4UI9L

Atomic structure of the human anaphase-promoting complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
182
structure length
182
Chain Sequence
TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
total genus 31
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4ui9L00
2W92A 5LA1A 1UXZA 2W5FA 3ECQA 4DUWA 1YQ2A 3OB8A 2J1AA 3IIIA 2WZEA 3A7QA 2W1SA 2C9KA 2OKXA 2B4KA 3T0BA 1HN1A 1O8SA 2W46A 5JXGA 3CKHA 4LHSA 4BK4A 4BXSV 1US3A 1JZ6A 4OZOA 4CUAA 4XURA 4QB1A 3WEZA 3I97A 1DYOA 3I2FA 2X05A 3SKJE 3U37A 5DMYA 2EIBA 4A42A 4CU8A 4P02B 4M4RA 1IQDC 1NX9A 1JYNA 2V5DA 3GDBA 2QQIA 4TXWA 1UMIA 1US2A 2VZSA 1D7PM 4E8CA 2Y6GA 2E33A 1XPWA 2WO1A 4DUVA 1EUUA 3VD9A 5G05L 3MUZ1 2CDOA 3I2IA 3W5NA 4P08A 5CZKA 3IAPA 2QQKA 4ARXA 3VD4A 2WN2A 2ORZA 4CUBA 4LQRA 5IJRA 2W95A 3HPNA 5C70A 2BBAA 2EIDA 3HNBM 2VMFA 2WAAA 4OYUA 1GOGA 4M4PA 1JI6A 1JZ7A 5DQ0A 5B4NA 1UZ0A 1O59A 2R7EB 1JYVA 3GM8A 3HNYM 3T2QA 3VDCA 3C7EA 4MGQA 3MV11 4A41A 2J1SA 1R64A 2WABA 1ULPA 4DXTA 3P6BA 2W94A 1JHJA 1BHGA 2JD9A 3C8XA 1UX7A 5DN2A 3NRUA 2Y8KA 1TVGA 2YC4A 3LEGA 1PMHX 5LCWL 1K3IA 2PQSA 3A22A 1W8OA 3K75B 3VD7A 4A44A 4ET7A 1W8NA 3C7FA 4W4ZA 4ZXEA 2Y6LA 3C7HA 3OG2A 1J83A 4QPWA 3DYPA 3I2JA 2W87A 2VCCA 2ID4A 2VZ1A 3T0DA 2RJ2A 2QQJA 1UYXA 1T2XA 1XC6A 2HLEA 2VMCA 3LEIA 4CVUA 4FI9A 3W5MA 2YG0A 5HXMA 4BJ0A 3GXUA 4QDQA 3C7OA 3OEBA 3HOBA 1F4HA 3SEPA 3WSOA 1OH4A 1RYYA 2XQXA 3LQCA 2LS6A 4QDRA 2E26A 2BGOA 4Z2AA 4IUGA 4GWIA 2WDBA 4L0PA 1WCQA 3EB7A 5I0DA 2VZRA 2QQMA 3I3EA 4ARYA 4W8JA 3IAQA 3NQHA 1H6YA 1UY0A 4QDSA 2VCBA 4KI5M 2W91A 2VR4A 5JMOA 2V72A 4QX1A 3K4DA 1K42A 2VC9A 3NNGA 2JDAA 5IFPA 3I2GA 5EJ1B 3J7HA 2DCJA 3UESA 5F7UA 3THCA 5JXIA 3T09A 4CU7A 5JXJA 1L7RA 3E1F1 3FL7A 2VTFA 1SG3A 1I5PA 1CX1A 4DXRA 3ABZA 2W1UA 2VZOA 3LPGA 2WN3A 4XUTA 2W3JA 2VQUA 1OF3A 3WNNA 3MUY1 4XUPA 2LW8A 4MGSA 5EIYB 3ZM8A 3K4AA 3K46A 2Y64A 4QX2A 3VD5A 5JXHA 2QBXA 1SDDB 3I3DA 1UYYA 1JYWA 1CIYA 4CU9A 2QQOA 1UY3A 3FN9A 2W9XA 4RN5A 4A3ZA 5C71A 3DECA 4DXSA 3IDAA 1OF4A 1NKGA 4DUXA 1OD3A 5CYYA 3NJVA 2L9LA 4AG4A 1O8PA 1LNSA 1ULOA 3JXSA 2WAOA 4XUNA 4PT6A 3CZJA 2C26A 4ZZ5A 3WNPA 3MO4A 3CDZB 4A4AA 3I2HA 3PUHA 3OBAA 1OT5A 2WQ8A 1K45A 1F4AA 3CZUA 4BK5A 1W9WA 3MV01 2VO5A 2YFUA 3BN6A 3HNMA 3ACHA 3GGLA 3EYPA 1UYZA 3WF3A 2VMDA 3I2KA 3A21A 2XHNA 4XZUG 3FHQA 1UY1A 1UY2A 5DPNA 2Y6JA 4RYDA 1W9TA 3K77A 1JZ4A 2WUHA 2BZDA 4PF1A 2RVAA 2ZEZA 2YB7A 2B9VA 2WO3A 4YPJA 2ZXQA 4QX0A 1JU3A 1W0NA 4OUEA 3WNMA 1H6XA 1XNTA 4LKSA 4HG6B 4ZY9A 2VOTA 3LEKA 1JZ3A 1JU4A 2J1VA 4A6OA 4OMDA 2E32A 3D3AA 4QB2A 2X09A 4ZZ8A 3UNPA 1GU3A 1L7QA 4QX3A 3F2ZA 5HPOA 2ZEWA 1J84A 2X10A 2VMEA 1TG7A 1CZVA 1JYXA 3OGVA 2ORXA 3VD3A 4QB6A 4E8DA 3OGSA 2C4XA 1EUTA 2W1WA 1NUKA 2VM9A 2J22A 2ZEXA 2W47A 3T2OA 3ACFA 3CIHA 3THDA 4XVHA 3NJXA 2XONA 5A1AA 2JKXA 5C7GA 5EJZB 1W9SA 4XUQA 3WF1A 3BGAA 4KMQA 3I3BA 2RV9A 5J1XA 1DLCA 4LPLA 4W50A 3SEEA 1CZTA 1P8JA 4P00B 2WYSA 4D8MA 2WO2A 3T2PA 4DEQA 2KD7A 3AC0A 2VZPA 2CDPA 2J1UA 4UAPA 3PUIA 1DP0A 3LE0A 3MBWA 1KEXA 4DEVA 1W99A 1K12A 2VZVA 4JKMA 3C7GA 1JZ5A 2DCKA 3T0AA 3WNOA 5G04L 3SKVA 3VDBA 2J7MA 4GWJA 2V4VA 3FHAA 5IFTA 2J1TA 2VZUA 3CMGA 1XNAA 2QQNA 2VCAA 3K4ZA 3HN3A 2Y6HA 3ACGA 3VDAA 4MO3M 1MPXA 1GMMA 1GNYA 4PQQA 1UMHA 3WNLA 4JX0A 3WQBA 4TTGA 3ETPA 2BERA 3OEAA 3DYMA 1GUIA 4KWUA 2DDUA 2VQTA 5JR2A 3WF0A 2VJXA 2WBKA 4OMCA 2EIEA 3ACIA 4CUCA 1JZ2A 2VL4A 4GZ9A 5JUVA 3OGRA 4AAXA 4JHZA 2VZ3A 5IHRA 2YC2A 3WNKA 1GQPA 2XOMA 1JZ8A 3HJRA 3T08A 2ZEYA 4UI9L 3A23A 1NAEA 1GOHA 2W1QA 2Y6KA 1PX4A 1SHWB 3P1IA 5FUIA 2EICA 3WF2A 4BDVB 1UXXX 3CQOA 4JKKA 2E31A 5IYYA 2J1RA 3IB3A 2WZ8A 1PMJX 2J1EA 2VZQA 1PX3A 1GOFA 1KGYA 2Z4FA 4UOJA 4MADA 2VZTA 3LPFA 3HEIA 4QAWA 2JE8A 2QQLA 4A45A 4CU6A 3WF4A 4D0QA 2HYXA 4XUOA 5B4XA 3UETA 3DYOA 4MOAA 5LA2A 2YFZA 4JKLA 2BGPA 1UY4A 5LA0A 1CZSA 1WKYA 4P5YA 1UWWA
chains in the Genus database with same CATH superfamily
2W92A 4AI3A 3BU0A 4W65A 3POSA 1MQTC 3BTXA 1XSRA 4CCOA 3IIIA 5L9VA 1TQ5A 3CJIB 1AX0A 2W1SA 4EQVA 2RDSA 2R073 5I8YA 2C9KA 1PO11 5ANQA 4LTAA 3NNJA 2B4KA 4BQ2A 4BXFA 2BJSA 4FP3A 4JQRA 1EAH1 4RQPC 2DFBA 2W46A 5JXGA 1US3A 1CWPA 2OQ6A 2CGNA 4RGKA 2KA3A 3FUQA 3SLIA 3FFQA 5GKAC 1COV1 1D4M1 2A3XA 3KF3A 3WEZA 4Q5OA 5JMCA 5K0UB 3ZSJA 2WL1A 1RVF2 5A32A 1RJ7A 3W9AA 2FZ1A 3U37A 3LA7A 4HKWA 2WKKA 4V1PA 1YFYA 2ZABA 3NL1A 4K9SA 4CRQA 2W39A 3PVEA 4IL7A 1WD3A 1A8MA 4CU8A 1J3PA 5FREA 3ZN6A 4M4RA 1RINA 5FY8A 5A6XA 1NX9A 3R4DB 2PLV1 3WLUA 1LENA 1UMIA 1LOFC 1C5IA 1UN1A 2R061 4C90A 1LHOA 4DNYA 1ZX5A 1RUE1 2Y6GA 3C3VA 3KV9A 1XPWA 4XYXA 5A6QA 1K5MC 4HZFA 1NA1C 1XE7A 1R091 1OMIA 1AR71 3VD9A 3AK0A 5G05L 4QGLA 3I8TA 3RWNA 1O3TA 3MUZ1 4O65A 2VUDA 3J8F3 4XJWA 3O1MA 2CDOA 2MEV1 2HYKA 2XJRA 5LBCA 4CCDA 4XHXA 3PVBB 3UKNA 3VZOA 5KHKA 3WP3A 2ZMKA 1LEMA 1W6QA 1X7NA 3W5NA 1YJKA 3IAPA 5LRRA 4UT5A 5JOXA 3J4UH 3HN1A 3KD4A 2QTWB 1Q8PA 5A7WA 5LBBA 4CCKA 4CUBA 1PGW1 1DYKA 1DF0A 4LQRA 3ZSLA 3UV9A 1V9U2 1SFYA 5IJRA 1WCSA 4AW7A 3J7MA 4CE8A 4QQLA 5T50A 3J8F2 3WP5A 2ZBJA 5EP9A 3WDYA 2LTNA 2EIDA 1MS1A 3UYJA 2VMFA 2WAAA 3DL3A 4OYUA 3S6PA 3ZLIA 4CXWA 4XFFA 1GZCA 1C57A 1W6OA 2CWSA 3HQXA 4EN0A 4XOGA 1SPPB 3BVCA 1H4GA 3E5XA 1TMF1 4LKFA 1YQ8A 4OI0A 5A3WA 5ABJA 2VQ0A 5KXBA 4JTNA 1HRI3 4C8DA 2CAVA 3OD4A 4OHXA 3TRSB 4YLZA 1OUSA 2BRTA 1ULPA 3ZX7A 4CEYC 1KQRA 3I59B 4YGBA 2Y26A 3MF9A 1LAJA 1JOPA 