;  2VR4 A;  3C7O A;  3WNK A;  2J1U A;  3P6B A;  3I2F A;  4ZZ5 A;  4M4R A;  2E33 A;  2JE8 A;  3CZJ A;  3SKV A;  4XZU G;  1UYZ A;  2YFU A;  3VD4 A;  4Z2A A;  3EYP A;  1JZ3 A;  5CYY A;  4A41 A;  1UY0 A;  1JZ4 A;  2W92 A;  4CUC A;  2C26 A;  2DCK A;  5FUI A;  1YQ2 A;  5LA0 A;  4QAW A;  1UXZ A;  4A6O A;  5JUV A;  4ARX A;  2Y6L A;  2YG0 A;  4JX0 A;  4MGQ A;  2ZEY A;  4W4Z A;  2QQK A;  4W8J A;  4QDS A;  2QQL A;  3T09 A;  4QB6 A;  3SEE A;  5IYY A;  2WZ8 A;  3PUI A;  4MO3 M;  5DQ0 A;  1UYX A;  2EIB A;  2B4K A;  1J84 A;  2WO1 A;  1JZ6 A;  3LE0 A;  3K4D A;  3OG2 A;  2C4X A;  2W94 A;  2EID A;  3VDB A;  1K42 A;  2WAB A;  4XVH A;  4D8M A;  4OMC A;  3C8X A;  4M4P A;  3DYP A;  3FHA A;  1ULP A;  3C7F A;  4UI9 L;  1UWW A;  3E1F 1;  4QX1 A;  5JXJ A;  3UNP A;  2ZXQ A;  4A3Z A;  2BGP A;  2VL4 A;  1JYN A;  1UY3 A;  4D0Q A;  2QQN A;  2VO5 A;  3I97 A;  4XUQ A;  2EIE A;  3IDA A;  5LCW L;  4BXS V;  2V4V A;  1JZ5 A;  4P5Y A;  2WN2 A;  1PMJ X;  4E8D A;  3FHQ A;  1SDD B;  1JU3 A;  3NJV A;  4GWJ A;  3UET A;  2V5D A;  2VM9 A; 
#chains in the Genus database with same CATH topology
 1OSG A;  1POV 0;  1CES A;  4CXW A;  2WKK A;  5C6C A;  4R4Z A;  4YGC A;  2BER A;  2ZGP A;  1WLC A;  1MVE A;  1WW6 A;  1N1T A;  1VMF A;  1HLC A;  4OUS A;  1I9R A;  2WS9 1;  4JGZ A;  4QPI A;  4OQ9 A;  1QH7 A;  3INA A;  3S7I A;  1AJO A;  1BEV 3;  2TUN A;  4CDW A;  2F4L A;  2Z69 A;  4W6W A;  1AYM 3;  1C57 A;  4MAD A;  2WR9 A;  1KD7 A;  1K5M C;  5CNA A;  2QQP A;  5DAB A;  2WYS A;  3KM5 A;  3WP4 A;  3HNB M;  3WNX A;  4YNI A;  3JU9 A;  4IV1 A;  1D0G A;  2D97 A;  1DDL A;  2CGP A;  3WCS A;  1U5X A;  4L99 A;  4NHY A;  3U37 A;  1Y4W A;  2BGO A;  1MEC 1;  3Q8C A;  2HKX A;  1O8S A;  2FCV A;  4GMP 1;  1OUX A;  3HVD A;  2GC0 A;  3DEM A;  5LK7 B;  4AED A;  1W6P B;  3OY8 B;  4XJA A;  3VD5 A;  1NXD 1;  3H7J A;  1OUR A;  2BDR A;  4DEQ A;  5CFC A;  1VBA 1;  2JG8 C;  3HQU A;  3N7L A;  3Q8F A;  4UFJ A;  4NIH A;  1TME 1;  1O5L A;  4BE3 A;  4MGK E;  3ACF A;  2KR2 A;  4ET7 A;  2D40 A;  4FTS A;  3POW A;  1MS3 A;  3OSD A;  3KB5 A;  1XPW A;  2P37 A;  3C7E A;  4XFF A;  1RUF 3;  3V0A B;  2JDA A;  2WT1 A;  3DV8 A;  3RSJ A;  4D3W A;  2WLP A;  1Q8S A;  1SLA A;  1ND2 C;  1NLR A;  4LTA A;  3USU A;  5E89 A;  3T08 A;  2D6M A;  4YGB A;  2J1V A;  2PHL A;  2XJU A;  1Y7B A;  5GZD A;  1I3H A;  2QBX A;  1HX6 A;  4HN0 A;  1RUE 1;  5ABJ C;  3FFZ A;  2JDM A;  5DUX A;  4OLL A;  1ALY A;  2ADD A;  4IGQ A;  4YVW A;  3APB A;  2JD4 A;  3ZKU A;  3WP6 A;  1AR6 3;  2WNE A;  1OT5 A;  1MZF A;  3GJA A;  3AVS A;  2ORX A;  4AGV A;  1DFQ A;  1H9P A;  1HB1 A;  1CAX B;  1S55 A;  4NAO A;  1X8E A;  3LGR A;  2HWC 3;  4ZU7 A;  5K0U C;  1JHJ A;  4Q0U A;  4B4Q A;  2FZ2 A;  1O3T A;  3ZYB A;  4M0H A;  2N7G A;  3RVH A;  1JMU B;  4WZC A;  1LHU A;  2PHF A;  1ZBE 2;  3SCG A;  1SLI A;  2JG8 B;  4MGS A;  1X82 A;  2XJP A;  5DDJ 3;  1W6O B;  3DYM A;  2LS6 A;  1A3K A;  5C8W A;  1W3V A;  2OKX A;  1JYW A;  3JBG 2;  3S5Q A;  3ROU A;  5FXV A;  2HWF 3;  3N9L A;  3ZSL A;  3AKP A;  1W8O A;  3I3D A;  1AJK A;  4QXB A;  5FOB B;  5KHG A;  3H8O A;  3N9P A;  1XU1 A;  4CPB D;  1MZE A;  2WL1 A;  5FWE A;  2HWE 3;  4YW2 A;  4N8M A;  3TEX A;  1XE0 A;  4Q27 A;  2LUW A;  3DGT A;  4IXL A;  4RD7 A;  1ND2 B;  4XXP A;  1UZW A;  2VJX A;  3K51 A;  2GAU A;  2VZ1 A;  2XOM A;  4DXZ A;  2JWP A;  4J6G A;  5GLT A;  2WFF 1;  4XMA A;  3B3Q E;  2A6W A;  3AKQ A;  3Q8B A;  3BGA A;  1CD3 G;  3QAC A;  1RUG 3;  2B7Y A;  4FQZ A;  4LHN A;  2LTN A;  5ABJ B;  2UWC A;  2JIJ A;  4XJ8 A;  4XF0 A;  4BU2 A;  4CZS A;  4O7X A;  1CQ9 A;  3ZDV A;  1L7Q A;  4Y3O A;  4OI1 A;  5BNO A;  2WLQ A;  1O8P A;  5FZF A;  1XYP A;  4YSF A;  3JXS A;  2P6C A;  1AVB A;  3MUZ 1;  3ON7 A;  4YZ3 A;  5JOX A;  2VZR A;  4Q0V A;  1OUS A;  3VHO A;  2PN5 A;  3WDU A;  4R9A A;  4G4F A;  5K0U B;  4LNV A;  2GH8 A;  4QKN A;  2VXJ A;  1RIR A;  3SCF A;  4ASM B;  2ZHL A;  2R32 A;  4QDR A;  3PVB B;  4JDO A;  3ZN4 A;  4FOW A;  2BWA A;  1XB9 A;  2IXI A;  2RDR A;  2QTW B;  4LKE A;  5EYY A;  1O5U A;  3TAY A;  1YHF A;  1RUC 1;  3H3L A;  2JDK A;  3KT7 A;  1YIP A;  4EWE A;  1KS4 A;  1A34 A;  4MGI E;  2WNU A;  1SHW B;  4DRR A;  1REF A;  3U4S A;  1AR9 1;  2ZMK A;  5H9R A;  4BOW A;  4XAB A;  3GDB A;  2E6V A;  3BVC A;  1AR7 1;  1SZB A;  4OMD A;  4BXF A;  4FTE A;  4YFW A;  2W3J A;  2QE3 A;  3LEK A;  4L8Q A;  3LCP A;  1IQD C;  1CZT A;  1SEF A;  5GKA C;  2VMD A;  3FHI B;  2O8Q A;  1W6Q B;  4FPJ A;  2HH9 A;  3THD A;  2AUY A;  3BB6 A;  3J7M A;  4GMP 3;  4X8P A;  1BZW A;  4BLI A;  1POQ A;  5FP9 A;  1X8M A;  2UUR A;  2VGD A;  1B35 A;  3KZ4 C;  5JZG B;  4IGO A;  1RUD 2;  1VBA 3;  2Z79 A;  4GD4 A;  1V6N A;  4A44 A;  3MFA A;  1N3P A;  1PIV 1;  4N43 B;  1MS0 A;  4Q2F A;  1NY7 1;  2J22 A;  1HXS 2;  1RMU 3;  3GBG A;  3LAG A;  1LU2 A;  5A1L A;  3E6D A;  2WZR 2;  1B09 A;  1X9T A;  2UYB A;  2QDR A;  3UK9 A;  2FDH A;  1DF0 A;  3OTF A;  2ENR A;  4FP2 A;  1HN1 A;  1LUL A;  1R08 1;  3AL6 A;  3NV2 A;  3HBK A;  1SBF A;  3O1U A;  3VDD C;  2GAL A;  3MIE A;  4I0B A;  3GXU A;  1RUE 3;  1F5J A;  3OCP A;  5CG8 A;  2R06 2;  1V9U 3;  4R4X A;  3NNG A;  1F15 A;  1W06 A;  2RS5 1;  4CEY B;  5D2A A;  5KXB A;  5FPZ A;  5H9Q A;  4NID A;  3N9Q A;  2IXK A;  3OGS A;  4CP2 A;  2PQS A;  4D94 A;  1URX A;  1NQD A;  1BHG A;  2XQX A;  3N35 A;  2BNN A;  2FZ1 A;  3PU3 A;  1VBB 2;  4HXC A;  3AMH A;  4Q8K A;  1JZ7 A;  3AXE A;  3CIH A;  2G9G A;  1UZY A;  4YM0 A;  4K20 A;  2W1S A;  3S7E A;  4KWJ A;  3L2Y A;  1LAJ A;  2VVF A;  4YG6 A;  1CVN A;  3WW3 A;  5DMY A;  2ID4 A;  1JOD A;  3ZR6 A;  2OQ6 A;  4F8A A;  1YRZ A;  4G9S B;  4XE9 A;  2RM2 1;  3THP A;  1DQ1 A;  4XFH A;  1YFX A;  2ZGM A;  3AKT A;  1WGP A;  