4UI9L

Atomic structure of the human anaphase-promoting complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
182
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 31
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4ui9L00
3C7GA 5G04L 3I2HA 3T0BA 2VQTA 4PF1A 2JD9A 1UYZA 4CUAA 2W95A 3WF4A 1HN1A 4KI5M 3ECQA 1SHWB 1J83A 3ACFA 4CU6A 4XUQA 5B4XA 3WNPA 4BJ0A 5LA2A 3THDA 4W50A 1XNAA 2VR4A 3LEKA 2WO3A 3VD9A 4P5YA 3FHQA 1GOHA 3OBAA 2QQLA 2EIEA 1LNSA 4BXSV 2W5FA 1RYYA 2B9VA 4XURA 2YC2A 4GWIA 4A4AA 2W9XA 3EB7A 3FN9A 4ZZ5A 1F4AA 1NUKA 1UMHA 2EIBA 2QQMA 2ORXA 4KMQA 3WF3A 2XOMA 1DP0A 4RYDA 1GQPA 2YFUA 2EICA 1JZ8A 3MUY1 3WSOA 5JXGA 4QX3A 1OF4A 2ID4A 5HPOA 1P8JA 2W1SA 5DMYA 1W9WA 4OMCA 4DUVA 1UZ0A 2C4XA 2VCCA 3WEZA 1CIYA 4UAPA 4A3ZA 2XONA 2J1UA 3VD5A 2HYXA 1H6XA 4QX1A 2X10A 1O59A 1XPWA 1ULOA 2J1AA 2WDBA 2E33A 3WF2A 4LKSA 2VZUA 4A45A 1GOGA 3VD3A 4QPWA 3A21A 4UOJA 4ARXA 2JE8A 4XUPA 3GGLA 4RN5A 5JUVA 4QDQA 3P6BA 5C70A 1K42A 3FL7A 4JKLA 5DQ0A 3ABZA 3JXSA 3LE0A 1JYNA 1PMHX 3IAPA 2VCAA 5G05L 3LPFA 3T08A 3K77A 2ZEXA 5EJ1B 3I2GA 4FI9A 3HPNA 2RJ2A 1T2XA 3DYMA 4M4PA 5LA0A 2ZEYA 3MO4A 5IFTA 2XHNA 2VZ3A 2DCKA 1UY4A 5C7GA 5HXMA 1H6YA 2W3JA 5DPNA 2C26A 3DECA 5IHRA 3DYPA 2BBAA 5I0DA 3CQOA 1K12A 4OMDA 1EUUA 3J7HA 3OB8A 3ACIA 1NX9A 3GM8A 1GNYA 3HNBM 1GUIA 4QB2A 1XNTA 3F2ZA 2QBXA 2BGPA 2J1TA 5CZKA 2ZEWA 3T09A 2VZOA 3UETA 1JZ2A 3U37A 1JI6A 4CUCA 4TXWA 3CDZB 1OF3A 2EIDA 2W91A 2V4VA 3OG2A 1WKYA 2VZ1A 1IQDC 3WNKA 2QQKA 2DCJA 3I2KA 2C9KA 2WAOA 4D8MA 5LCWL 3FHAA 4OZOA 2Y6HA 2WZ8A 2QQJA 3OGVA 1TVGA 2LW8A 3I3DA 1L7QA 1R64A 2J1VA 4JKMA 5LA1A 1K45A 3VDBA 4TTGA 2BERA 4GZ9A 3A23A 4CUBA 3HNMA 4MGQA 3HN3A 2ZEZA 4DXRA 3W5NA 2J7MA 1I5PA 3CMGA 4QAWA 1JZ7A 2WABA 1XC6A 3T2PA 4PQQA 4UI9L 1JZ3A 1UY2A 3ACGA 5JR2A 3P1IA 4ZY9A 5FUIA 2WZEA 4BDVB 3LQCA 4A44A 3BN6A 2E32A 4IUGA 3ZM8A 2JKXA 3SKVA 5B4NA 1JYWA 3ETPA 4MO3M 3IDAA 1UMIA 2VL4A 2KD7A 1EUTA 2YC4A 4P08A 4CU8A 2J1RA 2YG0A 1OH4A 3LEGA 1YQ2A 2VJXA 3NJVA 2WUHA 2VO5A 2VMFA 1UYXA 1PX3A 1NAEA 2Y8KA 1DYOA 1PMJX 2X09A 1K3IA 2WN3A 3HOBA 4QDRA 2YB7A 1O8PA 3VDAA 2J1SA 3MV11 1W9TA 2V72A 2VTFA 3ACHA 2Y6GA 1JHJA 2B4KA 3WNMA 5J1XA 5JXJA 3C7FA 3CZUA 3OGRA 4ET7A 3VD7A 1JYVA 3C8XA 1ULPA 3WF1A 4OUEA 4YPJA 1JU3A 1W9SA 2BGOA 1OD3A 4DXTA 4QX2A 4LQRA 2W1WA 3THCA 3OGSA 2ZXQA 2WAAA 2RVAA 1SDDB 2E26A 3VD4A 2VCBA 1JZ6A 2Y6KA 2CDOA 4W4ZA 3MBWA 3HEIA 3LEIA 3K46A 3OEAA 3T0DA 2Y64A 2R7EB 2V5DA 4DXSA 2RV9A 3K75B 3I2IA 5JMOA 4P00B 4BK4A 3I3BA 1JZ5A 3MUZ1 1UY3A 2XQXA 4LHSA 1J84A 3WF0A 3C7OA 4D0QA 1GU3A 4E8DA 1CX1A 1BHGA 3NQHA 2VZRA 3SEPA 3BGAA 4JHZA 2DDUA 3IIIA 3IB3A 3CKHA 2VZVA 2VZSA 2BZDA 3A22A 5EJZB 3UESA 1JU4A 3I3EA 4CU7A 4QDSA 4CVUA 3NNGA 2Z4FA 3GXUA 2ORZA 2QQOA 3WNOA 4MGSA 3HNYM 4A6OA 3NRUA 2X05A 2CDPA 3T0AA 2PQSA 4JX0A 4QB6A 1O8SA 4DEQA 1US2A 4HG6B 4A42A 3T2OA 1UX7A 3I2JA 1OT5A 1PX4A 2WQ8A 3NJXA 3MV01 1KEXA 3WNNA 2VOTA 3C7EA 2W1QA 3K4DA 1W0NA 1UYYA 5EIYB 1GOFA 1W99A 4ZZ8A 2L9LA 4QB1A 3A7QA 1JZ4A 3LPGA 2VMCA 2VC9A 3T2QA 5CYYA 2VZQA 5IJRA 1GMMA 3AC0A 2WO2A 4ARYA 4MADA 3UNPA 3GDBA 2VMDA 3I2FA 4A41A 2VQUA 3D3AA 3VDCA 1WCQA 2WYSA 5IFPA 3SEEA 5JXIA 1F4HA 4KWUA 2W92A 4OYUA 2HLEA 2E31A 2W1UA 3WQBA 2LS6A 1MPXA 4XUNA 1CZVA 2VM9A 1UXZA 3EYPA 4XUTA 3OEBA 1SG3A 4CU9A 4DEVA 1CZTA 2JDAA 5A1AA 2J1EA 2QQNA 3CIHA 4AG4A 1NKGA 5C71A 1DLCA 5JXHA 3SKJE 3WNLA 4ZXEA 4PT6A 2VMEA 2QQIA 4AAXA 2YFZA 1L7RA 3DYOA 1US3A 3C7HA 3CZJA 4W8JA 2W46A 4XVHA 4LPLA 4P02B 4XZUG 1UY0A 2WBKA 1UXXX 4JKKA 3IAQA 4GWJA 4XUOA 5IYYA 3PUIA 3I97A 1CZSA 2J22A 4E8CA 2WO1A 2Y6LA 5DN2A 4M4RA 2W47A 2WN2A 1UY1A 1KGYA 2Y6JA 4BK5A 1W8OA 1D7PM 2OKXA 1JYXA 4Z2AA 2VZPA 4QX0A 1TG7A 3K4AA 3HJRA 4DUXA 2W94A 4L0PA 3W5MA 3PUHA 3K4ZA 1W8NA 2VZTA 2W87A 4DUWA 3E1F1 4MOAA 5F7UA 1UWWA
chains in the Genus database with same CATH superfamily
4NAOA 2YGMA 4M01A 3ZXJA 4AEJA 1PNGA 4ZU7A 2VVEA 1WBLA 1W8HA 2IXJA 4AQ2A 1D0GA 1QQP1 2VQTA 4Y1VA 1RUH2 5JLVA 2BFUS 2WZR1 1SLCA 4QPIA 5LBFA 1OH3A 4GH4C 4LBJA 2QKDA 5LY2A 4KI5M 4XDOA 1SHWB 3ACFA 4CU6A 4XUQA 3MIGA 1W6QB 2BNOA 4XQWA 1QJY1 3RJRA 4A2UA 4OHVA 5T3NA 4IW3A 3TAYA 3VD9A 3HQXA 1KITA 5T5JA 3FHQA 3N9QA 1FMD3 2Y34A 4COVA 3S5AA 1W8WA 1QXRA 4PI2A 2WFF3 1PK6C 1L3JA 1OOPC 3O5SA 4UFKA 5EP9A 1BVP1 1DBNA 3JD73 3KT7A 3M3CA 1JUIA 1TMF1 1PHMA 4BCUA 1RUE3 2FDHA 2PQQA 3EB7A 3LFMA 4FPOB 2Q8EA 3KD4A 1H2KA 2J42A 2Y33A 3E5QA 4QWNA 1NCQA 2DVAA 4BISA 4JGYA 2P5BA 4N8MA 5FZKA 2QQMA 5JOXA 4IE7A 5T5PA 1R1A3 2WKKA 4Q27A 1RUF3 1T6GC 4CDXA 2XOMA 4UF0A 4AI9A 4FOWA 1DP0A 2YHJA 4KG8A 1IKPA 4CA9A 1OF4A 1XYOA 2UY9A 4B8EA 5HPOA 1P8JA 3NKTA 1CQ9A 5DAXA 5IUQA 3X29B 4EZ4A 2W1SA 1VBC1 4OMCA 4H14A 5JOWA 1WA4A 2WWUA 2Q8CA 2ET7A 2R1DA 2HWE3 2VBDA 1LHWA 3POJA 3QCWA 2V4AA 4COWA 4CCEA 4AI2A 1S2EA 2A3WA 1IGOA 3WLUA 5JPNB 1HXS1 4IEXA 1PK6A 1J1TA 4CPBA 3HN1A 2WQ4A 4A3ZA 2J1UA 5F32A 3LFIA 5FUNA 3VD5A 4I09A 1IPJA 1DU3D 3ZSEA 3ZOIA 5FYSA 2X10A 3MIEA 3CNAA 3AKSA 3SLIA 3VBUB 3OUHA 5A6ZA 3PU3A 2PFWA 1V70A 2J1AA 3KMHA 3OOXA 5FAXA 2VZUA 3FLTA 1NCQB 2PHFA 3ZVXA 5CNAA 4XJAA 1ZBE3 4QXCA 4CCNA 1GOGA 4AFMA 5FO9B 3KCCA 4GWNA 4QPWA 1UX6A 2P3YA 2TNFA 4MX3A 5KXEA 3H7JA 5JUVA 4LO8A 2ZGTA 4WV8A 2QUOA 3P6BA 2P1BA 1K42A 3FL7A 2YDEA 3N7JA 1W2NA 4IV3C 2VU9A 1RUI1 4AFAA 1H8VA 3FJSA 1GBGA 1PMHX 3P3NA 1HRV1 4G3YC 2UWCA 1AF9A 4CCJA 1JODA 4TN7A 2GU9A 2OX0A 4FBFA 2ZTNA 2R072 1HB4A 2LUWA 1O4ZA 1U12A 2RJ2A 3HPNA 3S0MA 1QJX1 2ZMKA 1N47A 4M4PA 4WBBA 5LA0A 1PK6B 3LGRA 3MO4A 4FPCA 2R061 4N43A 2VZ3A 1UY4A 2QTWB 5FY7A 1H6YA 2TEPA 1UYPA 2C26A 1BLZA 4RR3A 3VBUA 4JV4A 4YVWA 2UYBA 1OXCA 4OMDA 1EUUA 4UBHA 1HV0A 1I1EA 3VHPA 1NX9A 1QNYA 2BW8A 3BU7A 2AGSA 3QOPA 3O0WA 1GZCA 1R091 1QJX2 4Q4Y1 5F39A 2ZABA 2GDFA 1LOAA 4C91A 1G7YA 5GZCA 4NIAA 2OUHA 5A7NA 3ZYHA 3MW3A 1ACCA 1ZZBA 3LSDA 5FZMA 3L9JT 4HMZA 1POQA 1A8DA 1KJLA 3TB0A 3U37A 5A3MA 3TNQA 2ZGRA 2ZGSA 4CUCA 1JZ2A 1VRBA 5DXDA 5IK8A 4CDUA 4KWJA 2VZ1A 1UOBA 3I3QA 5DAWA 3AP4A 5J36A 1MVQA 2YXSA 4H55A 3AM2A 5JOYA 1WBFA 5A33B 1Q8QA 4IV1C 1TNRA 4CRQA 5C9AC 3JD71 4ZU5A 2RJKA 1OLME 3KF3A 5KHKA 1HN0A 3ITQA 3Q8BA 4N43B 1OA2A 3WQ1A 4YG6A 2NPIA 4OZOA 2FD8A 2D40A 2B7YA 1AR82 1PM4A 2XBO1 4WM8C 2AH2A 5D8AB 2VOXA 1V6MA 3WP6A 4YVWB 2ZHKA 4CEYB 3PURA 2LW8A 5F2WA 3UV9A 5BY5A 4LKFA 1L7QA 4UW6A 1R64A 2J1VA 4JKMA 4NO4A 4KGGA 4NAMA 1Z7S1 4R9BA 3DKWA 1BEV2 3SH4A 2YY1A 5HI0A 5FMOL 1CAWA 2BERA 3HT2A 3A23A 4QM9A 4CUBA 3ZXEA 5FBJA 1RUH3 5C3SA 1XNKA 2OZ6A 4GB32 2DVDA 4K8RB 1PGW1 3HN3A 2XKOA 4HKOA 4ITCA 4MGQA 3LIGA 2RJLA 3ZYIB 1PO23 3A4UA 5FMCA 1GP5A 5FPBA 1NA1B 1NE4A 3T2PA 1LKNA 4RD7A 4UI9L 4EJRA 3PVOA 4Q0VA 2RM22 3OY8B 2WZEA 5F5IA 5HCBA 4AW7A 1LR5A 4D94A 2YPJA 1Z7S2 2VGDA 1CGPA 3GHNA 4FFIA 2ZHLA 1W6MA 2JKXA 4JQTA 2JICA 2XVGA 3BODA 1BZWA 2O1QA 2VUJA 3ETPA 3PMEA 4Y33A 1W90A 4BLIA 1H8TA 3RQ0A 5JSRA 3VZJA 1S0DA 5D8AA 4CCCA 2JG9C 1MS0A 3JBG1 1C1FA 4NN0A 1UU4A 5FMOS 3NL1A 1RMU2 3KV6A 1UMIA 2PMWB 1R1A2 3LDKA 1XE0A 1FPN3 5C9AA 5FO8B 5J09A 2DCTA 1RITA 2R073 4CU8A 2HWF2 2VE1A 4LIUA 1OQEA 2VW0A 3ACLA 3K2OA 4NIHA 4Q4Y2 1YQ2A 4LUMA 2YBKA 2WA3A 2VJXA 1HRI1 5A3LA 1LGBA 4YG0A 3NAPC 3N4MA 2VO5A 1VE0A 2A6YA 1NA1A 1RL3A 1S0IA 2VMFA 1UYXA 4NPRA 1C57A 2BP6A 5E89A 1NAEA 4CDUC 2PA7A 1CAXA 1VRH1 4HKWA 4I3GA 2JENA 1UN1A 1PMJX 2ZKLA 1K3IA 4Z2WA 3K3NA 4Q4V1 4BWOA 2W52A 1B35C 3ZSKA 3WW3A 4QDRA 1OVSA 4QX8A 2TBVA 2VTXA 2EVXA 2W0XA 3A0KA 3LDBA 4CDQC 2JE9A 3VBRC 5A32B 2V72A 1WCUA 1QNWA 3OPWA 2GP3A 4JDNA 1SLBA 5DABA 2Y6GA 4K8FA 4JQRA 3SITA 1VMFA 5BUVA 1CX4A 3BYWA 3MEPA 3NWKA 4OFGA 5JXJA 3C7FA 3CZUA 3OGRA 2Z2SB 5LBCA 1R082 4RQPB 1SDWA 1ULGA 2NQYA 4WM7B 3WF1A 3WUDA 1Y9GA 3I7DA 4Q4V2 3VL9A 1WCDJ 2G4IA 3V0AB 1OD3A 1SFYA 4LE3A 5CKMA 4DXTA 2Q30A 2IVJA 3QH7A 4JRLA 1YIFA 3NAPA 2WFPA 2ZGPA 5IVYA 4LHKA 1RUE2 5DAVA 2D6KA 4E2SA 1EAH3 3ZMOA 2ZMLA 3HVDA 1W2UA 4QKNA 2E26A 3ZSMA 4HT1T 1LEDA 1FXZA 2ZZJA 2VCBA 2CU5A 1JZ6A 5K0UB 4AQSA 3R4UA 4DY5A 5IVCA 1Y4WA 3PJQA 1YUDA 1M4WA 4OUSA 3RZLA 2Q4SA 3WDXA 1ZZ7A 4P5HA 1C5HA 2R7EB 4KU7A 4IV3A 1TMF3 1E5IA 3OD0A 1RVF1 4LTAA 3T4HB 2ZAAA 3FUOA 1D4VB 3WVJA 4AI0A 4HVQA 4LULA 4RQPA 4P00B 3WZ1A 3I3BA 5CFCB 3ZDSA 3MUZ1 1WUVA 1EP0A 1N3QA 2OS2A 3L2YA 4LHSA 4WM8B 4YG3A 5TSWA 4CDQA 4EWEA 4IEQA 4Z07A 1BHGA 4ZS3A 3R4DB 3ZFEB 3POEA 1CX1A 3J7MA 3SCFA 3ZKYA 2X29A 1CAVA 4IERA 2VZRA 4KGQA 3BGAA 4L2NA 3POSA 2Q1MA 2VW2A 1X9TA 1OLRA 2DUOA 3JUUA 5LW9A 1DDLA 1XXNA 2BVBA 4JHZA 3VZMA 3NAPB 5FZIA 3WR0A 1WGPA 1BMV1 1QOSA 1QXPA 5LWBA 2P6CA 2UYAA 2V73A 3I3EA 1A34A 4CU7A 2BOIA 1VP6A 5ACA2 5K0UA 5KR7A 2IUWA 2HWC3 1UOGA 2FBEA 2ZGNA 1HXS3 4GIQA 3SC7X 1PM7A 2OYZA 2QQOA 2RS53 4MGSA 2F4PA 2LALA 3UJQA 2Q1ZB 1JS9A 2IWGB 2ZGMA 2UWBA 2RG4A 1VBE1 4IV3B 2JDNA 1FOD2 5GM0A 4BQWA 1BK1A 2PQSA 4QB6A 1JN2P 5I91A 3TWIA 1O8SA 1RHI3 4CCDA 4XTPA 4EROA 5CFCA 1UW8A 4NPLA 4Q4W3 5FYBA 4J25A 4HG6B 3JB8A 4YW7A 4A42A 1STMA 4BQYA 3KT4A 1OT5A 3GZTB 4P9WA 4R9DA 5FJKA 4AHYA 4XAEA 4AGVA 3MV01 1KEXA 1VBD2 1CAVB 2PN5A 2ZAHA 1RJ8A 1DF0A 4LE4A 1W0NA 4IESA 1W99A 2L9LA 4FT8A 4P9LA 3LPGA 3U0ZA 4BLJA 1RUE1 1MS3A 2FMYA 1PIV2 5IJRA 2FDIA 4PBOA 4QQOA 4XTMA 5A7QA 3E6CC 4ARYA 2EAAA 3BPZA 4XJZA 3D82A 3GDBA 2FZ1A 4PLOA 4A41A 1PO11 2VQUA 4Q1RA 3D3AA 5CVRA 1OA3A 4MGYE 3BI3A 2E7QA 1QDCA 3Q8AA 3IT8A 2IXIA 2VOWA 4XXAA 3VZNA 1F4HA 3WV6A 4B7EA 5LY1A 1XSQA 2E31A 2W1UA 3RG0A 3JU9A 4OVEA 2WLQA 3AKTA 3VLBB 2D7FA 1FX5A 2AR6A 1SBFA 3DPRA 3W59A 2GMMA 1YJLA 4YNIA 3VBHB 2BEOA 4Q4Y3 2FMDA 1YI9A 2IFRA 1OPMA 1XYNA 1TQ5A 1ODMA 1CZTA 2XJRA 2JDAA 4FQZA 2FHRA 3AP9A 4I0AA 3H8XA 2QQNA 3LSEA 4GALA 2VBBA 1NKGA 2A1XA 1AR61 2VD7A 4XXPA 5AC93 5C71A 3NW4A 2ARBA 3DPRC 1QOTA 1RB8G 1FMD2 3MW4A 3WHUA 5F9TA 1V9U2 2XXZA 4LBQB 2G9GA 4HANA 1QJY3 1W8UA 3NJYA 3C7HA 3VN4A 1QGLA 5FZDA 4HKLA 4RS5B 1ZM1A 2SBAA 2PHLA 5H9SA 4LPLA 1F15A 2NN8A 2O14A 1MZFA 1UY0A 2WBKA 4JKKA 4LNVA 4XHBA 4KL1A 5L9BA 2Z42A 3WINE 4E2GA 5GJ6A 2GAUA 3UKVA 1AR62 4D3WA 4E8CA 2HBTA 1JYCA 5DN2A 4EN7B 4D6SA 1LGCA 4U36A 5LBEA 2BV4A 4FTEA 1REFA 3DPRB 3J9SA 4BQ4A 4ZKTB 5IVFA 5C4WA 3VBHA 3PJYA 2QDNA 5I8TA 3I59B 2Y0IA 3O0VA 2OKXA 4YZ4A 5A6QA 3ZR6A 4Q0PA 2PTMA 2R0HA 1GQGA 4QQ2A 4Y26A 1PO21 1UPIA 3MFCA 4D7TA 2EALA 4EN8B 1E5RA 1G9FA 1VBD1 2DURA 1SFNA 1TG7A 3K4AA 2VY0A 4L0PA 4EN6B 3PUHA 1VBB1 4PIZA 4C8DA 3BB6A 1TME3 3UKNA 2VTXJ 3MHZA 3C7GA 4HN1A 2K0GA 4ONUA 2DVFA 3THPA 3U1XA 4C1WA 4PF1A 4RS5A 5IAVA 4CUAA 1BCXA 1GSLA 2XBO3 4UFIA 4ZONA 4DB5A 2JG8C 3VL8A 3WF4A 1HN1A 1R093 5IVBA 1RHI1 4Q5OA 1CR7A 2HBUA 4LIVA 5B4XA 2X53S 1HRV3 4MH0E 4P9IA 4XCBA 2RS33 5LA2A 5L9VA 1T6BX 4W50A 1XNAA 1W2AX 4QHOA 3LEKA 1QOOA 1EY2A 