1BVVA 1FNYA 3RZZA 4LIUA 4FOQA 1JMUB 4FFFA 1TVGA 1JUIA 2GNDA 1UIKA 3VBHC 2ZTNA 3VKFC 3A22A 1W8OA 3NNFA 3OPZA 1YI7A 4GMP1 1E57A 1GBGA 5HV4A 3WXPA 1J1TA 2R042 1G9DA 2XJPA 3ZKYA 2RR12 2VCCA 3ZPYA 1UU5A 2VUAA 5FZOB 4QMAA 3M8LA 2RJ2A 3KB5A 4GB32 3BTYA 5HCAA 1W6QB 3SC7X 1T2XA 2VMCA 4AZZA 4DB5A 5JCTA 2WZR1 2VGDA 3LZZA 2CGOA 1WBFA 4HXCA 4YM0A 2MNGA 1MS0A 3PDQA 5D8AA 4TLFA 3W5MA 3H3LA 4COWA 5FZCA 4BJ0A 1G9FA 2D6NA 3WDXA 1Y43B 3P5BA 4L8QA 1OHFA 3POYA 4XF3A 4BQ3A 5F1RA 3INAA 1F4HA 1OPMA 3N7LA 1OH4A 1ZBA2 3OF1A 1MS9A 4JGZA 3WSOA 2WINB 5FYMA 2D5FA 1YFXA 1KDKA 3MGUA 3KQ4B 4D69A 4QHOA 1RUI2 4MXWB 3ZXFA 2EXHA 3BALA 3EB7A 5I0DA 1UOJA 4XF1A 3UKVA 2W2IA 3WW4A 4LOTA 1DCSA 3THPA 5BNNB 3HAGA 3KS7A 3WT3A 1W6MA 4CDQA 2FMYA 1AL22 1X9TA 2PHTA 3ST7A 5ABJB 4UFKA 1R092 2A71A 5DDJ1 4ZXKA 2VD7A 1FT9A 1RUE2 3PMEA 2ZGLA 2G1MA 1FYUA 3E5UA 4CP2A 2WNEA 2O8QA 5A7SA 4Y20B 1VPHA 5BNQA 1YWKA 4CDUA 2X5IA 1MS8A 4OLLA 1D4VB 3K4DA 4CTEA 3BTZA 1IG0A 3NNGA 1ASJ3 2A6WA 2DCJA 2JB8A 1Q56A 1OVSA 2BOIA 3EMRA 4LNVA 3SH3A 4AYUA 1FNZA 5J3UA 3THCA 3OYWA 1U12A 5JXIA 3E5QA 3T09A 2W08A 4CU7A 1O5UA 1FATA 2CU5A 3L2YA 3E1F1 4KGGA 1RJ8A 2Q8DA 1HXS3 4H7LA 5EYYA 1OSGA 1I5PA 4Z1VA 1CX1A 1PK6B 4RFRB 1CESA 2E7AA 1AHSA 1HIXA 1LJ7A 1X8EA 4LA2A 2N7GA 1OC1A 4LEJA 2E53A 3CLPA 5A7NA 5A70A 1QJY2 2FD8A 1PIV3 2WFPA 2JJ6A 3HMYA 4BLJA 5KXCA 2DVGA 3GZUC 4LR4A 4MGSA 3O7OA 4N90A 5EIYB 2W0XA 4K6BA 2WNUA 3N36A 5LEJA 2XQRA 3I2OA 5L9BA 5J7MA 3GBFA 4WV8A 4RFT0 2B39A 1JYWA 1UYYA 4CPBA 4CU9A 4CSWA 1JXNA 2IZWA 2RS53 5AVPA 3V56A 4CP1A 4BE3A 2PELA 4JQTA 3I49A 3AZXA 4NHLA 5C71A 3DECA 1J59A 5L73A 5DXDA 1OF4A 5FQ0A 2YBKA 1NKGA 3OBRA 4DUXA 1OD3A 4AEJA 1YJLA 3AZWA 1RITA 1LNSA 3ZO0B 4IETA 1ULOA 4I0WB 4IEVA 4XE9A 2PMWB 2WAOA 2G4IA 3JXSA 3ZXGA 1IQAA 1H8TB 4YVWB 2Q4SA 3JQXA 2VCMA 1Q8VA 2PLV2 3X29B 3CZJA 2VBBA 1ND3A 2Q5TA 4JTOA 4AOCA 4N8MA 3S7EA 4LBQD 4D7TA 3CDZB 4FTSA 1PM4A 4LHLA 2G9FA 1JUHA 3TN92 3TNPB 1N3OA 3CZUA 4BK5A 4CEYB 1LHUA 2YMZA 5KXDA 1G9AA 1NXD1 3O1SA 2LROA 3M70A 3Q9OA 2XLAA 4GB31 4M3CF 2VO5A 3BN6A 5T5LA 4XBLA 2R063 4XF9A 3WW3A 5FY1A 5A3UA 1SLTA 1DGWX 2XBO1 4FQ4A 3ALQA 4B1LA 4WM7B 2YUEA 3HR9A 3KT1A 4SLIA 3FHQA 1UY2A 2ZHKA 2JD4A 1I9RA 2IXLA 2Y6JA 4AEDC 1OH3A 3ZDSA 4KQ7A 4RYDA 4XZPA 2DBIA 3ZYBA 5I93A 1QWRA 1ODMA 4BU2A 4PF1A 3O1OA 2WC2A 1NZIA 2XJQA 5ANNA 3CJXA 4IEXA 5A7WB 4IE0A 1REEA 3IM0A 3SCFA 4B4QA 1W0NA 2YBPA 1H6XA 3VN4A 3ZXLA 4DO0A 4NMIA 2OUHA 4R4XA 2SLIA 5EV7A 1NY72 4QX5A 4FXGB 5FP7A 3ZFFB 3L9JT 4CDXC 1F9KA 3M3EA 4ZY9A 1KRIA 1JHNA 2GNMA 5C8CC 5F3IA 2VOTA 4YNIA 1UZVA 3U75A 2PN5A 3I7DA 3UGGA 2D98A 4JAAA 4Q4W3 4MHRA 3O14A 3DCQA 1ZVFA 1W06A 4IV1A 2AEYA 2P6HA 2EA7A 2X5IC 1WLTA 4SBVA 4ZZ8A 5KXEA 4Y22B 4HSJA 1DHKB 1WD4A 2B5HA 1OI6A 3F2ZA 1ODNA 4OUSA 1D2QA 3MIBA 2OQ7A 1WA6X 4LOSA 5ACA1 5A3OA 5GALA 3R0RA 3NVCA 2VMEA 2DUOA 3WG3A 1AYN1 4IV3C 5FV3A 5FWEA 1N47A 2ZGUA 1GZWB 3ZSEA 4IEZA 3VD3A 1AF9A 4QB6A 1UU4A 3MICA 1MZ5A 4FFIA 4FOYA 1EUTA 3O1TA 2PAEA 2J22A 2WLQA 5CVRA 2ZEXA 2G19A 3BTAA 1HRI1 3PNAA 1V6OA 2IVJA 3VBSA 2C24A 3WCSA 2Q30A 3H8RA 4DS0A 2ARAA 5IT6A 1QHDA 1VMFA 2JEMA 1W3VA 4BIFA 2VOVA 1O5LA 4MYEA 1W9SA 2YU2A 2PAKA 2VBPA 4RGAA 4ZU5A 2IVIB 4FPGA 4RS5C 1VP6A 5J1XA 1DLCA 2RS31 4JV4A 5SV5A 5A7PA 4E27A 2JB4A 1AR63 4MXVA 2XKPA 4QGNA 4QWNA 2LUWA 3RZJA 4BA6A 2Z42A 4D8MA 2WYSA 4CCEA 2R6QA 5FIXA 4AFCA 1XOYA 3T2PA 2UWCA 4DEQA 1PO12 4DOUA 3AC0A 4NIGA 1Y4WA 5JZGB 3OGGA 4NRMA 1PZ9A 1KS5A 2YY1A 3PUIA 5F3GA 3Q8EA 3POWA 5FLIA 5DUVA 1BEV3 3KWVA 4L11A 3KSCA 3RFRA 5LK7B 4QU2A 4JKMA 1PK6A 3DPRC 3WNOA 3FHIB 1AL23 1Y9MA 2VNVA 3SKVA 4LE3A 3MFCA 3ZYIB 4AVCA 2A6ZA 3OYWB 1S0GA 2A5ZA 2W52A 1GKBA 3FUOA 1B35B 1IPJA 1VBD2 2QQNA 3GBWA 4NROA 3V0BB 1W0PA 1DQ2A 1BJQA 1IGOA 4DZGA 1KFXL 4URAA 5IK5A 1UX6A 3ACGA 4Q0VA 3QOPA 3VDAA 2ATFA 5F5QA 1VB4A 5LZ6A 4UW3A 1MPXA 1UMHA 5J98B 4GD4A 5DAQA 3EXUA 3T2TA 1MEC1 1MACA 4PBOA 2A73B 5EFUA 5FZ8A 3OEAA 4KWUA 4GQ7A 3WHTA 3WUCA 3WY6A 5JR2A 1A34A 1QJFA 2V4AA 4ORFA 1VJ2A 1BBT3 4CDQB 2EIEA 5CFCA 1UYPA 4CUCA 1RUH2 1O3QA 3LOBA 5F32A 1DYPA 4H55A 1BCXA 4NHYA 3NAPC 3PUQA 3PL0A 4HKOA 1NXMA 1SZBA 3ZN5A 2ZAHA 1OA3A 1PIV2 2CY6A 4ATEA 2HEVF 4O61A 3WG2A 1W9YA 2Y60A 5L7OA 1GQPA 2WNVB 5GZCA 4PIYA 2ZEYA 2CAUA 4MV2A 1NAEA 2HWB2 2QKDA 1VBE3 4HFSA 1PX4A 1SHWB 3FLTA 3WZ1A 2PHRA 4K20A 2EICA 4Q0UA 4UFMA 5DDJ3 4BDVB 2RS52 1H8VA 2ZS6B 3ILRA 4QHBA 4XJ9A 1VBE1 5JI7A 4GWNA 2DTYA 5IYYA 1VLNA 3EBRA 5T5OA 1WCDJ 4XFHA 2VVFA 2VZQA 2UWBA 2PA7A 5L9RA 1C3HA 4CDWB 5J96B 3DKQA 2Z79A 4UOJA 2FMDA 2X29A 2VZTA 3VZJA 2OPKA 3HEIA 2QQLA 1F5FA 4Q0PA 4OULA 4RSUA 1OA4A 2Z5WA 3OY8B 4XUOA 5FYVA 5FZ7A 3O12A 2Q1MA 1IOAA 3DYOA 1VAMA 4HMZA 4F8AA 3UKTA 3B93A 1EPZA 4K1ZA 5K7PA 1QJX2 3FMGA 2YBSA 1ZA7A 1UY4A 2WSVA 4L99A 1LESA 1LGBA 5IVJA 3PVOA 2RM21 2F6BA 1H2NA 5FXVA 5JVVA 3R4UA 3R05A 3WG4A 4D6SA 5LA1A 1Q43A 4C0BA 3ECQA 4DUWA 1S2BA 1O3SA 4ITCA 2DU0A 4OI4A 2JG9C 2KM2A 2WZEA 3AKSA 3B02A 4GB33 1REDA 5IK7A 3O1VA 4JGYB 4KWLA 4GJZA 1AL21 4LK6A 3RJ2X 2QUOA 1N1YA 2OKXA 4KBZA 3T0BA 4TWTA 2P17A 2EF6A 3N7JA 4Q4V1 1O8SA 3NWKA 1DIWA 1BEV1 4BK4A 5EQUA 4AQSA 4AHYA 4AGGA 4EJRA 2QJVA 1BKZA 3MW4A 4EYUA 5JZGA 1CX4A 5DAVA 4QB1A 1TE1B 2IWGB 3QLQA 1DYOA 3I2FA 2X05A 1HLCA 2WRAA 3B9IA 1CD3G 1POV3 3QCWA 3ZYPA 1ACCA 1X36A 1VMJA 4LO7A 5FZ6A 3ZFGB 4A42A 1XNKA 5F5AA 4ES8A 2XL9A 1TME2 3FE5A 3H42B 4CP0A 2ZOEB 