1TQ5 A;  2HEY F;  4WM8 A;  1QJY 2;  1Y43 B;  4QX5 A;  1KJL A;  5F39 A;  5BYN A;  1PVC 2;  3VDD B;  1SLL A;  4NRQ A;  5FZ4 A;  3WDW A;  2J1R A;  5IK4 A;  5BNP A;  1W0N A;  5ACA 3;  1C5I A;  3OBA A;  1EPZ A;  5EYX A;  2P1B A;  1FMD 2;  3QH6 A;  4K8F A;  3DPR A;  2CV6 A;  2VQ0 A;  4QD2 A;  2OPK A;  2R6Q A;  1GQH A;  4I3G A;  4UFI A;  1CR7 A;  4FPG A;  4Z07 A;  3NAP B;  3ZKY A;  5J96 B;  2UY9 A;  5ANN A;  4RGA A;  4Y5S A;  4XUN A;  1QXR A;  3K77 A;  5FZC A;  2WNV A;  1GUI A;  3EQE A;  4YW5 A;  4PI0 A;  2R1D A;  4P02 B;  1XNA A;  2PLV 2;  3WW2 A;  5SV5 A;  1S1A A;  5FQ0 B;  1OOP A;  1RUH 2;  1BBT 1;  1JN2 P;  1N3O A;  1RUC 3;  1RVF 1;  1BCX A;  1KXG A;  1RIN A;  1WZX A;  2G19 A;  2RS1 1;  3AVR A;  4ISR A;  5F5I A;  1NA1 B;  4YW4 A;  3OF1 A;  2ZZJ A;  1IS6 A;  3AYA A;  3ACI A;  2RVA A;  4AQ2 A;  5A3O A;  3P3N A;  1GNY A;  1LRH A;  1O4T A;  3JD7 2;  4P9X A;  4QHB A;  3L2H A;  1JI6 A;  5DZG A;  1AR7 3;  2PFW A;  4P14 A;  4NIG A;  2A3Y A;  3VUO A;  3I2D A;  4N53 A;  1WCS A;  2YBP A;  4Q4W 2;  5FZK A;  4HON A;  4OHX A;  3TN9 1;  1KQR A;  1HRV 1;  1RXG A;  1D4M 2;  2AEY A;  1GZW A;  1VE0 A;  5KHI A;  2PAM A;  4JC1 A;  3AMQ A;  2ZA9 A;  2AC1 A;  4NN0 A;  3NV4 A;  2VXR A;  2ZGR A;  5KC6 A;  4IE7 A;  2QUO A;  1CWP A;  3I2J A;  1ASJ 1;  3C7H A;  5APA A;  1FPN 2;  5FJH A;  4CXY A;  1O4Z A;  1MZ5 A;  1PIV 3;  1H1A A;  5EXO A;  5M0T A;  3AP6 A;  1OXC A;  1QNY A;  3R4D B;  1S0F A;  2VUD A;  2VY0 A;  1SDW A;  5GZG A;  4P00 B;  1COV 2;  1C8M 2;  3MZH A;  1NCQ C;  5F5A A;  1X33 A;  3HD8 B;  4YW6 A;  5IUQ A;  3KHB A;  4XDO A;  5E1R A;  4E4D X;  3OGJ A;  1O91 A;  2EXK A;  4CDX C;  2Q1Z B;  2XML A;  1VB4 A;  1R08 3;  1OLM A;  1GAN A;  3AZZ A;  5JXI A;  1JHN A;  4YGD A;  2OW4 A;  1T6G C;  2GN7 A;  5FZE A;  3Q8E A;  1H0B A;  1H1I A;  3N7M A;  5F37 A;  5JMC A;  3LSD A;  2XBO 1;  4AVT A;  4EN8 B;  5IT6 A;  1JYX A;  5LEJ A;  1YFY A;  2RS5 3;  2AZ5 A;  3PUR A;  4LR4 A;  2D6K A;  1WW7 A;  4LEJ A;  5IVC A;  2W87 A;  2YC2 A;  3D8C A;  2VZO A;  2WQ4 A;  1LNS A;  4Y26 A;  4BQW A;  2OX0 A;  1D2Q A;  2VNG A;  1LOF A;  1WCD J;  3O0X A;  2WWJ A;  2FQP A;  5C8C A;  1JYI A;  2YGL A;  4UT5 A;  4B1M A;  1H30 A;  2YZ4 A;  4MGT A;  4M3C A;  4UOJ A;  3AKR A;  1LHV A;  3UKT A;  1F8V A;  1X9P A;  1BYH A;  2GNM A;  2JD9 A;  3LF7 A;  2R04 2;  5E88 A;  2PMW B;  4XCB A;  1GOF A;  3BU7 A;  3UES A;  2VZS A;  2R16 A;  4KWK A;  4AI9 A;  4PDW C;  1PGL 1;  1WMX A;  2TNF A;  2C6S A;  3AL5 A;  3M3I A;  2JKX A;  2RM2 3;  2B46 X;  3B69 A;  4IV1 C;  4QX3 A;  2E7Q A;  3D0S A;  2PTM A;  3D3A A;  3PVE A;  4QKD A;  3RI9 A;  3VBH C;  1PX3 A;  4MG2 A;  4Q0Q A;  5CZK A;  2AYH A;  1YI7 A;  3WQ0 A;  3ENR A;  2CTV A;  3N9N A;  3KT4 A;  1CZV A;  4IEY A;  5F3C A;  1AL2 1;  3CDZ B;  3BAL A;  1H2N A;  1AZD A;  3CJI B;  3ILF A;  3E6B A;  3WIN E;  1W39 A;  3U75 A;  3MFC A;  4I02 A;  1YNA A;  2D6L X;  2VAU A;  3PJY A;  4A4A A;  2ZX4 A;  4D7T A;  4ZXK A;  5BNN A;  4PT6 A;  5CFC C;  3MW2 A;  1YI9 A;  4KWL A;  4XFC A;  1W28 A;  3S0M A;  1W8F A;  1DGR A;  3ASI A;  4DY3 A;  3A21 A;  3KD4 A;  2QQI A;  3O0V A;  3DN7 A;  1GWK A;  3I54 A;  5T52 A;  4BCU A;  3MO4 A;  3HT2 A;  1HIX A;  4KI5 M;  1UU6 A;  1VLN A;  4XCA A;  4KGG A;  1ULO A;  1US3 A;  4QPI B;  1FV3 A;  2PHW A;  4JGZ B;  4CDQ A;  2NMO A;  1CIW A;  4Q29 A;  5FKB A;  2ARA A;  3WNO A;  4C0H A;  5JIA A;  1BBT 3;  5A6X A;  1DYP A;  4NUB A;  3SIS A;  3WHT A;  2RS1 3;  2YC4 A;  3AM2 A;  4XUR A;  3M8L A;  1AXZ A;  1UU4 A;  5A7Q A;  3WD5 A;  2A3X A;  1OPO A;  2ARB A;  3GZU C;  5FLJ A;  5JI7 A;  2KXL A;  3MGU A;  3O1T A;  3LOB A;  5FYH A;  3LDR A;  5TSW A;  3WNK A;  4AE2 A;  3P6B A;  3TNP B;  4AVV A;  3POI A;  4YVW C;  1O6U A;  2A6Y A;  4DIN B;  4AZZ A;  2VPV A;  3KV9 A;  4NO4 A;  4AL9 A;  4ZZ5 A;  4CCN A;  2NQY A;  3ZO0 B;  4ORF A;  4XZU G;  3FE5 A;  4Q4X 2;  4XTP A;  3VD4 A;  4Z2A A;  1HRV 3;  2HWB 2;  4AED B;  4LMF A;  4XFG A;  2NMN A;  5CYY A;  3SMH A;  4DO0 A;  2Q0A A;  4IGP A;  2W92 A;  4QPG C;  5FXW A;  2H6B A;  5FUI A;  1YQ2 A;  4QGN A;  3TYJ A;  4EE2 A;  2FCT A;  4PQ9 A;  2Y34 A;  1ASJ 3;  4BQ2 A;  5JUV A;  3R0R A;  1PO2 3;  1VBC 1;  4MV2 A;  3WVJ A;  2PXJ A;  5LY1 A;  5T5O A;  2P3Y A;  1HW5 A;  2YG0 A;  3IMM A;  2WIN B;  3MF9 A;  3MLL A;  5K8S A;  1FAT A;  1W2T A;  5KHH A;  4YM1 A;  1S2B A;  1DQ0 A;  2ZX1 A;  3USU B;  4DS0 A;  4QDS A;  4P5H A;  4KQ7 A;  5FCC A;  3MIF A;  4I3P A;  4A3X A;  4O65 A;  2X8K A;  4O9E A;  2Y0O A;  1OFS A;  3OUI A;  3E5Q A;  3MW4 A;  2RG4 A;  1S0C A;  2B4K A;  1J84 A;  4BIS A;  1Q8P A;  3WQ7 A;  1JZ6 A;  4KBZ A;  1N1Y A;  1KRI A;  1VR3 A;  2WWS A;  5FV3 A;  1C3H A;  3LE0 A;  3U10 A;  1RUJ 1;  3OG2 A;  2C4X A;  2UYA A;  3ZYP A;  1F31 A;  1K42 A;  1Z0H A;  2EA7 A;  3N7K A;  3RYP A;  2V09 A;  1GLH A;  2EXI A;  4GJZ A;  4XVH A;  1IG3 A;  4Y1U A;  1LJ7 A;  4OHZ A;  2RDN A;  2GH2 A;  2R07 2;  4PIZ A;  4S2G A;  4CEY A;  3NWK A;  3C8X A;  3DYP A;  3FHA A;  4UFL A;  1VAL A;  1NQJ A;  2RR1 1;  4NE9 A;  1UN1 A;  2Z5W A;  2VBB A;  2WII B;  4LA3 A;  1PM4 A;  2ERF A;  4RHV 1;  4AYU A;  3B9I A;  4BM8 A;  4HBN A;  2Q30 A;  5CFD C;  4BMB A;  4A7Z A;  2WNU C;  2MNG A;  3HT1 A;  4A3Z A;  1HQN A;  2BVV A;  1KS5 A;  1R1A 2;  3ZXF A;  4IE4 A;  4D0Q A;  3R4S A;  4XPV A;  4XTM A;  2XR4 A;  4Q1P A;  3M4F A;  4AI3 A;  3I4I A;  2E63 A;  2ARE A;  5BV6 A;  5JDB A;  1FV2 A;  4CEW A;  3EMR A;  4V1P A;  5DUU A;  1JU3 A;  3OJB A;  3UKV A;  3N4M A;  2OPW A;  4QHZ A;  3U07 A;  2FBE A;  2NN8 A;  2V5D A;  2WC2 A;  3IDC B;  2RDQ A;  5F32 A;  2HWD 1;  5E16 A;  3J7H A;  1QOS A;  5JSO A;  1UZ0 A;  3L9J T;  2ZJC A;  4WM7 A;  5CIR A;  5BNO B;  4DRV A;  2VTF A;  4G3Y