2E53A 4P5YA 2Y6FA 4H7MA 2XJTA 2XUEA 2QQLA 3PNAA 4A3XA 2HWB3 2IXCA 2KM2A 5A3NA 1PMIA 5C4WB 4BXSV 2W5FA 4NHYA 2B9VA 3JQWA 2RR13 2V5YA 1AXYA 1KDKA 4N9IA 4NE9A 1S0BA 3AFGA 4OI4A 2BTVC 4P9XA 4YM2A 2JDHA 3DL3A 3IKWA 2OQ7A 3RI9A 1E5HA 1K5MC 3GJBA 4M3CE 3ZO0B 4E4ZA 4HFSA 1N1SA 1XU2A 4MGKE 2A75A 2NM1A 2WS92 5F3IA 2G19A 4LKEA 1GYKA 1G6NA 2C0ZA 2JIJA 2ZX2A 3THTA 4QQHA 5K4LA 1UIJA 4Y3OA 5LBBA 5C3RA 5KC5A 4CCLA 5JI9A 2DBIA 1SZBA 4D7YA 2A6XA 4M3CA 1RUI3 1IS4A 2ORXA 3ORJA 1UNBA 4YRDA 3WF3A 5K0UC 3PVBB 3FFQA 2D6PA 4RYDA 1W2TA 4YSFA 2ETEA 3WG3A 1RUF2 5K9YA 2EICA 4XF1A 1JZ8A 3ALQA 5FPZA 4J6GA 4NIDA 2YMZA 4EWDA 2WA4A 3GBGA 1SBDA 3SNMA 5FYYA 2BNMA 1W6PB 5FP9A 2PLV2 3RZHA 1Q5OA 1UZ0A 2VCCA 3MF9A 3MFAA 2FDJA 4EN0A 5JIUA 2YZ4A 1VB4A 3KVAA 1JOPA 4UBGA 2Q0AA 4UAPA 5L36A 4BYYA 1ZBA1 5F3EA 3AJZA 1AUYA 3MPBA 1Y43B 3M1HA 2GN7A 2HYXA 1AR81 1TNFA 2XBO2 4K21A 3WW1A 3NNFA 4QGMA 5E88A 1SBEA 4FPLA 1XPWA 1GWMA 1ULOA 2RDNA 2WDBA 2WO7A 3NV4A 4LA3A 4FFHA 2W39A 3PVEA 5FQ0B 3FBYA 1Y9MA 5BNNC 2A70A 3FC0A 5D1IA 5JAXA 1SACA 3AMQA 1WLTA 2MEV1 5F1RA 4XILA 4UOJA 4GB31 3APBA 1YYNA 4XOGA 1ZNPA 3GGLA 4NVPA 2UURA 4Q0SA 1AHSA 4K6BA 4QDQA 1YQ6A 3SHRA 1J1LA 4IV1A 3WUCA 5C70A 4DINB 4URAA 1QWRA 1FI2A 3ABZA 5DQ0A 1C8M2 2DUQA 4B4PA 2GC0A 3WOGA 4CCKA 4HOOA 2VCAA 5G05L 4ZXKA 1U5IA 5EJ1B 5FO7B 2R16A 2RS11 5IK4A 3M3QA 2D98A 1R092 1UZZA 4FQ4A 4U2AA 3DYMA 5FZ8A 2HWE1 2YBPA 1W8ZA 2MEV2 1RUG2 3ZYBA 1DQ5A 1H1MA 1UAIA 1KFXL 2XHNA 4LORA 1C5IA 1RUJ2 2DCKA 5HXMA 1H1IA 1K5MA 4AVSA 2YC0A 1VRH2 1JBCA 3HBZA 2F6BA 3H8UA 3DYPA 2BBAA 1RTVA 3D0SA 4C90A 2V09A 3I2DA 3PUSA 2DVGA 1EV12 1ULCA 1FPN1 5A7PA 3GM8A 5FQ0A 3ZFGB 5AVAA 4YZ1A 3NV1A 5B2GB 1W2OA 2PHDA 4HZFA 5HCAA 1GUIA 2VUDA 3IMMA 3ZIWA 5FYHA 1XNTA 2KR2A 1V6OA 1CVNA 1DGLA 1BYHA 1OKOA 1ULEA 2QBXA 1NE6A 5T54A 1W0OA 1MEC2 1YI7A 1DGWA 5CZKA 1XRUA 1RUJ1 2ZEWA 5DDJ1 2C5DA 3QBQA 5CADA 1HJGA 3AMHA 4O9EA 3UETA 1B35B 1JI6A 4LJHA 1LHUA 1OF3A 2EIDA 3CDZB 1QIQA 1W04A 3M3EA 2V4VA 4RL7A 4MLOA 4QD2A 4W6WA 5FZ0A 2HWB1 3ASIA 5D8AC 1SFPA 1G9DA 1FPN2 5LEJA 5FV3A 1LODA 2WSUA 1ODNA 2QQVA 4K3UA 5FYUA 1LOGA 1IQDC 4XFHA 1V0AA 2DU1A 2XVKA 2ARXA 4S2GA 3WNKA 5C8CC 5FP3A 1KD7A 3PUAA 3ZPOA 3AYAA 1ZBA2 3R6SA 2WAOA 1PGSA 4NR1A 3MLKA 5ACA3 5L7OB 3FHAA 2EIGA 3E6BA 2ZHMA 3IWZA 4LHLA 4PJYA 1MS5A 3FFZA 2ADDA 3NNLA 4QXHA 4EZHA 2ZS6B 3SISA 2XJQA 4AR2A 5IAXA 1GNHA 2QQJA 3OGVA 1TVGA 3JQXA 4L8QA 5DG1A 1DQ6A 5IK7A 4MUVA 4P9JA 1K45A 4AWDA 5LA1A 3I49A 3VDBA 4M0HA 4TTGA 2ZPXA 1X8MA 2DUPA 4GZ9A 4XW3A 5LA9A 1EAH2 2VXRA 2WQZC 3LIHA 4IE0A 3W5NA 1RVF2 1J3PA 1VBD3 1ONAA 3PMSA 1W3XA 4XAAA 5CEHA 1V6KA 5GZGA 2AENA 2EA7A 1PIV3 3FX3A 3GF6A 4DXZA 1C8M1 4I01A 2WABA 1XC6A 5HBAA 1JZ7A 3WP4A 3IBMA 4PQQA 5C33A 1JZ3A 3ACGA 1S0FA 2Z69A 5JR2A 1RC6A 4KG0A 4ZY9A 5FUIA 5FY0A 1QU0A 3CO2A 2HWF1 5C8WA 3BN6A 2E32A 3L2HA 4IUGA 2ATFA 5FZ6A 4JDMA 1FV2A 2ZGOA 4ORFA 1D2SA 5IVJA 3SKVA 1S1AA 3ZXLA 3VBRA 1HRI2 4QXKA 5FZOB 4AOCA 1YFXA 4HLTA 2JDYA 1X36A 2D6MA 1VB2A 3KLSA 2D6NA 2YUEA 3ZYFA 2VNGA 2BRTA 5ACA1 1RUOA 1REEA 4JZRA 3Q8EA 4H2AA 4EV0A 2O8OA 5FDBA 5FKBA 4UW4A 1VBE3 2K46A 5JSOA 1XNBA 2YGLA 4Q8LA 3W21A 4ES9A 4IE6A 1GV9A 1Y3TA 2ZGKA 2ZJCA 4BQ1A 4PDWC 3MLJA 3Q8FA 5LEKA 3OBRA 5CA6A 1H30A 4CYDA 3OD4A 2QFEA 2WUHA 3VUOA 4A6SA 2JXAA 4META 4L97A 1OD5A 2CL2A 2A6VA 2PLV3 2VVDA 4DOUA 1PX3A 1QJX3 4UFLA 3B94A 2JEMA 4FOVA 4HPKB 4TZDA 2JX9A 2X09A 1AYN1 4CDWA 2XDVA 4CP9A 1OQ1A 2UY8A 2WN3A 1ZRFA 2XLFA 1IKQA 1YFUA 1Q3EA 5FZEA 2D44A 1QJY2 3AP5A 4WVMB 4WM7C 4CDXC 2OA2A 3I2OA 4ES8A 4FTBA 2XJSA 1OC1A 1MQTA 4JVAA 5F6KA 5JWPA 1HKDA 1IOAA 4YZ3A 2CAUA 3O1OA 3O14A 1JHJA 3QD6A 1KFUL 2B4KA 3HR9A 4IE5A 1O7FA 4XDPA 3WNMA 4CUGA 5J1XA 1VIWB 3AVRA 5FKCA 3BUCA 1G9CA 2E9QA 3NSTA 5T5LA 3VKMA 1IS3A 3A0NA 4CP1A 2ZX1A 5J7MA 1ZRRA 3VD7A 4YW6A 3NKGA 4GQ7A 5FYIA 4Y1YA 1YQCA 3I54A 4OUEA 1JU3A 1SQ4A 5A7OA 4XPVA 5A7WA 4IEOA 1ZREA 4FPFA 4I02A 2ZBJA 3VBSB 3LOBA 3OGJA 3S7EA 4Q2FA 1YFYA 3LA3A 1UCXA 2IFWA 2R063 1C1LA 4LQRA 3THCA 4XEZA 1DIWA 1RUD3 2JE7A 1WA6X 3LDRA 5KHGA 3AYCA 3VBFC 3O7OA 5C3OA 1KRIA 4HXCA 3D6EA 3RWKX 5DUXA 1POV1 4QPIB 1PVC1 1S0EA 4YWAA 4HPKA 1OLMA 3LOIA 4JGZA 3F95A 2RDQA 3U75A 2Y6KA 4FPJA 1F9KA 1LHVA 1VBC3 2XWJB 3MIHA 4M00A 4RGKA 4W6XA 4FAGA 3RYPA 1S2BA 4S2DA 2OXBA 5FP4A 2PHRA 3ZFFA 1AX1A 1W3VA 1MQTC 1VRH3 2VOVA 1ULDA 4ISRA 4AGGA 5CG9A 2NMNA 4DXSA 4DQAA 4YZ5A 2GP5A 1VJ2A 3I2IA 5DUWA 5JMOA 4LBKA 1DZRA 4BH9A 4BK4A 1YNAA 1JZ5A 1UY3A 2P3JA 2XLGA 1RUC1 2XQXA 3UT0A 5J96B 4LA2A 1GU3A 3B69A 2HEVF 3ZFFC 4UFJA 5CFDA 2W68A 2CAVA 3VBSA 2PHUA 3LZZA 3VHOA 4RFT0 4GMP1 1VBE2 3RPQA 3POYA 3S7IA 1RXGA 5EZWA 2AACA 2VZVA 3CKHA 1GZWB 4UF0B 4XFFA 4YLZA 4XF4A 3O1RA 1GZTA 5KHJA 2VZSA 3A22A 3UESA 1SCRA 4OHZA 5C3QA 4KU8A 1KQRA 1XE8A 3WXPA 5FZLA 1U5ZA 2Z5WA 2I07B 4DFSA 1WLCA 3AFKA 3UK9A 4OHXA 4CVUA 2JJ6A 3USUB 3FBMA 4AEDB 1QH6A 3HT1A 1PVC3 5EYXA 1N3OA 4UFHA 3EJKA 1G86A 4PHZA 3O1PA 1SLLA 4BE3A 3DXUA 2JWPA 3H8OA 2VQAA 4A6OA 1IG0A 2X05A 1ENRA 1QMJA 4OLLA 4AXOA 4JX0A 2WT2A 1GKBA 2FCVA 3WDUA 2IVIB 2P3KA 4B1LA 2WJSA 3AXEA 4LUKA 5FR3A 1UO9A 3UGHA 1WZXA 4IEWA 2VQ0A 5A3UA 1US2A 1W8FA 2JG9B 2PXJA 3T2OA 1ND2B 1UX7A 2ZGLA 3I2JA 2XG3A 1PO22 1PX4A 2MEV3 2WQ8A 4HL0A 3WNNA 4AFDA 4R9AA 2VOTA 4LBLA 5C6CA 3N7LA 4E4SA 4AQTA 3K4DA 3ZIXA 3FUQA 4AZZA 2GH2A 4LLFA 4GJZA 2RM23 4ZZ8A 4QB1A 4COYA 2Z79A 3A7QA 1JZ4A 2AEYA 1NCRA 2Q5TA 2VMCA 2VC9A 1SPPB 4LR4A 3T2QA 1D2QA 1GMMA 3KGLA 3J8F1 4N53A 1WCKA 2OQ6A 1S0GA 4IEUA 5A6XA 4B4QA 2VMDA 1H4HA 2ADEA 2WRAA 3SMHA 3USUA 2A6WA 3B3QE 4AEDA 2WNVA 5L73A 1WCQA 3RMXA 5IFPA 5FLJA 1JHNA 2W92A 2HLEA 4HN0A 4IGPA 3WQBA 4AFCA 2LS6A 4ZS2A 1MPXA 3B93A 4NUBA 4XIOA 5LZ6A 2VUAA 1HQNA 5HV4A 1CZVA 2W2IA 2BOJA 3EYPA 2Q1FA 4QQLA 1AR71 4LLOA 3N9MA 5KC6A 1XSRA 5KXBA 2GALA 2D97A 5A3WA 3OEBA 1ND2A 3P5BA 3V56A 4DEVA 1VBC2 1LU1A 4YM0A 1U0AA 2J1EA 1BEV1 2JD4A 3ME2A 1ZBA3 4AAPA 1LOFC 2Y38A 1DLCA 1NCRB 1YIPA 4KWKA 2QQIA 2YFZA 1L7RA 2B8MA 1AR72 1US3A 5FMBA 4CXWA 4DNYA 2GSYA 2P2KA 2W46A 2EXIA 2RR12 5FTTC 5F2SA 4PQ9A 3DV8A 1O4TA 3KSCA 4HSLA 3IDBB 2EXHA 5JPMB 4N9HA 1LULA 1PZ9A 1PO13 2PLV1 5F3GA 5FIXA 4LO6B 5A33A 3MPPG 2HEWF 4AI3A 5DAPA 5IYYA 3BTYA 4D69A 4NIGA 3N35A 1IS6A 1PGL2 5JI7A 1QJU2 4GXLA 2QQPA 3VV1A 1DQ4A 2PHTA 2XMLA 1LHOA 2WN2A 4CXYA 1I6XA 3B9IA 1GANA 1SLIA 4GAZA 3E97A 3KZ4C 4XFBA 5L9RA 4MXWB 2CY6A 1D7PM 4NHMA 4OI2A 4YM1A 1AR83 1AR93 2X5IA 5JR7B 5FZ7A 2ARAA 1JYXA 3RYKA 3BTXA 1YFWA 4H3WA 3PTYA 3S6PA 4RS5C 4XC9A 4XETA 3WP5A 4BHPA 4YGDA 2ZKNA 5I93A 1NZCA 2BNNA 2W87A 4X8PA 1B09A 5FZ9A 5I0RA 4LOTA 4MOAA 1IG3A 1QXJA 1UWWA 4GA9A 3U14A 1MS4A 2DFBA 2D43A 4PI0A 1FATA 2HWF3 2IZWA 1AYM2 2JD9A 1UYZA 3GZEA 3RI8A 2VVFA 1ND3A 2W95A 1J83A 3VHNA 3ZXGA 4BJ0A 1SEFA 1CPNA 1D4M3 2DCYA 4GKXA 2ILMA 4CCOA 3WNXA 3THDA 1IPKA 3JZVA 3QH6A 1KJRA 1W6MB 2VR4A 1O6UA 2PHWA 4INDA 4LBMA 4QPGA 3T2TA 3WX5A 5A6YA 2XPJA 4IEYA 1Y7BA 1DQ1A 3OBAA 4UWDA 3VDDC 4P9GA 2EIEA 1H8TB 2YYOA 5GLVA 4R52A 4MXWA 3VKOA 1RUF1 4F7ZA 4FOYA 2X5IB 1DYPA 4GWIA 2W9XA 3V0BB 3QACA 1LECA 1W8TA 2HEYF 4A7KA 2KA3A 4QM8A 1N1TA 1WD4A 3GJAA 5LK5A 3ST7A 5DG2A 1EV11 2A3XA 3FN9A 5FXVA 1NUKA 2E7TA 3CLPA 1UU6A 1AR63 2GNMA 3BKZA 2GMPA 3C3VA 5DZFA 5ABJA 3N7KA 3H50A 3KHCA 2VULA 1A78A 2VMHA 5T52A 3N36A 4MHRA 4X6RB 1MEC1 4B3NA 1S2KA 5FK8A 4D6QA 2RS13 1CAXB 2CWMA 1ND3B 3MUY1 2K9ZA 4QX3A 4RA0A 5JXGA 5KHIA 4QXBA 1HW5A 2A3YA 4CPBD 5DMYA 1W9WA 2D3RA 4FFFA 4AI1A 4AYUA 1X8EA 5FY4A 1PVXA 3WEZA 4QPGB 2R6QA 3TYJA 4MGZE 5GZEA 5JZGA 1V6LA 1BVVA 1KDMA 5AVPA 4O7XA 4LO7A 2WINB 2FDKA 1CONA 3AMPA 2X8KA 1CPMA 1OVPA 4N43C 1G9AA 3J8F3 2PAMA 3S5QA 1H6XA 3J7NA 3J4UH 4LBOA 4TWTA 1W6NA 5CKQA 1O59A 2LTNA 3KVBA 3EMRA 4XF3A 5EV7A 4YW1A 5FFOC 1W28A 5JVVA 2E33A 1RJ7A 2R49A 4LKSA 1BKZA 4UYBA 4WZCA 3V0AA 3D8CA 3Q8CA 1YHFA 3ZXAC 2R042 4XF0A 4Y22B 3VD3A 1OPOA 1TZOA 2OW4A 2HWD2 4W6YA 5BNPA 1TME1 1W9FA 1X33A 3KGZA 5FP7A 2JE8A 5J3UA 1KS4A 4XUPA 2YU1A 3AJYA 3C2UA 4XFGA 4URTA 1IS5A 1VBA1 3LD8A 4GH4B 4JKLA 1LAJA 3JXSA 3AK0A 1R1A1 4RHV1 4DMIA 1NYWA 4DPNA 1JYNA 4LBQD 2BJSA 5HCHA 3IAPA 3V65A 3T08A 3K77A 3B7MA 3MIDA 1QKQA 4DRRA 1N1VA 2H6BA 1T2XA 4ASMB 4AHXA 3DEMA 1G8WA 3TEXA 2ZEYA 1VAMA 2VNRA 3M3IA 4NIIA 4PIYA 2VXJA 5IFTA 2XJUA 3ZSLA 5H9QA 4AEMA 4AI8A 5C7GA 4HK8A 2W3JA 4QQPA 4OQ9A 5I8YA 5DPNA 1W6NB 1H8TC 4WM8A 5FJHA 5IHRA 1EV13 2B39A 5F8PA 5FPAA 5IWFA 1K12A 3Q9OA 3ZFEA 2QDRA 1JOJA 1COV2 3J7HA 3NV3A 2JECA 5LASA 4QPYA 3UKTA 1GNYA 1UL9A 4Y22A 5FLIA 1MZ5A 4YW4A 3GZUC 3W58A 3HNBM 1NQDA 2F17A 4XZPA 5CISA 3F2ZA 4QU1A 2DCZA 3R05A 2BGPA 1UIKA 2J1TA 4OULA 1LENA 4AF9A 3T09A 1V6JA 5BYNA 4NRMA 4IETA 1QJU3 4LKDA 1FNYA 1W9YA 2C9AA 1AJKA 3AMNA 4PF5A 3SH5A 4BOWA 1WKYA 1PO12 5E6HA 1YLLA 4KNCA 3M70A 3PTRB 4AVTA 4YW5A 4COZA 2BWAA 4XFAA 1AR92 2P6HA 3IN9A 4NPMA 4PIXA 2QQKA 2DCJA 1NG0A 1URXA 1XJAA 5FYTA 2C9KA 4YVSA 4D8MA 2RE9A 5LCWL 4XHXA 1AX2A 3VZOA 3PDQA 2N7GA 1AXKA 2XR4A 2Y6HA 4LK6A 4RR3C 5LRSA 5FOBB 3OUJA 2JIGA 2G9FA 2SLIA 3CL1A 3CEWA 4GWMA 1JW6A 4J1WA 4DY3A 1LEMA 5IW0A 4FOQA 3I3DA 1V9U3 1BEV3 2VBPA 3WD5A 4ZPIA 5FXWA 3B02A 2PYTA 1LRHA 2QNKA 5EXOA 2RS51 2QE3A 3SQOA 2IXLA 2JDKA 3N9PA 3VDDA 4R4ZA 1FMD1 2H0VA 1UZVA 4BMEA 4F3JA 4P14A 4DXRA 3T4VA 3H1MA 4FSJA 1YXWA 3HIFA 4YVWC 4TYSA 4AVVA 4YZ2A 1I5PA 1MS8A 3CMGA 5LK7B 2FCTA 2OT7A 2RHPA 4E4DX 5CU1A 3AXDA 1LJ7A 2PELA 1AYN3 1J59A 2I45A 1UY2A 1ZZ8A 1H2MA 1BK0A 1D4M2 3ATGA 4BDVB 5F5AA 1H2NA 4ASLA 4COUA 3UJOA 5T55A 1AXZA 1W6QA 3FLPA 5F5QA 4IE4A 4K1ZA 3B5LB 3ZM8A 1J3RA 2YROA 3ROUA 3SCGA 1W39A 4XBQA 3ZN4A 5JIAA 2BU9A 2XJVA 4WVWA 4MO3M 4YVSB 3SCHA 4C0HA 1N1YA 4CP0A 3CBNA 4Y4RA 2CWSA 2DTWA 2VNVA 2FZ2A 5BNQA 5C8CA 3LAGA 2MHFA 2GNTA 5CB7A 2B9UA 3WW4A 4Z82A 3HMYA 1HB2A 1NXMA 2KD7A 2YU2A 1EUTA 4Q4X1 1HQWA 3NO8A 4P08A 5D21A 4Q8KA 4HSJA 2J1RA 4YVSC 4W65A 2JG8B 2YG0A 3K48A 4DRVA 3VDDB 1QHDA 3AL6A 3M4FA 1ZRCA 2D5HA 4JGYB 3EO6A 2XQRA 4GMP3 3NMBA 2XKPA 3IDEA 4UT5A 2Y26A 5T5OA 1ZZ9A 3NJVA 4LBQA 4CDXB 2HWC2 4JCKA 4NOTA 5CBLA 4AGRA 3KWVA 1CESA 5FREA 2Y8KA 1DYOA 1RHI2 4FP2A 4XE9A 1J3QA 4Y4YA 4Q4X2 2WLPA 1F5JA 5I0TA 3HOBA 1LESA 4FPKA 1AR91 3KV5A 3MI8A 3WW2A 3ES1A 4J1XA 1Z0HA 5L7OC 1A3KA 3MIBA 2IXHA 1X82A 1UU5A 2A7AA 2HKXA 3K51A 3J8F2 5BXXA 5C8CB 1A8MA 3AYEA 4AVBA 1VALA 2CYFA 5CFDC 1H0BA 1OUXA 1H1AA 3TN92 3VBFA 4O61A 1C8NA 1ULPA 2IXKA 3PU8A 4G4FA 1ND3C 2VG9A 5FZ4A 2WS91 2JG8A 3B00A 1O91A 4YPJA 1E5SA 1PZ7A 1W9SA 2WFF2 3KQRA 2AYHA 2HWD3 2EF6A 1ZZ6A 3H3UA 1C28A 4QX2A 2RMU1 2DV9A 1U5XA 1WW7A 4QGLA 4V2VA 2W1WA 4FVVA 3FLRA 4N90A 3RRDA 4D6RA 4EYUA 2ZXQA 2WAAA 2RVAA 1DQ0A 3BALA 4JRAA 1SDDB 1QF3A 4TSVA 4XCAA 5F5CA 2CHHA 