2UWAA 5LW9A 2H6BA 2JG8C 2JIJA 4D94A 4YFZA 5APAA 4P02B 5CISA 3AVSA 2MPFA 1W90A 3MI8A 1ENRA 4ZKTB 2PQQA 2V5DA 3GDBA 1MVEA 2QQIA 3N9PA 4F3JA 2C1FA 3BKZA 1V0AA 3RGBA 4E8CA 4CEWA 3VBOA 4XXAA 5F3EA 5C8WA 2JDKA 4S2FA 3Q8BA 4WVWA 1PM7A 2WO1A 4M01A 1GLHA 1W8TA 4I3GA 2K9ZA 5DUWA 3ZN6B 3KMHA 3N35A 3TEXA 1OOPA 3I2IA 1NCQA 3LIGA 4HK9A 1T6BX 5CZKA 5A7QA 3JB8A 3KV6A 3MW3A 1XBFA 2ORZA 5ACA3 1U5XA 5FZBA 3AKPA 1ZRRA 1QH6A 1XRUA 5FY0A 3ZXEA 3VV1A 3OY8A 5GM0A 1UW8A 1EV13 1MZEA 2XWJB 4V2VA 5FMOL 5EHDA 2HWF1 1RUE3 1RVF1 4AQ6A 5E6HA 4MGZE 4E2QA 1JN2P 1CAVB 1W6NA 1GOGA 5FBZA 3W20A 4M4PA 1HW5A 1QJY3 4CZSA 2DUQA 2OA2A 3IDCB 3LD8A 1SLBA 2WJSA 4PHZA 2P4EA 1DBNA 2YV8A 4FPEA 2RDQA 3ZYJB 1OQDA 3FBMA 5C5UA 2B42B 4FPOB 2P3IA 3T2QA 1BK1A 3EHKA 1NA1B 3MLKA 4YVSC 5FTTC 1ZBE1 4FAHA 3VDCA 1R081 3B01A 3C7EA 1GP5A 4JZRA 3O0WA 1GSLA 1HJGA 2WABA 4F83A 3AXDA 5LBFA 4LJHA 2AUYA 2W94A 1BHGA 3C8XA 5HV0A 2LRPA 2ARBA 4MH0E 1SFPA 5I0TA 2TBVA 1S0JA 2Y8KA 3WNXA 2YC4A 1M06G 3LEGA 1PMHX 4PLNA 5F5IA 4BHPA 2D3RA 4E4HA 4CDWC 2RS12 4W4ZA 5T3NA 2UURA 4NAMA 1VBB1 1OQEA 3OG2A 3GHNA 3NV4A 4BLIA 3I2JA 4WM8B 3D0SA 4BZ4A 2ID4A 4QKFA 4XDOA 1KITA 3WW1A 4HONA 4YW4A 3ZVXA 2QCSB 4EZHA 2CV6A 1UYXA 4CXXA 3A4UA 1XSQA 2O1QA 1LB2A 1LHNA 4LBNA 3LEIA 1I3HA 4CVUA 4FI9A 3LA3A 2EXJA 2YG0A 4QDQA 4GXLA 2OS2A 1RUF3 4I2OA 2XLFA 1KS4A 3HOBA 4BMBA 5JSPA 3ZIWA 3SEPA 4L2NA 1ZA4A 3LQCA 3M3QA 2LS6A 1QJX1 2ZCWA 3RQ0A 5L7OC 2E26A 2BGOA 2IXKA 5CKMA 2JX9A 4FOVA 4YM1A 4AEDA 2BV4A 4PBPA 3OSDA 2PHXA 4IUGA 1RUD1 1BYHA 5JSRA 1RXGA 2RMU2 4GH4C 2OYZA 5HI0A 2WDBA 4JRLA 4L0PA 3DPRA 5C33A 1MEC3 1OKQA 4AQTA 3TEYA 2CWMA 2IXCA 5D8AB 5F37A 5FZMA 2R062 3J7LA 2JIGA 4Y5Z0 1RUI3 1ZNPA 5JDBA 3KV4A 3KM5A 1V9U1 3OTFA 4UFLA 5K9YA 4LBQA 4FFGA 4HANA 3MPBA 1H9PA 2VR4A 4FPHA 5JMOA 3G7DA 5ERLA 4CP9A 4IQPA 4MZUA 3ZFGC 5CFDB 3H50A 2ADEA 1GWMA 5CU1A 2Q1ZB 1DGLA 3MYXA 1WCKA 2WWSA 3J26N 1MR5A 4N53C 4UYBA 3VBUB 3D5OA 5A1LA 1TME3 4RA0A 3K2OA 4QKBA 1ASJ1 1UNBA 4RHV1 2OPWA 4AI2A 1KFUL 4N7UA 1XYOA 4CDUB 1FMD1 1AX2A 1YQCA 4IERA 4K21A 3VBRC 1IS6A 2YGMA 3QH7A 3ZFEA 1HKDA 1ULEA 4C0HA 2UYBA 4IGPA 2VTFA 1SG3A 3FC0A 1W2UA 1ZZ9A 2VVDA 3RZKA 1WMDA 4Q8KA 2W1UA 4K40A 2PFWA 3O1PA 2WNOA 3RPQA 1NCRB 2VECA 3VLBB 1QGLA 1OVPA 5HXVA 1OF3A 3GZTB 1HRV2 3MUY1 4JDNA 4PDWA 3VKNA 4IXLA 4AHXA 4MXWA 1UKGA 2I45A 3VL9A 4CPBD 5F3CA 1W8FA 1IKPA 1ONAA 1ALYA 4IEYA 4B4PA 1QDCA 4XJZA 2HWD2 5JXHA 3CF6E 4IGQA 2WT0A 3ZFFC 3ES1A 1SDDB 1CIYA 1F15A 4XF4A 2QQOA 5FPAA 2XR4A 4LUMA 1RUG2 2E9QA 3BPZA 3LDKA 5IVYA 4CUAA 2D6MA 4A3ZA 1NQDA 4LO5B 4WVMA 1LRHA 3MW2A 5H9QA 3IDAA 4XCAA 3WG1A 3VBHA 1ZRFA 3NJVA 5FYUA 4AG4A 1YIPA 4CDWA 4IDZA 4COZA 1W2AX 1PMIA 4KL1A 4W6YA 5JPMB 1V6JA 3APBA 2FHRA 4YSFA 3JQWA 3Q8AA 2BNMA 1NCRC 5FK7A 4P9XA 1VIWB 2C26A 4FBFA 3VHNA 1UKRA 4XAAA 3LOIA 1PK6C 2YZ4A 1U5ZA 2XL7A 1L3JA 3GCXA 1RMU1 2GH2A 3MO4A 3HBKA 3RMXA 4A4AA 3PUHA 4Z8BA 3VUOA 1OLME 4DRVA 4ZU4A 4LKEA 2WQ8A 4XTPA 2A3YA 4GMP3 2R1BA 1PO13 2ZX2A 3RI9A 1YLLA 3Q8CA 2R071 4BH9A 1QNYA 2BU9A 4V2WA 3K51A 2Y0OA 2PTMA 2YFUA 3HNMA 3PJQA 5A33A 3ACHA 1PVXA 4E4DX 3GGLA 2R32A 3TWIA 5FOJB 1HQWA 3ELNA 5A3PA 1UCXA 1APNA 1AYM3 4JGZC 5JWPA 3A21A 4Q4X3 4QX8A 4XHBA 1JH5A 2DYCA 2Q0AA 3ENRA 1RUH1 5F6KA 2BFUL 4YGDA 3QD6A 1W9TA 3K77A 1LGNA 4XFAA 3L2HA 1AZDA 4NIIA 4ASKA 5CFCB 1Y7BA 3LCPA 1LGCA 5HCHA 2HBUA 3SQOA 2HEWF 2ZX3A 3QACA 2XLGA 2OVUA 2GNBA 3NNMA 5FZEA 2WO3A 2FZ2A 4OUEA 1Q3EA 1XNTA 1VRBA 2P37A 4HG6B 4A3XA 4NO4A 4EV0A 1UOGA 2HJIA 4LT5A 2RHPA 2YU1A 3AM2A 5BNNA 3WQ7A 2DVFA 2BWCA 4AXOA 4FCAA 4IEQA 1QU0A 2IFRA 5E1RA 1F8VA 5KR7A 3H8OA 2J1VA 3BPSA 1EY2A 4IEPA 4XFBA 4CCNA 4IGOA 4Q1PA 4OMDA 4AGRA 4C1WA 5FPBA 5E16A 1WCUA 2IFWA 1LU1A 2X09A 3UNPA 1GU3A 1QEXA 2I07B 1L7QA 1N3QA 4QX3A 3S30A 3S0MA 4JGZB 5BV6A 5C3SA 5HPOA 3KHCA 1J84A 2FDHA 1CR7A 1NLQA 3ZMNA 3IPVB 3M1HA 5AFBA 4WVZA 3S5AA 1E5RA 3QH6A 2QDRA 3RZLA 3GBGA 3KF5A 4BWOA 1NA1A 3VBRA 3RI8A 2QE3A 2MEV3 2C4XA 4OCTA 5FZDA 1JTZX 4YFWA 1S2KA 5KHGA 1J3QA 4ISQA 1NUKA 4PI2A 2VM9A 4QKNA 4UXAA 2K46A 4R9BA 5FK8A 4NIAA 1RB8G 1ZRDA 3WQ0A 3B00A 1E5IA 3ES4A 2W47A 1QF3A 3ACFA 2ZPXA 3THDA 1W6NB 3S5QA 1ZRCA 4J6GA 3PLQA 3D0JA 3PIGA 4Q0SA 3BI3A 2XMLA 2WWUA 1JS9A 2CGPA 2JKXA 4ZZ5A 4XBNA 2Y33A 5EJZB 2B9UA 3AZYA 1GR3A 3WF1A 5FPXA 2WS92 5CG8A 2ZX1A 3I3BA 2R043 4YM3A 5DG2A 2A6YA 4AI1A 1NE4A 2NYYA 5C5TA 2QZ3A 5JOYA 1ULCA 2Y38A 1CZTA 4LBMA 4U36A 4XACA 3O1RA 5A1FA 3RZMA 2ZGKA 4P00B 1LHWA 5FJHA 2JDYA 3E6BA 1CAXA 2WO2A 3U4XA 3LB9A 2HWE1 4UW5A 4MUVA 3OUIA 1XE0A 3H1MA 2VOXA 2HWE3 1H30A 4UAPA 1VBB2 4XIOA 3BODA 4KWJA 3LE0A 3MBWA 1AYN2 1KEXA 1GZWA 1CAXB 1K12A 2PHFA 3I4IA 3KT4A 2HEYF 4XETA 2XVKA 3C7GA 1F2NA 4GH4A 2VQAA 4XTMA 4I01A 4UWDA 1GV9A 4AR2A 5JIUA 1WBLA 3CJIA 5DUXA 5G04L 4Z92B 1QOTA 4HPKB 1QNWA 3OCPA 4MLOA 3SH4A 4QGMA 1KDMA 4COUA 1GQGA 5KHIA 1RUD3 4IV1B 2I2SA 4B3NA 2YYOA 4TLGA 2J1TA 3K48A 5SV8A 3CMGA 3MPPG 1XNAA 2NP0A 4YWAA 1CN1A 1O91A 1VBA3 1HDKA 4QPGA 3V65A 2XJTA 1FPN3 5BPXA 2R16A 3K3NA 2JG8A 3AB0A 5I0UA 1GMMA 4QQPA 2HWD3 1JYTA 1UZZA 2DVDA 2DBNA 5EYXA 1EYBA 4FPJA 1AR82 1QJU2 2G9ZA 2R0FA 1Z7S1 3AZZA 3KGZA 2BUKA 2VQTA 1DGRA 1FAYA 3LSEA 5LRSA 2VJXA 3OPWA 2ZACA 4OMCA 4HKLA 3ACIA 2P3KA 3FFZA 1JOBA 3DPRB 4H7MA 4FT8A 2VL4A 5JUVA 5FZ1A 3AKRA 3THTA 1IZ3A 5A6YA 2BOJA 5FY4A 3AP7A 1O7FA 2HWC3 3GZEA 3KVAA 4P9JA 4TSVA 5IWFA 4LBKA 1FI2A 4BQYA 2YC2A 