C;  2D6N A;  4K3U A;  4CSW A;  1JOP A;  1B35 C;  1PO1 2;  3VN4 A;  4DB5 A;  4KG8 A;  1JYT A;  4J1X A;  3E5U A;  4E2G A;  4CDU A;  1UYY A;  1CJD A;  1WW5 A;  2KD7 A;  1IQA A;  5FK8 A;  5GAL A;  5FP4 A;  5LBB A;  2FHR A;  3JQW A;  3IWZ A;  4NR1 A;  1RUN A;  2WZR 3;  1ULD A;  5HI0 A;  3V65 A;  3ZSK A;  4TLF A;  1L3J A;  4COV A;  1BMV 1;  2XHN A;  1JU4 A;  2J1A A;  3GGL A;  2WNU B;  2NYY A;  3BOD A;  4KU8 A;  2BEO A;  2ZAH A;  1W8N A;  2IFW A;  2DCT A;  1UX6 A;  4BZ4 A;  3M2M A;  1TMF 1;  3PUA A;  1IGO A;  1VBE 1;  1RUO A;  4AHZ A;  1E57 A;  2D98 A;  1NA1 A;  5T5L A;  1W8W A;  1XQN A;  5A3L A;  5J48 A;  5EJ1 B;  5JPM B;  2ILM A;  1YQ6 A;  1DIW A;  1VRH 1;  5J98 B;  4AGR A;  5AC9 2;  5T3N A;  2FDI A;  1V6M A;  4M0N A;  4PQQ A;  2GNT A;  2WWU A;  5LBC A;  5FZ9 A;  1AR8 2;  4FPE A;  4LHL A;  1VMH A;  1WMF A;  4NRP A;  3SKJ E;  4F7Z A;  3BIW E;  1AX1 A;  1B35 B;  3SNM A;  1S2K A;  1CPN A;  1DBN A;  2CWM A;  2VW1 A;  1V0A A;  5LK5 A;  4XZP A;  4MHR A;  4JKM A;  4CCJ A;  1QJU 2;  5FPU A;  3G6J B;  1RED A;  4FCA A;  1VBC 3;  2GC3 A;  2O1Q A;  3ZYI B;  4JCK A;  1HV1 A;  4V2V A;  5FUP A;  5D8A A;  4AF9 A;  4XXA A;  4CP0 A;  2NLR A;  1QJY 3;  4Y1V A;  4MVT A;  2ORZ A;  4HVO A;  2BVB A;  1ZZB A;  3B01 A;  1ZRR A;  1RUI 1;  3IBM A;  4EN7 B;  3IDB B;  1PVC 3;  1LCL A;  4JTO A;  2D3S A;  4XFA A;  5BNP C;  5LRS A;  5FZ6 A;  3T2Q A;  1L7L A;  1PGW 2;  3MV0 1;  2ZCW A;  4L2N A;  3WZ1 A;  5LZ6 A;  3KCY A;  5I0R A;  3DPR C;  2I45 A;  1DQ2 A;  5FR3 A;  4P9L A;  4AHX A;  1HB2 A;  1RUJ 3;  2XON A;  4DOU A;  4QU1 A;  4N90 A;  1ZX5 A;  2RS3 1;  3BTY A;  2WNV C;  4ZS2 A;  2A1X A;  3Q8A A;  4QXK A;  4NWV A;  5IHR A;  4GWN A;  2JIC A;  2VG9 A;  2P34 A;  1LOD A;  3H3U A;  1LEN A;  1DYO A;  1UY4 A;  5B2G B;  1LEC A;  4RSU A;  4CCM A;  3NKG A;  2IWG B;  1Z7S 2;  1OOP C;  2RR1 3;  2W52 A;  2O0O A;  1W03 A;  2HWC 1;  3DXU A;  4RHV 3;  5DN2 A;  4YW1 A;  4TZD A;  3WF3 A;  4RQP A;  3VBR A;  2YGM A;  1X50 A;  5FZD A;  1HRI 1;  2YHJ A;  1QOO A;  2DUQ A;  4GKX A;  3WR0 A;  1PK6 A;  4WVZ A;  4YM2 A;  3KSC A;  3AB0 A;  3IPV A;  3OD0 A;  3MHZ A;  1E5I A;  4WM8 B;  2V72 A;  1WWY A;  5H9P A;  1CN1 A;  2W1W A;  2HWF 1;  4IE6 A;  5EQU A;  3EHK A;  3LA2 A;  2D93 A;  2VU9 A;  4N53 C;  2BV4 A;  2GMP A;  4Q4W 3;  3TBD A;  3U11 A;  1VMJ A;  3WNL A;  4CA9 A;  3BPZ A;  1MQT A;  5J1X A;  1POV 3;  2HWD 3;  2VNR A;  5EV7 A;  3UGF A;  4ZS3 A;  1W04 A;  1NAE A;  3NL1 A;  3NRU A;  3WCR A;  1PGS A;  1I5Z A;  4MGZ E;  2GC1 A;  4IUG A;  3DPR B;  3DKW A;  3O14 A;  4B8E A;  3WHU A;  5FY8 A;  5CBL A;  3CEW A;  5A7S A;  1Y9M A;  2DBI A;  2J1T A;  2XH6 A;  4IEW A;  4EWA A;  1U5I A;  2WNV B;  1H6X A;  3M1H A;  1I5P A;  2C1F A;  3GAL A;  3BTZ A;  1ULG A;  4Z8B A;  4KH9 A;  1ENQ A;  1EUU A;  1OPM A;  4OCT A;  5C71 A;  1ZBA 3;  2YYO A;  5DAX A;  1TG7 A;  2BNO A;  3VZJ A;  2F17 A;  2C24 A;  4LBL A;  1ZM1 A;  2ZGS A;  1OF3 A;  2YU1 A;  3AMM A;  4OI2 A;  4GAZ A;  4WVM A;  3SXW A;  3WF4 A;  2J1S A;  3S30 A;  1YEW A;  4XUT A;  1ULE A;  1TMF 3;  2QFE A;  3FC0 A;  3OEB A;  4LBQ A;  4HZF A;  4IEX A;  1VBE 3;  4JGY A;  4N53 B;  3ZMN A;  2EIG A;  4U36 A;  1NT0 A;  4DUV A;  1VRH 3;  5BPX A;  3QCW A;  3WDX A;  1A8M A;  3KV6 A;  2PEL A;  3FBY A;  5D21 A;  4LBM A;  1GZW B;  2GU9 A;  3ZYH A;  1RJ7 A;  4LXL A;  1U0A A;  3U14 A;  4DZG A;  3PME A;  1LOF C;  1N1V A;  2LRP A;  2R0H A;  5C8C C;  2H6C A;  5KXC A;  2BTV C;  1PMI A;  2E7A A;  4XEZ A;  3ZR5 A;  2CDO A;  4QGM A;  2FMY A;  4D7S A;  4LQR A;  3WDV A;  3RZM A;  3N9M A;  3A7Q A;  4Q26 A;  4TYS A;  1HV0 A;  4KWU A;  4JQT A;  3FUO A;  4SBV A;  3GBW A;  3J8F 1;  1ZA7 A;  2B9V A;  2PHU A;  2Y6J A;  4C91 A;  2WN3 A;  3FZ3 A;  4FPL A;  1AX0 A;  5EJZ B;  1W05 A;  3H3Z A;  1OD5 A;  1RMU 1;  1LGB A;  1UOB A;  1AYN 1;  3WNP A;  5B4X A;  1RUI 3;  3QD6 A;  2XB6 C;  1JTZ X;  4C1X A;  4GQ7 A;  3AYE A;  4C0B A;  4IEU A;  1YQ5 A;  1J3P A;  4JZR A;  3O1V A;  3BUC A;  2A73 B;  4UAP A;  5L9R A;  1ENR A;  4HK9 A;  3ZFF A;  5FZ3 A;  3ZFE A;  2D6P A;  3I2K A;  5T50 A;  4XET A;  5LRR A;  2P3K A;  4PLO A;  3FBM A;  5JOY A;  2RS3 3;  4FXK B;  2EIC A;  1XRU A;  2OT7 A;  5FP7 A;  1V9U 1;  5KC5 A;  1V6O A;  4CU9 A;  2EXJ A;  1I6X A;  5C8C B;  3ME2 A;  3ZIW A;  2R1B A;  4URA A;  2FCU A;  4COY A;  5JMO A;  2V5Y A;  3O0W A;  1IHM A;  4M3C B;  3T1M A;  1NCR B;  3VBF A;  1MVQ A;  3WUD A;  4CDQ C;  4ZU4 A;  3ORJ A;  2RV9 A;  3OPZ A;  4FXG B;  5FZB A;  2DUO A;  1LOA A;  4CP9 B;  1HRI 3;  4L9B A;  2A6X A;  4IEZ A;  1W90 A;  2GP5 A;  1XYO A;  4QX7 A;  2OVU A;  2VCB A;  2IVI B;  1W2U A;  1FOD 1;  4HKO A;  5IVF A;  5DXD A;  4IE5 A;  4BPZ A;  1J83 A;  1W99 A;  3FJS A;  4IV3 A;  3OBR A;  4XJU A;  5A7O A;  2XJT A;  4R52 A;  1QIQ A;  1OBN A;  3NJX A;  3ECQ A;  1HKD A;  1Q3E A;  2Y26 A;  4GA9 A;  2XVL A;  1R09 2;  4FFI A;  2HWB 3;  4P9J A;  3CKH A;  3E6C C;  2PQQ A;  3LFM A;  3RDI A;  1LHO A;  5GZF A;  5KXD A;  1AXY A;  2CAU A;  4GH4 A;  3VBU A;  3P3P A;  4B29 A;  5BNN B;  2OA2 A;  1UKG A;  4PI2 A;  4AFB A;  4CE8 A;  5K7P A;  2J7M A;  3SCH A;  3KF5 A;  1F2N A;  1OI6 A;  4DMI A;  4QQO A;  5AVA A;  2VMF A;  1GOH A;  5ACA 1;  5L9B A;  2B5H A;  1KDK A;  3RZK A;  2HBU A;  2OZ6 A;  5JZG C;  5FBJ A;  4CU8 A;  1CX4 A;  1MS8 A;  4I01 A;  4CDQ B;  3HBZ A;  3RMY A;  1SPP A;  4UBH A;  1QGL A;  4N43 C;  2QQW A;  1UW8 A;  1XU2 A;  3TNQ A;  2DDU A;  1KFX L;  4XUP A;  2VZU A;  3TOJ A;  4P9W A;  4QX8 A;  5F7U A;  2W95 A;  4RS5 A;  3HJR A;  3HNY M;  1JYC A;  1DGR N;  4QQL A;  3WV6 A;  4Y5T A;  2JE9 A;  3MUY 1;  1WUV A;  3QOP A;  3MBW A;  5C3Q A;  2WA4 A;  1WD4 A;  4P9G A;  1QDO A;  3DUI A;  4QX0 A;  2I2S A;  1S0J