2JDPA 1M06G 1UKGA 1AYM3 2DVBA 3VD4A 5FWEA 1IQAA 2I2SA 3H3LA 1RUG3 3LA7A 1XB9A 2CDOA 3TRSB 4SBVA 3MBWA 1H2LA 2G1MA 3DGTA 2WFF1 3LEIA 3WP3A 5KXDA 3OBZA 1CAUB 3IPVB 4FAHA 2Y60A 2VNOA 1OURA 1NZIA 1XNCA 3GBFA 4ISQA 4E9KA 1UOJA 1HDKA 3J26N 1I9RA 3MDPA 3OPTA 3ZN5A 3VBFB 1YQ8A 5EQUA 1COV3 4RR3B 4C0BA 3ZX7A 1J84A 5KWRA 2WZR3 2ARCA 5ANNA 5FZBA 4E8DA 4I3PA 3O1VA 1O3QA 2DF7A 4GMP0 3SEPA 2CGNA 3TEZA 4R9CA 3INAA 4OZXA 5A1FA 4BMBA 2NLRA 1PGL1 1HRI3 1X50A 4LBNA 3SH3A 1UD1A 1ASJ1 4XURA 2W08A 4XFIA 5IVEA 3IB3A 4OQ8A 2WNUC 4L11A 2BWCA 4XDQA 3H0OA 3EXUA 2BZDA 1HV1A 2YBSA 1AL22 4IXLA 3M3OA 4BPZA 1UQXA 4CZSA 5CAZA 3ZR5A 2GC1A 3ZLIA 2B45X 2E51A 4LMFA 4CDUB 5A3TA 3NNGA 5HXVA 2ORZA 1CAUA 3IPVA 1HIXA 3OUIA 5FOJB 1QQP3 3OSDA 2R071 5J98B 3RNSA 1Q8VA 3NRUA 1ASJ2 1OHFA 2GZWA 2CDPA 2VOKA 3T0AA 5I8SA 3AL5A 3ZYGA 4E4HA 3AKRA 3MYXA 3WDYA 4BQXA 1OA4A 1OKQA 1OMIA 2KXLA 3I3MA 4CEYA 4GB33 3HQUA 3NJXA 5A80A 4WZFA 1UKRA 1GQHA 2F4LA 4AVAA 1R083 5A1LA 3KT1A 2AC1A 3TN93 3VB9A 1CAWB 2RMU2 5EIYB 1GOFA 3I8TA 1YEWA 3NNMA 4CSWA 4KBZA 3IDCB 1AZDA 1YRZA 4A7ZA 4CEWA 3O1SA 3VBSC 5DZGA 5CYYA 4IV1B 4RGGA 2WO2A 3G6JB 3B01A 1Q8PA 1YO8A 5BV6A 3UNPA 5IVVA 2AREA 3GNEA 4XJ9A 3I2FA 2CGPA 1EPWA 2LRPA 3ZYJB 3FWEA 1SLAA 4QPGC 3OY8A 1NXD1 2WZPP 3RVHA 5ANQA 2WYSA 2A71A 3SEEA 4CEWC 3FE5A 4BQ3A 2OIIA 5H9PA 3VBOC 5FRAA 3IMNA 4F83A 2X5IC 3MW2A 1MS9A 3H7YA 1K5MB 3AP6A 4XQ4A 4XUTA 3KCXA 4QKBA 2B46X 2BFUL 2WNOA 4FXKB 4UW3A 3USSA 4BXFA 1W6OA 3RZJA 1VMJA 3AYDA 2LROA 2WT1A 1JYTA 3WY6A 5GZDA 1WW4A 1EYBA 2O0OA 5A1AA 1XQNA 1Y9QA 2QCSB 4OCTA 3VZKA 2RDSA 5C9AB 2O8QA 1FNZA 1MR5A 3H9AA 3CIHA 1RUJ3 4AG4A 4AFBA 2A6ZA 2ZGUA 2HYKA 1CD3G 2XUMA 5FPVA 5JCTA 5FMDA 1LOEA 1OQDA 4ZXEA 3SKJE 3WNLA 4CEWB 3ZXKA 3VKFC 3ZXDA 2AUYA 4N7IA 4AAXA 1G9BA 4I2OA 4Z92B 2XGXA 2ZZQA 1ENSA 3KCYA 3CZJA 4W8JA 3U07A 3B9CA 4XIKA 4XVHA 3ZXFA 3VBHC 2VW1A 2IC1A 4FPHA 4MSVA 4P02B 1EPZA 1JOBA 4PCRA 4QPIC 4XZUG 3WDTA 5B4NA 5FY8A 5JOZA 1BQPA 4LEJA 4YW2A 4GWJA 4MV2A 1SCSA 4GJYA 2D6LX 1APNA 3PUIA 2VECA 3I97A 1CZSA 2J22A 1N3PA 2WO1A 4N53C 2Y6LA 4P9YA 4M4RA 1ZBE2 4NHLA 1BJQA 1O3TA 5A32A 1WD3A 5A3PA 1KGYA 4Q4W1 1VBA2 4BK5A 4XACA 4JGYC 1W6OB 4MZUA 3HWJA 1GZ9A 1WMFA 3DKQA 2JDUA 1X7NA 1Z7S3 3H42B 4CDWC 3BU0A 4Z2AA 5GZFA 1RMU1 3MLLA 3DCQA 4Y1ZA 4WM7A 3VKLA 4M0NA 1LOFA 1OFSA 4NWVA 5BNPC 1OBNA 2ZOEB 3HJRA 2DU0A 5FZ1A 3VGIA 1WMDA 3POWA 3W5MA 3K4ZA 1OSGA 3PIGA 3ON7A 3AVSA 4K20A 2VZTA 3WDVA 4EWAA 4XQDA 3NJZA 5I0UA 4I0WB 2WT0A 3E1F1 3KF5A 2WR9A 3NVCA 4A7YA 4DUWA 5F7UA 1FOD1 1RVF3 5C5UA 4Z1VA 1H4GA 3OGGA 3I2HA 5G04L 3T0BA 3AZXA 3W9AA 1FYUA 2WYFA 5FXZA 4ZU4A 2LM3A 3ZYRA 1COV1 1YC61 4BQ5A 4D7SA 3ECQA 3WG2A 1ZX5A 3ZN6B 3WNPA 1RUD1 4ZHNA 1F5FA 2VAUA 2ZCWA 3O1MA 3IIAA 5KHHA 3FZ3A 2WO3A 5E16A 4L92A 4QX7A 1BBT1 1FV3A 2GMEA 1XE7A 1GOHA 3FHIB 2UU8A 1O3SA 4AVCA 1LNSA 3WHTA 2G9ZA 3CJIA 3PHMA 1RYYA 4Q4X3 3WCSA 1PIV1 2YC2A 1R081 3RZZA 1IZ3A 1O5UA 3OCPA 4OI1A 2GNDA 1JUHA 3BTAA 4MHUA 4CDQB 2EAKA 2P3IA 4ZZ5A 1F4AA 5BNOC 3RZKA 1A6CA 4Y1XA 3EHKA 1C3HA 2D3SA 1BBT3 1MACA 3MF6A 1UMHA 2VMGA 2EIBA 1W03A 2CTVA 3PLQA 1BBT2 5H9RA 4KMQA 2YPDA 5LATA 4FPEA 4JHTA 1S0JA 1GQPA 4WVZA 5CFCC 2YFUA 4K7JA 4O9GA 3WSOA 4XBNA 1V00A 2ID4A 5APAA 5EFUA 1UPSA 3ZN6A 3ILRA 4CXXA 4DUVA 4QU2A 1ZRIA 1ZA4A 2OZJA 3CF6E 2C4XA 5FP8A 1O3RA 2RS52 1MVEA 3KV9A 2D93A 2VH9A 4HK9A 4AEKA 2NMOA 1TME2 1YJKA 1CIYA 5AC91 1C4RA 1CIWA 2WNEA 1NLQA 3D4KA 3GCXA 4MGIE 4B1MA 3CJIB 4KQ7A 2XONA 5K7PA 2P37A 3WDWA 1S4CA 4CTEA 2RMU3 1XU1A 1VR3A 3BOWA 2BQPA 4QX1A 5A3OA 4N7UA 1S0CA 1Z78A 4RSUA 1F31A 4YM3A 1RUC3 4NHKA 5SV8A 2C24A 1AL0G 3WF2A 1BXHA 4A45A 4PLNA 4YFWA 3ILNA 4B4RA 1DLLA 2WWJA 3VBOA 3MICA 4IEZA 3LF7A 3T1LA 3A21A 5DDJ3 3WQ7A 3JBG3 2PHXA 5FPUA 4ARXA 4Q1PA 1D0HA 1V6NA 3TOJA 4RN5A 2ZGQA 2XVLA 5ISLA 4LO4B 1W05A 2BDRA 3OJBA 1QQP2 5GLTA 3LE0A 3T3YA 3DF0A 2JB8A 4LHNA 4JGZB 4XF9A 5FZAA 2WL1A 3KS7A 4DZGA 3ZKUA 1AJOA 1D4M1 5IT6A 2E6VA 1RUD2 1WMXA 4BB3A 4AE2A 1X9PA 5T50A 3LPFA 2GN3A 2QZ2A 2ZEXA 1XOYA 2JDZA 1REDA 3I2GA 3ZFFB 4MGTA 4FI9A 2NP0A 3HAGA 1Q43A 2D3PA 1ZVFA 2R30A 5EHDA 4YGCA 1ZRDA 2FDGA 1RUNA 1QJFA 1JMUB 3ZFGC 4HONA 3P3PA 4RHV3 1VLNA 2WWSA 2XLAA 4OUMA 3O12A 5FY1A 3M8LA 5FYZA 3KB5A 1ENQA 1POV3 3DECA 3EQEA 3WG1A 1YWKA 3RFRA 1RUH1 3RWNA 5I0DA 1AYN2 4CCMA 2NZ9A 3CQOA 5FPXA 1QY4A 2VPVA 4PDWB 1S55A 2NYYA 3OPZA 3ACIA 3OB8A 4YGEA 5CFDB 3RZGA 5FYCA 3VBOB 4FTSA 1NOVA 4FO9A 1UMZA 4JAAA 2Y0OA 4QB2A 5M0TA 4IDZA 1GZWA 3N9LA 4FCAA 4I0BA 5GLUA 4ASKA 3RS6A 3U78A 1U5YA 3POGA 4R8HA 4BQ2A 1ND2C 5C5TA 2D6OX 2HWC1 2VZOA 1AX0A 3KQ4B 1VPHA 1RGSA 2OPWA 2ZA9A 4JDOA 4TXWA 3SXWA 2UWAA 1QJEA 2W91A 4YW3A 3UL2A 1VAKA 3OG2A 5F37A 2BPA2 2ES3A 3CU7A 3ZYPA 4XYXA 1LOBA 2BUKA 1WLDA 2R1BA 4V2WA 4Y5Z0 2XHKA 4OHWA 5FYMA 1GNZA 4PBPA 3I2KA 1R1ZA 4IEVA 2ZHNA 1CWPA 1F35A 4Q0UA 4AK3A 4LITA 4TLFA 4C1XA 3WQ0A 1PVC2 1LCLA 1HLCA 2WZ8A 4FFGA 3I59A 3LEMA 2I74A 4WVVA 2JG9A 3ZFEC 3U10A 3TN91 3AZWA 4PDWA 2BVVA 2QQUA 3RSJA 4UXAA 3U11A 1LOCA 2JDMA 4XMIA 5EJ3A 1HB1A 3AZYA 5J37A 3H3ZA 4S2FA 4V1PA 2PAKA 3UGFA 5JMCA 2DBNA 3JCIA 4E27A 5A7SA 5FPLA 3HNMA 2ZX4A 4QKFA 3HQRA 5FZHA 3GCWA 2H6CA 3POFA 2ZEZA 1SPPA 1E57A 3QLQA 5FLHA 5L19A 2J7MA 2QJVA 4N53B 1V9U1 2RR11 4QAWA 4HBNA 1Q8OA 1LHNA 1GFF2 1RUC2 1LB2A 2XL9A 3HD8B 2B5HA 2XWBB 4XFCA 1HRV2 3P1IA 4DO0A 1QH7A 2WNVB 3LQCA 4GKYA 5ERLA 1CJPA 1MZ6A 5EWSA 4A44A 4NHXA 4X6QB 4Y24A 1DYKA 2GC2A 2XB6C 1ULFA 5DUUA 1QJU1 4KH9A 4LXLA 3AX4A 2TUNA 2R062 4NRQA 1POV0 4KWLA 3RMYA 4HVRA 3VHRA 3DXTA 1XBFA 1OFNA 4NMIA 4Q26A 1DGRN 1RIRA 2WC2A 3IDAA 5GLZA 1NA1C 1AL23 4A4AA 2VL4A 1QEXA 1RUI2 3G7DA 1HJFA 3MIFA 1O4YA 2YC4A 4ATFA 2FDFA 1IPSA 5E1RA 2DYCA 1VBB3 4QMAA 5JDBA 2RDRA 3KHBA 1OH4A 4GD4A 1J58A 3ILFA 1VBB2 3LEGA 2P4EA 3GYDA 1JH5A 4M3CB 4F8AA 4BZ4A 1AVBA 1OOPA 3M7AA 3URFA 1RUG1 1GP4A 2R0FA 4YFZA 3RDIA 3J7LA 3PIJA 5FCCA 4BM8A 2EXJA 2Q8DA 1AYM1 1NQJA 2HH9A 4NJ4A 3CJXA 5I0SA 3DUIA 4Q0QA 5F3CA 3FMGA 2HJIA 3KM5A 4BA6A 1MEC3 4KBBA 1WW5A 1IHMA 4JGZC 3IZOA 4JTNA 3VZLA 1W6PA 3NV2A 3BIWE 4Y20B 3LB9A 3O0XA 3RYRA 1NT0A 2YB7A 1O8PA 3CHXA 4MVTA 3UYJA 3VDAA 2FCUA 2OVUA 2J1SA 2A73B 3BCWA 4QHZA 3MV11 1ST8A 1UZWA 1W9TA 1HX6A 2ENRA 2VTFA 3GBWA 1LU2A 5BNOB 1W0PA 2P17A 3ACHA 4XABA 4QHBA 1NLRA 5DDJ2 4ET7A 3OBTA 1GR3A 3HBKA 1DHKB 3C8XA 1JYVA 4XJWA 1RXFA 3ES4A 5FK7A 4LOSA 2MNGA 2WSVA 3PVNA 3ZSJA 2HWB2 5JSPA 2AEZA 2BGOA 2E7AA 2OPKA 1PGW2 1OOPB 1GWKA 3JD72 3N9OA 3T1MA 3OGSA 1MZEA 4QX5A 3OYWA 1CJDA 2DFCA 4G9SB 1DG6A 4UFMA 3ZMNA 3TEYA 2GC3A 3CJIC 4OI0A 4Y5TA 1QJZA 5IATA 1I3HA 4IGOA 5DAQA 4LK7A 4YYOA 3NNJA 5BNNA 3BTZA 4BIOA 2ZX3A 3R4SA 4Y20A 2VMIA 4W4ZA 1ZA7A 4EE2A 2PAEA 2OUJA 2CSGA 1DGWX 3HEIA 5FYVA 4QKDA 2RS32 3K46A 2MPFA 2E63A 3R0RA 3OEAA 3TBDA 5BNOA 3RZMA 3WT3A 3D0JA 1EAH1 2Y64A 3T0DA 2DTYA 5FUPA 2V5DA 1GWLA 2RV9A 4K40A 1DQ2A 3K75B 1AL21 1WCSA 2WNUA 3JBG2 4Y5SA 3UGGA 3V0BA 1NY71 5FWJA 3WF0A 3C7OA 4D0QA 2C6SA 3W20A 4K1YA 5CKNA 2RM21 2YV8A 3N7MA 3NQHA 3KV4A 2H0BA 4NROA 3M2MA 2WIIB 4FXGB 3GZAA 5ABJB 3AKQA 3IM0A 2RS31 3ZFGA 3U4XA 1ZBE1 1Q8SA 2BGCA 2R041 2DDUA 4AEDC 3ETQA 1VAVA 1DZTA 2HWD1 2JB4A 2QQWA 3IIIA 3OYWB 1KS5A 4IQPA 1QDOA 3BPSA 4R4XA 4B29A 5J48A 5EPAA 5F6LB 2WS93 5KXCA 3VBUC 5EJZB 4SLIA 1DFQA 2BYVE 1JU4A 4CP2A 2CV6A 4XBLA 4S2HA 3I4IA 2JKBA 3RJ2X 1TEIA 3LA2A 1B35A 3E5UA 4QDSA 4GULA 4L99A 4RHV2 3OF1A 5BNNB 4Q4V3 1OLQA 1WWYA 3AZVA 2Z4FA 5HV0A 5JZGB 3GXUA 5KBFA 3WNOA 2CGOA 2GNBA 2HWE2 4AL9A 2RS12 3VKNA 3HNYM 1NCQC 4EN9B 3H1YA 4JC1A 3K3OA 5FZCA 5FZ3A 1KXGA 4HETA 1WLWA 5HCFA 5DZEA 1FAYA 2XL7A 1JTZX 5L7OA 4AHWA 4Q4W2 3O1TA 2WNUB 1L7LA 1F8VA 1V6IA 1Q56A 1UF2C 4DEQA 4BU2A 1SLTA 2ZACA 2XH6A 4IGQA 3AMMA 4Z8BA 4OHYA 4B7KA 2QZ3A 3C7EA 4QGNA 1K5JA 1ZYBA 2W1QA 2B42B 3E6DA 3MGUA 1GP6A 3N3HA 4JTOA 1XYPA 1GLHA 1UYYA 5BNPB 1FT9A 1TE1B 1JXNA 3LCPA 5LB6A 4EQVA 3WG4A 1JYWA 3H1WA 5LRRA 2VZQA 5SV5A 4GH4A 5AFEA 3AC0A 2R043 3GHMA 5DUVA 3POIA 4MADA 2EXKA 3O1UA 4HVOA 1JYIA 4QT6A 1UZYA 2WZR2 5GKAC 1HB3A 3VDCA 3JB4C 4NRPA 2GH8A 4E2QA 3AKPA 1F2NA 3TEWA 1OI6A 5JXIA 3N9NA 4KWUA 4OYUA 1NCRC 3GALA 1CN1A 2BBVA 4RGAA 2D5FA 4XMAA 4I30A 4XUNA 3PUQA 3LWCA 3VBRB 1I5ZA 1LGNA 2DWRA 2VM9A 1UXZA 3PL0A 2ZX0A 3AB0A 4RQPC 5FZOA 4AHZA 1ALYA 2QVSB 1WMEA 3ZDVA 1XNDA 2C1FA 2VUCA 5C4WC 1NY72 2AZ5A 5C3PA 1PNFA 1SG3A 4CU9A 4DIQA 1TMF2 5FBZA 4RFRB 4DS0A 2ZMNA 4FP3A 4ATEA 4BIFA 4LT5A 5EYYA 2Q8OA 4FPYA 1O5LA 4CE8A 3AP7A 5JXHA 3MZHA 3S30A 4XJUA 5AC92 4MG2A 4IL7A 3BOPA 3DN7A 4TLGA 1ENXA 1HQLA 1AR73 3D5OA 4PT6A 2FQPA 3LKJA 1RINA 2VMEA 5CIRA 1W06A 4CEYC 3DYOA 5FXXA 2ET1A 3E5XA 2VCMA 3U4SA 1UOFA 1OUSA 3POBA 4YGBA 2K2SA 1DZQA 5JZGC 1NLSA 1UXXX 4CDWB 5A70A 1YCIA 5BPXA 3BVCA 4IEPA 3IAQA 5FY9A 4CP9B 4XUOA 1DCSA 5GLWA 1RMU3 1DGRA 1ZZCA 5E8AA 4M3CF 4WVMA 4AQ6A 4O65A 2XJPA 4MYEA 3RGBA 1VBA3 1HXS2 1MQTB 2W47A 2CNAA 3AZZA 1UY1A 5FZFA 1LTEA 2Y6JA 1PZ8A 2R32A 4Y1UA 1MS1A 1H9PA 1W8OA 4UW5A 4XJ8A 3EBRA 1BMV2 2WNVC 4FPGA 2A5ZA 1VMHA 4Q29A 4K9SA 4PLMA 1ASJ3 5AFBA 1H9WA 2ERFA 3TNPB 4MXVA 1FOD3 2P34A 5K8SA 2VZPA 5ABJC 1GICA 4QX0A 1YQ5A 4YARA 3ZPYA 3T30A 5FY5A 3WCRA 4L9BA 3ELNA 2W94A 5GALA 5FZGA 4DUXA 5A7WB 4X8NA 3BIEA 3V64A 5D2AA 5IK5A 5CG8A 4NWWA 1W8NA 4LO5B 3H8RA 3ENRA 1C8M3 1SMVA 1WW6A 4H7LA 3OTFA 3S57A
chains in the Genus database with same CATH topology