5FLJA 1ND2B 2ZA9A 3OD0A 3VHPA 2DWRA 1NCQC 1UL9A 2HWC1 3J7NA 3R4SA 4IEWA 2E6VA 3DXUA 3HJRA 5FLHA 2JDUA 4AF9A 1VBD3 1JZ8A 1W0OA 1WW5A 5JAXA 4AI0A 2Y6KA 2C6SA 1O3RA 4FTEA 2RDNA 5FUIA 4GJYA 1ZM1A 4YARA 1RUG3 1UXXX 1S0IA 4JKKA 1ENQA 4KH9A 1LOGA 2HWC2 2ZMLA 4AEKA 1I6XA 3T1LA 4URTA 4ATFA 1I1EA 3FWEA 2WZ8A 4N43C 3TAYA 3KZ4C 5FZ4A 2VNOA 3AYEA 4HT1T 4NUBA 4O9GA 4CDQC 3AKTA 5I91A 5KWRA 3SNMA 4R4ZA 1PX3A 2ZGQA 1YUDA 2YPJA 1BMV1 2NMNA 4MADA 1OKOA 1TMF2 4Y4RA 4QAWA 4CU6A 3ATGA 4A45A 1IS3A 1VBC1 4Q27A 1NOVA 5ABJC 4I0BA 4YVSA 1AR81 4D0QA 4N53A 4WZFA 2O14A 4JDMA 5B4XA 5FXWA 5FMBA 2FDKA 3UETA 2FDJA 3AMPA 4MOAA 4N9HA 3PTRB 5LA2A 5C4WB 1WLDA 1ZBA1 4S2DA 5FMDA 5FJKA 3AP5A 4UBHA 4XMIA 4RR3C 2O8OA 1TMF3 4JRAA 4XQDA 1KJRA 2XUMA 3USUB 3IN9A 3GJAA 4NRQA 5FWJA 2JECA 1STMA 1KD7A 5CIRA 1FOD3 2QQVA 2A1XA 3RMYA 3NSTA 1OFSA 5IAXA 2W5FA 3OB8A 2MEV2 2EVXA 3SXWA 2D93A 3A7QA 3GJBA 4IE6A 1RUF2 1DGRN 3MF6A 3HBZA 3V0AA 3GCWA 1XNBA 3AXEA 4X6RB 2WFF2 1A3KA 2A6VA 1V70A 2ZMNA 1Y9QA 4YGEA 1HN1A 1RGSA 5FRAA 2ET7A 2AYHA 2YHJA 5FYZA 5IVVA 3CKHA 4LHSA 1NZCA 4NWWA 3VBFB 1VE0A 3GNEA 4BXSV 4OZOA 1JZ6A 4OVEA 3SMHA 1PVC1 2WS93 4HN0A 4NIHA 3POEA 3I97A 3E6CC 3SKJE 2RS13 1C1LA 3JD71 4YYOA 3H8UA 2DCTA 4AVBA 1UZWA 1ZREA 5DMYA 1W05A 2ZGTA 2EIBA 2WYFA 4FXKB 4AVSA 4A7KA 3U1XA 1AR73 1GYKA 3JD73 2RMU3 4YZ1A 5BNOA 2XHKA 1W8UA 2H6CA 1SLIA 5DAXA 3LAGA 4QPYA 2JG9B 1XE8A 3P3NA 4PIXA 2D97A 4ISRA 1IQDC 2F4PA 3WR0A 3LKJA 4FPLA 4XABA 1JYNA 2Q8CA 1PO23 3H1YA 2XJVA 4YW6A 4AHZA 4IEOA 4IV3A 5CKQA 4MVTA 5DAPA 2Q8OA 5CA6A 4OQ8A 1D0GA 3UK9A 3OPTA 4DUVA 4BM8A 4PLMA 1H1AA 2B46X 5F2WA 5GZEA 1FX5A 4X8NA 2RE9A 5E8AA 4CCLA 4B7KA 4LBOA 4X8PA 2RR13 4JCKA 1G7YA 3VBSC 1UMZA 4CDUC 3PURA 3BB6A 3LFIA 4B4RA 3O1UA 2NQYA 2Z2SB 4P08A 1RUOA 2RM23 2QQKA 3WCRA 2GC0A 2WN2A 4KU8A 4INDA 2HWB1 5FZ0A 1YRZA 3ON7A 4J1WA 3PMSA 3ZYGA 2RR11 3BIEA 2G9GA 4QXCA 1H8TC 2ETEA 4YVWC 1VRH1 5GZFA 1S0EA 1VB2A 1G8WA 2QQPA 1CAVA 1AR83 3AYDA 4YW7A 5FP4A 5HCFA 4XJAA 5FXZA 4BMEA 5C3PA 5J48A 4R9AA 3PJYA 3ZN4A 2HWE2 4DQAA 5A80A 1HRV3 3JBG3 1JI6A 2DTWA 2D6KA 1XXNA 3MLLA 4K1YA 1JZ7A 5B4NA 1RIRA 1UZ0A 2GU9A 4GWMA 2WO7A 1RUJ2 3LDRA 3HT2A 4QXKA 3FZ3A 3WDWA 5C9AB 5AC92 1JODA 1SACA 2R7EB 1JYVA 2XB6C 3GM8A 3GALA 3HNYM 4M0NA 1SLCA 5LBEA 5FYCA 4HK8A 3WHUA 3AL5A 4QT6A 4BQ1A 1OOPB 4LO4B 2J1SA 3WDVA 1LECA 4Q2FA 1UQXA 4Y1XA 5FMOS 3WVJA 4DXTA 1HN0A 3WP6A 1TZOA 1E5HA 3T30A 5ACA2 4ZHNA 3P6BA 1JHJA 2VVEA 3AMQA 5C9AA 1VBD1 1CJDA 4H2AA 2TEPA 3AMNA 5DN2A 3NRUA 1AR91 3DGTA 1SPPA 4IE7A 4WM8A 3B9CA 1JW6A 5FPVA 1K3IA 2PQSA 3ORJA 3ASIA 1MQTA 3VD7A 1REFA 1VRH3 3WUDA 4E2SA 1ZZ6A 1W8NA 3C7FA 4ZXEA 1RMU2 2XJUA 2ZGRA 2QDNA 3VGIA 5F9TA 2K2SA 2JDNA 2BP6A 2GN3A 1J83A 2W87A 3ZYFA 3D82A 2DCZA 2I74A 5FMCA 3TNQA 2FBEA 2UU8A 4B29A 2JG8B 2P3YA 4KU7A 3AKQA 3AX4A 2DURA 1NLSA 2KR2A 1DQ6A 5FPZA 3WQ1A 1WLWA 3AMHA 1X9PA 2IUWA 1JOJA 3O0XA 1C8M3 2A7AA 5J36A 4NAOA 3M2MA 3OJBA 1S4CA 3RDIA 4CUGA 5HBAA 5HXMA 3GXUA 1NQJA 4WM7A 3C7OA 5GZDA 4HPKA 1DFQA 2ILMA 2OT7A 3A0NA 4YG0A 3U14A 4ZU7A 2IC1A 1RYYA 2R041 2JDZA 2XQXA 4UFJA 1PO21 5FYBA 1YIFA 2GDFA 5A3NA 4K3UA 4UW6A 5DAWA 3WP4A 1AXKA 4Z2AA 3AP4A 3LGRA 4FP2A 3N9MA 1J1LA 4L9BA 2Q8EA 4EN9B 3ZR6A 1DDLA 1G9BA 1POQA 1CAUB 2ZAAA 2VZRA 4XBQA 1WMFA 3MHZA 4Z2WA 2GMMA 1LTEA 1QXRA 2QQMA 1A78A 4NJ4A 1VR3A 2WFF3 3MIDA 4LHKA 4Q29A 4W8JA 3NQHA 3TB0A 5FPUA 4XILA 1UY0A 4WZCA 3VKMA 3AP6A 1RHI2 2D6LX 1O4TA 1PVC3 1WLCA 2HBTA 1V6LA 2WS91 3KCYA 4GAZA 4KI5M 3TN93 4FPYA 4QPGC 2Y0IA 4LA3A 4HETA 5FZIA 1AXZA 4UFHA 3ZSKA 1RUG1 2GP3A 2VMGA 5BXXA 1JYIA 1T6GC 3EO6A 4R9DA 5JOWA 2V72A 4YG6A 5D1IA 1RUI1 4BCUA 1UPIA 4QX1A 2IXIA 4J1XA 4COVA 1K42A 1RUC1 5IFPA 4HVRA 3I2GA 5EJ1B 3GZAA 3SH5A 3UGHA 1DZRA 2XDVA 3OUHA 4OUMA 1WW6A 4A6SA 4QHZA 5FCCA 1PGSA 3UESA 3AFGA 2WZPP 5F7UA 1OD5A 1RHI3 2BDRA 1W28A 3JU9A 3NMBA 3RS6A 3W59A 2QVSB 5JXJA 1UIJA 1PGL1 3RRDA 3ZR5A 1WW7A 2Q1FA 3FL7A 3NAPA 5FPLA 2LALA 3PUAA 2SBAA 4YW1A 2VZOA 3ABZA 3N3HA 3RNSA 2KXLA 3LPGA 1W8HA 2BTVC 4OI2A 3O5SA 3RYPA 4NHXA 4QD2A 4QPIA 2PHDA 3KV5A 2ZJCA 3TYJA 4XUPA 5LEKA 4DY3A 3IMNA 4KG0A 2NN8A 3RSJA 3PTYA 3K4AA 1S0DA 3K46A 2Y64A 4IV3B 4N53B 4COYA 5C8CB 3UJQA 5GLVA 5FO8B 2QBXA 1HRV1 5FP8A 2DVBA 1UY3A 1PNFA 5C9AC 2VW1A 1H0BA 5C3OA 3M4FA 4RN5A 2X5IB 3LFMA 4NRPA 4UF0A 3VZLA 4AEMA 1ULGA 5BUVA 1RTVA 1PHMA 3U07A 4LITA 1O8PA 4AVAA 4D6RA 2BW8A 5BNOC 4MGYE 3HD8B 3ACLA 1R1A1 4XUNA 4Z82A 2Y6FA 2VNGA 4CCJA 5KHJA 2OIIA 1GICA 1OA2A 1SMVA 2DCYA 5FZAA 2WIIB 3WNPA 1NCQB 2NPIA 1C8NA 3I2HA 3JCIA 3OBAA 3M7AA 5C3QA 3LEMA 2LM3A 4RR3A 3VBOC 1CAUA 1F4AA 2AENA 1K5MA 1NT0A 1BLZA 2WA4A 1Q5OA 3N9NA 3MV01 4N9IA 1S0BA 4GKXA 3LWCA 4Y5SA 3ZKUA 4CEWB 4JDOA 4Z07A 1AVBA 3WF3A 1NE6A 3POGA 4EWDA 4NPLA 3HWJA 4LBJA 4AFAA 5GZGA 1W3XA 2BNNA 3AJYA 1AL0G 1QMJA 1JZ4A 2WUHA 1SBEA 4RQPA 4NE9A 2RMU1 4YZ3A 2ZEZA 2ZGSA 1K5JA 2DUPA 2EIGA 3OUJA 4NPMA 4XMAA 2YB7A 4QXBA 1MZ6A 4YW5A 4YPJA 4QX0A 3PIJA 4AFMA 1Y9GA 3WNMA 1HX6A 1YXWA 4YRDA 5JZGC 2VOKA 4H3WA 4Q4V2 2MHFA 4LKSA 2RS32 5HCBA 5C6CA 5I0SA 4HOOA 3IIAA 3NJYA 5A3MA 2VPVA 5KHHA 2ENRA 5C3RA 4QXHA 5FZKA 3MIFA 3FLPA 4I30A 1XJAA 4EN8B 2JDPA 2VW0A 1JU4A 3MIEA 3H9AA 1RUC3 1QJU3 1O4ZA 1SDWA 1UOFA 3LF7A 3QBQA 4P5HA 2E32A 3D3AA 1Z7S2 1HV0A 2ZGPA 4K7JA 1QJU1 3UT0A 3WW2A 3VHOA 4Q0QA 5LY1A 3ILNA 3IBMA 2XG3A 5A6ZA 4KWKA 1V6IA 2ZEWA 2ZX0A 1O6UA 1GP4A 1WMXA 