A;  3NNF A;  1D0H A;  2PAE A;  4CEY C;  4NMI A;  4S2H A;  5FFO C;  1IKQ A;  3KWV A;  3KV5 A;  3U0Z A;  1DZQ A;  3AXD A;  2BFU L;  3POS A;  1BXH A;  4JKK A;  3LSE A;  1OH4 A;  4TXW A;  1PX4 A;  1AL0 G;  1ULC A;  4OHY A;  5F6K A;  3NW4 A;  3VBO B;  3ZN6 B;  4OQ8 A;  3I59 A;  1DP0 A;  4FPK A;  4SLI A;  4CU7 A;  4CRQ A;  1W2N A;  2PHT A;  3J8F 3;  1R1Z A;  3VBS A;  2ZAB A;  4QQ2 A;  3K48 A;  4HVR A;  5LA2 A;  2MEV 2;  4CEW C;  3A22 A;  2HYK A;  1NG0 A;  1AYN 3;  4AOC A;  2LM3 A;  1ZZ9 A;  3NQH A;  4PBO A;  2VZQ A;  2WRA A;  1EPW A;  1QQP 2;  1NE4 A;  2ES3 A;  3NV3 A;  3T3Y A;  3ZFG A;  3B9C A;  4BIO A;  1I1E A;  3GCX A;  2ET7 A;  3AK0 A;  2JKB A;  4WM7 C;  3RI8 A;  1AL2 2;  3ZXA C;  3K3N A;  3IDE A;  2XG3 A;  2XJV A;  3ZM8 A;  3H1Y A;  2VUA A;  3ACG A;  3KCX A;  4H2A A;  1OA3 A;  1XNK A;  3E5X A;  4OHW A;  2RJ2 A;  4WBB A;  2W91 A;  1UAI A;  2VTX J;  2UU8 A;  4AXO A;  5A1A A;  4XIK A;  4CDU C;  5EP9 A;  3MLK A;  1SFP A;  2IXC A;  4UF0 A;  1Y9G A;  3BTA A;  2Q8C A;  1UU5 A;  2ZGT A;  3OPW A;  2IUW A;  2DYC A;  3KLS A;  1ZZ7 A;  1SMV A;  5DG2 A;  4HVQ A;  5E8A A;  4AI0 A;  4B3N A;  2XXZ A;  1G86 A;  1O4Y A;  1HB4 A;  3AFK A;  3NAP C;  3QBQ A;  4HG6 B;  5T55 A;  4XJZ A;  3DYO A;  4Q4V 1;  1GU3 A;  3WG3 A;  4BQ3 A;  1ZRD A;  4D7Y A;  1O3Q A;  5C3P A;  1D7P M;  4W6Y A;  3ZYR A;  3VD7 A;  4MLO A;  2VZ3 A;  4HLT A;  3FFQ A;  4NRO A;  4AR2 A;  5C5U A;  1GNZ A;  1ZVF A;  1FOD 3;  3IMN A;  1PNG A;  5FMC A;  3IIA A;  5LBE A;  4YGE A;  4CEW B;  2VCM A;  1NA1 C;  2WQ8 A;  3AZX A;  5FPA A;  4GXL A;  5BXX A;  3VZN A;  2XLA A;  5LW9 A;  1Q8O A;  1VJ2 A;  4GWI A;  5EFU A;  5FYM A;  4HFS A;  1V00 A;  1SBE A;  1RL3 A;  2C0Z A;  4UW6 A;  4WM7 B;  1AR8 3;  3WNM A;  1KDM A;  1G9F A;  1OD3 A;  5A7P A;  4ISQ A;  3POJ A;  4CYD A;  2E32 A;  2BGC A;  3RJ2 X;  1MR5 A;  4TN7 A;  1W2A X;  4CDU B;  4HK8 A;  4CUA A;  2EVX A;  2JDY A;  1QJU 3;  2X05 A;  5FZ7 A;  5FLH A;  3VL9 A;  2P5B A;  2VR4 A;  4KG0 A;  4GJY A;  5LWB A;  2IXL A;  5GJ6 A;  3BU0 A;  1TNR A;  4PBP A;  2XVK A;  5D8A C;  3UGH A;  1Q56 A;  4IND A;  3I2F A;  2OQ7 A;  1CAW A;  3KT1 A;  4GB3 2;  4NIA A;  3POY A;  3BYW A;  4ZHN A;  1VBD 2;  4Y1Z A;  1G9C A;  1UYZ A;  1QDC A;  3H8X A;  1FT9 A;  1NZI A;  1DU3 D;  4CUC A;  1EV1 2;  2DCK A;  4ITC A;  5CVR A;  5C4W A;  3S6P A;  1VIW B;  2EAK A;  4QAW A;  4A6O A;  3RWK X;  2D5H A;  2RMU 2;  3QH7 A;  2A3W A;  2EAL A;  3A0N A;  3G7D A;  1MAC A;  4HKL A;  4MXW A;  4B4P A;  2LAL A;  3SH5 A;  3DF0 A;  5JOZ A;  5I8Y A;  1VPH A;  5A3N A;  3GZA A;  4HPK A;  3T30 A;  4MGQ A;  2JG9 A;  1SCR A;  3TEW A;  1BVV A;  4ASK A;  4OI0 A;  2VOK A;  1F35 A;  3JB4 C;  3MI8 A;  2CY6 A;  4CUG A;  5HCA A;  1QWR A;  4Q1R A;  4QB6 A;  1J3Q A;  1WCU A;  4J25 A;  4RQP C;  1O3S A;  4RR3 A;  2RDS A;  4AWD A;  1EAH 2;  5FY7 A;  4D6S A;  1ZBE 1;  2E7T A;  2EXH A;  1PK6 C;  1N47 A;  5D8A B;  2EIB A;  2LRO A;  5FO9 B;  1GKB A;  1GZ9 A;  2WO1 A;  4XHB A;  3JBG 1;  4CCD A;  1PO2 1;  1PNF A;  2NZ9 A;  5J3U A;  3K4D A;  1V6I A;  5BY5 A;  5FMO S;  5A6Z A;  1S0D A;  3VDB A;  4YZ2 A;  2WAB A;  1LGN A;  1MQT C;  5T5P A;  2VUL A;  5FZL A;  5K4L A;  4EN0 A;  4JV4 A;  4OMC A;  2P4E A;  4XF4 A;  4Y1Y A;  5KHJ A;  4M4P A;  1HJG A;  1ULP A;  2DU1 A;  3I8T A;  3VZM A;  4MET A;  1QJX 2;  2ZPX A;  2ZXQ A;  5FMD A;  4QGL A;  2ADE A;  4NVP A;  2BGP A;  2VL4 A;  3CJI C;  2V4A A;  4LBJ A;  2P3I A;  1C1L A;  1UY3 A;  2QQN A;  3NJY A;  1PVX A;  3A0K A;  2EIE A;  1OKQ A;  3IDA A;  4BXS V;  1DGL A;  2BP6 A;  4Y4Y A;  4FAH A;  1DLL A;  2TBV A;  2ZGK A;  2VW2 A;  4YAR A;  3CO2 A;  5EPA A;  4P9Y A;  2MPF A;  2JDZ A;  1SDD B;  2Q8D A;  4N7I A;  4Q4V 3;  5A3T A;  3UET A;  1JOB A;  2CNA A;  1DCS A;  4RQP B;  3VBR B;  3BOW A;  2VM9 A;  5DG1 A;  5KR7 A;  1CAV A;  3UJO A;  1YC6 1;  3SH3 A;  2W9X A;  3D6E A;  2I74 A;  4QPI C;  1PK6 B;  3RZH A;  1EY2 A;  2R30 A;  4JGZ C;  4HKW A;  3IPV B;  4C8D A;  5JSP A;  1NCR A;  1J3R A;  2P3J A;  1JZ2 A;  2BJS A;  4CDW C;  1UZV A;  2A6V A;  4NRM A;  1DLC A;  4AVA A;  5EHD A;  3GBF A;  1BEV 2;  1C4R A;  3HEI A;  1UXX X;  4CP9 A;  1H4H A;  1MQT B;  3FX3 A;  1AYM 2;  2BQP A;  5FO8 B;  2RJK A;  1HDK A;  1OHF A;  1DYK A;  2D44 A;  4XYX A;  3LPF A;  5HV0 A;  2K0G A;  1E5R A;  5G04 L;  3SHR A;  3SQO A;  3NO8 A;  1RYY A;  3UGG A;  2XUM A;  4Y20 A;  4E4H A;  3AZY A;  2X5I A;  4MUV A;  3SIT A;  1WD3 A;  1NKG A;  1DQ4 A;  3VKL A;  2JXA A;  3AYD A;  1W9S A;  4AED C;  1SAC A;  4AI8 A;  5FAX A;  4X8N A;  3GJB A;  5C3S A;  2IXJ A;  3M7A A;  1DG6 A;  1VB2 A;  1W9W A;  2QQV A;  1GZC A;  1ONA A;  1RUD 1;  4LHK A;  2F4P A;  1IPK A;  2QDN A;  5F2W A;  3CMG A;  4LBK A;  1GFF 2;  1HXS 1;  4QB1 A;  1CPM A;  4FPY A;  1VRB A;  4WVM B;  4FTB A;  4XJW A;  4I30 A;  2WAO A;  2WZR 1;  4KNC A;  5GZC A;  3LEI A;  3DEC A;  4LBQ B;  2DVG A;  3LB9 A;  1S0I A;  4KL1 A;  3NNL A;  1W6M A;  1RUF 2;  5FYS A;  2VZT A;  4DXS A;  4JGY B;  5F9T A;  2E9Q A;  4JDM A;  2VVD A;  2XL9 A;  4I0A A;  3EJK A;  2PYT A;  3I49 A;  5K9Y A;  5FYI A;  4YZ5 A;  2GNB A;  2I07 B;  3POE A;  4HN1 A;  4XC9 A;  3BI3 A;  3OBZ A;  5JVV A;  1DGW X;  2JDU A;  2R06 1;  4LE4 A;  4JHZ A;  4LBQ D;  4QQP A;  3ZXJ A;  2B9U A;  4I0W B;  4F83 A;  1XYN A;  2D5F A;  2ATF A;  4U2A A;  4LA2 A;  1BVP 1;  5HCB A;  1AR6 2;  2GND A;  3P5B A;  5DZF A;  5F3G A;  2WZE A;  2ZZQ A;  3C7G A;  2ET1 A;  2OYZ A;  3WF2 A;  4EV0 A;  1WBL A;  1RHI 2;  1W9Y A;  4CCC A;  3PUS A;  1GYK A;  3LIG A;  4DY5 A;  1VBB 1;  4LOT A;  3KHC A;  2TEP A;  5IFT A;  1J58 A;  3RWN A;  1ZBE 3;  4DUW A;  4UBG A;  1NE6 A;  1STM A;  4UYB A;  2Q5T A;  3JBG 3;  4IV3 C;  4NHK A;  4D6Q A;  1GQG A;  5DDJ 2;  