3C7GA 5G04L 3I2HA 3T0BA 2VQTA 4PF1A 2JD9A 1UYZA 4CUAA 2W95A 3WF4A 1HN1A 4KI5M 3ECQA 1SHWB 1J83A 3ACFA 4CU6A 4XUQA 5B4XA 3WNPA 4BJ0A 5LA2A 3THDA 4W50A 1XNAA 2VR4A 3LEKA 2WO3A 3VD9A 4P5YA 3FHQA 1GOHA 3OBAA 2QQLA 2EIEA 1LNSA 4BXSV 2W5FA 1RYYA 2B9VA 4XURA 2YC2A 4GWIA 4A4AA 2W9XA 3EB7A 3FN9A 4ZZ5A 1F4AA 1NUKA 1UMHA 2EIBA 2QQMA 2ORXA 4KMQA 3WF3A 2XOMA 1DP0A 4RYDA 1GQPA 2YFUA 2EICA 1JZ8A 3MUY1 3WSOA 5JXGA 4QX3A 1OF4A 2ID4A 5HPOA 1P8JA 2W1SA 5DMYA 1W9WA 4OMCA 4DUVA 1UZ0A 2C4XA 2VCCA 3WEZA 1CIYA 4UAPA 4A3ZA 2XONA 2J1UA 3VD5A 2HYXA 1H6XA 4QX1A 2X10A 1O59A 1XPWA 1ULOA 2J1AA 2WDBA 2E33A 3WF2A 4LKSA 2VZUA 4A45A 1GOGA 3VD3A 4QPWA 3A21A 4UOJA 4ARXA 2JE8A 4XUPA 3GGLA 4RN5A 5JUVA 4QDQA 3P6BA 5C70A 1K42A 3FL7A 4JKLA 5DQ0A 3ABZA 3JXSA 3LE0A 1JYNA 1PMHX 3IAPA 2VCAA 5G05L 3LPFA 3T08A 3K77A 2ZEXA 5EJ1B 3I2GA 4FI9A 3HPNA 2RJ2A 1T2XA 3DYMA 4M4PA 5LA0A 2ZEYA 3MO4A 5IFTA 2XHNA 2VZ3A 2DCKA 1UY4A 5C7GA 5HXMA 1H6YA 2W3JA 5DPNA 2C26A 3DECA 5IHRA 3DYPA 2BBAA 5I0DA 3CQOA 1K12A 4OMDA 1EUUA 3J7HA 3OB8A 3ACIA 1NX9A 3GM8A 1GNYA 3HNBM 1GUIA 4QB2A 1XNTA 3F2ZA 2QBXA 2BGPA 2J1TA 5CZKA 2ZEWA 3T09A 2VZOA 3UETA 1JZ2A 3U37A 1JI6A 4CUCA 4TXWA 3CDZB 1OF3A 2EIDA 2W91A 2V4VA 3OG2A 1WKYA 2VZ1A 1IQDC 3WNKA 2QQKA 2DCJA 3I2KA 2C9KA 2WAOA 4D8MA 5LCWL 3FHAA 4OZOA 2Y6HA 2WZ8A 2QQJA 3OGVA 1TVGA 2LW8A 3I3DA 1L7QA 1R64A 2J1VA 4JKMA 5LA1A 1K45A 3VDBA 4TTGA 2BERA 4GZ9A 3A23A 4CUBA 3HNMA 4MGQA 3HN3A 2ZEZA 4DXRA 3W5NA 2J7MA 1I5PA 3CMGA 4QAWA 1JZ7A 2WABA 1XC6A 3T2PA 4PQQA 4UI9L 1JZ3A 1UY2A 3ACGA 5JR2A 3P1IA 4ZY9A 5FUIA 2WZEA 4BDVB 3LQCA 4A44A 3BN6A 2E32A 4IUGA 3ZM8A 2JKXA 3SKVA 5B4NA 1JYWA 3ETPA 4MO3M 3IDAA 1UMIA 2VL4A 2KD7A 1EUTA 2YC4A 4P08A 4CU8A 2J1RA 2YG0A 1OH4A 3LEGA 1YQ2A 2VJXA 3NJVA 2WUHA 2VO5A 2VMFA 1UYXA 1PX3A 1NAEA 2Y8KA 1DYOA 1PMJX 2X09A 1K3IA 2WN3A 3HOBA 4QDRA 2YB7A 1O8PA 3VDAA 2J1SA 3MV11 1W9TA 2V72A 2VTFA 3ACHA 2Y6GA 1JHJA 2B4KA 3WNMA 5J1XA 5JXJA 3C7FA 3CZUA 3OGRA 4ET7A 3VD7A 1JYVA 3C8XA 1ULPA 3WF1A 4OUEA 4YPJA 1JU3A 1W9SA 2BGOA 1OD3A 4DXTA 4QX2A 4LQRA 2W1WA 3THCA 3OGSA 2ZXQA 2WAAA 2RVAA 1SDDB 2E26A 3VD4A 2VCBA 1JZ6A 2Y6KA 2CDOA 4W4ZA 3MBWA 3HEIA 3LEIA 3K46A 3OEAA 3T0DA 2Y64A 2R7EB 2V5DA 4DXSA 2RV9A 3K75B 3I2IA 5JMOA 4P00B 4BK4A 3I3BA 1JZ5A 3MUZ1 1UY3A 2XQXA 4LHSA 1J84A 3WF0A 3C7OA 4D0QA 1GU3A 4E8DA 1CX1A 1BHGA 3NQHA 2VZRA 3SEPA 3BGAA 4JHZA 2DDUA 3IIIA 3IB3A 3CKHA 2VZVA 2VZSA 2BZDA 3A22A 5EJZB 3UESA 1JU4A 3I3EA 4CU7A 4QDSA 4CVUA 3NNGA 2Z4FA 3GXUA 2ORZA 2QQOA 3WNOA 4MGSA 3HNYM 4A6OA 3NRUA 2X05A 2CDPA 3T0AA 2PQSA 4JX0A 4QB6A 1O8SA 4DEQA 1US2A 4HG6B 4A42A 3T2OA 1UX7A 3I2JA 1OT5A 1PX4A 2WQ8A 3NJXA 3MV01 1KEXA 3WNNA 2VOTA 3C7EA 2W1QA 3K4DA 1W0NA 1UYYA 5EIYB 1GOFA 1W99A 4ZZ8A 2L9LA 4QB1A 3A7QA 1JZ4A 3LPGA 2VMCA 2VC9A 3T2QA 5CYYA 2VZQA 5IJRA 1GMMA 3AC0A 2WO2A 4ARYA 4MADA 3UNPA 3GDBA 2VMDA 3I2FA 4A41A 2VQUA 3D3AA 3VDCA 1WCQA 2WYSA 5IFPA 3SEEA 5JXIA 1F4HA 4KWUA 2W92A 4OYUA 2HLEA 2E31A 2W1UA 3WQBA 2LS6A 1MPXA 4XUNA 1CZVA 2VM9A 1UXZA 3EYPA 4XUTA 3OEBA 1SG3A 4CU9A 4DEVA 1CZTA 2JDAA 5A1AA 2J1EA 2QQNA 3CIHA 4AG4A 1NKGA 5C71A 1DLCA 5JXHA 3SKJE 3WNLA 4ZXEA 4PT6A 2VMEA 2QQIA 4AAXA 2YFZA 1L7RA 3DYOA 1US3A 3C7HA 3CZJA 4W8JA 2W46A 4XVHA 4LPLA 4P02B 4XZUG 1UY0A 2WBKA 1UXXX 4JKKA 3IAQA 4GWJA 4XUOA 5IYYA 3PUIA 3I97A 1CZSA 2J22A 4E8CA 2WO1A 2Y6LA 5DN2A 4M4RA 2W47A 2WN2A 1UY1A 1KGYA 2Y6JA 4BK5A 1W8OA 1D7PM 2OKXA 1JYXA 4Z2AA 2VZPA 4QX0A 1TG7A 3K4AA 3HJRA 4DUXA 2W94A 4L0PA 3W5MA 3PUHA 3K4ZA 1W8NA 2VZTA 2W87A 4DUWA 3E1F1 4MOAA 5F7UA 1UWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C7G A;  5G04 L;  3I2H A;  3T0B A;  2VQT A;  4PF1 A;  2JD9 A;  1UYZ A;  4CUA A;  2W95 A;  3WF4 A;  1HN1 A;  4KI5 M;  3ECQ A;  1SHW B;  1J83 A;  3ACF A;  4CU6 A;  4XUQ A;  5B4X A;  3WNP A;  4BJ0 A;  5LA2 A;  3THD A;  4W50 A;  1XNA A;  2VR4 A;  3LEK A;  2WO3 A;  3VD9 A;  4P5Y A;  3FHQ A;  1GOH A;  3OBA A;  2QQL A;  2EIE A;  1LNS A;  4BXS V;  2W5F A;  1RYY A;  2B9V A;  4XUR A;  2YC2 A;  4GWI A;  4A4A A;  2W9X A;  3EB7 A;  3FN9 A;  4ZZ5 A;  1F4A A;  1NUK A;  1UMH A;  2EIB A;  2QQM A;  2ORX A;  4KMQ A;  3WF3 A;  2XOM A;  1DP0 A;  4RYD A;  1GQP A;  2YFU A;  2EIC A;  1JZ8 A;  3MUY 1;  3WSO A;  5JXG A;  4QX3 A;  1OF4 A;  2ID4 A;  5HPO A;  1P8J A;  2W1S A;  5DMY A;  1W9W A;  4OMC A;  4DUV A;  1UZ0 A;  2C4X A;  2VCC A;  3WEZ A;  1CIY A;  4UAP A;  4A3Z A;  2XON A;  2J1U A;  3VD5 A;  2HYX A;  1H6X A;  4QX1 A;  2X10 A;  1O59 A;  1XPW A;  1ULO A;  2J1A A;  2WDB A;  2E33 A;  3WF2 A;  4LKS A;  2VZU A;  4A45 A;  1GOG A;  3VD3 A;  4QPW A;  3A21 A;  4UOJ A;  4ARX A;  2JE8 A;  4XUP A;  3GGL A;  4RN5 A;  5JUV A;  4QDQ A;  3P6B A;  5C70 A;  1K42 A;  3FL7 A;  4JKL A;  5DQ0 A;  3ABZ A;  3JXS A;  3LE0 A;  1JYN A;  1PMH X;  3IAP A;  2VCA A;  5G05 L;  3LPF A;  3T08 A;  3K77 A;  2ZEX A;  5EJ1 B;  3I2G A;  4FI9 A;  3HPN A;  2RJ2 A;  1T2X A;  3DYM A;  4M4P A;  5LA0 A;  2ZEY A;  3MO4 A;  5IFT A;  2XHN A;  2VZ3 A;  2DCK A;  1UY4 A;  5C7G A;  5HXM A;  1H6Y A;  2W3J A;  5DPN A;  2C26 A;  3DEC A;  5IHR A;  3DYP A;  2BBA A;  5I0D A;  3CQO A;  1K12 A;  4OMD A;  1EUU A;  3J7H A;  3OB8 A;  3ACI A;  1NX9 A;  3GM8 A;  1GNY A;  3HNB M;  1GUI A;  4QB2 A;  1XNT A;  3F2Z A;  2QBX A;  2BGP A;  2J1T A;  5CZK A;  2ZEW A;  3T09 A;  2VZO A;  3UET A;  1JZ2 A;  3U37 A;  1JI6 A;  4CUC A;  4TXW A;  3CDZ B;  1OF3 A;  2EID A;  2W91 A;  2V4V A;  3OG2 A;  1WKY A;  2VZ1 A;  1IQD C;  3WNK A;  2QQK A;  2DCJ A;  3I2K A;  2C9K A;  2WAO A;  4D8M A;  5LCW L;  3FHA A;  4OZO A;  2Y6H A;  2WZ8 A;  2QQJ A;  3OGV A;  1TVG A;  2LW8 A;  3I3D A;  1L7Q A;  1R64 A;  2J1V A;  4JKM A;  5LA1 A;  1K45 A;  3VDB A;  4TTG A;  2BER A;  4GZ9 A;  3A23 A;  4CUB A;  3HNM A;  4MGQ A;  3HN3 A;  2ZEZ A;  4DXR A;  3W5N A;  2J7M A;  1I5P A;  3CMG A;  4QAW A;  1JZ7 A;  2WAB A;  1XC6 A;  3T2P A;  4PQQ A;  4UI9 L;  1JZ3 A;  1UY2 A;  3ACG A;  5JR2 A;  3P1I A;  4ZY9 A;  5FUI A;  2WZE A;  4BDV B;  3LQC A;  4A44 A;  3BN6 A;  2E32 A;  4IUG A;  3ZM8 A;  2JKX A;  3SKV A;  5B4N A;  1JYW A;  3ETP A;  4MO3 M;  3IDA A;  1UMI A;  2VL4 A;  2KD7 A;  1EUT A;  2YC4 A;  4P08 A;  4CU8 A;  2J1R A;  2YG0 A;  1OH4 A;  3LEG A;  1YQ2 A;  2VJX A;  3NJV A;  2WUH A;  2VO5 A;  2VMF A;  1UYX A;  1PX3 A;  1NAE A;  2Y8K A;  1DYO A;  1PMJ X;  2X09 A;  1K3I A;  2WN3 A;  3HOB A;  4QDR A;  2YB7 A;  1O8P A;  3VDA A;  2J1S A;  3MV1 1;  1W9T A;  2V72 A;  2VTF A;  3ACH A;  2Y6G A;  1JHJ A;  2B4K A;  3WNM A;  5J1X A;  5JXJ A;  3C7F A;  3CZU A;  3OGR A;  4ET7 A;  3VD7 A;  1JYV A;  3C8X A;  1ULP A;  3WF1 A;  4OUE A;  4YPJ A;  1JU3 A;  1W9S A;  2BGO A;  1OD3 A;  4DXT A;  4QX2 A;  4LQR A;  2W1W A;  3THC A;  3OGS A;  2ZXQ A;  2WAA A;  2RVA A;  1SDD B;  2E26 A;  3VD4 A;  2VCB A;  1JZ6 A;  2Y6K A;  2CDO A;  4W4Z A;  3MBW A;  3HEI A;  3LEI A;  3K46 A;  3OEA A;  3T0D A;  2Y64 A;  2R7E B;  2V5D A;  4DXS A;  2RV9 A;  3K75 B;  3I2I A;  5JMO A;  4P00 B;  4BK4 A;  3I3B A;  1JZ5 A;  3MUZ 1;  1UY3 A;  2XQX A;  4LHS A;  1J84 A;  3WF0 A;  3C7O A;  4D0Q A;  1GU3 A;  4E8D A;  1CX1 A;  1BHG A;  3NQH A;  2VZR A;  3SEP A;  3BGA A;  4JHZ A;  2DDU A;  3III A;  3IB3 A;  3CKH A;  2VZV A;  2VZS A;  2BZD A;  3A22 A;  5EJZ B;  3UES A;  1JU4 A;  3I3E A;  4CU7 A;  4QDS A;  4CVU A;  3NNG A;  2Z4F A;  3GXU A;  2ORZ A;  2QQO A;  3WNO A;  4MGS A;  3HNY M;  4A6O A;  3NRU A;  2X05 A;  2CDP A;  3T0A A;  2PQS A;  4JX0 A;  4QB6 A;  1O8S A;  4DEQ A;  1US2 A;  4HG6 B;  4A42 A;  3T2O A;  1UX7 A;  3I2J A;  1OT5 A;  1PX4 A;  2WQ8 A;  3NJX A;  3MV0 1;  1KEX A;  3WNN A;  2VOT A;  3C7E A;  2W1Q A;  3K4D A;  1W0N A;  1UYY A;  5EIY B;  1GOF A;  1W99 A;  4ZZ8 A;  2L9L A;  4QB1 A;  3A7Q A;  1JZ4 A;  3LPG A;  2VMC A;  2VC9 A;  3T2Q A;  5CYY A;  2VZQ A;  5IJR A;  1GMM A;  3AC0 A;  2WO2 A;  4ARY A;  4MAD A;  3UNP A;  3GDB A;  2VMD A;  3I2F A;  4A41 A;  2VQU A;  3D3A A;  3VDC A;  1WCQ A;  2WYS A;  5IFP A;  3SEE A;  5JXI A;  1F4H A;  4KWU A;  2W92 A;  4OYU A;  2HLE A;  2E31 A;  2W1U A;  3WQB A;  2LS6 A;  1MPX A;  4XUN A;  1CZV A;  2VM9 A;  1UXZ A;  3EYP A;  4XUT A;  3OEB A;  1SG3 A;  4CU9 A;  4DEV A;  1CZT A;  2JDA A;  5A1A A;  2J1E A;  2QQN A;  3CIH A;  4AG4 A;  1NKG A;  5C71 A;  1DLC A;  5JXH A;  3SKJ E;  3WNL A;  4ZXE A;  4PT6 A;  2VME A;  2QQI A;  4AAX A;  2YFZ A;  1L7R A;  3DYO A;  1US3 A;  3C7H A;  3CZJ A;  4W8J A;  2W46 A;  4XVH A;  4LPL A;  4P02 B;  4XZU G;  1UY0 A;  2WBK A;  1UXX X;  4JKK A;  3IAQ A;  4GWJ A;  4XUO A;  5IYY A;  3PUI A;  3I97 A;  1CZS A;  2J22 A;  4E8C A;  2WO1 A;  2Y6L A;  5DN2 A;  4M4R A;  2W47 A;  2WN2 A;  1UY1 A;  1KGY A;  2Y6J A;  4BK5 A;  1W8O A;  1D7P M;  2OKX A;  1JYX A;  4Z2A A;  2VZP A;  4QX0 A;  1TG7 A;  3K4A A;  3HJR A;  4DUX A;  2W94 A;  4L0P A;  3W5M A;  3PUH A;  3K4Z A;  1W8N A;  2VZT A;  2W87 A;  4DUW A;  3E1F 1;  4MOA A;  5F7U A;  1UWW A; 
#chains in the Genus database with same CATH topology
 4NAO A;  2YGM A;  4M01 A;  3ZXJ A;  4AEJ A;  1PNG A;  4ZU7 A;  2VVE A;  1WBL A;  1W8H A;  2IXJ A;  4AQ2 A;  1D0G A;  1QQP 1;  2VQT A;  4Y1V A;  1RUH 2;  5JLV A;  2BFU S;  2WZR 1;  1SLC A;  4QPI A;  5LBF A;  1OH3 A;  4GH4 C;  4LBJ A;  2QKD A;  5LY2 A;  4KI5 M;  4XDO A;  1SHW B;  3ACF A;  4CU6 A;  4XUQ A;  3MIG A;  1W6Q B;  2BNO A;  4XQW A;  1QJY 1;  3RJR A;  4A2U A;  4OHV A;  5T3N A;  4IW3 A;  3TAY A;  3VD9 A;  3HQX A;  1KIT A;  5T5J A;  3FHQ A;  3N9Q A;  1FMD 3;  2Y34 A;  4COV A;  3S5A A;  1W8W A;  1QXR A;  4PI2 A;  2WFF 3;  1PK6 C;  1L3J A;  1OOP C;  3O5S A;  4UFK A;  5EP9 A;  1BVP 1;  1DBN A;  3JD7 3;  3KT7 A;  3M3C A;  1JUI A;  1TMF 1;  1PHM A;  4BCU A;  1RUE 3;  2FDH A;  2PQQ A;  3EB7 A;  3LFM A;  4FPO B;  2Q8E A;  3KD4 A;  1H2K A;  2J42 A;  2Y33 A;  3E5Q A;  4QWN A;  1NCQ A;  2DVA A;  4BIS A;  4JGY A;  2P5B A;  4N8M A;  5FZK A;  2QQM A;  5JOX A;  4IE7 A;  5T5P A;  1R1A 3;  2WKK A;  4Q27 A;  1RUF 3;  1T6G C;  4CDX A;  2XOM A;  4UF0 A;  4AI9 A;  4FOW A;  1DP0 A;  2YHJ A;  4KG8 A;  1IKP A;  4CA9 A;  1OF4 A;  1XYO A;  2UY9 A;  4B8E A;  5HPO A;  1P8J A;  3NKT A;  1CQ9 A;  5DAX A;  5IUQ A;  3X29 B;  4EZ4 A;  2W1S A;  1VBC 1;  4OMC A;  4H14 A;  5JOW A;  1WA4 A;  2WWU A;  2Q8C A;  2ET7 A;  2R1D A;  2HWE 3;  2VBD A;  1LHW A;  3POJ A;  3QCW A;  2V4A A;  4COW A;  4CCE A;  4AI2 A;  1S2E A;  2A3W A;  1IGO A;  3WLU A;  5JPN B;  1HXS 1;  4IEX A;  1PK6 A;  1J1T A;  4CPB A;  3HN1 A;  2WQ4 A;  4A3Z A;  2J1U A;  5F32 A;  3LFI A;  5FUN A;  3VD5 A;  4I09 A;  1IPJ A;  1DU3 D;  3ZSE A;  3ZOI A;  5FYS A;  2X10 A;  3MIE A;  3CNA A;  3AKS A;  3SLI A;  3VBU B;  3OUH A;  5A6Z A;  3PU3 A;  2PFW A;  1V70 A;  2J1A A;  3KMH A;  3OOX A;  5FAX A;  2VZU A;  3FLT A;  1NCQ B;  2PHF A;  3ZVX A;  5CNA A;  4XJA A;  1ZBE 3;  4QXC A;  4CCN A;  1GOG A;  4AFM A;  5FO9 B;  3KCC A;  4GWN A;  4QPW A;  1UX6 A;  2P3Y A;  2TNF A;  4MX3 A;  5KXE A;  3H7J A;  5JUV A;  4LO8 A;  2ZGT A;  4WV8 A;  2QUO A;  3P6B A;  2P1B A;  1K42 A;  3FL7 A;  2YDE A;  3N7J A;  1W2N A;  4IV3 C;  2VU9 A;  1RUI 1;  4AFA A;  1H8V A;  3FJS A;  1GBG A;  1PMH X;  3P3N A;  1HRV 1;  4G3Y C;  2UWC A;  1AF9 A;  4CCJ A;  1JOD A;  4TN7 A;  2GU9 A;  2OX0 A;  4FBF A;  2ZTN A;  2R07 2;  1HB4 A;  2LUW A;  1O4Z A;  1U12 A;  2RJ2 A;  3HPN A;  3S0M A;  1QJX 1;  2ZMK A;  1N47 A;  4M4P A;  4WBB A;  5LA0 A;  1PK6 B;  3LGR A;  3MO4 A;  4FPC A;  2R06 1;  4N43 A;  2VZ3 A;  1UY4 A;  2QTW B;  5FY7 A;  1H6Y A;  2TEP A;  1UYP A;  2C26 A;  1BLZ A;  4RR3 A;  3VBU A;  4JV4 A;  4YVW A;  2UYB A;  1OXC A;  4OMD A;  1EUU A;  4UBH A;  1HV0 A;  1I1E A;  3VHP A;  1NX9 A;  1QNY A;  2BW8 A;  3BU7 A;  2AGS A;  3QOP A;  3O0W A;  1GZC A;  1R09 1;  1QJX 2;  4Q4Y 1;  5F39 A;  2ZAB A;  2GDF A;  1LOA A;  4C91 A;  1G7Y A;  5GZC A;  4NIA A;  2OUH A;  5A7N A;  3ZYH A;  3MW3 