5BY5A 1MZFA 1HXS2 2VMHA 2VTXA 3TN91 4C1XA 1K5MB 1TG7A 1OXCA 5C4WC 1JYXA 4AK3A 3OGVA 5EPAA 2ORXA 4GALA 2WFF1 3OGSA 1LOAA 2W1WA 4Y33A 2JICA 4AI9A 1AJOA 2JXAA 3POBA 3N7KA 4OHVA 5DABA 4BOWA 2QNKA 1ULDA 1IHMA 3CIHA 1VAVA 4R52A 1OBNA 4XVHA 3NJXA 5FQ0B 4RGGA 2CNAA 1FOD2 3VDDA 2XONA 5E88A 2AZ5A 5A1AA 4P14A 2V5YA 4AAPA 3DEMA 1HXS1 1FMD3 1R1A2 1R082 4XUQA 5FP3A 3CEWA 5JOZA 4CP9B 5FFOC 3BGAA 4XPVA 1TME1 2GC2A 2RV9A 2K0GA 2C9AA 3V0AB 2B8MA 3WDUA 1NYWA 4P9WA 2C5DA 2EXKA 4LPLA 3ZFFA 5H9PA 3SEEA 2XJSA 2ZGMA 3VBFC 2P1BA 2FDFA 4L97A 2V73A 2ZZQA 1IS4A 2ERFA 2WLPA 3AFKA 3PU3A 4YGCA 4WM7C 4DRRA 1QY4A 2KD7A 5AFEA 2J1UA 4O7XA 1R1A3 3NKGA 1TNRA 4Q8LA 1VAKA 5IVFA 1DP0A 1WUVA 1DQ1A 2YROA 3TBDA 1W99A 1KJLA 2VZVA 4Q4W2 4QQ2A 2QFEA 4AEDB 1VBB3 1WA4A 2C0ZA 3N4MA 1CQ9A 1S0FA 3IWZA 4LMFA 3T0AA 4ASLA 3CL1A 4H14A 4YVSB 3VDBA 1ZRIA 3C2UA 2EXIA 2J7MA 2VTXJ 3D8CA 4Q26A 3ZXAC 4DINB 5IFTA 2VZUA 4LK7A 2H0VA 2O0OA 3JB4C 3UL2A 4B1MA 3B7MA 3H1WA 3HN3A 3F95A 2Y6HA 4PF5A 4B7EA 3OBZA 1H4HA 1XU2A 2DVAA 4MO3M 4XQWA 2IXHA 1VBC2 4NHKA 3VBSB 1GNYA 3WNLA 3RG0A 3E97A 4HN1A 4JX0A 5CAZA 2JE9A 3WQBA 4TTGA 4GULA 4AHWA 4J25A 3USUA 1OFNA 2DDUA 1LCLA 5T52A 1AYM1 1W8WA 2Y34A 3WF0A 2FDIA 1FPN1 2WBKA 1VBA1 4R8HA 2VH9A 1UOBA 2RG4A 1LU2A 3USSA 5K4LA 1JZ2A 1QQP1 3LDBA 3PHMA 1G86A 1OLQA 3OGRA 4AAXA 5DZGA 5KC5A 1RHI1 3OGJA 1QOOA 2VZ3A 1G6NA 3LSDA 3I3MA 5CB7A 1R1ZA 5IHRA 3CNAA 1GWLA 1UF2C 4Y22A 4MG2A 3TEZA 2NLRA 4Q4Y3 3ZOIA 1JYCA 4WVVA 3T3YA 4BQ4A 3FX3A 1FXZA 1O4YA 2VE1A 3NV2A 2XOMA 4DIQA 1LOBA 1FV2A 3JBG2 5A3TA 4UI9L 4C91A 5CG9A 4PDWC 1WMEA 1GOHA 1SQ4A 4E4ZA 1W03A 5TSWA 1BBT1 1CPMA 3AYAA 5CNAA 3P1IA 3LIHA 5FY5A 5FZFA 3ZIXA 4LE4A 3AMMA 3WF2A 1U5IA 1J58A 2P34A 4BQWA 3CQOA 2TUNA 1BEV2 2J1RA 2A75A 1GZ9A 2WQZC 5C4WA 3B3QE 1AJKA 2QZ2A 1PNGA 2J1EA 1ZBA3 1DG6A 5LB6A 1UO9A 3B94A 1X33A 5GJ6A 1GOFA 1Q8QA 3SCGA 1KGYA 2R1DA 2Z4FA 2P3JA 2UYAA 1GZTA 2D6PA 4MSVA 1ENSA 4LHNA 2JDMA 2RM22 2V09A 4DFSA 4EWAA 3VL8A 2JE8A 3JZVA 4N43B 1RVF3 4YW2A 4YG3A 1C4RA 3CHXA 3VDDC 3WF4A 3IMMA 2GH8A 5FUNA 1NG0A 2AEZA 4HLTA 1ZZCA 5IAVA 1U0AA 3E6DA 1QJEA 4AVVA 2E51A 1AR62 5L19A 1YQ6A 1LOCA 4R9CA 3VZNA 4CEYA 4NWVA 4PDWB 3MIHA 2YFZA 4XIKA 2BGPA 4Y26A 5F5CA 1CONA 2GNTA 1V00A 2BFUS 1CZSA 1POV1 3NW4A 1AR92 4PCRA 2VY0A 1IPKA 5FY9A 1UWWA 1D0HA 2YPDA 1N1TA 5FAXA 1COV2 1D4M2 1EV12 1QXJA 2GSYA 1WGPA 1UXZA 4FFHA 1C8M2 4MGIE 4TYSA 4XDPA 3VBOB 1C1FA 4QPIC 1YQ2A 3ZFEB 2GC1A 2ZHMA 5JR7B 4CA9A 2J1AA 4PLOA 3OBTA 1SCSA 2X53S 1AR61 5A33B 1HB4A 1MS5A 2RS51 2P5BA 4NVPA 5IVEA 3AL6A 3CO2A 2VU9A 1AR93 4D6QA 1S55A 3POIA 1TEIA 4G9SB 2J42A 3ME2A 3NV3A 1XNCA 2DV9A 5JLVA 3HIFA 3MIGA 4Y1VA 2YXSA 3BCWA 4XURA 1PGW2 1GWKA 1UZYA 2R0HA 4YZ5A 2XVGA 2WNUB 1RUC2 3IZOA 2D5HA 4QX7A 3K3OA 4S2GA 2VOWA 3JUUA 4CDXA 4LORA 1F35A 1Z7S3 2Z69A 3N9LA 3HQRA 5FY7A 1H1IA 3FLRA 5IUQA 1FMD2 1QIQA 3PUSA 3KGLA 4QM8A 4Q1RA 4P9IA 3RZHA 2GMPA 5EXOA 1HV1A 3H3UA 4WVMB 4Q4X1 1S1AA 1ND2C 1AR72 1MS3A 1ND3C 1RUH3 3IPVA 5I8SA 1L7LA 1U5YA 2JWPA 4GIQA 4TXWA 1US2A 1ZZ7A 2VZSA 2JKBA 1QKQA 1D7PM 1BQPA 1EAH3 2E33A 4LIVA 1OPOA 2ZGNA 4L92A 1HB2A 5FYHA 1OLMA 4AWDA 2FDGA 1MEC2 5FR3A 4GH4B 5GLWA 1EUUA 2VXJA 3D4KA 3I59A 1BK0A 1W2TA 1EV11 4BISA 1SFNA 4FPFA 4OHZA 4DPNA 5L36A 2HWB3 1OLRA 4U2AA 4P9YA 1CJPA 1XQNA 1EPWA 2JENA 3BUCA 5A7OA 1ND3B 1VALA 3IDBB 5FP9A 5A3LA 2BVVA 5AVAA 4LXLA 1AX1A 1URXA 4JHTA 4ARXA 2YDEA 3B69A 4UBGA 1SLLA 5K0UA 1RL3A 3VKOA 2E7QA 3M3IA 4RS5A 1CVNA 2W95A 3HPNA 4NPRA 2A70A 5DUUA 5JIAA 5AC91 2BBAA 5C70A 1DZTA 4N43A 3VBFA 2EALA 3V64A 4FTBA 3HNBM 3JD72 1V6NA 5FYTA 4DXZA 5C8CA 1YFUA 4PI0A 1OURA 5E89A 4BB3A 1DLLA 5DQ0A 2ES3A 3W21A 3WD5A 1O59A 4E4SA 5J37A 5CKNA 3Q8FA 1PO22 3KCCA 1W2NA 1S2EA 1PZ7A 1V6KA 2JE7A 3KT7A 3EJKA 1RUJ3 4Y24A 2GALA 3O0VA 4MGQA 1C28A 4BPZA 3MV11 4NHMA 2WZR3 4A41A 5EZWA 1R64A 3VBRB 4UW4A 2B7YA 3NAPB 3FJSA 3ZPOA 1LEDA 1Y3TA 3MEPA 2JD9A 3I54A 1UX7A 3POJA 5CBLA 4PIZA 2P6CA 4M0HA 2HKXA 5FZHA 5GLZA 1VBC3 1NLRA 1W04A 2WNVC 5D2AA 5H9SA 4GKYA 4AFBA 5LCWL 4MGKE 1H2KA 4RL7A 4FOWA 1XYNA 3K75B 4A44A 1UD1A 4OFGA 4ET7A 3AVRA 2A6XA 4AGVA 2Y6LA 2D40A 2OXBA 3C7HA 1HJFA 1ST8A 4XQ4A 1XU1A 1FPN2 3DYPA 4QPWA 1C8M1 1YO8A 4LKDA 1SBDA 3VDDB 2VZ1A 4IESA 4RS5B 1UAIA 3AYCA 1WWYA 4N7IA 2OUJA 1FOD1 1QQP2 3CBNA 3T0DA 4M00A 1AUYA 3ROUA 2JDHA 1M4WA 1RUD2 2P2KA 2QQJA 2VW2A 5FDBA 5T5PA 1XC6A 2HLEA 2WWJA 4RHV2 1RUNA 1B35A 1VMHA 2AH2A 5FYYA 1LR5A 1H2LA 5JSOA 2GP5A 4EN6B 4FAGA 4Q4Y1 4NIDA 2XH6A 2OZ6A 3OEBA 4A2UA 4LLFA 5LA9A 5M0TA 4GMP0 2PHUA 2F17A 3B5LB 4FO9A 3SISA 3ZSMA 1OUXA 4QDRA 1QQP3 1RXFA 2CHHA 3NO8A 5H9RA 3CU7A 3SITA 3I2DA 4AI8A 4AQ2A 1W6OB 3M3CA 5FZ3A 1RC6A 3H7JA 1ND2A 2NZ9A 4GWIA 2GZWA 1WCQA 2DFCA 2VAUA 3CJIC 4FQZA 1A8DA 5LY2A 3VBUA 1N1SA 4PQ9A 4KBBA 3BU7A 2IXJA 3I3EA 4ARYA 3IAQA 5F6LB 1W2OA 2XXZA 2BEOA 1H6YA 3BOPA 2X8KA 5CFDA 1VRH2 3FBYA 2QQUA 1QJZA 4QDSA 2HWD1 2AGSA 2GMEA 2VCBA 3S7IA 4TZDA 1W8ZA 2W91A 1W6PA 4ES9A 2FCVA 4DMIA 4LLOA 4RQPB 4CDXB 1H1MA 4BQ5A 4IV1C 3HVDA 1XYPA 3JBG1 4RD7A 5J09A 3MLJA 3VBHB 5FZOA 2ADDA 1BBT2 2VC9A 2JDAA 1UPSA 4QPGB 3EQEA 1DQ0A 3J7HA 3N9QA 2ZZJA 2W68A 1ZBE2 4OHYA 2CTVA 5K8SA 5IK8A 5CFCC 4O9EA 1V6MA 1GP6A 1ZZBA 2RJKA 1YQ5A 2PLV3 3GHMA 3H3ZA 4M3CB 2BWAA 1WW4A 5DG1A 5DDJ2 1L7RA 1S0CA 1IKQA 1YC61 1D2SA 2D44A 2VXRA 4RR3B 4MGTA 4DXRA 1BMV2 4NOTA 5T55A 2WN3A 1YI9A 4ZS3A 2QQWA 1XNDA 