4W6X A;  3VBO A;  3ZN6 A;  3VZL A;  5FKC A;  5KHK A;  4XFB A;  4Q4Y 2;  2BW8 A;  3THC A;  3WG1 A;  3PLQ A;  4TLG A;  1XSQ A;  2Q8O A;  4CCO A;  1QJY 1;  2QQM A;  2HWE 2;  2VCA A;  2YPD A;  3WT3 A;  4BK5 A;  4ARY A;  5C3O A;  1GP4 A;  4P08 A;  4KBB A;  2C9K A;  2BOI A;  4MOA A;  5A33 A;  3ZFF B;  4CTE A;  1CX1 A;  3ZFE B;  3FL7 A;  3VBU C;  1PVC 1;  5A1F A;  2YC0 A;  1JXN A;  1A78 A;  2ZGU A;  1Y3T A;  5A6Y A;  1RUG 2;  4BQY A;  3KV4 A;  5IW0 A;  3ZLI A;  5BNO C;  5ISL A;  1FMD 1;  3MPP G;  4BJ0 A;  2W5F A;  4LUM A;  3WQB A;  2D3P A;  1IKP A;  1BQP A;  2VNO A;  1ENS A;  4XAA A;  4XUO A;  4BQX A;  4CCK A;  2DTY A;  1XBF A;  5FPV A;  3VBF B;  4AQ6 A;  5DPN A;  4DEV A;  5HCH A;  3EXU A;  1GR3 A;  3ZOI A;  2NPI A;  3O1P A;  2XL7 A;  4COU A;  3UKN A;  2VC9 A;  3ETQ A;  5IVB A;  1KIT A;  2DVD A;  4Y22 A;  2PLV 1;  3TB0 A;  2CSG A;  4GIQ A;  4LO7 A;  1UPS A;  3B93 A;  4ZXE A;  1RUH 1;  2VW0 A;  4RS5 C;  5BUV A;  3ZSE A;  2BBV A;  4IV3 B;  2W1Q A;  2WS9 2;  3VGI A;  1TE1 B;  2BBA A;  3VDA A;  4DNY A;  3POF A;  3KVB A;  1CAU A;  1UO9 A;  3BN6 A;  4QXH A;  3JD7 1;  4EN9 B;  4FFF A;  5FP3 A;  2YPJ A;  2ZOE B;  1HQW A;  2P17 A;  3BOP A;  2AAC A;  3OPT A;  4DUX A;  3LPG A;  3J7N A;  4IET A;  1AX2 A;  1BJQ A;  1CIY A;  2K2S A;  4GH4 B;  4L97 A;  4Q4W 1;  3T0A A;  3VBU B;  1POV 1;  1UCX A;  1D4M 1;  4YZ1 A;  4FFG A;  1OVP A;  1MEC 2;  1H2L A;  5FOJ B;  2VEC A;  1P8J A;  2W2I A;  4N7U A;  1J1L A;  1W9T A;  1QF3 A;  1YJK A;  4LKF A;  3J26 N;  1IOA A;  1DQ6 A;  3HN1 A;  4MYE A;  2SBA A;  4ZY9 A;  2Q8E A;  1RUD 3;  2GDF A;  3U78 A;  3VBS C;  3T2P A;  1FPN 1;  1SPP B;  4FFH A;  1TEI A;  4EJR A;  2MEV 3;  1VBA 2;  4IEP A;  3ZSM A;  1HXS 3;  1BK1 A;  4OVE A;  1TME 2;  5GLW A;  1PM7 A;  4L11 A;  2QJV A;  3ZYJ B;  1COV 1;  1C8M 1;  1QQP 3;  1NOV A;  1ZBA 1;  2DCZ A;  5G05 L;  5C5T A;  3LIH A;  3ZFG C;  4LIT A;  4LLF A;  4UWD A;  1UY2 A;  2RJL A;  4RS5 B;  2BZD A;  4K6B A;  3DKQ A;  3IT8 A;  4KMQ A;  1RIT A;  1APN A;  4RYD A;  5F1R A;  2FDF A;  3NVC A;  2EAA A;  4NPM A;  2WAA A;  3H8R A;  3N7J A;  3ABZ A;  1JW6 A;  4AGG A;  3CL1 A;  4CXX A;  1SBD A;  1TVG A;  4Y5Z 0;  5FLI A;  3WDY A;  3T4H B;  2D3R A;  3W5N A;  3J7L A;  1AUY A;  1RUE 2;  1ZYB A;  2R06 3;  4FQ4 A;  2BRT A;  4LPL A;  5GLU A;  2W39 A;  3BPS A;  2QZ2 A;  3X29 B;  1R64 A;  2YBS A;  1V9U 2;  3CBN A;  5A3P A;  3PL0 A;  1W3X A;  5FMB A;  4L0P A;  5J36 A;  4BME A;  4TTG A;  4K7J A;  1YJL A;  2HJI A;  2ARC A;  1UYP A;  2ZBJ A;  3I59 B;  3K3O A;  5A80 A;  1U5Z A;  1MS9 A;  1HN0 A;  1SFN A;  1VBB 3;  1WCQ A;  2YFZ A;  1YQ8 A;  1W0O A;  2CYF A;  2SLI A;  3K75 B;  4FOV A;  3W58 A;  4E4Z A;  3LA3 A;  3PIJ A;  4CUB A;  5CEH A;  3VBS B;  3RQ0 A;  2WYF A;  1O59 A;  3SEP A;  2J42 A;  3P1I A;  1VP6 A;  1LKN A;  1QHD A;  1OKO A;  2CHH A;  2R04 1;  2XGX A;  4XF1 A;  2QCS B;  5LAS A;  2GSY A;  1UL9 A;  3BCW A;  3HPN A;  4EN6 B;  4FP3 A;  4XAE A;  2GC2 A;  2WBK A;  4AHW A;  2GZW A;  3T1L A;  1W8U A;  2F6B A;  3ZFG B;  2WSU A;  1PHM A;  3OBT A;  4WM8 C;  3MIH A;  3ZYF A;  1LTE A;  3RYR A;  1VAM A;  4PJY A;  5F2S A;  3B7M A;  2IFR A;  3WX5 A;  5FZO A;  3O1O A;  3WF0 A;  3PTY A;  2UWA A;  1OF4 A;  2BNM A;  5DAV A;  1NX9 A;  1F5F A;  2WFF 2;  2WSV A;  4XBN A;  2XWB B;  3T2T A;  4YLZ A;  4UF0 B;  5JXH A;  2ZS6 B;  1MS4 A;  5L7O A;  1O7F A;  3W59 A;  4HET A;  1JOJ A;  2FDG A;  1YXW A;  1FMD 3;  1JBC A;  2HYX A;  1PZ9 A;  3B94 A;  3K2O A;  4YPJ A;  4AI1 A;  1GMM A;  3I3E A;  4XIL A;  4FSJ A;  4PCR A;  4LK6 A;  1VBD 3;  2BFU S;  4KU7 A;  4AG4 A;  5FRA A;  4AEK A;  4FO9 A;  2QQJ A;  4Q5O A;  3Q9O A;  4XJ9 A;  2PLV 3;  4W50 A;  3USS A;  4BH9 A;  2Y38 A;  4I2O A;  3H8U A;  4E8C A;  1FX5 A;  5JR2 A;  1RUH 3;  5DUW A;  4RFT 0;  1TZO A;  3PUQ A;  3OYW A;  3VKO A;  3T0D A;  3W21 A;  5HBA A;  5FDB A;  1RUC 2;  4QKF A;  4Z2W A;  5FUN A;  4CVU A;  4A45 A;  1JYV A;  3JD7 3;  2PHD A;  3ETP A;  1AR9 2;  3EBR A;  3H7Y A;  4XDP A;  4XQD A;  2VOV A;  3RNS A;  3ZYG A;  2X29 A;  4DXR A;  2DFB A;  2AEN A;  1OFN A;  1YIF A;  4K40 A;  1AR7 2;  5FYY A;  4BLJ A;  3ZXL A;  3RYK A;  2VVE A;  5AVP A;  3V56 A;  2ETE A;  4Q4X 1;  2HEW F;  1GNH A;  3I3B A;  5HCF A;  1D4M 3;  2JDN A;  4M00 A;  4AVB A;  4H55 A;  2HWB 1;  2DCY A;  3AP5 A;  4Y1X A;  4ONU A;  1NLS A;  3I3Q A;  1Z78 A;  1U5Y A;  3III A;  1G9B A;  5JI9 A;  3AX4 A;  2VQA A;  4XHX A;  5IFP A;  3IM0 A;  3W9A A;  1CAW B;  3JCI A;  4QPW A;  1GZT A;  1FPN 3;  3DCQ A;  3CF6 E;  3PIG A;  2W08 A;  5L19 A;  4OFG A;  3MYX A;  2GME A;  5KBF A;  1PIV 2;  1GQP A;  1LOB A;  1T6B X;  1NY7 2;  1COV 3;  1C8M 3;  1QJE A;  4JDN A;  2WUH A;  4H7L A;  2VZV A;  3LKJ A;  1Q5O A;  4JTN A;  1REE A;  1UOF A;  5FO7 B;  1WCK A;  4ATF A;  4AFD A;  3OD4 A;  3VKF C;  5JXG A;  2H0B A;  1NCQ A;  1H6Y A;  1SLB A;  2IVJ A;  2P2K A;  4GAL A;  4ZZ8 A;  5I0U A;  5C4W B;  2L9L A;  5A32 A;  4BIF A;  2DBN A;  4S2D A;  5FK7 A;  4CDX A;  3SH4 A;  3JB8 A;  4MXW B;  3NV1 A;  1R08 2;  1V70 A;  4OHV A;  2W68 A;  3DXT A;  3HNM A;  3O5S A;  3AP9 A;  1VAK A;  4NHM A;  4HMZ A;  4HPK B;  1GBG A;  3PJQ A;  4P9I A;  1XOY A;  5GLZ A;  4LLO A;  2JG9 B;  1SCS A;  3RMX A;  3WG2 A;  2Y60 A;  2X53 S;  2RS5 2;  3KCC A;  2XKO A;  2Y6G A;  3TRS B;  2BPA 2;  3OGV A;  4QX2 A;  1WA4 A;  4YRD A;  5CB7 A;  4LK7 A;  2Q4S A;  4RR3 B;  4H14 A;  4D69 A;  5A3M A;  1LES A;  2R07 1;  3FLP A;  2IZW A;  2ZHM A;  4LO5 B;  5C70 A;  3UT0 A;  4UFK A;  3PTR B;  3K4Z A;  5EIY B;  5D1I A;  1QY4 A;  2JEC A;  1NCR C;  4GKY A;  4BK4 A;  4Z92 B;  2R04 3;  4QPY A;  5AFB A;  5IJR A;  4E4S A;  4WZF A;  2DUP A;  1R1A 1;  4N9I A;  5LB6 A;  2ZHK A;  1V6J A;  4PDW A;  1XNC