A;  1ACC A;  1ZZB A;  3LSD A;  5FZM A;  3L9J T;  4HMZ A;  1POQ A;  1A8D A;  1KJL A;  3TB0 A;  3U37 A;  5A3M A;  3TNQ A;  2ZGR A;  2ZGS A;  4CUC A;  1JZ2 A;  1VRB A;  5DXD A;  5IK8 A;  4CDU A;  4KWJ A;  2VZ1 A;  1UOB A;  3I3Q A;  5DAW A;  3AP4 A;  5J36 A;  1MVQ A;  2YXS A;  4H55 A;  3AM2 A;  5JOY A;  1WBF A;  5A33 B;  1Q8Q A;  4IV1 C;  1TNR A;  4CRQ A;  5C9A C;  3JD7 1;  4ZU5 A;  2RJK A;  1OLM E;  3KF3 A;  5KHK A;  1HN0 A;  3ITQ A;  3Q8B A;  4N43 B;  1OA2 A;  3WQ1 A;  4YG6 A;  2NPI A;  4OZO A;  2FD8 A;  2D40 A;  2B7Y A;  1AR8 2;  1PM4 A;  2XBO 1;  4WM8 C;  2AH2 A;  5D8A B;  2VOX A;  1V6M A;  3WP6 A;  4YVW B;  2ZHK A;  4CEY B;  3PUR A;  2LW8 A;  5F2W A;  3UV9 A;  5BY5 A;  4LKF A;  1L7Q A;  4UW6 A;  1R64 A;  2J1V A;  4JKM A;  4NO4 A;  4KGG A;  4NAM A;  1Z7S 1;  4R9B A;  3DKW A;  1BEV 2;  3SH4 A;  2YY1 A;  5HI0 A;  5FMO L;  1CAW A;  2BER A;  3HT2 A;  3A23 A;  4QM9 A;  4CUB A;  3ZXE A;  5FBJ A;  1RUH 3;  5C3S A;  1XNK A;  2OZ6 A;  4GB3 2;  2DVD A;  4K8R B;  1PGW 1;  3HN3 A;  2XKO A;  4HKO A;  4ITC A;  4MGQ A;  3LIG A;  2RJL A;  3ZYI B;  1PO2 3;  3A4U A;  5FMC A;  1GP5 A;  5FPB A;  1NA1 B;  1NE4 A;  3T2P A;  1LKN A;  4RD7 A;  4UI9 L;  4EJR A;  3PVO A;  4Q0V A;  2RM2 2;  3OY8 B;  2WZE A;  5F5I A;  5HCB A;  4AW7 A;  1LR5 A;  4D94 A;  2YPJ A;  1Z7S 2;  2VGD A;  1CGP A;  3GHN A;  4FFI A;  2ZHL A;  1W6M A;  2JKX A;  4JQT A;  2JIC A;  2XVG A;  3BOD A;  1BZW A;  2O1Q A;  2VUJ A;  3ETP A;  3PME A;  4Y33 A;  1W90 A;  4BLI A;  1H8T A;  3RQ0 A;  5JSR A;  3VZJ A;  1S0D A;  5D8A A;  4CCC A;  2JG9 C;  1MS0 A;  3JBG 1;  1C1F A;  4NN0 A;  1UU4 A;  5FMO S;  3NL1 A;  1RMU 2;  3KV6 A;  1UMI A;  2PMW B;  1R1A 2;  3LDK A;  1XE0 A;  1FPN 3;  5C9A A;  5FO8 B;  5J09 A;  2DCT A;  1RIT A;  2R07 3;  4CU8 A;  2HWF 2;  2VE1 A;  4LIU A;  1OQE A;  2VW0 A;  3ACL A;  3K2O A;  4NIH A;  4Q4Y 2;  1YQ2 A;  4LUM A;  2YBK A;  2WA3 A;  2VJX A;  1HRI 1;  5A3L A;  1LGB A;  4YG0 A;  3NAP C;  3N4M A;  2VO5 A;  1VE0 A;  2A6Y A;  1NA1 A;  1RL3 A;  1S0I A;  2VMF A;  1UYX A;  4NPR A;  1C57 A;  2BP6 A;  5E89 A;  1NAE A;  4CDU C;  2PA7 A;  1CAX A;  1VRH 1;  4HKW A;  4I3G A;  2JEN A;  1UN1 A;  1PMJ X;  2ZKL A;  1K3I A;  4Z2W A;  3K3N A;  4Q4V 1;  4BWO A;  2W52 A;  1B35 C;  3ZSK A;  3WW3 A;  4QDR A;  1OVS A;  4QX8 A;  2TBV A;  2VTX A;  2EVX A;  2W0X A;  3A0K A;  3LDB A;  4CDQ C;  2JE9 A;  3VBR C;  5A32 B;  2V72 A;  1WCU A;  1QNW A;  3OPW A;  2GP3 A;  4JDN A;  1SLB A;  5DAB A;  2Y6G A;  4K8F A;  4JQR A;  3SIT A;  1VMF A;  5BUV A;  1CX4 A;  3BYW A;  3MEP A;  3NWK A;  4OFG A;  5JXJ A;  3C7F A;  3CZU A;  3OGR A;  2Z2S B;  5LBC A;  1R08 2;  4RQP B;  1SDW A;  1ULG A;  2NQY A;  4WM7 B;  3WF1 A;  3WUD A;  1Y9G A;  3I7D A;  4Q4V 2;  3VL9 A;  1WCD J;  2G4I A;  3V0A B;  1OD3 A;  1SFY A;  4LE3 A;  5CKM A;  4DXT A;  2Q30 A;  2IVJ A;  3QH7 A;  4JRL A;  1YIF A;  3NAP A;  2WFP A;  2ZGP A;  5IVY A;  4LHK A;  1RUE 2;  5DAV A;  2D6K A;  4E2S A;  1EAH 3;  3ZMO A;  2ZML A;  3HVD A;  1W2U A;  4QKN A;  2E26 A;  3ZSM A;  4HT1 T;  1LED A;  1FXZ A;  2ZZJ A;  2VCB A;  2CU5 A;  1JZ6 A;  5K0U B;  4AQS A;  3R4U A;  4DY5 A;  5IVC A;  1Y4W A;  3PJQ A;  1YUD A;  1M4W A;  4OUS A;  3RZL A;  2Q4S A;  3WDX A;  1ZZ7 A;  4P5H A;  1C5H A;  2R7E B;  4KU7 A;  4IV3 A;  1TMF 3;  1E5I A;  3OD0 A;  1RVF 1;  4LTA A;  3T4H B;  2ZAA A;  3FUO A;  1D4V B;  3WVJ A;  4AI0 A;  4HVQ A;  4LUL A;  4RQP A;  4P00 B;  3WZ1 A;  3I3B A;  5CFC B;  3ZDS A;  3MUZ 1;  1WUV A;  1EP0 A;  1N3Q A;  2OS2 A;  3L2Y A;  4LHS A;  4WM8 B;  4YG3 A;  5TSW A;  4CDQ A;  4EWE A;  4IEQ A;  4Z07 A;  1BHG A;  4ZS3 A;  3R4D B;  3ZFE B;  3POE A;  1CX1 A;  3J7M A;  3SCF A;  3ZKY A;  2X29 A;  1CAV A;  4IER A;  2VZR A;  4KGQ A;  3BGA A;  4L2N A;  3POS A;  2Q1M A;  2VW2 A;  1X9T A;  1OLR A;  2DUO A;  3JUU A;  5LW9 A;  1DDL A;  1XXN A;  2BVB A;  4JHZ A;  3VZM A;  3NAP B;  5FZI A;  3WR0 A;  1WGP A;  1BMV 1;  1QOS A;  1QXP A;  5LWB A;  2P6C A;  2UYA A;  2V73 A;  3I3E A;  1A34 A;  4CU7 A;  2BOI A;  1VP6 A;  5ACA 2;  5K0U A;  5KR7 A;  2IUW A;  2HWC 3;  1UOG A;  2FBE A;  2ZGN A;  1HXS 3;  4GIQ A;  3SC7 X;  1PM7 A;  2OYZ A;  2QQO A;  2RS5 3;  4MGS A;  2F4P A;  2LAL A;  3UJQ A;  2Q1Z B;  1JS9 A;  2IWG B;  2ZGM A;  2UWB A;  2RG4 A;  1VBE 1;  4IV3 B;  2JDN A;  1FOD 2;  5GM0 A;  4BQW A;  1BK1 A;  2PQS A;  4QB6 A;  1JN2 P;  5I91 A;  3TWI A;  1O8S A;  1RHI 3;  4CCD A;  4XTP A;  4ERO A;  5CFC A;  1UW8 A;  4NPL A;  4Q4W 3;  5FYB A;  4J25 A;  4HG6 B;  3JB8 A;  4YW7 A;  4A42 A;  1STM A;  4BQY A;  3KT4 A;  1OT5 A;  3GZT B;  4P9W A;  4R9D A;  5FJK A;  4AHY A;  4XAE A;  4AGV A;  3MV0 1;  1KEX A;  1VBD 2;  1CAV B;  2PN5 A;  2ZAH A;  1RJ8 A;  1DF0 A;  4LE4 A;  1W0N A;  4IES A;  1W99 A;  2L9L A;  4FT8 A;  4P9L A;  3LPG A;  3U0Z A;  4BLJ A;  1RUE 1;  1MS3 A;  2FMY A;  1PIV 2;  5IJR A;  2FDI A;  4PBO A;  4QQO A;  4XTM A;  5A7Q A;  3E6C C;  4ARY A;  2EAA A;  3BPZ A;  4XJZ A;  3D82 A;  3GDB A;  2FZ1 A;  4PLO A;  4A41 A;  1PO1 1;  2VQU A;  4Q1R A;  3D3A A;  5CVR A;  1OA3 A;  4MGY E;  3BI3 A;  2E7Q A;  1QDC A;  3Q8A A;  3IT8 A;  2IXI A;  2VOW A;  4XXA A;  3VZN A;  1F4H A;  3WV6 A;  4B7E A;  5LY1 A;  1XSQ A;  2E31 A;  2W1U A;  3RG0 A;  3JU9 A;  4OVE A;  2WLQ A;  3AKT A;  3VLB B;  2D7F A;  1FX5 A;  2AR6 A;  1SBF A;  3DPR A;  3W59 A;  2GMM A;  1YJL A;  4YNI A;  3VBH B;  2BEO A;  4Q4Y 3;  2FMD A;  1YI9 A;  2IFR A;  1OPM A;  1XYN A;  1TQ5 A;  1ODM A;  1CZT A;  2XJR A;  2JDA A;  4FQZ A;  2FHR A;  3AP9 A;  4I0A A;  3H8X A;  2QQN A;  3LSE A;  4GAL A;  2VBB A;  1NKG A;  2A1X A;  1AR6 1;  2VD7 A;  4XXP A;  5AC9 3;  5C71 A;  3NW4 A;  2ARB A;  3DPR C;  1QOT A;  1RB8 G;  1FMD 2;  3MW4 A;  3WHU A;  5F9T A;  1V9U 2;  2XXZ A;  4LBQ B;  2G9G A;  4HAN A;  1QJY 3;  1W8U A;  3NJY A;  3C7H A;  3VN4 A;  1QGL A;  5FZD A;  4HKL A;  4RS5 B;  1ZM1 A;  2SBA A;  2PHL A;  5H9S A;  4LPL A;  1F15 A;  2NN8 A;  2O14 A;  1MZF A;  1UY0 A;  2WBK A;  4JKK A;  4LNV A;  4XHB A;  4KL1 A;  5L9B A;  2Z42 A;  3WIN E;  4E2G A;  5GJ6 A;  2GAU A;  3UKV A;  1AR6 2;  4D3W A;  4E8C A;  2HBT A;  1JYC A;  5DN2 A;  4EN7 B;  4D6S A;  1LGC A;  4U36 A;  5LBE A;  2BV4 A;  4FTE A;  1REF A;  3DPR B;  3J9S A;  4BQ4 A;  4ZKT B;  5IVF A;  5C4W A;  3VBH A;  3PJY A;  2QDN A;  5I8T A;  3I59 B;  2Y0I A;  3O0V A;  2OKX A;  4YZ4 A;  5A6Q A;  3ZR6 A;  4Q0P A;  2PTM A;  2R0H A;  1GQG A;  4QQ2 A;  4Y26 A;  1PO2 1;  1UPI A;  3MFC A;  4D7T A;  2EAL A;  4EN8 B;  1E5R A;  1G9F A;  1VBD 1;  2DUR A;  1SFN A;  1TG7 A;  3K4A A;  2VY0 A;  4L0P A;  4EN6 B;  3PUH A;  1VBB 1;  4PIZ A;  4C8D A;  3BB6 A;  1TME 3;  3UKN A;  2VTX J;  3MHZ A;  3C7G A;  4HN1 A;  2K0G A;  4ONU A;  2DVF A;  3THP A;  3U1X A;  4C1W A;  4PF1 A;  4RS5 A;  5IAV A;  4CUA A;  1BCX A;  1GSL A;  2XBO 3;  4UFI A;  4ZON A;  4DB5 A;  2JG8 C;  3VL8 A;  3WF4 A;  1HN1 A;  1R09 3;  5IVB A;  1RHI 1;  4Q5O A;  1CR7 A;  2HBU A;  4LIV A;  5B4X A;  2X53 S;  1HRV 3;  4MH0 E;  4P9I A;  4XCB A;  2RS3 3;  5LA2 A;  5L9V A;  1T6B X;  4W50 A;  1XNA A;  1W2A X;  4QHO A;  3LEK A;  1QOO A;  1EY2 A;  2E53 A;  4P5Y A;  2Y6F A;  4H7M A;  2XJT A;  2XUE A;  2QQL A;  3PNA A;  4A3X A;  2HWB 3;  2IXC A;  2KM2 A;  5A3N A;  1PMI A;  5C4W B;  4BXS V;  2W5F A;  4NHY A;  2B9V A;  3JQW A;  2RR1 3;  2V5Y A;  1AXY A;  1KDK A;  4N9I A;  4NE9 A;  1S0B A;  3AFG A;  4OI4 A;  2BTV C;  4P9X A;  4YM2 A;  2JDH A;  3DL3 A;  3IKW A;  2OQ7 A;  3RI9 A;  1E5H A;  1K5M C;  3GJB A;  4M3C E;  3ZO0 B;  4E4Z A;  4HFS A;  1N1S A;  1XU2 A;  4MGK E;  2A75 A;  2NM1 A;  2WS9 2;  5F3I A;  2G19 A;  4LKE A;  1GYK A;  1G6N A;  2C0Z A;  2JIJ A;  2ZX2 A;  3THT A;  4QQH A;  5K4L A;  1UIJ A;  4Y3O A;  5LBB A;  5C3R A;  5KC5 A;  4CCL A;  5JI9 A;  2DBI A;  1SZB A;  4D7Y A;  2A6X A;  4M3C A;  1RUI 3;  1IS4 A;  2ORX A;  3ORJ A;  1UNB A;  4YRD A;  3WF3 A;  5K0U C;  3PVB B;  3FFQ A;  2D6P A;  4RYD A;  1W2T A;  4YSF A;  2ETE A;  3WG3 A;  1RUF 2;  5K9Y A;  2EIC A;  4XF1 A;  1JZ8 A;  3ALQ A;  5FPZ A;  4J6G A;  4NID A;  2YMZ A;  4EWD A;  2WA4 A;  3GBG A;  1SBD A;  3SNM A;  5FYY A;  2BNM A;  1W6P B;  5FP9 A;  2PLV 2;  3RZH A;  1Q5O A;  1UZ0 A;  2VCC A;  3MF9 A;  3MFA A;  2FDJ A;  4EN0 A;  5JIU A;  2YZ4 A;  1VB4 A;  3KVA A;  1JOP A;  4UBG A;  2Q0A A;  4UAP A;  5L36 A;  4BYY A;  1ZBA 1;  5F3E A;  3AJZ A;  1AUY A;  3MPB A;  1Y43 B;  3M1H A;  2GN7 A;  2HYX A;  1AR8 1;  1TNF A;  2XBO 2;  4K21 A;  3WW1 A;  3NNF A;  4QGM A;  5E88 A;  1SBE A;  4FPL A;  1XPW A;  1GWM A;  1ULO A;  2RDN A;  2WDB A;  2WO7 A;  3NV4 A;  4LA3 A;  4FFH A;  2W39 A;  3PVE A;  5FQ0 B;  3FBY A;  1Y9M A;  5BNN C;  2A70 A;  3FC0 A;  5D1I A;  5JAX A;  1SAC A;  3AMQ A;  1WLT A;  2MEV 1;  5F1R A;  4XIL A;  4UOJ A;  4GB3 1;  3APB A;  1YYN A;  4XOG A;  1ZNP A;  3GGL A;  4NVP A;  2UUR A;  4Q0S A;  1AHS A;  4K6B A;  4QDQ A;  1YQ6 A;  3SHR A;  1J1L A;  4IV1 A;  3WUC A;  5C70 A;  4DIN B;  4URA A;  1QWR A;  1FI2 A;  3ABZ A;  5DQ0 A;  1C8M 2;  2DUQ A;  4B4P A;  2GC0 A;  3WOG A;  4CCK A;  4HOO A;  2VCA A;  5G05 L;  4ZXK A;  1U5I A;  5EJ1 B;  5FO7 B;  2R16 A;  2RS1 1;  5IK4 A;  3M3Q A;  2D98 A;  1R09 2;  1UZZ A;  4FQ4 A;  4U2A A;  3DYM A;  5FZ8 A;  2HWE 1;  2YBP A;  1W8Z A;  2MEV 2;  1RUG 2;  3ZYB A;  1DQ5 A;  1H1M A;  1UAI A;  1KFX L;  2XHN A;  4LOR A;  1C5I A;  1RUJ 2;  2DCK A;  5HXM A;  1H1I A;  1K5M A;  4AVS A;  2YC0 A;  1VRH 2;  1JBC A;  3HBZ A;  2F6B A;  3H8U A;  3DYP A;  2BBA A;  1RTV A;  3D0S A;  4C90 A;  2V09 A;  3I2D A;  3PUS A;  2DVG A;  1EV1 2;  1ULC A;  1FPN 1;  5A7P A;  3GM8 A;  5FQ0 A;  3ZFG B;  5AVA A;  4YZ1 A;  3NV1 A;  5B2G B;  1W2O A;  2PHD A;  4HZF A;  5HCA A;  1GUI A;  2VUD A;  3IMM A;  3ZIW A;  5FYH A;  1XNT A;  2KR2 A;  1V6O A;  1CVN A;  1DGL A;  1BYH A;  1OKO A;  1ULE A;  2QBX A;  1NE6 A;  5T54 A;  1W0O A;  1MEC 2;  1YI7 A;  1DGW A;  5CZK A;  1XRU A;  1RUJ 1;  2ZEW A;  5DDJ 1;  2C5D A;  3QBQ A;  5CAD A;  1HJG A;  3AMH A;  4O9E A;  3UET A;  1B35 B;  1JI6 A;  4LJH A;  1LHU A;  1OF3 A;  2EID A;  3CDZ B;  1QIQ A;  1W04 A;  3M3E A;  2V4V A;  4RL7 A;  4MLO A;  4QD2 A;  4W6W A;  5FZ0 A;  2HWB 1;  3ASI A;  5D8A C;  1SFP A;  1G9D A;  1FPN 2;  5LEJ A;  5FV3 A;  1LOD A;  2WSU A;  1ODN A;  2QQV A;  4K3U A;  5FYU A;  1LOG A;  1IQD C;  4XFH A;  1V0A A;  2DU1 A;  2XVK A;  2ARX A;  4S2G A;  3WNK A;  5C8C C;  5FP3 A;  1KD7 A;  3PUA A;  3ZPO A;  3AYA A;  1ZBA 2;  3R6S A;  2WAO A;  1PGS A;  4NR1 A;  3MLK A;  5ACA 3;  5L7O