2W3JA 4XUTA 5FOBB 2FCTA 1YFWA 2VQUA 2HWF2 1QOSA 2WT2A 1R083 2VUCA 3WNNA 2CSGA 4UFIA 1ZBE3 5FZ9A 3WDTA 4Y1UA 2LW8A 1H9WA 1YNAA 4XEZA 1SLAA 5FBJA 3VZKA 3ZM8A 5GLTA 4QX2A 3VD5A 4FPCA 1F5JA 3ZYHA 1GNHA 4XJUA 1PVC2 3I3DA 3U10A 2BBVA 1TNFA 1LKNA 1QJY1 2E7TA 3FN9A 3H0OA 5IK4A 2W9XA 4KGQA 2BVBA 3ZXJA 5LWBA 2HWF3 2XUEA 4DXSA 2XPJA 1AXYA 1W9FA 2UY8A 1LODA 1YHFA 2AACA 1Q8SA 5CYYA 4LULA 1EP0A 2L9LA 5KBFA 3MDPA 2WSUA 2D3SA 1I5ZA 5CADA 1IS5A 3UGFA 4IE4A 2RS11 1HQNA 1HB1A 4IW3A 1DQ5A 4LBQB 2AC1A 1B09A 1KXGA 4PT6A 1SBFA 4TN7A 1N3PA 4D7SA 5JI9A 4P9LA 4Y1YA 3D6EA 2D7FA 1X8MA 4AVTA 1OT5A 4YW3A 2XGXA 1K45A 3MZHA 4IE5A 1MQTB 5L7OB 3BIWE 1CAWA 2E63A 2RJLA 1W9WA 3J9SA 1SEFA 2XBO3 3LA2A 2GC3A 3EYPA 1UYZA 4KG8A 2VMDA 3I2KA 4E2GA 2JG9A 4XFCA 2XHNA 1DZQA 1FV3A 4XZUG 5T5JA 4E9KA 1UY1A 2BPA2 5F39A 4A7YA 4QQOA 1VBA2 1QJX3 3KHBA 5DPNA 4Q4Y2 3ZMOA 2D3PA 5BNOB 1YEWA 4X6QB 4M3CE 3S57A 5FZLA 2BZDA 5K0UC 2RVAA 1LHVA 4JC1A 2TNFA 5GLUA 3RYKA 2B9VA 3VB9A 3A0KA 1SCRA 1JU3A 2ZXQA 4XCBA 5FXXA 4XFIA 1YYNA 3HQUA 3IKWA 4LO8A 5A32B 3TOJA 1JBCA 2WA3A 3TEWA 5KC6A 4XC9A 4JGYC 2OX0A 3ITQA 4RHV3 3DN7A 3U11A 4Q4V3 1AYN3 3LEKA 4I0AA 4KNCA 1MS4A 4UF0B 3SCHA 1JZ3A 1W39A 1X50A 3BOWA 5F2SA 4LBLA 2NM1A 2R49A 4HSLA 4W6XA 4Y1ZA 3IDEA 4A6OA 4ASMB 5FO7B 1R093 3RVHA 1QXPA 2WZR2 4QB2A 3T4HB 3U4SA 2ARCA 4P9GA 1ENXA 1CAWB 4QM9A 1DGWA 2GN7A 2F4LA 4G3YC 3W58A 5CEHA 5ISLA 4JVAA 4OI1A 4Q4W1 2X10A 3AJZA 3AP9A 3DV8A 4BYYA 4CEWC 4FSJA 1CZVA 4XJ8A 4GA9A 1PIV1 4QPIB 3ZFEC 3KLSA 1BXHA 2YGLA 4E8DA 4CXYA 5FKCA 5BNPC 3NKTA 2D6OX 4BQXA 2VBDA 5FUPA 4D3WA 4I02A 4G4FA 2WNVA 3VZMA 4D7YA 4WM8C 2RS33 1OOPC 3T2OA 1Z78A 4QKDA 4AL9A 3T1MA 1QDOA 5LASA 1A6CA 4FVVA 1COV3 1D4M3 1UU6A 4K8RB 2VG9A 1QH7A 2VUJA 1H2MA 4WBBA 5C7GA 2VMIA 4LUKA 5LATA 3BYWA 4XXPA 5IVBA 4EN7B 2ARXA 2WNUC 4Y20A 4KMQA 1DQ4A 1LULA 2ZHLA 1BZWA 2BYVE 3KVBA 4HBNA 1CPNA 4MX3A 1IG3A 1Z0HA 4W50A 5FZGA 5DZEA 3UJOA 5BNPB 1B35C 1P8JA 2AR6A 2XVLA 1AYM2 4S2HA 5D8AC 4FPKA 2HH9A 4Y5TA 1RMU3 3URFA 3U0ZA 1W6MB 4XDQA 5EWSA 3N9OA 4F7ZA 5LK5A 3MFAA 2EAAA 2VZPA 2CDPA 4ONUA 2CYFA 2VULA 2FQPA 2VNRA 3N7MA 4HL0A 3V0BA 3PVNA 5JPNB 3NV1A 1BVP1 1ULFA 1GQHA 4K8FA 3ZXDA 4CCCA 4XAEA 3ZYRA 4DEVA 2GAUA 2DU1A 1NCRA 4OQ9A 2AREA 3ZDVA 2ZX4A 3PU8A 4HVQA 1JZ5A 1WZXA 2DCKA 3GYDA 2PHLA 2PAMA 4AE2A 2XKOA 3I3QA 1VBE2 3VBUC 1HRI2 2OW4A 4GWJA 3KQRA 3DF0A 4ZONA 3ETQA 2V4VA 1LOEA 4META 5CFDC 3WOGA 3FHAA 1X82A 4Q4X2 1C5HA 3T4VA 2VCAA 3K4ZA 1GANA 4BIOA 3DKWA 4NR1A 1YCIA 3WINE 3ILFA 1W6PB 4EE2A 2RDRA 3WX5A 3R6SA 5BYNA 1F31A 3ZFGA 1GFF2 4PQQA 4YZ2A 1DU3D 1V9U3 1EAH2 4YM2A 3ETPA 4B8EA 2BERA 4QQHA 1GUIA 3DYMA 3NJZA 5I8TA 1LOFA 1IPSA 1G9CA 2NMOA 2R30A 1XB9A 4OZXA 1POV0 2WT1A 5IATA 1Q8OA 4GZ9A 2BQPA 1J3RA 4XFGA 2YC0A 4JHZA 1MVQA 4OHWA 2B45X 2UY9A 2ZGOA 1NY71 5BNNC 3RWKX 3AZVA 4I09A 4I3PA 4JGYA 2A3WA 5DZFA 5D21A 4IEUA 3WNKA 3DXTA 5IW0A 3SHRA 5FKBA 2ZHNA 3NNLA 3T08A 2PXJA 3A23A 3M3OA 2W1QA 1N1VA 3VHRA 4DY5A 2WR9A 5B2GB 4MHUA 1H8TA 4YVWA 3DUIA 3OOXA 4ZS2A 4Y4YA 2E31A 1HB3A 2XBO2 3J8F1 1HQLA 2DF7A 3IB3A 5F8PA 4EROA 4EZ4A 4ZPIA 4XF0A 5FYSA 2EAKA 3RYRA 1RUJ1 2FCUA 3HT1A 1PMJX 5FYIA 4LO6B 4M3CA 4Y3OA 4NN0A 5BNPA 2BGCA 2BNOA 5T54A 1OQ1A 3IT8A 3H8XA 2ET1A 3G6JB 2ZKLA 3LPFA 3VKLA 4PJYA 4A7ZA 1ZYBA 2D43A 2OZJA 3VD4A 1E5SA 1CGPA 2H0BA 3GF6A 1PZ8A 2HYXA 4QU1A 1CIWA 3RJRA 5IVCA 2WQ4A 3POFA 2CL2A 4AFDA 1RUF1 3WV6A 4CYDA 5AC93 3ZXKA 5EJ3A 4CCMA 5FO9B 1GNZA 1PGL2 2R072 4HVOA 2ZKNA 4YZ4A 3U78A 4JKLA 4XW3A 1ASJ2 5I0RA 2PYTA 5LA0A 3RZGA 3H7YA 1WKYA 3KCXA 4W6WA 4P5YA 1ZZ8A 2PHWA 4EWEA 3P3PA 2XWBB
chains in the Genus database with same CATH topology
2W92A 5LA1A 1UXZA 2W5FA 3ECQA 4DUWA 1YQ2A 3OB8A 2J1AA 3IIIA 2WZEA 3A7QA 2W1SA 2C9KA 2OKXA 2B4KA 3T0BA 1HN1A 1O8SA 2W46A 5JXGA 3CKHA 4LHSA 4BK4A 4BXSV 1US3A 1JZ6A 4OZOA 4CUAA 4XURA 4QB1A 3WEZA 3I97A 1DYOA 3I2FA 2X05A 3SKJE 3U37A 5DMYA 2EIBA 4A42A 4CU8A 4P02B 4M4RA 1IQDC 1NX9A 1JYNA 2V5DA 3GDBA 2QQIA 4TXWA 1UMIA 1US2A 2VZSA 1D7PM 4E8CA 2Y6GA 2E33A 1XPWA 2WO1A 4DUVA 1EUUA 3VD9A 5G05L 3MUZ1 2CDOA 3I2IA 3W5NA 4P08A 5CZKA 3IAPA 2QQKA 4ARXA 3VD4A 2WN2A 2ORZA 4CUBA 4LQRA 5IJRA 2W95A 3HPNA 5C70A 2BBAA 2EIDA 3HNBM 2VMFA 2WAAA 4OYUA 1GOGA 4M4PA 1JI6A 1JZ7A 5DQ0A 5B4NA 1UZ0A 1O59A 2R7EB 1JYVA 3GM8A 3HNYM 3T2QA 3VDCA 3C7EA 4MGQA 3MV11 4A41A 2J1SA 1R64A 2WABA 1ULPA 4DXTA 3P6BA 2W94A 1JHJA 1BHGA 2JD9A 3C8XA 1UX7A 5DN2A 3NRUA 2Y8KA 1TVGA 2YC4A 3LEGA 1PMHX 5LCWL 1K3IA 2PQSA 3A22A 1W8OA 3K75B 3VD7A 4A44A 4ET7A 1W8NA 3C7FA 4W4ZA 4ZXEA 2Y6LA 3C7HA 3OG2A 1J83A 4QPWA 3DYPA 3I2JA 2W87A 2VCCA 2ID4A 2VZ1A 3T0DA 2RJ2A 2QQJA 1UYXA 1T2XA 1XC6A 2HLEA 2VMCA 3LEIA 4CVUA 4FI9A 3W5MA 2YG0A 5HXMA 4BJ0A 3GXUA 4QDQA 3C7OA 3OEBA 3HOBA 1F4HA 3SEPA 3WSOA 1OH4A 1RYYA 2XQXA 3LQCA 2LS6A 4QDRA 2E26A 2BGOA 4Z2AA 4IUGA 4GWIA 2WDBA 4L0PA 1WCQA 3EB7A 5I0DA 2VZRA 2QQMA 3I3EA 4ARYA 4W8JA 3IAQA 3NQHA 1H6YA 1UY0A 4QDSA 2VCBA 4KI5M 2W91A 2VR4A 5JMOA 2V72A 4QX1A 3K4DA 1K42A 2VC9A 3NNGA 2JDAA 5IFPA 3I2GA 5EJ1B 3J7HA 2DCJA 3UESA 5F7UA 3THCA 5JXIA 3T09A 4CU7A 5JXJA 1L7RA 3E1F1 3FL7A 2VTFA 1SG3A 1I5PA 1CX1A 4DXRA 3ABZA 2W1UA 2VZOA 3LPGA 2WN3A 4XUTA 2W3JA 2VQUA 1OF3A 3WNNA 3MUY1 4XUPA 2LW8A 4MGSA 5EIYB 3ZM8A 3K4AA 3K46A 2Y64A 4QX2A 3VD5A 5JXHA 2QBXA 1SDDB 3I3DA 1UYYA 1JYWA 1CIYA 4CU9A 2QQOA 1UY3A 3FN9A 2W9XA 4RN5A 4A3ZA 5C71A 3DECA 