A;  3GM8 A;  3GYD A;  4BQ1 A;  1ND3 B;  2PHR A;  2VZP A;  4CU6 A;  4PIY A;  2RM2 2;  3FLR A;  1CZS A;  2HLE A;  3FWE A;  3GCW A;  2RHP A;  3VBH A;  4AVC A;  4C90 A;  2Z2S B;  2X5I C;  3HWJ A;  4B4R A;  1KEX A;  4FPC A;  5CKQ A;  4GZ9 A;  5FXX A;  4IEO A;  2WO3 A;  1OVS A;  4CDW B;  5J37 A;  2VTX A;  1PO1 1;  4UFH A;  5BNN C;  1H8T B;  2OII A;  5EJ3 A;  2ZKL A;  5FXZ A;  4Y4R A;  2G9Z A;  4CCL A;  1LOE A;  2ZGL A;  2C9A A;  2WT2 A;  3F2Z A;  1JH5 A;  1CAV B;  1S0G A;  2XQR A;  4FOY A;  4MSV A;  5F3E A;  1Y9Q A;  5FTT C;  4BHP A;  1UF2 C;  4E2Q A;  1RGS A;  2FDJ A;  3RZL A;  3ELN A;  2Y0I A;  3IZO A;  2ZEW A;  1IS3 A;  2XKP A;  1ST8 A;  4AW7 A;  3AZW A;  2ZAC A;  3JUU A;  1NZC A;  2XVG A;  4JRL A;  1QEX A;  1BBT 2;  1FAY A;  1RVF 2;  2DF7 A;  5FZ1 A;  2RS1 2;  2XJS A;  3ATG A;  3D5O A;  5A6Q A;  2XWJ B;  3MV1 1;  1K5M B;  3POG A;  5HV4 A;  3C7O A;  3MIC A;  1SLC A;  3N9O A;  3UJQ A;  2JIG A;  4L92 A;  4Y20 B;  5FYU A;  1O3R A;  4M4R A;  2X5I B;  2BOJ A;  3FLT A;  5AC9 1;  5LAT A;  4R9D A;  4Q4X 3;  2XHK A;  4PF5 A;  3B00 A;  3SKV A;  5KXE A;  4OUM A;  2YFU A;  3O1R A;  4YWA A;  2W0X A;  3EYP A;  3TN9 2;  1AR8 1;  5CAZ A;  1JZ3 A;  3BKZ A;  1RHI 3;  1HRV 2;  1ZNP A;  5FJK A;  1MZ6 A;  1UY0 A;  2BUK A;  2OS2 A;  5FY5 A;  4A41 A;  3ZSJ A;  4AQT A;  1N1S A;  2C26 A;  4QPG A;  4X6R B;  2B8M A;  5LA0 A;  1UXZ A;  4IE0 A;  3D4K A;  1QJU 1;  3NJZ A;  4ARX A;  4NJ4 A;  5JSR A;  1ASJ 2;  3VBO C;  4YW3 A;  3VHR A;  4QWN A;  1D4V B;  1PO2 2;  4Q4Y 3;  3ITQ A;  2VE1 A;  3V0B A;  1YUD A;  4QU2 A;  1W6M B;  4W4Z A;  4RFR B;  1NXM A;  2D7F A;  3T09 A;  4FAG A;  1E5H A;  4ZU5 A;  4NOT A;  2CU5 A;  3SEE A;  4Z1V A;  3WUC A;  4UXA A;  5A7N A;  2JDP A;  3PUI A;  1QNW A;  3PNA A;  4YYO A;  3S57 A;  4C1W A;  5HXV A;  1PGW 1;  5DQ0 A;  1C1F A;  5FYC A;  1ZZC A;  5JWP A;  2G4I A;  1UYX A;  3HAG A;  1SQ4 A;  4HL0 A;  4F3J A;  3WQ1 A;  2XBO 2;  3WDT A;  1FNY A;  4LUK A;  4ZPI A;  1V6L A;  4UW4 A;  2W94 A;  2Y33 A;  4AEM A;  2EID A;  1CON A;  2KM2 A;  2R07 3;  1Q8Q A;  4K8R B;  2B42 B;  1UKR A;  3HQR A;  3LZZ A;  3LWC A;  3MDP A;  4QHO A;  1Z7S 1;  1XE7 A;  2HEV F;  4HAN A;  4EZH A;  4UI9 L;  1UWW A;  3PMS A;  3UYJ A;  1EP0 A;  1V6K A;  2VMG A;  2WS9 3;  3H0O A;  4LE3 A;  4LO6 B;  4QX1 A;  1UZZ A;  3O1S A;  2ZX2 A;  1R1A 3;  1C8N A;  5CFD A;  3RFR A;  1JYN A;  2ZAA A;  4QKB A;  1DGW A;  5LCW L;  2VO5 A;  3I97 A;  4Q8L A;  5L9V A;  1PGL 2;  4UW5 A;  2XJR A;  2V4V A;  4P5Y A;  4GWM A;  4Q4V 2;  1MS5 A;  3ILN A;  1G9A A;  4IES A;  3VKM A;  5A33 B;  4Q0S A;  3FHQ A;  2JDH A;  5L36 A;  4GWJ A;  3W20 A;  3KMH A;  1OC1 A;  5CU1 A;  1OA4 A;  3WW4 A;  1MEC 3;  4AFM A;  2Z42 A;  2DVB A;  5LA1 A;  2VOX A;  1TNF A;  1PO1 3;  5CKM A;  1JS9 A;  2Z4F A;  3KGZ A;  5FYT A;  2R0F A;  4A7K A;  2VQT A;  1LGC A;  2ZMN A;  5BNQ A;  1PZ7 A;  2VMH A;  4XW3 A;  5IVE A;  5I0D A;  2EF6 A;  4GUL A;  1TME 3;  4QM9 A;  4QMA A;  3PUH A;  4DXT A;  5IK7 A;  2VCC A;  4Y22 B;  3PVN A;  3U1X A;  1BLZ A;  2VOT A;  3OGG A;  4QXC A;  5DAQ A;  2A71 A;  5JOW A;  4LT5 A;  3C3V A;  3AKS A;  1K3I A;  5C9A A;  2ZHN A;  1CAU B;  4HSJ A;  1GWL A;  2A6Z A;  2V73 A;  4GMP 0;  1HJF A;  3VZK A;  4R9B A;  4DQA A;  1OLM E;  2CGO A;  4ZKT B;  2XLF A;  3UNP A;  2ZGQ A;  5C7G A;  4QQH A;  4XIO A;  5FY1 A;  5C3R A;  4IDZ A;  2BU9 A;  2VBP A;  3UL2 A;  4PLN A;  5AC9 3;  5CKN A;  1W8T A;  5CA6 A;  3ACL A;  3V64 A;  2DFC A;  3O7O A;  5F6L B;  2XDV A;  1SG3 A;  3B02 A;  1NUK A;  1BKZ A;  1SFY A;  4QT6 A;  3M3O A;  1UQX A;  1E5S A;  4XQW A;  4LOS A;  3WOG A;  4JKL A;  2AR6 A;  2PA7 A;  5JAX A;  3LD8 A;  3OOX A;  3A23 A;  3NNM A;  5AFE A;  4J1W A;  2WZP P;  1XC6 A;  1XXN A;  4PIX A;  5ERL A;  2VMI A;  2E53 A;  2FD8 A;  3ST7 A;  1FI2 A;  4LHS A;  4M3C E;  1Q43 A;  1VBC 2;  3H50 A;  4MH0 E;  3VLB B;  1ZZ8 A;  3LA7 A;  1ENX A;  4A2U A;  1GSL A;  1SLT A;  1W8H A;  1W6N A;  5FY9 A;  2QNK A;  2E31 A;  5CAD A;  2WT0 A;  4E9K A;  4HT1 T;  2YB7 A;  4O61 A;  1W8Z A;  1KFU L;  3OEA A;  4I09 A;  5FWJ A;  2WFF 3;  4WV8 A;  2D43 A;  4FPO B;  1QH6 A;  4FI9 A;  5A7W A;  1UD1 A;  5L7O C;  1J59 A;  4AFA A;  1US2 A;  2VBD A;  2R7E B;  3ALQ A;  3THT A;  1LHN A;  1L7R A;  1A6C A;  1UOJ A;  5FYV A;  2A5Z A;  3RRD A;  1ZZ6 A;  3UV9 A;  1LB2 A;  4YVS A;  1AXK A;  3O1M A;  2JX9 A;  5F3I A;  1RUJ 2;  2VQU A;  1QKQ A;  2RE9 A;  1OLR A;  5FZ0 A;  2B45 X;  5B4N A;  2YY1 A;  1QJF A;  3EB7 A;  4NAM A;  4RA0 A;  3GHM A;  1H2K A;  1F4A A;  2A75 A;  2Y6K A;  2IC1 A;  3WP3 A;  1Z7S 3;  4A6S A;  5I93 A;  2FDK A;  1ZA4 A;  1RC6 A;  2GP3 A;  1UMI A;  3KVA A;  5LBF A;  2DV9 A;  3VBR C;  2RR1 2;  4WVW A;  4RHV 2;  5T54 A;  1K12 A;  3T4V A;  3IN9 A;  1YCI A;  3N36 A;  1G8W A;  1AR9 3;  3I2I A;  1WKY A;  4BYY A;  2ZEZ A;  4K1Z A;  2DTW A;  5FPL A;  3WNN A;  2VD7 A;  3T2O A;  3I3M A;  1ZRE A;  2GMM A;  2JJ6 A;  5FZO B;  1ULF A;  2H0V A;  4OI4 A;  1VAV A;  4YG0 A;  4Z82 A;  2YUE A;  1R09 1;  5F5C A;  5FBZ A;  5HXM A;  2W47 A;  4AFC A;  3FUQ A;  3ZPY A;  3CZU A;  4B7K A;  1ND3 A;  5I91 A;  5IVV A;  3CJX A;  5L7O B;  2HWD 2;  1QOT A;  3AZV A;  3SLI A;  4E27 A;  1UMH A;  4ES8 A;  3IB3 A;  3H42 B;  4PLM A;  1JZ8 A;  3BTX A;  3HOB A;  3TEZ A;  3VKN A;  2NP0 A;  1WW4 A;  2PHX A;  1FXZ A;  1W6P A;  1HQL A;  3OY8 A;  3AC0 A;  5DZE A;  3BIE A;  1H8T A;  4MX3 A;  4AI2 A;  1EUT A;  3LOI A;  3B5L B;  3M70 A;  3WF1 A;  1ZBA 2;  1CJP A;  2JB4 A;  4LBO A;  3I7D A;  3AJZ A;  3OYW B;  3VB9 A;  5JLV A;  1IG0 A;  3JQX A;  3W5M A;  4DPN A;  3PU8 A;  3NMB A;  4D6R A;  1BMV 2;  1XNT A;  1K45 A;  4X6Q B;  1J1T A;  2QZ3 A;  4H3W A;  1OMI A;  5FRE A;  5FIX A;  1ACC A;  1F4H A;  