B;  3FHA A;  2EIG A;  3E6B A;  2ZHM A;  3IWZ A;  4LHL A;  4PJY A;  1MS5 A;  3FFZ A;  2ADD A;  3NNL A;  4QXH A;  4EZH A;  2ZS6 B;  3SIS A;  2XJQ A;  4AR2 A;  5IAX A;  1GNH A;  2QQJ A;  3OGV A;  1TVG A;  3JQX A;  4L8Q A;  5DG1 A;  1DQ6 A;  5IK7 A;  4MUV A;  4P9J A;  1K45 A;  4AWD A;  5LA1 A;  3I49 A;  3VDB A;  4M0H A;  4TTG A;  2ZPX A;  1X8M A;  2DUP A;  4GZ9 A;  4XW3 A;  5LA9 A;  1EAH 2;  2VXR A;  2WQZ C;  3LIH A;  4IE0 A;  3W5N A;  1RVF 2;  1J3P A;  1VBD 3;  1ONA A;  3PMS A;  1W3X A;  4XAA A;  5CEH A;  1V6K A;  5GZG A;  2AEN A;  2EA7 A;  1PIV 3;  3FX3 A;  3GF6 A;  4DXZ A;  1C8M 1;  4I01 A;  2WAB A;  1XC6 A;  5HBA A;  1JZ7 A;  3WP4 A;  3IBM A;  4PQQ A;  5C33 A;  1JZ3 A;  3ACG A;  1S0F A;  2Z69 A;  5JR2 A;  1RC6 A;  4KG0 A;  4ZY9 A;  5FUI A;  5FY0 A;  1QU0 A;  3CO2 A;  2HWF 1;  5C8W A;  3BN6 A;  2E32 A;  3L2H A;  4IUG A;  2ATF A;  5FZ6 A;  4JDM A;  1FV2 A;  2ZGO A;  4ORF A;  1D2S A;  5IVJ A;  3SKV A;  1S1A A;  3ZXL A;  3VBR A;  1HRI 2;  4QXK A;  5FZO B;  4AOC A;  1YFX A;  4HLT A;  2JDY A;  1X36 A;  2D6M A;  1VB2 A;  3KLS A;  2D6N A;  2YUE A;  3ZYF A;  2VNG A;  2BRT A;  5ACA 1;  1RUO A;  1REE A;  4JZR A;  3Q8E A;  4H2A A;  4EV0 A;  2O8O A;  5FDB A;  5FKB A;  4UW4 A;  1VBE 3;  2K46 A;  5JSO A;  1XNB A;  2YGL A;  4Q8L A;  3W21 A;  4ES9 A;  4IE6 A;  1GV9 A;  1Y3T A;  2ZGK A;  2ZJC A;  4BQ1 A;  4PDW C;  3MLJ A;  3Q8F A;  5LEK A;  3OBR A;  5CA6 A;  1H30 A;  4CYD A;  3OD4 A;  2QFE A;  2WUH A;  3VUO A;  4A6S A;  2JXA A;  4MET A;  4L97 A;  1OD5 A;  2CL2 A;  2A6V A;  2PLV 3;  2VVD A;  4DOU A;  1PX3 A;  1QJX 3;  4UFL A;  3B94 A;  2JEM A;  4FOV A;  4HPK B;  4TZD A;  2JX9 A;  2X09 A;  1AYN 1;  4CDW A;  2XDV A;  4CP9 A;  1OQ1 A;  2UY8 A;  2WN3 A;  1ZRF A;  2XLF A;  1IKQ A;  1YFU A;  1Q3E A;  5FZE A;  2D44 A;  1QJY 2;  3AP5 A;  4WVM B;  4WM7 C;  4CDX C;  2OA2 A;  3I2O A;  4ES8 A;  4FTB A;  2XJS A;  1OC1 A;  1MQT A;  4JVA A;  5F6K A;  5JWP A;  1HKD A;  1IOA A;  4YZ3 A;  2CAU A;  3O1O A;  3O14 A;  1JHJ A;  3QD6 A;  1KFU L;  2B4K A;  3HR9 A;  4IE5 A;  1O7F A;  4XDP A;  3WNM A;  4CUG A;  5J1X A;  1VIW B;  3AVR A;  5FKC A;  3BUC A;  1G9C A;  2E9Q A;  3NST A;  5T5L A;  3VKM A;  1IS3 A;  3A0N A;  4CP1 A;  2ZX1 A;  5J7M A;  1ZRR A;  3VD7 A;  4YW6 A;  3NKG A;  4GQ7 A;  5FYI A;  4Y1Y A;  1YQC A;  3I54 A;  4OUE A;  1JU3 A;  1SQ4 A;  5A7O A;  4XPV A;  5A7W A;  4IEO A;  1ZRE A;  4FPF A;  4I02 A;  2ZBJ A;  3VBS B;  3LOB A;  3OGJ A;  3S7E A;  4Q2F A;  1YFY A;  3LA3 A;  1UCX A;  2IFW A;  2R06 3;  1C1L A;  4LQR A;  3THC A;  4XEZ A;  1DIW A;  1RUD 3;  2JE7 A;  1WA6 X;  3LDR A;  5KHG A;  3AYC A;  3VBF C;  3O7O A;  5C3O A;  1KRI A;  4HXC A;  3D6E A;  3RWK X;  5DUX A;  1POV 1;  4QPI B;  1PVC 1;  1S0E A;  4YWA A;  4HPK A;  1OLM A;  3LOI A;  4JGZ A;  3F95 A;  2RDQ A;  3U75 A;  2Y6K A;  4FPJ A;  1F9K A;  1LHV A;  1VBC 3;  2XWJ B;  3MIH A;  4M00 A;  4RGK A;  4W6X A;  4FAG A;  3RYP A;  1S2B A;  4S2D A;  2OXB A;  5FP4 A;  2PHR A;  3ZFF A;  1AX1 A;  1W3V A;  1MQT C;  1VRH 3;  2VOV A;  1ULD A;  4ISR A;  4AGG A;  5CG9 A;  2NMN A;  4DXS A;  4DQA A;  4YZ5 A;  2GP5 A;  1VJ2 A;  3I2I A;  5DUW A;  5JMO A;  4LBK A;  1DZR A;  4BH9 A;  4BK4 A;  1YNA A;  1JZ5 A;  1UY3 A;  2P3J A;  2XLG A;  1RUC 1;  2XQX A;  3UT0 A;  5J96 B;  4LA2 A;  1GU3 A;  3B69 A;  2HEV F;  3ZFF C;  4UFJ A;  5CFD A;  2W68 A;  2CAV A;  3VBS A;  2PHU A;  3LZZ A;  3VHO A;  4RFT 0;  4GMP 1;  1VBE 2;  3RPQ A;  3POY A;  3S7I A;  1RXG A;  5EZW A;  2AAC A;  2VZV A;  3CKH A;  1GZW B;  4UF0 B;  4XFF A;  4YLZ A;  4XF4 A;  3O1R A;  1GZT A;  5KHJ A;  2VZS A;  3A22 A;  3UES A;  1SCR A;  4OHZ A;  5C3Q A;  4KU8 A;  1KQR A;  1XE8 A;  3WXP A;  5FZL A;  1U5Z A;  2Z5W A;  2I07 B;  4DFS A;  1WLC A;  3AFK A;  3UK9 A;  4OHX A;  4CVU A;  2JJ6 A;  3USU B;  3FBM A;  4AED B;  1QH6 A;  3HT1 A;  1PVC 3;  5EYX A;  1N3O A;  4UFH A;  3EJK A;  1G86 A;  4PHZ A;  3O1P A;  1SLL A;  4BE3 A;  3DXU A;  2JWP A;  3H8O A;  2VQA A;  4A6O A;  1IG0 A;  2X05 A;  1ENR A;  1QMJ A;  4OLL A;  4AXO A;  4JX0 A;  2WT2 A;  1GKB A;  2FCV A;  3WDU A;  2IVI B;  2P3K A;  4B1L A;  2WJS A;  3AXE A;  4LUK A;  5FR3 A;  1UO9 A;  3UGH A;  1WZX A;  4IEW A;  2VQ0 A;  5A3U A;  1US2 A;  1W8F A;  2JG9 B;  2PXJ A;  3T2O A;  1ND2 B;  1UX7 A;  2ZGL A;  3I2J A;  2XG3 A;  1PO2 2;  1PX4 A;  2MEV 3;  2WQ8 A;  4HL0 A;  3WNN A;  4AFD A;  4R9A A;  2VOT A;  4LBL A;  5C6C A;  3N7L A;  4E4S A;  4AQT A;  3K4D A;  3ZIX A;  3FUQ A;  4AZZ A;  2GH2 A;  4LLF A;  4GJZ A;  2RM2 3;  4ZZ8 A;  4QB1 A;  4COY A;  2Z79 A;  3A7Q A;  1JZ4 A;  2AEY A;  1NCR A;  2Q5T A;  2VMC A;  2VC9 A;  1SPP B;  4LR4 A;  3T2Q A;  1D2Q A;  1GMM A;  3KGL A;  3J8F 1;  4N53 A;  1WCK A;  2OQ6 A;  1S0G A;  4IEU A;  5A6X A;  4B4Q A;  2VMD A;  1H4H A;  2ADE A;  2WRA A;  3SMH A;  3USU A;  2A6W A;  3B3Q E;  4AED A;  2WNV A;  5L73 A;  1WCQ A;  3RMX A;  5IFP A;  5FLJ A;  1JHN A;  2W92 A;  2HLE A;  4HN0 A;  4IGP A;  3WQB A;  4AFC A;  2LS6 A;  4ZS2 A;  1MPX A;  3B93 A;  4NUB A;  4XIO A;  5LZ6 A;  2VUA A;  1HQN A;  5HV4 A;  1CZV A;  2W2I A;  2BOJ A;  3EYP A;  2Q1F A;  4QQL A;  1AR7 1;  4LLO A;  3N9M A;  5KC6 A;  1XSR A;  5KXB A;  2GAL A;  2D97 A;  5A3W A;  3OEB A;  1ND2 A;  3P5B A;  3V56 A;  4DEV A;  1VBC 2;  1LU1 A;  4YM0 A;  1U0A A;  2J1E A;  1BEV 1;  2JD4 A;  3ME2 A;  1ZBA 3;  4AAP A;  1LOF C;  2Y38 A;  1DLC A;  1NCR B;  1YIP A;  4KWK A;  2QQI A;  2YFZ A;  1L7R A;  2B8M A;  1AR7 2;  1US3 A;  5FMB A;  4CXW A;  4DNY A;  2GSY A;  2P2K A;  2W46 A;  2EXI A;  2RR1 2;  5FTT C;  5F2S A;  4PQ9 A;  3DV8 A;  1O4T A;  3KSC A;  4HSL A;  3IDB B;  2EXH A;  5JPM B;  4N9H A;  1LUL A;  1PZ9 A;  1PO1 3;  2PLV 1;  5F3G A;  5FIX A;  4LO6 B;  5A33 A;  3MPP G;  2HEW F;  4AI3 A;  5DAP A;  5IYY A;  3BTY A;  4D69 A;  4NIG A;  3N35 A;  1IS6 A;  1PGL 2;  5JI7 A;  1QJU 2;  4GXL A;  2QQP A;  3VV1 A;  1DQ4 A;  2PHT A;  2XML A;  1LHO A;  2WN2 A;  4CXY A;  1I6X A;  3B9I A;  1GAN A;  1SLI A;  4GAZ A;  3E97 A;  3KZ4 C;  4XFB A;  5L9R A;  4MXW B;  2CY6 A;  1D7P M;  4NHM A;  4OI2 A;  4YM1 A;  1AR8 3;  1AR9 3;  2X5I A;  5JR7 B;  5FZ7 A;  2ARA A;  1JYX A;  3RYK A;  3BTX A;  1YFW A;  4H3W A;  3PTY A;  3S6P A;  4RS5 C;  4XC9 A;  4XET A;  3WP5 A;  4BHP A;  4YGD A;  2ZKN A;  5I93 A;  1NZC A;  2BNN A;  2W87 A;  4X8P A;  1B09 A;  5FZ9 A;  5I0R A;  4LOT A;  4MOA A;  1IG3 A;  1QXJ A;  1UWW A;  4GA9 A;  3U14 A;  1MS4 A;  2DFB A;  2D43 A;  4PI0 A;  1FAT A;  2HWF 3;  2IZW A;  1AYM 2;  2JD9 A;  1UYZ A;  3GZE A;  3RI8 A;  2VVF A;  1ND3 A;  2W95 A;  1J83 A;  3VHN A;  3ZXG A;  4BJ0 A;  1SEF A;  1CPN A;  1D4M 3;  2DCY A;  4GKX A;  2ILM A;  4CCO A;  3WNX A;  3THD A;  1IPK A;  3JZV A;  3QH6 A;  1KJR A;  1W6M B;  2VR4 A;  1O6U A;  2PHW A;  4IND A;  4LBM A;  4QPG A;  3T2T A;  3WX5 A;  5A6Y A;  2XPJ A;  4IEY A;  1Y7B A;  1DQ1 A;  3OBA A;  4UWD A;  3VDD C;  4P9G A;  2EIE A;  1H8T B;  2YYO A;  5GLV A;  4R52 A;  4MXW A;  3VKO A;  1RUF 1;  4F7Z A;  4FOY A;  2X5I B;  1DYP A;  4GWI A;  2W9X A;  3V0B B;  3QAC A;  1LEC A;  1W8T A;  2HEY F;  4A7K A;  2KA3 A;  4QM8 A;  1N1T A;  1WD4 A;  3GJA A;  5LK5 A;  3ST7 A;  5DG2 A;  1EV1 1;  2A3X A;  3FN9 A;  5FXV A;  1NUK A;  2E7T A;  3CLP A;  1UU6 A;  1AR6 3;  2GNM A;  3BKZ A;  2GMP A;  3C3V A;  5DZF A;  5ABJ A;  3N7K A;  3H50 A;  3KHC A;  2VUL A;  1A78 A;  2VMH A;  5T52 A;  3N36 A;  4MHR A;  4X6R B;  1MEC 1;  4B3N A;  1S2K A;  5FK8 A;  4D6Q A;  2RS1 3;  1CAX B;  2CWM A;  1ND3 B;  3MUY 1;  2K9Z A;  4QX3 A;  4RA0 A;  5JXG A;  5KHI A;  4QXB A;  1HW5 A;  2A3Y A;  4CPB D;  5DMY A;  1W9W A;  2D3R A;  4FFF A;  4AI1 A;  4AYU A;  1X8E A;  5FY4 A;  1PVX A;  3WEZ A;  4QPG B;  2R6Q A;  3TYJ A;  4MGZ E;  5GZE A;  5JZG A;  1V6L A;  1BVV A;  1KDM A;  5AVP A;  4O7X A;  4LO7 A;  2WIN B;  2FDK A;  1CON A;  3AMP A;  2X8K A;  1CPM A;  1OVP A;  4N43 C;  1G9A A;  3J8F 3;  2PAM A;  3S5Q A;  1H6X A;  3J7N A;  3J4U H;  4LBO A;  4TWT A;  1W6N A;  5CKQ A;  1O59 A;  2LTN A;  3KVB A;  3EMR A;  4XF3 A;  5EV7 A;  4YW1 A;  5FFO C;  1W28 A;  5JVV A;  2E33 A;  1RJ7 A;  2R49 A;  4LKS A;  1BKZ A;  4UYB A;  4WZC A;  3V0A A;  3D8C A;  3Q8C A;  1YHF A;  3ZXA C;  2R04 2;  4XF0 A;  4Y22 B;  3VD3 A;  1OPO A;  1TZO A;  2OW4 A;  2HWD 2;  4W6Y A;  5BNP A;  1TME 1;  1W9F A;  1X33 A;  3KGZ A;  5FP7 A;  2JE8 A;  5J3U A;  1KS4 A;  4XUP A;  2YU1 A;  3AJY A;  3C2U A;  4XFG A;  4URT A;  1IS5 A;  1VBA 1;  3LD8 A;  4GH4 B;  4JKL A;  1LAJ A;  3JXS A;  3AK0 A;  1R1A 1;  4RHV 1;  4DMI A;  1NYW A;  4DPN A;  1JYN A;  4LBQ D;  2BJS A;  5HCH A;  3IAP A;  3V65 A;  3T08 A;  3K77 A;  3B7M A;  3MID A;  1QKQ A;  4DRR A;  1N1V A;  2H6B A;  1T2X A;  4ASM B;  4AHX A;  3DEM A;  1G8W A;  3TEX A;  2ZEY A;  1VAM A;  2VNR A;  3M3I A;  4NII A;  4PIY A;  2VXJ A;  5IFT A;  2XJU A;  3ZSL A;  5H9Q A;  4AEM A;  4AI8 A;  5C7G A;  4HK8 A;  2W3J A;  4QQP A;  4OQ9 A;  5I8Y A;  5DPN A;  1W6N B;  1H8T C;  4WM8 A;  5FJH A;  5IHR A;  1EV1 3;  2B39 A;  5F8P A;  5FPA A;  5IWF A;  1K12 A;  3Q9O A;  3ZFE A;  2QDR A;  1JOJ A;  1COV 2;  3J7H A;  3NV3 A;  2JEC A;  5LAS A;  4QPY A;  3UKT A;  1GNY A;  1UL9 A;  4Y22 A;  5FLI A;  1MZ5 A;  4YW4 A;  3GZU C;  3W58 A;  3HNB M;  1NQD A;  2F17 A;  4XZP A;  5CIS A;  3F2Z A;  4QU1 A;  2DCZ A;  3R05 A;  2BGP A;  1UIK A;  2J1T A;  4OUL A;  1LEN A;  4AF9 A;  3T09 A;  1V6J A;  5BYN A;  4NRM A;  4IET A;  1QJU 3;  4LKD A;  1FNY A;  1W9Y A;  2C9A A;  1AJK A;  3AMN A;  4PF5 A;  3SH5 A;  4BOW A;  1WKY A;  1PO1 2;  5E6H A;  1YLL A;  4KNC A;  3M70 A;  3PTR B;  4AVT A;  4YW5 A;  4COZ A;  2BWA A;  4XFA A;  1AR9 2;  2P6H A;  3IN9 A;  4NPM A;  4PIX A;  2QQK A;  2DCJ A;  1NG0 A;  1URX A;  1XJA A;  5FYT A;  2C9K A;  4YVS A;  4D8M A;  2RE9 A;  5LCW L;  4XHX A;  1AX2 A;  3VZO A;  3PDQ A;  2N7G A;  1AXK A;  2XR4 A;  2Y6H A;  4LK6 A;  4RR3 C;  5LRS A;  5FOB B;  3OUJ A;  2JIG A;  2G9F A;  2SLI A;  3CL1 A;  3CEW A;  4GWM A;  1JW6 A;  4J1W A;  4DY3 A;  1LEM A;  5IW0 A;  4FOQ A;  3I3D A;  1V9U 3;  1BEV 3;  2VBP A;  3WD5 A;  4ZPI A;  5FXW A;  3B02 A;  2PYT A;  1LRH A;  2QNK A;  5EXO A;  2RS5 1;  2QE3 A;  3SQO A;  2IXL A;  2JDK A;  3N9P A;  3VDD A;  4R4Z A;  1FMD 1;  2H0V A;  1UZV A;  4BME A;  4F3J A;  4P14 A;  4DXR A;  3T4V A;  3H1M A;  4FSJ A;  1YXW A;  3HIF A;  4YVW C;  4TYS A;  4AVV A;  4YZ2 A;  1I5P A;  1MS8 A;  3CMG A;  5LK7 B;  2FCT A;  2OT7 A;  2RHP A;  4E4D X;  5CU1 A;  3AXD A;  1LJ7 A;  2PEL A;  1AYN 3;  1J59 A;  2I45 