4DXSA 3IDAA 1OF4A 1NKGA 4DUXA 1OD3A 5CYYA 3NJVA 2L9LA 4AG4A 1O8PA 1LNSA 1ULOA 3JXSA 2WAOA 4XUNA 4PT6A 3CZJA 2C26A 4ZZ5A 3WNPA 3MO4A 3CDZB 4A4AA 3I2HA 3PUHA 3OBAA 1OT5A 2WQ8A 1K45A 1F4AA 3CZUA 4BK5A 1W9WA 3MV01 2VO5A 2YFUA 3BN6A 3HNMA 3ACHA 3GGLA 3EYPA 1UYZA 3WF3A 2VMDA 3I2KA 3A21A 2XHNA 4XZUG 3FHQA 1UY1A 1UY2A 5DPNA 2Y6JA 4RYDA 1W9TA 3K77A 1JZ4A 2WUHA 2BZDA 4PF1A 2RVAA 2ZEZA 2YB7A 2B9VA 2WO3A 4YPJA 2ZXQA 4QX0A 1JU3A 1W0NA 4OUEA 3WNMA 1H6XA 1XNTA 4LKSA 4HG6B 4ZY9A 2VOTA 3LEKA 1JZ3A 1JU4A 2J1VA 4A6OA 4OMDA 2E32A 3D3AA 4QB2A 2X09A 4ZZ8A 3UNPA 1GU3A 1L7QA 4QX3A 3F2ZA 5HPOA 2ZEWA 1J84A 2X10A 2VMEA 1TG7A 1CZVA 1JYXA 3OGVA 2ORXA 3VD3A 4QB6A 4E8DA 3OGSA 2C4XA 1EUTA 2W1WA 1NUKA 2VM9A 2J22A 2ZEXA 2W47A 3T2OA 3ACFA 3CIHA 3THDA 4XVHA 3NJXA 2XONA 5A1AA 2JKXA 5C7GA 5EJZB 1W9SA 4XUQA 3WF1A 3BGAA 4KMQA 3I3BA 2RV9A 5J1XA 1DLCA 4LPLA 4W50A 3SEEA 1CZTA 1P8JA 4P00B 2WYSA 4D8MA 2WO2A 3T2PA 4DEQA 2KD7A 3AC0A 2VZPA 2CDPA 2J1UA 4UAPA 3PUIA 1DP0A 3LE0A 3MBWA 1KEXA 4DEVA 1W99A 1K12A 2VZVA 4JKMA 3C7GA 1JZ5A 2DCKA 3T0AA 3WNOA 5G04L 3SKVA 3VDBA 2J7MA 4GWJA 2V4VA 3FHAA 5IFTA 2J1TA 2VZUA 3CMGA 1XNAA 2QQNA 2VCAA 3K4ZA 3HN3A 2Y6HA 3ACGA 3VDAA 4MO3M 1MPXA 1GMMA 1GNYA 4PQQA 1UMHA 3WNLA 4JX0A 3WQBA 4TTGA 3ETPA 2BERA 3OEAA 3DYMA 1GUIA 4KWUA 2DDUA 2VQTA 5JR2A 3WF0A 2VJXA 2WBKA 4OMCA 2EIEA 3ACIA 4CUCA 1JZ2A 2VL4A 4GZ9A 5JUVA 3OGRA 4AAXA 4JHZA 2VZ3A 5IHRA 2YC2A 3WNKA 1GQPA 2XOMA 1JZ8A 3HJRA 3T08A 2ZEYA 4UI9L 3A23A 1NAEA 1GOHA 2W1QA 2Y6KA 1PX4A 1SHWB 3P1IA 5FUIA 2EICA 3WF2A 4BDVB 1UXXX 3CQOA 4JKKA 2E31A 5IYYA 2J1RA 3IB3A 2WZ8A 1PMJX 2J1EA 2VZQA 1PX3A 1GOFA 1KGYA 2Z4FA 4UOJA 4MADA 2VZTA 3LPFA 3HEIA 4QAWA 2JE8A 2QQLA 4A45A 4CU6A 3WF4A 4D0QA 2HYXA 4XUOA 5B4XA 3UETA 3DYOA 4MOAA 5LA2A 2YFZA 4JKLA 2BGPA 1UY4A 5LA0A 1CZSA 1WKYA 4P5YA 1UWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W92 A;  5LA1 A;  1UXZ A;  2W5F A;  3ECQ A;  4DUW A;  1YQ2 A;  3OB8 A;  2J1A A;  3III A;  2WZE A;  3A7Q A;  2W1S A;  2C9K A;  2OKX A;  2B4K A;  3T0B A;  1HN1 A;  1O8S A;  2W46 A;  5JXG A;  3CKH A;  4LHS A;  4BK4 A;  4BXS V;  1US3 A;  1JZ6 A;  4OZO A;  4CUA A;  4XUR A;  4QB1 A;  3WEZ A;  3I97 A;  1DYO A;  3I2F A;  2X05 A;  3SKJ E;  3U37 A;  5DMY A;  2EIB A;  4A42 A;  4CU8 A;  4P02 B;  4M4R A;  1IQD C;  1NX9 A;  1JYN A;  2V5D A;  3GDB A;  2QQI A;  4TXW A;  1UMI A;  1US2 A;  2VZS A;  1D7P M;  4E8C A;  2Y6G A;  2E33 A;  1XPW A;  2WO1 A;  4DUV A;  1EUU A;  3VD9 A;  5G05 L;  3MUZ 1;  2CDO A;  3I2I A;  3W5N A;  4P08 A;  5CZK A;  3IAP A;  2QQK A;  4ARX A;  3VD4 A;  2WN2 A;  2ORZ A;  4CUB A;  4LQR A;  5IJR A;  2W95 A;  3HPN A;  5C70 A;  2BBA A;  2EID A;  3HNB M;  2VMF A;  2WAA A;  4OYU A;  1GOG A;  4M4P A;  1JI6 A;  1JZ7 A;  5DQ0 A;  5B4N A;  1UZ0 A;  1O59 A;  2R7E B;  1JYV A;  3GM8 A;  3HNY M;  3T2Q A;  3VDC A;  3C7E A;  4MGQ A;  3MV1 1;  4A41 A;  2J1S A;  1R64 A;  2WAB A;  1ULP A;  4DXT A;  3P6B A;  2W94 A;  1JHJ A;  1BHG A;  2JD9 A;  3C8X A;  1UX7 A;  5DN2 A;  3NRU A;  2Y8K A;  1TVG A;  2YC4 A;  3LEG A;  1PMH X;  5LCW L;  1K3I A;  2PQS A;  3A22 A;  1W8O A;  3K75 B;  3VD7 A;  4A44 A;  4ET7 A;  1W8N A;  3C7F A;  4W4Z A;  4ZXE A;  2Y6L A;  3C7H A;  3OG2 A;  1J83 A;  4QPW A;  3DYP A;  3I2J A;  2W87 A;  2VCC A;  2ID4 A;  2VZ1 A;  3T0D A;  2RJ2 A;  2QQJ A;  1UYX A;  1T2X A;  1XC6 A;  2HLE A;  2VMC A;  3LEI A;  4CVU A;  4FI9 A;  3W5M A;  2YG0 A;  5HXM A;  4BJ0 A;  3GXU A;  4QDQ A;  3C7O A;  3OEB A;  3HOB A;  1F4H A;  3SEP A;  3WSO A;  1OH4 A;  1RYY A;  2XQX A;  3LQC A;  2LS6 A;  4QDR A;  2E26 A;  2BGO A;  4Z2A A;  4IUG A;  4GWI A;  2WDB A;  4L0P A;  1WCQ A;  3EB7 A;  5I0D A;  2VZR A;  2QQM A;  3I3E A;  4ARY A;  4W8J A;  3IAQ A;  3NQH A;  1H6Y A;  1UY0 A;  4QDS A;  2VCB A;  4KI5 M;  2W91 A;  2VR4 A;  5JMO A;  2V72 A;  4QX1 A;  3K4D A;  1K42 A;  2VC9 A;  3NNG A;  2JDA A;  5IFP A;  3I2G A;  5EJ1 B;  3J7H A;  2DCJ A;  3UES A;  5F7U A;  3THC A;  5JXI A;  3T09 A;  4CU7 A;  5JXJ A;  1L7R A;  3E1F 1;  3FL7 A;  2VTF A;  1SG3 A;  1I5P A;  1CX1 A;  4DXR A;  3ABZ A;  2W1U A;  2VZO A;  3LPG A;  2WN3 A;  4XUT A;  2W3J A;  2VQU A;  1OF3 A;  3WNN A;  3MUY 1;  4XUP A;  2LW8 A;  4MGS A;  5EIY B;  3ZM8 A;  3K4A A;  3K46 A;  2Y64 A;  4QX2 A;  3VD5 A;  5JXH A;  2QBX A;  1SDD B;  3I3D A;  1UYY A;  1JYW A;  1CIY A;  4CU9 A;  2QQO A;  1UY3 A;  3FN9 A;  2W9X A;  4RN5 A;  4A3Z A;  5C71 A;  3DEC A;  4DXS A;  3IDA A;  1OF4 A;  1NKG A;  4DUX A;  1OD3 A;  5CYY A;  3NJV A;  2L9L A;  4AG4 A;  1O8P A;  1LNS A;  1ULO A;  3JXS A;  2WAO A;  4XUN A;  4PT6 A;  3CZJ A;  2C26 A;  4ZZ5 A;  3WNP A;  3MO4 A;  3CDZ B;  4A4A A;  3I2H A;  3PUH A;  3OBA A;  1OT5 A;  2WQ8 A;  1K45 A;  1F4A A;  3CZU A;  4BK5 A;  1W9W A;  3MV0 1;  2VO5 A;  2YFU A;  3BN6 A;  3HNM A;  3ACH A;  3GGL A;  3EYP A;  1UYZ A;  3WF3 A;  2VMD A;  3I2K A;  3A21 A;  2XHN A;  4XZU G;  3FHQ A;  1UY1 A;  1UY2 A;  5DPN A;  2Y6J A;  4RYD A;  1W9T A;  3K77 A;  1JZ4 A;  2WUH A;  2BZD A;  4PF1 A;  2RVA A;  2ZEZ A;  2YB7 A;  2B9V A;  2WO3 A;  4YPJ A;  2ZXQ A;  4QX0 A;  1JU3 A;  1W0N A;  4OUE A;  3WNM A;  1H6X A;  1XNT A;  4LKS A;  4HG6 B;  4ZY9 A;  2VOT A;  3LEK A;  1JZ3 A;  1JU4 A;  2J1V A;  4A6O A;  4OMD A;  2E32 A;  3D3A A;  4QB2 A;  2X09 A;  4ZZ8 A;  3UNP A;  1GU3 A;  1L7Q A;  4QX3 A;  3F2Z