1TMF 2;  1UPI A;  4JGY C;  4LBN A;  3V0A A;  1OA2 A;  3AMN A;  1G6N A;  1VBE 2;  1M4W A;  4RGK A;  3WEZ A;  1QXJ A;  3GZE A;  1K5M A;  5IAT A;  3CNA A;  3WSO A;  1VRH 2;  2ZKN A;  3IAP A;  3RJR A;  2NM1 A;  4EYU A;  3RZJ A;  2WA3 A;  2UY8 A;  4NPL A;  2Y64 A;  3MIB A;  3LEG A;  1OQE A;  1GP6 A;  1FYU A;  5L73 A;  4CCE A;  4IL7 A;  5FPB A;  3K46 A;  3PVO A;  4ASL A;  2W46 A;  1CAX A;  5JPN B;  2VH9 A;  2X10 A;  2DVF A;  4CPB A;  5LY2 A;  2XUE A;  5LA9 A;  5FZG A;  2YMZ A;  3LQC A;  1KJR A;  1LOC A;  1NCQ B;  3KGL A;  2MEV 1;  2JG8 A;  3O12 A;  3POB A;  3AMP A;  3I2H A;  1W6O A;  4HSL A;  5A32 B;  4CDX B;  2O14 A;  1C28 A;  5FZA A;  5IWF A;  3C2U A;  1JUI A;  1QQP 1;  2QKD A;  2JEN A;  4FVV A;  1RUI 2;  1LED A;  1WME A;  3ZMO A;  1ZRC A;  3M3C A;  3RGB A;  4JQR A;  3RZG A;  2R49 A;  1KGY A;  1H8V A;  4A42 A;  1LOG A;  2ZX0 A;  3HN3 A;  3ZFE C;  3NNJ A;  3ZFF C;  1ND2 A;  1YYN A;  4FPH A;  1X7N A;  3LDB A;  4IQP A;  4YFZ A;  2E26 A;  5GZE A;  2A7A A;  2QQO A;  3MLJ A;  4FPF A;  4WVV A;  4BB3 A;  4COW A;  1QXP A;  3AP7 A;  1H9W A;  2ZGN A;  4OZO A;  4XBQ A;  5ABJ A;  2RS3 2;  4QM8 A;  3DL3 A;  1QU0 A;  5I8S A;  1ODM A;  4IEV A;  2YRO A;  1XND A;  2ZGO A;  4MHU A;  1XJA A;  3M3Q A;  2A70 A;  4XBL A;  3VBF C;  3HMY A;  5FY0 A;  4JVA A;  4AQS A;  1T2X A;  2LW8 A;  1RVF 3;  1S4C A;  2HWC 2;  5K0U A;  1H2M A;  5KWR A;  3D82 A;  4H7M A;  3OB8 A;  4A7Y A;  5A70 A;  5IK5 A;  4PDW B;  1HRI 2;  1LEM A;  2VOW A;  1C5H A;  2J1E A;  4LIU A;  2JB8 A;  4AVS A;  3VD3 A;  2ZTN A;  2Q1M A;  3NST A;  4IV1 B;  1AF9 A;  3NKT A;  2Q1F A;  2VUC A;  4NHL A;  3EO6 A;  3VBH B;  1YFU A;  1IPS A;  2O8O A;  2WO7 A;  2AEZ A;  3ZXD A;  1WBF A;  2HWF 2;  2DWR A;  2OZJ A;  1R09 3;  4AAP A;  4OUE A;  4OZX A;  1XNB A;  3TN9 3;  5LEK A;  2VMC A;  4K1Y A;  5F5Q A;  1LHW A;  2C5D A;  4IEQ A;  4GH4 C;  1YFW A;  2Y8K A;  2VME A;  5DUV A;  1N3Q A;  3AYC A;  2WQZ C;  4LKS A;  4HOO A;  4XF9 A;  5CFC B;  3MEP A;  4IER A;  3CLP A;  1W6Q A;  2X09 A;  3HIF A;  4R9C A;  1XSR A;  5FZM A;  2OXB A;  1YWK A;  3MID A;  5C33 A;  1F9K A;  4BDV B;  4W65 A;  1K5J A;  4GB3 1;  5EZW A;  2VUJ A;  2CAV A;  5JZG A;  4YM3 A;  5JR7 B;  1VBD 1;  4JAA A;  3LEM A;  4N43 A;  1DZT A;  1PMH X;  1D2S A;  4M01 A;  3K4A A;  4EWD A;  3SC7 X;  1OQ1 A;  3FMG A;  3T0B A;  2WDB A;  1GOG A;  1EV1 1;  3RG0 A;  4YZ4 A;  5FZ8 A;  3ES4 A;  5J09 A;  3WW1 A;  5I0S A;  4E2S A;  3ZN5 A;  2RMU 1;  1BK0 A;  3ES1 A;  4YVW B;  3GNE A;  2XBO 3;  5HPO A;  2YV8 A;  2ZEX A;  4K21 A;  2DCJ A;  3CQO A;  4LO4 B;  3KF3 A;  2P6H A;  3JZV A;  2IXH A;  2Y6H A;  1ZRI A;  3RZZ A;  4BQ4 A;  5CG9 A;  2WFP A;  1YO8 A;  3FN9 A;  1S0B A;  3WLU A;  4QPG B;  1M06 G;  2WO2 A;  4M3C F;  3A4U A;  3KQR A;  1DZR A;  1UY1 A;  4XQ4 A;  3LDK A;  5FZH A;  1YQC A;  4COZ A;  1EAH 1;  1PZ8 A;  1IPJ A;  2BYV E;  3V0B B;  4URT A;  4BQ5 A;  3I2O A;  1UMZ A;  1OLQ A;  3J8F 2;  1W9F A;  4NWW A;  2WJS A;  4B7E A;  1GIC A;  2JEM A;  1RMU 2;  3M3E A;  3R4U A;  1AYN 2;  5IVJ A;  3H1W A;  3HQX A;  4FT8 A;  4ATE A;  3CHX A;  5J7M A;  4RGG A;  1G9D A;  1AL2 3;  1MPX A;  4ES9 A;  2QQU A;  1GWM A;  2YBK A;  4AAX A;  3WY6 A;  1H4G A;  1QJX 1;  1CGP A;  4QDQ A;  4NPR A;  5A3W A;  3U4X A;  3LFI A;  4TWT A;  3VDD A;  2DU0 A;  2XJQ A;  3CU7 A;  4S2F A;  5IAX A;  2DVA A;  1W2O A;  4YG3 A;  4CP1 A;  1UOG A;  4XDQ A;  2JE7 A;  3GZT B;  4DFS A;  5H9S A;  1IZ3 A;  4NHX A;  2W1U A;  4EZ4 A;  1LR5 A;  1UIJ A;  1UX7 A;  5JIU A;  3J4U H;  4V2W A;  5DAP A;  3VD9 A;  1GV9 A;  3VDC A;  3WXP A;  3NAP A;  5C9A C;  5GLV A;  4ERO A;  4MGY E;  4XMI A;  1YLL A;  2CGN A;  3ACH A;  3IAQ A;  5FMO L;  5CFD B;  3VHP A;  3IKW A;  5EWS A;  4ZON A;  4FBF A;  2CDP A;  4XFI A;  4OYU A;  3D0J A;  4NII A;  4Q0P A;  3WG4 A;  5FQ0 A;  3E97 A;  1OQD A;  3ZDS A;  4RN5 A;  1FOD 2;  1JUH A;  3I2G A;  1BEV 1;  2ZML A;  1FNZ A;  1HB3 A;  3H9A A;  3RS6 A;  1AYM 1;  4PF1 A;  3VZO A;  3ZXE A;  2E51 A;  3QLQ A;  3AJY A;  3MIG A;  4EQV A;  4LKD A;  4O9G A;  4AHY A;  1WMD A;  4LO8 A;  4N9H A;  2YU2 A;  3AFG A;  4OUL A;  3VV1 A;  1ODN A;  2AH2 A;  4QB2 A;  3OGR A;  5F8P A;  2ZX3 A;  3ZX7 A;  1RJ8 A;  4MZU A;  4AEJ A;  2ARX A;  3URF A;  3R05 A;  4FOQ A;  3RPQ A;  1NLQ A;  2J1U A;  5ACA 2;  4PHZ A;  2DUR A;  2G1M A;  4GB3 3;  2K9Z A;  2YDE A;  3ILR A;  4YW7 A;  2E33 A;  2JE8 A;  5C9A B;  5FPX A;  2FMD A;  3CZJ A;  2KA3 A;  3ZVX A;  1QJZ A;  5I8T A;  4RL7 A;  4R8H A;  3TEY A;  1ZRF A;  5GM0 A;  1EV1 3;  1Q8V A;  2GN3 A;  1JZ4 A;  1RUF 1;  5C4W C;  1AHS A;  2G9F A;  2K46 A;  3KS7 A;  2D6O X;  3MW3 A;  2RMU 3;  5E6H A;  4JRA A;  1W0P A;  1XE8 A;  3ZIX A;  1UIK A;  5A3U A;  2WNO A;  4K9S A;  4YVS C;  1WLT A;  4XF3 A;  3MF6 A;  3WP5 A;  2XLG A;  2Y6L A;  5ANQ A;  4JHT A;  3VL8 A;  4DIQ A;  4Y24 A;  3R6S A;  4BA6 A;  5FYZ A;  1G7Y A;  4JX0 A;  2JG9 C;  1MS1 A;  2OUJ A;  4B1L A;  2ZEY A;  3TWI A;  3ZPO A;  3J9S A;  1AR6 1;  2XPJ A;  4XAC A;  1S2E A;  2QQK A;  3F95 A;  2QVS B;  1A8D A;  2QQL A;  1S0E A;  3GHN A;  4W8J A;  1WLD A;  2AGS A;  5SV8 A;  3KQ4 B;  1RHI 1;  1QMJ A;  4RR3 C;  5IYY A;  2WZ8 A;  1EAH 3;  5IK8 A;  3PDQ A;  4MO3 M;  3N3H A;  1X36 A;  4LUL A;  3MPB A;  4MXV A;  4Y33 A;  3ZXG A;  1IS4 A;  5FP8 A;  1RTV A;  1EYB A;  1W6N B;  5DDJ 1;  3PHM A;  5DAW A;  1U12 A;  4Q4Y 1;  4UFM A;  4AK3 A;  2CWS A;  4LJH A;  3HR9 A;  1DHK B;  2HWE 1;  1H1M A;  1ND3 C;  2MHF A;  5A7W B;  4D8M A;  1UNB A;  3S5A A;  5T5J A;  1RB8 G;  4IW3 A;  3AP4 A;  1WLW A;  2B39 A;  5JCT A;  3H1M A;  5BNP B;  2CL2 A;  1RXF A;  3C7F A;  1LU1 A;  4LIV A;  3E1F 1;  4XOG A;  5CIS A;  1QJX 3;  2Y6F A;  5FY4 A;  3VHN A;  5JXJ A;  4YVS B;  1OH3 A;  2OUH A;  1RUG 1;  2PAK A;  2VNV A;  5I0T A;  1WA6 X;  2HBT A;  4KGQ A;  3ZXK A;  1NYW A;  3CJI A;  4XUQ A;  4TSV A;  4BWO A;  5FYB A;  5IVY A;  1H8T C;  1JZ5 A;  2WN2 A;  2BWC A;  2UWB A;  2YXS A;  1PMJ X;  1GP5 A;  4UW3 A;  4E8D A;  3GF6 A;  3NJV A;  1OOP B;  3OUJ A;  5FZI A;  3OUH A;  5IAV A;  4LOR A;  1IS5 A;  1DQ5 A; 