A;  1UY2 A;  1ZZ8 A;  1H2M A;  1BK0 A;  1D4M 2;  3ATG A;  4BDV B;  5F5A A;  1H2N A;  4ASL A;  4COU A;  3UJO A;  5T55 A;  1AXZ A;  1W6Q A;  3FLP A;  5F5Q A;  4IE4 A;  4K1Z A;  3B5L B;  3ZM8 A;  1J3R A;  2YRO A;  3ROU A;  3SCG A;  1W39 A;  4XBQ A;  3ZN4 A;  5JIA A;  2BU9 A;  2XJV A;  4WVW A;  4MO3 M;  4YVS B;  3SCH A;  4C0H A;  1N1Y A;  4CP0 A;  3CBN A;  4Y4R A;  2CWS A;  2DTW A;  2VNV A;  2FZ2 A;  5BNQ A;  5C8C A;  3LAG A;  2MHF A;  2GNT A;  5CB7 A;  2B9U A;  3WW4 A;  4Z82 A;  3HMY A;  1HB2 A;  1NXM A;  2KD7 A;  2YU2 A;  1EUT A;  4Q4X 1;  1HQW A;  3NO8 A;  4P08 A;  5D21 A;  4Q8K A;  4HSJ A;  2J1R A;  4YVS C;  4W65 A;  2JG8 B;  2YG0 A;  3K48 A;  4DRV A;  3VDD B;  1QHD A;  3AL6 A;  3M4F A;  1ZRC A;  2D5H A;  4JGY B;  3EO6 A;  2XQR A;  4GMP 3;  3NMB A;  2XKP A;  3IDE A;  4UT5 A;  2Y26 A;  5T5O A;  1ZZ9 A;  3NJV A;  4LBQ A;  4CDX B;  2HWC 2;  4JCK A;  4NOT A;  5CBL A;  4AGR A;  3KWV A;  1CES A;  5FRE A;  2Y8K A;  1DYO A;  1RHI 2;  4FP2 A;  4XE9 A;  1J3Q A;  4Y4Y A;  4Q4X 2;  2WLP A;  1F5J A;  5I0T A;  3HOB A;  1LES A;  4FPK A;  1AR9 1;  3KV5 A;  3MI8 A;  3WW2 A;  3ES1 A;  4J1X A;  1Z0H A;  5L7O C;  1A3K A;  3MIB A;  2IXH A;  1X82 A;  1UU5 A;  2A7A A;  2HKX A;  3K51 A;  3J8F 2;  5BXX A;  5C8C B;  1A8M A;  3AYE A;  4AVB A;  1VAL A;  2CYF A;  5CFD C;  1H0B A;  1OUX A;  1H1A A;  3TN9 2;  3VBF A;  4O61 A;  1C8N A;  1ULP A;  2IXK A;  3PU8 A;  4G4F A;  1ND3 C;  2VG9 A;  5FZ4 A;  2WS9 1;  2JG8 A;  3B00 A;  1O91 A;  4YPJ A;  1E5S A;  1PZ7 A;  1W9S A;  2WFF 2;  3KQR A;  2AYH A;  2HWD 3;  2EF6 A;  1ZZ6 A;  3H3U A;  1C28 A;  4QX2 A;  2RMU 1;  2DV9 A;  1U5X A;  1WW7 A;  4QGL A;  4V2V A;  2W1W A;  4FVV A;  3FLR A;  4N90 A;  3RRD A;  4D6R A;  4EYU A;  2ZXQ A;  2WAA A;  2RVA A;  1DQ0 A;  3BAL A;  4JRA A;  1SDD B;  1QF3 A;  4TSV A;  4XCA A;  5F5C A;  2CHH A;  2JDP A;  1M06 G;  1UKG A;  1AYM 3;  2DVB A;  3VD4 A;  5FWE A;  1IQA A;  2I2S A;  3H3L A;  1RUG 3;  3LA7 A;  1XB9 A;  2CDO A;  3TRS B;  4SBV A;  3MBW A;  1H2L A;  2G1M A;  3DGT A;  2WFF 1;  3LEI A;  3WP3 A;  5KXD A;  3OBZ A;  1CAU B;  3IPV B;  4FAH A;  2Y60 A;  2VNO A;  1OUR A;  1NZI A;  1XNC A;  3GBF A;  4ISQ A;  4E9K A;  1UOJ A;  1HDK A;  3J26 N;  1I9R A;  3MDP A;  3OPT A;  3ZN5 A;  3VBF B;  1YQ8 A;  5EQU A;  1COV 3;  4RR3 B;  4C0B A;  3ZX7 A;  1J84 A;  5KWR A;  2WZR 3;  2ARC A;  5ANN A;  5FZB A;  4E8D A;  4I3P A;  3O1V A;  1O3Q A;  2DF7 A;  4GMP 0;  3SEP A;  2CGN A;  3TEZ A;  4R9C A;  3INA A;  4OZX A;  5A1F A;  4BMB A;  2NLR A;  1PGL 1;  1HRI 3;  1X50 A;  4LBN A;  3SH3 A;  1UD1 A;  1ASJ 1;  4XUR A;  2W08 A;  4XFI A;  5IVE A;  3IB3 A;  4OQ8 A;  2WNU C;  4L11 A;  2BWC A;  4XDQ A;  3H0O A;  3EXU A;  2BZD A;  1HV1 A;  2YBS A;  1AL2 2;  4IXL A;  3M3O A;  4BPZ A;  1UQX A;  4CZS A;  5CAZ A;  3ZR5 A;  2GC1 A;  3ZLI A;  2B45 X;  2E51 A;  4LMF A;  4CDU B;  5A3T A;  3NNG A;  5HXV A;  2ORZ A;  1CAU A;  3IPV A;  1HIX A;  3OUI A;  5FOJ B;  1QQP 3;  3OSD A;  2R07 1;  5J98 B;  3RNS A;  1Q8V A;  3NRU A;  1ASJ 2;  1OHF A;  2GZW A;  2CDP A;  2VOK A;  3T0A A;  5I8S A;  3AL5 A;  3ZYG A;  4E4H A;  3AKR A;  3MYX A;  3WDY A;  4BQX A;  1OA4 A;  1OKQ A;  1OMI A;  2KXL A;  3I3M A;  4CEY A;  4GB3 3;  3HQU A;  3NJX A;  5A80 A;  4WZF A;  1UKR A;  1GQH A;  2F4L A;  4AVA A;  1R08 3;  5A1L A;  3KT1 A;  2AC1 A;  3TN9 3;  3VB9 A;  1CAW B;  2RMU 2;  5EIY B;  1GOF A;  3I8T A;  1YEW A;  3NNM A;  4CSW A;  4KBZ A;  3IDC B;  1AZD A;  1YRZ A;  4A7Z A;  4CEW A;  3O1S A;  3VBS C;  5DZG A;  5CYY A;  4IV1 B;  4RGG A;  2WO2 A;  3G6J B;  3B01 A;  1Q8P A;  1YO8 A;  5BV6 A;  3UNP A;  5IVV A;  2ARE A;  3GNE A;  4XJ9 A;  3I2F A;  2CGP A;  1EPW A;  2LRP A;  3ZYJ B;  3FWE A;  1SLA A;  4QPG C;  3OY8 A;  1NXD 1;  2WZP P;  3RVH A;  5ANQ A;  2WYS A;  2A71 A;  3SEE A;  4CEW C;  3FE5 A;  4BQ3 A;  2OII A;  5H9P A;  3VBO C;  5FRA A;  3IMN A;  4F83 A;  2X5I C;  3MW2 A;  1MS9 A;  3H7Y A;  1K5M B;  3AP6 A;  4XQ4 A;  4XUT A;  3KCX A;  4QKB A;  2B46 X;  2BFU L;  2WNO A;  4FXK B;  4UW3 A;  3USS A;  4BXF A;  1W6O A;  3RZJ A;  1VMJ A;  3AYD A;  2LRO A;  2WT1 A;  1JYT A;  3WY6 A;  5GZD A;  1WW4 A;  1EYB A;  2O0O A;  5A1A A;  1XQN A;  1Y9Q A;  2QCS B;  4OCT A;  3VZK A;  2RDS A;  5C9A B;  2O8Q A;  1FNZ A;  1MR5 A;  3H9A A;  3CIH A;  1RUJ 3;  4AG4 A;  4AFB A;  2A6Z A;  2ZGU A;  2HYK A;  1CD3 G;  2XUM A;  5FPV A;  5JCT A;  5FMD A;  1LOE A;  1OQD A;  4ZXE A;  3SKJ E;  3WNL A;  4CEW B;  3ZXK A;  3VKF C;  3ZXD A;  2AUY A;  4N7I A;  4AAX A;  1G9B A;  4I2O A;  4Z92 B;  2XGX A;  2ZZQ A;  1ENS A;  3KCY A;  3CZJ A;  4W8J A;  3U07 A;  3B9C A;  4XIK A;  4XVH A;  3ZXF A;  3VBH C;  2VW1 A;  2IC1 A;  4FPH A;  4MSV A;  4P02 B;  1EPZ A;  1JOB A;  4PCR A;  4QPI C;  4XZU G;  3WDT A;  5B4N A;  5FY8 A;  5JOZ A;  1BQP A;  4LEJ A;  4YW2 A;  4GWJ A;  4MV2 A;  1SCS A;  4GJY A;  2D6L X;  1APN A;  3PUI A;  2VEC A;  3I97 A;  1CZS A;  2J22 A;  1N3P A;  2WO1 A;  4N53 C;  2Y6L A;  4P9Y A;  4M4R A;  1ZBE 2;  4NHL A;  1BJQ A;  1O3T A;  5A32 A;  1WD3 A;  5A3P A;  1KGY A;  4Q4W 1;  1VBA 2;  4BK5 A;  4XAC A;  4JGY C;  1W6O B;  4MZU A;  3HWJ A;  1GZ9 A;  1WMF A;  3DKQ A;  2JDU A;  1X7N A;  1Z7S 3;  3H42 B;  4CDW C;  3BU0 A;  4Z2A A;  5GZF A;  1RMU 1;  3MLL A;  3DCQ A;  4Y1Z A;  4WM7 A;  3VKL A;  4M0N A;  1LOF A;  1OFS A;  4NWV A;  5BNP C;  1OBN A;  2ZOE B;  3HJR A;  2DU0 A;  5FZ1 A;  3VGI A;  1WMD A;  3POW A;  3W5M A;  3K4Z A;  1OSG A;  3PIG A;  3ON7 A;  3AVS A;  4K20 A;  2VZT A;  3WDV A;  4EWA A;  4XQD A;  3NJZ A;  5I0U A;  4I0W B;  2WT0 A;  3E1F 1;  3KF5 A;  2WR9 A;  3NVC A;  4A7Y A;  4DUW A;  5F7U A;  1FOD 1;  1RVF 3;  5C5U A;  4Z1V A;  1H4G A;  3OGG A;  3I2H A;  5G04 L;  3T0B A;  3AZX A;  3W9A A;  1FYU A;  2WYF A;  5FXZ A;  4ZU4 A;  2LM3 A;  3ZYR A;  1COV 1;  1YC6 1;  4BQ5 A;  4D7S A;  3ECQ A;  3WG2 A;  1ZX5 A;  3ZN6 B;  3WNP A;  1RUD 1;  4ZHN A;  1F5F A;  2VAU A;  2ZCW A;  3O1M A;  3IIA A;  5KHH A;  3FZ3 A;  2WO3 A;  5E16 A;  4L92 A;  4QX7 A;  1BBT 1;  1FV3 A;  2GME A;  1XE7 A;  1GOH A;  3FHI B;  2UU8 A;  1O3S A;  4AVC A;  1LNS A;  3WHT A;  2G9Z A;  3CJI A;  3PHM A;  1RYY A;  4Q4X 3;  3WCS A;  1PIV 1;  2YC2 A;  1R08 1;  3RZZ A;  1IZ3 A;  1O5U A;  3OCP A;  4OI1 A;  2GND A;  1JUH A;  3BTA A;  4MHU A;  4CDQ B;  2EAK A;  2P3I A;  4ZZ5 A;  1F4A A;  5BNO C;  3RZK A;  1A6C A;  4Y1X A;  3EHK A;  1C3H A;  2D3S A;  1BBT 3;  1MAC A;  3MF6 A;  1UMH A;  2VMG A;  2EIB A;  1W03 A;  2CTV A;  3PLQ A;  1BBT 2;  5H9R A;  4KMQ A;  2YPD A;  5LAT A;  4FPE A;  4JHT A;  1S0J A;  1GQP A;  4WVZ A;  5CFC C;  2YFU A;  4K7J A;  4O9G A;  3WSO A;  4XBN A;  1V00 A;  2ID4 A;  5APA A;  5EFU A;  1UPS A;  3ZN6 A;  3ILR A;  4CXX A;  4DUV A;  4QU2 A;  1ZRI A;  1ZA4 A;  2OZJ A;  3CF6 E;  2C4X A;  5FP8 A;  1O3R A;  2RS5 2;  1MVE A;  3KV9 A;  2D93 A;  2VH9 A;  4HK9 A;  4AEK A;  2NMO A;  1TME 2;  1YJK A;  1CIY A;  5AC9 1;  1C4R A;  1CIW A;  2WNE A;  1NLQ A;  3D4K A;  3GCX A;  4MGI E;  4B1M A;  3CJI B;  4KQ7 A;  2XON A;  5K7P A;  2P37 A;  3WDW A;  1S4C A;  4CTE A;  2RMU 3;  1XU1 A;  1VR3 A;  3BOW A;  2BQP A;  4QX1 A;  5A3O A;  4N7U A;  1S0C A;  1Z78 A;  4RSU A;  1F31 A;  4YM3 A;  1RUC 3;  4NHK A;  5SV8 A;  2C24 A;  1AL0 G;  3WF2 A;  1BXH A;  4A45 A;  4PLN A;  4YFW A;  3ILN A;  4B4R A;  1DLL A;  2WWJ A;  3VBO A;  3MIC A;  4IEZ A;  3LF7 A;  3T1L A;  3A21 A;  5DDJ 3;  3WQ7 A;  3JBG 3;  2PHX A;  5FPU A;  4ARX A;  4Q1P A;  1D0H A;  1V6N A;  3TOJ A;  4RN5 A;  2ZGQ A;  2XVL A;  5ISL A;  4LO4 B;  1W05 A;  2BDR A;  3OJB A;  1QQP 2;  5GLT A;  3LE0 A;  3T3Y A;  3DF0 A;  2JB8 A;  4LHN A;  4JGZ B;  4XF9 A;  5FZA A;  2WL1 A;  3KS7 A;  4DZG A;  3ZKU A;  1AJO A;  1D4M 1;  5IT6 A;  2E6V A;  1RUD 2;  1WMX A;  4BB3 A;  4AE2 A;  1X9P A;  5T50 A;  3LPF A;  2GN3 A;  2QZ2 A;  2ZEX A;  1XOY A;  2JDZ A;  1RED A;  3I2G A;  3ZFF B;  4MGT A;  4FI9 A;  2NP0 A;  3HAG A;  1Q43 A;  2D3P A;  1ZVF A;  2R30 A;  5EHD A;  4YGC A;  1ZRD A;  2FDG A;  1RUN A;  1QJF A;  1JMU B;  3ZFG C;  4HON A;  3P3P A;  4RHV 3;  1VLN A;  2WWS A;  2XLA A;  4OUM A;  3O12 A;  5FY1 A;  3M8L A;  5FYZ A;  3KB5 A;  1ENQ A;  1POV 3;  3DEC A;  3EQE A;  3WG1 A;  1YWK A;  3RFR A;  1RUH 1;  3RWN A;  5I0D A;  1AYN 2;  4CCM A;  2NZ9 A;  3CQO A;  5FPX A;  1QY4 A;  2VPV A;  4PDW B;  1S55 A;  2NYY A;  3OPZ A;  3ACI A;  3OB8 A;  4YGE A;  5CFD B;  3RZG A;  5FYC A;  3VBO B;  4FTS A;  1NOV A;  4FO9 A;  1UMZ A;  4JAA A;  2Y0O A;  4QB2 A;  5M0T A;  4IDZ A;  1GZW A;  3N9L A;  4FCA A;  4I0B A;  5GLU A;  4ASK A;  3RS6 A;  3U78 A;  1U5Y A;  3POG A;  4R8H A;  4BQ2 A;  1ND2 C;  5C5T A;  2D6O X;  2HWC 1;  2VZO A;  1AX0 A;  3KQ4 B;  1VPH A;  1RGS A;  2OPW A;  2ZA9 A;  4JDO A;  4TXW A;  3SXW A;  2UWA A;  1QJE A;  2W91 A;  4YW3 A;  3UL2 A;  1VAK A;  3OG2 A;  5F37 A;  2BPA 2;  2ES3 A;  3CU7 A;  3ZYP A;  4XYX A;  1LOB A;  2BUK A;  1WLD A;  2R1B A;  4V2W A;  4Y5Z 0;  2XHK A;  4OHW A;  5FYM A;  1GNZ A;  4PBP A;  3I2K A;  1R1Z A;  4IEV A;  2ZHN A;  1CWP A;  1F35 A;  4Q0U A;  4AK3 A;  4LIT A;  4TLF A;  4C1X A;  3WQ0 A;  1PVC 2;  1LCL A;  1HLC A;  2WZ8 A;  4FFG A;  3I59 A;  3LEM A;  2I74 A;  4WVV A;  2JG9 A;  3ZFE C;  3U10 A;  3TN9 1;  3AZW A;  4PDW A;  2BVV A;  2QQU A;  3RSJ A;  4UXA A;  3U11 A;  1LOC A;  2JDM A;  4XMI A;  5EJ3 A;  1HB1 A;  3AZY A;  5J37 A;  3H3Z A;  4S2F A;  4V1P A;  2PAK A;  3UGF A;  5JMC A;  2DBN A;  3JCI A;  4E27 A;  5A7S A;  5FPL A;  3HNM A;  2ZX4 A;  4QKF A;  3HQR A;  5FZH A;  3GCW A;  2H6C A;  3POF A;  2ZEZ A;  1SPP A;  1E57 A;  3QLQ A;  5FLH A;  5L19 A;  2J7M A;  2QJV A;  4N53 B;  1V9U 1;  2RR1 1;  4QAW A;  4HBN A;  1Q8O A;  1LHN A;  1GFF 2;  1RUC 2;  1LB2 A;  2XL9 A;  3HD8 B;  2B5H A;  2XWB B;  4XFC A;  1HRV 2;  3P1I A;  4DO0 A;  1QH7 A;  2WNV B;  3LQC A;  4GKY A;  5ERL A;  1CJP A;  1MZ6 A;  5EWS A;  4A44 A;  4NHX A;  4X6Q B;  4Y24 A;  1DYK A;  2GC2 A;  2XB6 C;  1ULF A;  5DUU A;  1QJU 1;  4KH9 A;  4LXL A;  3AX4 A;  2TUN A;  2R06 2;  4NRQ A;  1POV 0;  4KWL A;  3RMY A;  4HVR A;  3VHR A;  3DXT A;  1XBF A;  1OFN A;  4NMI A;  4Q26 A;  1DGR N;  1RIR A;  2WC2 A;  3IDA A;  5GLZ A;  1NA1 C;  1AL2 3;  4A4A A;  2VL4 A;  1QEX A;  1RUI 2;  3G7D A;  1HJF A;  3MIF A;  1O4Y A;  2YC4 A;  4ATF A;  2FDF A;  1IPS A;  5E1R A;  2DYC A;  1VBB 3;  4QMA A;  5JDB A;  2RDR A;  3KHB A;  1OH4 A;  4GD4 A;  1J58 A;  3ILF A;  1VBB 2;  3LEG A;  2P4E A;  3GYD A;  1JH5 A;  4M3C B;  4F8A A;  4BZ4 A;  1AVB A;  1OOP A;  3M7A