#chains in the Genus database with same CATH homology
 3J7H A;  1UZ0 A;  2W9X A;  2BER A;  5LA1 A;  2VTF A;  1JZ2 A;  2Z4F A;  1DLC A;  2VQT A;  3HEI A;  1UXX X;  1UYY A;  4MAD A;  2KD7 A;  5I0D A;  3PUH A;  2WYS A;  4DXT A;  2VCC A;  3HNB M;  2VOT A;  3LPF A;  5G04 L;  1RYY A;  3U37 A;  1K3I A;  2BGO A;  2XHN A;  1JU4 A;  2J1A A;  3GGL A;  1NKG A;  1O8S A;  1W9S A;  1W8N A;  3VD5 A;  5C7G A;  1W9W A;  4DEQ A;  3CMG A;  5EJ1 B;  4QB1 A;  3ACF A;  4ET7 A;  4PQQ A;  1SG3 A;  1NUK A;  1XPW A;  2WAO A;  3C7E A;  3LEI A;  3SKJ E;  3DEC A;  4JKL A;  2JDA A;  4DXS A;  2VZT A;  3A23 A;  3T08 A;  1XC6 A;  2J1V A;  4JKM A;  2QBX A;  4LHS A;  4JHZ A;  1OT5 A;  2ORZ A;  2ORX A;  2E31 A;  2YB7 A;  2WZE A;  3C7G A;  3WF2 A;  3OEA A;  1JHJ A;  4FI9 A;  5IFT A;  1US2 A;  2R7E B;  4DUW A;  3T2Q A;  3MV0 1;  4MGS A;  1L7R A;  3DYM A;  2LS6 A;  2OKX A;  1JYW A;  2XON A;  1W8O A;  3I3D A;  2VQU A;  5B4N A;  3THC A;  3EB7 A;  5IHR A;  2QQM A;  2VCA A;  4BK5 A;  1F4A A;  2Y6K A;  4ARY A;  1DYO A;  1UY4 A;  4P08 A;  2C9K A;  4MOA A;  1CX1 A;  2VJX A;  1UMI A;  2VZ1 A;  2XOM A;  3FL7 A;  5DN2 A;  3WF3 A;  3BGA A;  1K12 A;  3I2I A;  1WKY A;  2ZEZ A;  1L7Q A;  4BJ0 A;  3WNN A;  2W5F A;  3T2O A;  3WQB A;  2V72 A;  1O8P A;  2W1W A;  4XUO A;  4DEV A;  3JXS A;  5DPN A;  3MUZ 1;  2VZR A;  3WNL A;  5HXM A;  2W47 A;  2VC9 A;  3CZU A;  5J1X A;  4QDR A;  1NAE A;  3NRU A;  4ZXE A;  1UMH A;  4IUG A;  2W1Q A;  3IB3 A;  1JZ8 A;  3VDA A;  2BBA A;  3HOB A;  1SHW B;  3BN6 A;  2J1T A;  1H6X A;  1I5P A;  3AC0 A;  3GDB A;  5C71 A;  1EUU A;  1EUT A;  4OMD A;  4DUX A;  3LPG A;  3T0A A;  3WF1 A;  1CIY A;  1TG7 A;  2W3J A;  3LEK A;  1IQD C;  1CZT A;  3W5M A;  2VMD A;  1OF3 A;  3THD A;  1XNT A;  1K45 A;  3WF4 A;  1P8J A;  2J1S A;  4XUT A;  1W9T A;  3OEB A;  1F4H A;  4ZY9 A;  3T2P A;  4A44 A;  3WEZ A;  4DUV A;  3WSO A;  2J22 A;  3IAP A;  5G05 L;  2Y64 A;  3LEG A;  1UY2 A;  2BZD A;  4KMQ A;  4RYD A;  3K46 A;  1HN1 A;  2W46 A;  2CDO A;  2WAA A;  3ABZ A;  4LQR A;  1TVG A;  3GXU A;  3A7Q A;  3W5N A;  2X10 A;  4KWU A;  4LPL A;  3LQC A;  2B9V A;  1R64 A;  2Y6J A;  3NNG A;  2WN3 A;  3I2H A;  5EJZ B;  3WNP A;  4L0P A;  3OGS A;  4TTG A;  5B4X A;  2PQS A;  1BHG A;  2XQX A;  1WCQ A;  2YFZ A;  3K75 B;  1KGY A;  1JZ7 A;  4CUB A;  4UAP A;  4A42 A;  3CIH A;  3HN3 A;  1O59 A;  3SEP A;  3P1I A;  2W1S A;  3I2K A;  2E26 A;  2QQO A;  3HPN A;  5DMY A;  2ID4 A;  2WBK A;  4OZO A;  2EIC A;  4CU9 A;  5JMO A;  3WF0 A;  1T2X A;  2RV9 A;  2LW8 A;  1OF4 A;  1NX9 A;  5JXH A;  3OB8 A;  2J1R A;  2J1E A;  2VCB A;  1W0N A;  3OBA A;  3VD3 A;  2HYX A;  1J83 A;  1W99 A;  4YPJ A;  1GMM A;  3I3E A;  3NJX A;  3ECQ A;  4XUN A;  3K77 A;  4OUE A;  4AG4 A;  1GUI A;  2QQJ A;  2VMC A;  3CKH A;  4W50 A;  4P02 B;  1XNA A;  4E8C A;  5JR2 A;  2Y8K A;  2VME A;  3T0D A;  4LKS A;  2J7M A;  4CVU A;  2X09 A;  4A45 A;  3ACI A;  1JYV A;  2RVA A;  1GOH A;  2VMF A;  3ETP A;  1GNY A;  4BDV B;  1JI6 A;  4DXR A;  4CU8 A;  3I3B A;  1PMH X;  3K4A A;  2DDU A;  4XUP A;  3T0B A;  2WDB A;  2VZU A;  1GOG A;  3III A;  5F7U A;  2W95 A;  3HJR A;  3HNY M;  5IFP A;  4QPW A;  3I2J A;  5HPO A;  3MUY 1;  2ZEX A;  3C7H A;  2DCJ A;  3MBW A;  3CQO A;  1GQP A;  2Y6H A;  4QX0 A;  2WUH A;  4P00 B;  2VZV A;  5JXG A;  3FN9 A;  2WO2 A;  1H6Y A;  4ZZ8 A;  2L9L A;  4JKK A;  1UY1 A;  1OH4 A;  4TXW A;  1PX4 A;  5JXI A;  3HNM A;  1DP0 A;  4CU7 A;  1JYX A;  5LA2 A;  2Y6G A;  3A22 A;  3OGV A;  4QX2 A;  2W87 A;  2YC2 A;  3NQH A;  2VZQ A;  2VZO A;  1LNS A;  5C70 A;  1MPX A;  3K4Z A;  4AAX A;  5EIY B;  3ZM8 A;  4BK4 A;  3ACG A;  4UOJ A;  2RJ2 A;  2W91 A;  4QDQ A;  2JD9 A;  5A1A A;  5IJR A;  1GOF A;  3UES A;  2VZS A;  2JKX A;  3GM8 A;  4QX3 A;  2VZP A;  4CU6 A;  2W1U A;  1UX7 A;  1CZS A;  3D3A A;  2HLE A;  1PX3 A;  5CZK A;  4HG6 B;  3VD9 A;  3VDC A;  3DYO A;  1KEX A;  1GU3 A;  4GZ9 A;  1CZV A;  3IAQ A;  3ACH A;  1D7P M;  3CDZ B;  2WO3 A;  2CDP A;  3VD7 A;  4OYU A;  2VZ3 A;  4A4A A;  4RN5 A;  3I2G A;  4PT6 A;  2WQ8 A;  4PF1 A;  3A21 A;  4GWI A;  2QQI A;  3F2Z A;  3MO4 A;  4KI5 M;  3WNM A;  1ULO A;  1US3 A;  1OD3 A;  2ZEW A;  3WNO A;  2E32 A;  4QB2 A;  2YC4 A;  3OGR A;  4XUR A;  4CUA A;  2X05 A;  3MV1 1;  2VR4 A;  3C7O A;  3WNK A;  2J1U A;  3P6B A;  3I2F A;  4ZZ5 A;  4M4R A;  2E33 A;  2JE8 A;  3CZJ A;  3SKV A;  4XZU G;  1UYZ A;  2YFU A;  3VD4 A;  4Z2A A;  3EYP A;  1JZ3 A;  5CYY A;  4A41 A;  1UY0 A;  1JZ4 A;  2W92 A;  4CUC A;  2C26 A;  2DCK A;  5FUI A;  1YQ2 A;  5LA0 A;  4QAW A;  1UXZ A;  4A6O A;  5JUV A;  4ARX A;  2Y6L A;  2YG0 A;  4JX0 A;  4MGQ A;  2ZEY A;  4W4Z A;  2QQK A;  4W8J A;  4QDS A;  2QQL A;  3T09 A;  4QB6 A;  3SEE A;  5IYY A;  2WZ8 A;  3PUI A;  4MO3 M;  5DQ0 A;  1UYX A;  2EIB A;  2B4K A;  1J84 A;  2WO1 A;  1JZ6 A;  3LE0 A;  3K4D A;  3OG2 A;  2C4X A;  2W94 A;  2EID A;  3VDB A;  1K42 A;  2WAB A;  4XVH A;  4D8M A;  4OMC A;  3C8X A;  4M4P A;  3DYP A;  3FHA A;  1ULP A;  3C7F A;  4UI9 L;  1UWW A;  3E1F 1;  4QX1 A;  5JXJ A;  3UNP A;  2ZXQ A;  4A3Z A;  2BGP A;  2VL4 A;  1JYN A;  1UY3 A;  4D0Q A;  2QQN A;  2VO5 A;  3I97 A;  4XUQ A;  2EIE A;  3IDA A;  5LCW L;  4BXS V;  2V4V A;  1JZ5 A;  4P5Y A;  2WN2 A;  1PMJ X;  4E8D A;  3FHQ A;  1SDD B;  1JU3 A;  3NJV A;  4GWJ A;  3UET A;  2V5D A;  2VM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...