A;  3URF A;  1RUG 1;  1GP4 A;  2R0F A;  4YFZ A;  3RDI A;  3J7L A;  3PIJ A;  5FCC A;  4BM8 A;  2EXJ A;  2Q8D A;  1AYM 1;  1NQJ A;  2HH9 A;  4NJ4 A;  3CJX A;  5I0S A;  3DUI A;  4Q0Q A;  5F3C A;  3FMG A;  2HJI A;  3KM5 A;  4BA6 A;  1MEC 3;  4KBB A;  1WW5 A;  1IHM A;  4JGZ C;  3IZO A;  4JTN A;  3VZL A;  1W6P A;  3NV2 A;  3BIW E;  4Y20 B;  3LB9 A;  3O0X A;  3RYR A;  1NT0 A;  2YB7 A;  1O8P A;  3CHX A;  4MVT A;  3UYJ A;  3VDA A;  2FCU A;  2OVU A;  2J1S A;  2A73 B;  3BCW A;  4QHZ A;  3MV1 1;  1ST8 A;  1UZW A;  1W9T A;  1HX6 A;  2ENR A;  2VTF A;  3GBW A;  1LU2 A;  5BNO B;  1W0P A;  2P17 A;  3ACH A;  4XAB A;  4QHB A;  1NLR A;  5DDJ 2;  4ET7 A;  3OBT A;  1GR3 A;  3HBK A;  1DHK B;  3C8X A;  1JYV A;  4XJW A;  1RXF A;  3ES4 A;  5FK7 A;  4LOS A;  2MNG A;  2WSV A;  3PVN A;  3ZSJ A;  2HWB 2;  5JSP A;  2AEZ A;  2BGO A;  2E7A A;  2OPK A;  1PGW 2;  1OOP B;  1GWK A;  3JD7 2;  3N9O A;  3T1M A;  3OGS A;  1MZE A;  4QX5 A;  3OYW A;  1CJD A;  2DFC A;  4G9S B;  1DG6 A;  4UFM A;  3ZMN A;  3TEY A;  2GC3 A;  3CJI C;  4OI0 A;  4Y5T A;  1QJZ A;  5IAT A;  1I3H A;  4IGO A;  5DAQ A;  4LK7 A;  4YYO A;  3NNJ A;  5BNN A;  3BTZ A;  4BIO A;  2ZX3 A;  3R4S A;  4Y20 A;  2VMI A;  4W4Z A;  1ZA7 A;  4EE2 A;  2PAE A;  2OUJ A;  2CSG A;  1DGW X;  3HEI A;  5FYV A;  4QKD A;  2RS3 2;  3K46 A;  2MPF A;  2E63 A;  3R0R A;  3OEA A;  3TBD A;  5BNO A;  3RZM A;  3WT3 A;  3D0J A;  1EAH 1;  2Y64 A;  3T0D A;  2DTY A;  5FUP A;  2V5D A;  1GWL A;  2RV9 A;  4K40 A;  1DQ2 A;  3K75 B;  1AL2 1;  1WCS A;  2WNU A;  3JBG 2;  4Y5S A;  3UGG A;  3V0B A;  1NY7 1;  5FWJ A;  3WF0 A;  3C7O A;  4D0Q A;  2C6S A;  3W20 A;  4K1Y A;  5CKN A;  2RM2 1;  2YV8 A;  3N7M A;  3NQH A;  3KV4 A;  2H0B A;  4NRO A;  3M2M A;  2WII B;  4FXG B;  3GZA A;  5ABJ B;  3AKQ A;  3IM0 A;  2RS3 1;  3ZFG A;  3U4X A;  1ZBE 1;  1Q8S A;  2BGC A;  2R04 1;  2DDU A;  4AED C;  3ETQ A;  1VAV A;  1DZT A;  2HWD 1;  2JB4 A;  2QQW A;  3III A;  3OYW B;  1KS5 A;  4IQP A;  1QDO A;  3BPS A;  4R4X A;  4B29 A;  5J48 A;  5EPA A;  5F6L B;  2WS9 3;  5KXC A;  3VBU C;  5EJZ B;  4SLI A;  1DFQ A;  2BYV E;  1JU4 A;  4CP2 A;  2CV6 A;  4XBL A;  4S2H A;  3I4I A;  2JKB A;  3RJ2 X;  1TEI A;  3LA2 A;  1B35 A;  3E5U A;  4QDS A;  4GUL A;  4L99 A;  4RHV 2;  3OF1 A;  5BNN B;  4Q4V 3;  1OLQ A;  1WWY A;  3AZV A;  2Z4F A;  5HV0 A;  5JZG B;  3GXU A;  5KBF A;  3WNO A;  2CGO A;  2GNB A;  2HWE 2;  4AL9 A;  2RS1 2;  3VKN A;  3HNY M;  1NCQ C;  4EN9 B;  3H1Y A;  4JC1 A;  3K3O A;  5FZC A;  5FZ3 A;  1KXG A;  4HET A;  1WLW A;  5HCF A;  5DZE A;  1FAY A;  2XL7 A;  1JTZ X;  5L7O A;  4AHW A;  4Q4W 2;  3O1T A;  2WNU B;  1L7L A;  1F8V A;  1V6I A;  1Q56 A;  1UF2 C;  4DEQ A;  4BU2 A;  1SLT A;  2ZAC A;  2XH6 A;  4IGQ A;  3AMM A;  4Z8B A;  4OHY A;  4B7K A;  2QZ3 A;  3C7E A;  4QGN A;  1K5J A;  1ZYB A;  2W1Q A;  2B42 B;  3E6D A;  3MGU A;  1GP6 A;  3N3H A;  4JTO A;  1XYP A;  1GLH A;  1UYY A;  5BNP B;  1FT9 A;  1TE1 B;  1JXN A;  3LCP A;  5LB6 A;  4EQV A;  3WG4 A;  1JYW A;  3H1W A;  5LRR A;  2VZQ A;  5SV5 A;  4GH4 A;  5AFE A;  3AC0 A;  2R04 3;  3GHM A;  5DUV A;  3POI A;  4MAD A;  2EXK A;  3O1U A;  4HVO A;  1JYI A;  4QT6 A;  1UZY A;  2WZR 2;  5GKA C;  1HB3 A;  3VDC A;  3JB4 C;  4NRP A;  2GH8 A;  4E2Q A;  3AKP A;  1F2N A;  3TEW A;  1OI6 A;  5JXI A;  3N9N A;  4KWU A;  4OYU A;  1NCR C;  3GAL A;  1CN1 A;  2BBV A;  4RGA A;  2D5F A;  4XMA A;  4I30 A;  4XUN A;  3PUQ A;  3LWC A;  3VBR B;  1I5Z A;  1LGN A;  2DWR A;  2VM9 A;  1UXZ A;  3PL0 A;  2ZX0 A;  3AB0 A;  4RQP C;  5FZO A;  4AHZ A;  1ALY A;  2QVS B;  1WME A;  3ZDV A;  1XND A;  2C1F A;  2VUC A;  5C4W C;  1NY7 2;  2AZ5 A;  5C3P A;  1PNF A;  1SG3 A;  4CU9 A;  4DIQ A;  1TMF 2;  5FBZ A;  4RFR B;  4DS0 A;  2ZMN A;  4FP3 A;  4ATE A;  4BIF A;  4LT5 A;  5EYY A;  2Q8O A;  4FPY A;  1O5L A;  4CE8 A;  3AP7 A;  5JXH A;  3MZH A;  3S30 A;  4XJU A;  5AC9 2;  4MG2 A;  4IL7 A;  3BOP A;  3DN7 A;  4TLG A;  1ENX A;  1HQL A;  1AR7 3;  3D5O A;  4PT6 A;  2FQP A;  3LKJ A;  1RIN A;  2VME A;  5CIR A;  1W06 A;  4CEY C;  3DYO A;  5FXX A;  2ET1 A;  3E5X A;  2VCM A;  3U4S A;  1UOF A;  1OUS A;  3POB A;  4YGB A;  2K2S A;  1DZQ A;  5JZG C;  1NLS A;  1UXX X;  4CDW B;  5A70 A;  1YCI A;  5BPX A;  3BVC A;  4IEP A;  3IAQ A;  5FY9 A;  4CP9 B;  4XUO A;  1DCS A;  5GLW A;  1RMU 3;  1DGR A;  1ZZC A;  5E8A A;  4M3C F;  4WVM A;  4AQ6 A;  4O65 A;  2XJP A;  4MYE A;  3RGB A;  1VBA 3;  1HXS 2;  1MQT B;  2W47 A;  2CNA A;  3AZZ A;  1UY1 A;  5FZF A;  1LTE A;  2Y6J A;  1PZ8 A;  2R32 A;  4Y1U A;  1MS1 A;  1H9P A;  1W8O A;  4UW5 A;  4XJ8 A;  3EBR A;  1BMV 2;  2WNV C;  4FPG A;  2A5Z A;  1VMH A;  4Q29 A;  4K9S A;  4PLM A;  1ASJ 3;  5AFB A;  1H9W A;  2ERF A;  3TNP B;  4MXV A;  1FOD 3;  2P34 A;  5K8S A;  2VZP A;  5ABJ C;  1GIC A;  4QX0 A;  1YQ5 A;  4YAR A;  3ZPY A;  3T30 A;  5FY5 A;  3WCR A;  4L9B A;  3ELN A;  2W94 A;  5GAL A;  5FZG A;  4DUX A;  5A7W B;  4X8N A;  3BIE A;  3V64 A;  5D2A A;  5IK5 A;  5CG8 A;  4NWW A;  1W8N A;  4LO5 B;  3H8R A;  3ENR A;  1C8M 3;  1SMV A;  1WW6 A;  4H7L A;  3OTF A;  3S57 A; 
#chains in the Genus database with same CATH homology
 3C7G A;  5G04 L;  3I2H A;  3T0B A;  2VQT A;  4PF1 A;  2JD9 A;  1UYZ A;  4CUA A;  2W95 A;  3WF4 A;  1HN1 A;  4KI5 M;  3ECQ A;  1SHW B;  1J83 A;  3ACF A;  4CU6 A;  4XUQ A;  5B4X A;  3WNP A;  4BJ0 A;  5LA2 A;  3THD A;  4W50 A;  1XNA A;  2VR4 A;  3LEK A;  2WO3 A;  3VD9 A;  4P5Y A;  3FHQ A;  1GOH A;  3OBA A;  2QQL A;  2EIE A;  1LNS A;  4BXS V;  2W5F A;  1RYY A;  2B9V A;  4XUR A;  2YC2 A;  4GWI A;  4A4A A;  2W9X A;  3EB7 A;  3FN9 A;  4ZZ5 A;  1F4A A;  1NUK A;  1UMH A;  2EIB A;  2QQM A;  2ORX A;  4KMQ A;  3WF3 A;  2XOM A;  1DP0 A;  4RYD A;  1GQP A;  2YFU A;  2EIC A;  1JZ8 A;  3MUY 1;  3WSO A;  5JXG A;  4QX3 A;  1OF4 A;  2ID4 A;  5HPO A;  1P8J A;  2W1S A;  5DMY A;  1W9W A;  4OMC A;  4DUV A;  1UZ0 A;  2C4X A;  2VCC A;  3WEZ A;  1CIY A;  4UAP A;  4A3Z A;  2XON A;  2J1U A;  3VD5 A;  2HYX A;  1H6X A;  4QX1 A;  2X10 A;  1O59 A;  1XPW A;  1ULO A;  2J1A A;  2WDB A;  2E33 A;  3WF2 A;  4LKS A;  2VZU A;  4A45 A;  1GOG A;  3VD3 A;  4QPW A;  3A21 A;  4UOJ A;  4ARX A;  2JE8 A;  4XUP A;  3GGL A;  4RN5 A;  5JUV A;  4QDQ A;  3P6B A;  5C70 A;  1K42 A;  3FL7 A;  4JKL A;  5DQ0 A;  3ABZ A;  3JXS A;  3LE0 A;  1JYN A;  1PMH X;  3IAP A;  2VCA A;  5G05 L;  3LPF A;  3T08 A;  3K77 A;  2ZEX A;  5EJ1 B;  3I2G A;  4FI9 A;  3HPN A;  2RJ2 A;  1T2X A;  3DYM A;  4M4P A;  5LA0 A;  2ZEY A;  3MO4 A;  5IFT A;  2XHN A;  2VZ3 A;  2DCK A;  1UY4 A;  5C7G A;  5HXM A;  1H6Y A;  2W3J A;  5DPN A;  2C26 A;  3DEC A;  5IHR A;  3DYP A;  2BBA A;  5I0D A;  3CQO A;  1K12 A;  4OMD A;  1EUU A;  3J7H A;  3OB8 A;  3ACI A;  1NX9 A;  3GM8 A;  1GNY A;  3HNB M;  1GUI A;  4QB2 A;  1XNT A;  3F2Z A;  2QBX A;  2BGP A;  2J1T A;  5CZK A;  2ZEW A;  3T09 A;  2VZO A;  3UET A;  1JZ2 A;  3U37 A;  1JI6 A;  4CUC A;  4TXW A;  3CDZ B;  1OF3 A;  2EID A;  2W91 A;  2V4V A;  3OG2 A;  1WKY A;  2VZ1 A;  1IQD C;  3WNK A;  2QQK A;  2DCJ A;  3I2K A;  2C9K A;  2WAO A;  4D8M A;  5LCW L;  3FHA A;  4OZO A;  2Y6H A;  2WZ8 A;  2QQJ A;  3OGV A;  1TVG A;  2LW8 A;  3I3D A;  1L7Q A;  1R64 A;  2J1V A;  4JKM A;  5LA1 A;  1K45 A;  3VDB A;  4TTG A;  2BER A;  4GZ9 A;  3A23 A;  4CUB A;  3HNM A;  4MGQ A;  3HN3 A;  2ZEZ A;  4DXR A;  3W5N A;  2J7M A;  1I5P A;  3CMG A;  4QAW A;  1JZ7 A;  2WAB A;  1XC6 A;  3T2P A;  4PQQ A;  4UI9 L;  1JZ3 A;  1UY2 A;  3ACG A;  5JR2 A;  3P1I A;  4ZY9 A;  5FUI A;  2WZE A;  4BDV B;  3LQC A;  4A44 A;  3BN6 A;  2E32 A;  4IUG A;  3ZM8 A;  2JKX A;  3SKV A;  5B4N A;  1JYW A;  3ETP A;  4MO3 M;  3IDA A;  1UMI A;  2VL4 A;  2KD7 A;  1EUT A;  2YC4 A;  4P08 A;  4CU8 A;  2J1R A;  2YG0 A;  1OH4 A;  3LEG A;  1YQ2 A;  2VJX A;  3NJV A;  2WUH A;  2VO5 A;  2VMF A;  1UYX A;  1PX3 A;  1NAE A;  2Y8K A;  1DYO A;  1PMJ X;  2X09 A;  1K3I A;  2WN3 A;  3HOB A;  4QDR A;  2YB7 A;  1O8P A;  3VDA A;  2J1S A;  3MV1 1;  1W9T A;  2V72 A;  2VTF A;  3ACH A;  2Y6G A;  1JHJ A;  2B4K A;  3WNM A;  5J1X A;  5JXJ A;  3C7F A;  3CZU A;  3OGR A;  4ET7 A;  3VD7 A;  1JYV A;  3C8X A;  1ULP A;  3WF1 A;  4OUE A;  4YPJ A;  1JU3 A;  1W9S A;  2BGO A;  1OD3 A;  4DXT A;  4QX2 A;  4LQR A;  2W1W A;  3THC A;  3OGS A;  2ZXQ A;  2WAA A;  2RVA A;  1SDD B;  2E26 A;  3VD4 A;  2VCB A;  1JZ6 A;  2Y6K A;  2CDO A;  4W4Z A;  3MBW A;  3HEI A;  3LEI A;  3K46 A;  3OEA A;  3T0D A;  2Y64 A;  2R7E B;  2V5D A;  4DXS A;  2RV9 A;  3K75 B;  3I2I A;  5JMO A;  4P00 B;  4BK4 A;  3I3B A;  1JZ5 A;  3MUZ 1;  1UY3 A;  2XQX A;  4LHS A;  1J84 A;  3WF0 A;  3C7O A;  4D0Q A;  1GU3 A;  4E8D A;  1CX1 A;  1BHG A;  3NQH A;  2VZR A;  3SEP A;  3BGA A;  4JHZ A;  2DDU A;  3III A;  3IB3 A;  3CKH A;  2VZV A;  2VZS A;  2BZD A;  3A22 A;  5EJZ B;  3UES A;  1JU4 A;  3I3E A;  4CU7 A;  4QDS A;  4CVU A;  3NNG A;  2Z4F A;  3GXU A;  2ORZ A;  2QQO A;  3WNO A;  4MGS A;  3HNY M;  4A6O A;  3NRU A;  2X05 A;  2CDP A;  3T0A A;  2PQS A;  4JX0 A;  4QB6 A;  1O8S A;  4DEQ A;  1US2 A;  4HG6 B;  4A42 A;  3T2O A;  1UX7 A;  3I2J A;  1OT5 A;  1PX4 A;  2WQ8 A;  3NJX A;  3MV0 1;  1KEX A;  3WNN A;  2VOT A;  3C7E A;  2W1Q A;  3K4D A;  1W0N A;  1UYY A;  5EIY B;  1GOF A;  1W99 A;  4ZZ8 A;  2L9L A;  4QB1 A;  3A7Q A;  1JZ4 A;  3LPG A;  2VMC A;  2VC9 A;  3T2Q A;  5CYY A;  2VZQ A;  5IJR A;  1GMM A;  3AC0 A;  2WO2 A;  4ARY A;  4MAD A;  3UNP A;  3GDB A;  2VMD A;  3I2F A;  4A41 A;  2VQU A;  3D3A A;  3VDC A;  1WCQ A;  2WYS A;  5IFP A;  3SEE A;  5JXI A;  1F4H A;  4KWU A;  2W92 A;  4OYU A;  2HLE A;  2E31 A;  2W1U A;  3WQB A;  2LS6 A;  1MPX A;  4XUN A;  1CZV A;  2VM9 A;  1UXZ A;  3EYP A;  4XUT A;  3OEB A;  1SG3 A;  4CU9 A;  4DEV A;  1CZT A;  2JDA A;  5A1A A;  2J1E A;  2QQN A;  3CIH A;  4AG4 A;  1NKG A;  5C71 A;  1DLC A;  5JXH A;  3SKJ E;  3WNL A;  4ZXE A;  4PT6 A;  2VME A;  2QQI A;  4AAX A;  2YFZ A;  1L7R A;  3DYO A;  1US3 A;  3C7H A;  3CZJ A;  4W8J A;  2W46 A;  4XVH A;  4LPL A;  4P02 B;  4XZU G;  1UY0 A;  2WBK A;  1UXX X;  4JKK A;  3IAQ A;  4GWJ A;  4XUO A;  5IYY A;  3PUI A;  3I97 A;  1CZS A;  2J22 A;  4E8C A;  2WO1 A;  2Y6L A;  5DN2 A;  4M4R A;  2W47 A;  2WN2 A;  1UY1 A;  1KGY A;  2Y6J A;  4BK5 A;  1W8O A;  1D7P M;  2OKX A;  1JYX A;  4Z2A A;  2VZP A;  4QX0 A;  1TG7 A;  3K4A A;  3HJR A;  4DUX A;  2W94 A;  4L0P A;  3W5M A;  3PUH A;  3K4Z A;  1W8N A;  2VZT A;  2W87 A;  4DUW A;  3E1F 1;  4MOA A;  5F7U A;  1UWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...