A;  5HPO A;  2ZEW A;  1J84 A;  2X10 A;  2VME A;  1TG7 A;  1CZV A;  1JYX A;  3OGV A;  2ORX A;  3VD3 A;  4QB6 A;  4E8D A;  3OGS A;  2C4X A;  1EUT A;  2W1W A;  1NUK A;  2VM9 A;  2J22 A;  2ZEX A;  2W47 A;  3T2O A;  3ACF A;  3CIH A;  3THD A;  4XVH A;  3NJX A;  2XON A;  5A1A A;  2JKX A;  5C7G A;  5EJZ B;  1W9S A;  4XUQ A;  3WF1 A;  3BGA A;  4KMQ A;  3I3B A;  2RV9 A;  5J1X A;  1DLC A;  4LPL A;  4W50 A;  3SEE A;  1CZT A;  1P8J A;  4P00 B;  2WYS A;  4D8M A;  2WO2 A;  3T2P A;  4DEQ A;  2KD7 A;  3AC0 A;  2VZP A;  2CDP A;  2J1U A;  4UAP A;  3PUI A;  1DP0 A;  3LE0 A;  3MBW A;  1KEX A;  4DEV A;  1W99 A;  1K12 A;  2VZV A;  4JKM A;  3C7G A;  1JZ5 A;  2DCK A;  3T0A A;  3WNO A;  5G04 L;  3SKV A;  3VDB A;  2J7M A;  4GWJ A;  2V4V A;  3FHA A;  5IFT A;  2J1T A;  2VZU A;  3CMG A;  1XNA A;  2QQN A;  2VCA A;  3K4Z A;  3HN3 A;  2Y6H A;  3ACG A;  3VDA A;  4MO3 M;  1MPX A;  1GMM A;  1GNY A;  4PQQ A;  1UMH A;  3WNL A;  4JX0 A;  3WQB A;  4TTG A;  3ETP A;  2BER A;  3OEA A;  3DYM A;  1GUI A;  4KWU A;  2DDU A;  2VQT A;  5JR2 A;  3WF0 A;  2VJX A;  2WBK A;  4OMC A;  2EIE A;  3ACI A;  4CUC A;  1JZ2 A;  2VL4 A;  4GZ9 A;  5JUV A;  3OGR A;  4AAX A;  4JHZ A;  2VZ3 A;  5IHR A;  2YC2 A;  3WNK A;  1GQP A;  2XOM A;  1JZ8 A;  3HJR A;  3T08 A;  2ZEY A;  4UI9 L;  3A23 A;  1NAE A;  1GOH A;  2W1Q A;  2Y6K A;  1PX4 A;  1SHW B;  3P1I A;  5FUI A;  2EIC A;  3WF2 A;  4BDV B;  1UXX X;  3CQO A;  4JKK A;  2E31 A;  5IYY A;  2J1R A;  3IB3 A;  2WZ8 A;  1PMJ X;  2J1E A;  2VZQ A;  1PX3 A;  1GOF A;  1KGY A;  2Z4F A;  4UOJ A;  4MAD A;  2VZT A;  3LPF A;  3HEI A;  4QAW A;  2JE8 A;  2QQL A;  4A45 A;  4CU6 A;  3WF4 A;  4D0Q A;  2HYX A;  4XUO A;  5B4X A;  3UET A;  3DYO A;  4MOA A;  5LA2 A;  2YFZ A;  4JKL A;  2BGP A;  1UY4 A;  5LA0 A;  1CZS A;  1WKY A;  4P5Y A;  1UWW A; 
#chains in the Genus database with same CATH topology
 2W92 A;  4AI3 A;  3BU0 A;  4W65 A;  3POS A;  1MQT C;  3BTX A;  1XSR A;  4CCO A;  3III A;  5L9V A;  1TQ5 A;  3CJI B;  1AX0 A;  2W1S A;  4EQV A;  2RDS A;  2R07 3;  5I8Y A;  2C9K A;  1PO1 1;  5ANQ A;  4LTA A;  3NNJ A;  2B4K A;  4BQ2 A;  4BXF A;  2BJS A;  4FP3 A;  4JQR A;  1EAH 1;  4RQP C;  2DFB A;  2W46 A;  5JXG A;  1US3 A;  1CWP A;  2OQ6 A;  2CGN A;  4RGK A;  2KA3 A;  3FUQ A;  3SLI A;  3FFQ A;  5GKA C;  1COV 1;  1D4M 1;  2A3X A;  3KF3 A;  3WEZ A;  4Q5O A;  5JMC A;  5K0U B;  3ZSJ A;  2WL1 A;  1RVF 2;  5A32 A;  1RJ7 A;  3W9A A;  2FZ1 A;  3U37 A;  3LA7 A;  4HKW A;  2WKK A;  4V1P A;  1YFY A;  2ZAB A;  3NL1 A;  4K9S A;  4CRQ A;  2W39 A;  3PVE A;  4IL7 A;  1WD3 A;  1A8M A;  4CU8 A;  1J3P A;  5FRE A;  3ZN6 A;  4M4R A;  1RIN A;  5FY8 A;  5A6X A;  1NX9 A;  3R4D B;  2PLV 1;  3WLU A;  1LEN A;  1UMI A;  1LOF C;  1C5I A;  1UN1 A;  2R06 1;  4C90 A;  1LHO A;  4DNY A;  1ZX5 A;  1RUE 1;  2Y6G A;  3C3V A;  3KV9 A;  1XPW A;  4XYX A;  5A6Q A;  1K5M C;  4HZF A;  1NA1 C;  1XE7 A;  1R09 1;  1OMI A;  1AR7 1;  3VD9 A;  3AK0 A;  5G05 L;  4QGL A;  3I8T A;  3RWN A;  1O3T A;  3MUZ 1;  4O65 A;  2VUD A;  3J8F 3;  4XJW A;  3O1M A;  2CDO A;  2MEV 1;  2HYK A;  2XJR A;  5LBC A;  4CCD A;  4XHX A;  3PVB B;  3UKN A;  3VZO A;  5KHK A;  3WP3 A;  2ZMK A;  1LEM A;  1W6Q A;  1X7N A;  3W5N A;  1YJK A;  3IAP A;  5LRR A;  4UT5 A;  5JOX A;  3J4U H;  3HN1 A;  3KD4 A;  2QTW B;  1Q8P A;  5A7W A;  5LBB A;  4CCK A;  4CUB A;  1PGW 1;  1DYK A;  1DF0 A;  4LQR A;  3ZSL A;  3UV9 A;  1V9U 2;  1SFY A;  5IJR A;  1WCS A;  4AW7 A;  3J7M A;  4CE8 A;  4QQL A;  5T50 A;  3J8F 2;  3WP5 A;  2ZBJ A;  5EP9 A;  3WDY A;  2LTN A;  2EID A;  1MS1 A;  3UYJ A;  2VMF A;  2WAA A;  3DL3 A;  4OYU A;  3S6P A;  3ZLI A;  4CXW A;  4XFF A;  1GZC A;  1C57 A;  1W6O A;  2CWS A;  3HQX A;  4EN0 A;  4XOG A;  1SPP B;  3BVC A;  1H4G A;  3E5X A;  1TMF 1;  4LKF A;  1YQ8 A;  4OI0 A;  5A3W A;  5ABJ A;  2VQ0 A;  5KXB A;  4JTN A;  1HRI 3;  4C8D A;  2CAV A;  3OD4 A;  4OHX A;  3TRS B;  4YLZ A;  1OUS A;  2BRT A;  1ULP A;  3ZX7 A;  4CEY C;  1KQR A;  3I59 B;  4YGB A;  2Y26 A;  3MF9 A;  1LAJ A;  1JOP A;  1BVV A;  1FNY A;  3RZZ A;  4LIU A;  4FOQ A;  1JMU B;  4FFF A;  1TVG A;  1JUI A;  2GND A;  1UIK A;  3VBH C;  2ZTN A;  3VKF C;  3A22 A;  1W8O A;  3NNF A;  3OPZ A;  1YI7 A;  4GMP 1;  1E57 A;  1GBG A;  5HV4 A;  3WXP A;  1J1T A;  2R04 2;  1G9D A;  2XJP A;  3ZKY A;  2RR1 2;  2VCC A;  3ZPY A;  1UU5 A;  2VUA A;  5FZO B;  4QMA A;  3M8L A;  2RJ2 A;  3KB5 A;  4GB3 2;  3BTY A;  5HCA A;  1W6Q B;  3SC7 X;  1T2X A;  2VMC A;  4AZZ A;  4DB5 A;  5JCT A;  2WZR 1;  2VGD A;  3LZZ A;  2CGO A;  1WBF A;  4HXC A;  4YM0 A;  2MNG A;  1MS0 A;  3PDQ A;  5D8A A;  4TLF A;  3W5M A;  3H3L A;  4COW A;  5FZC A;  4BJ0 A;  1G9F A;  2D6N A;  3WDX A;  1Y43 B;  3P5B A;  4L8Q A;  1OHF A;  3POY A;  4XF3 A;  4BQ3 A;  5F1R A;  3INA A;  1F4H A;  1OPM A;  3N7L A;  1OH4 A;  1ZBA 2;  3OF1 A;  1MS9 A;  4JGZ A;  3WSO A;  2WIN B;  5FYM A;  2D5F A;  1YFX A;  1KDK A;  3MGU A;  3KQ4 B;  4D69 A;  4QHO A;  1RUI 2;  4MXW B;  3ZXF A;  2EXH A;  3BAL A;  3EB7 A;  5I0D A;  1UOJ A;  4XF1 A;  3UKV A;  2W2I A;  3WW4 A;  4LOT A;  1DCS A;  3THP A;  5BNN B;  3HAG A;  3KS7 A;  3WT3 A;  1W6M A;  4CDQ A;  2FMY A;  1AL2 2;  1X9T A;  2PHT A;  3ST7 A;  5ABJ B;  4UFK A;  1R09 2;  2A71 A;  5DDJ 1;  4ZXK A;  2VD7 A;  1FT9 A;  1RUE 2;  3PME A;  2ZGL A;  2G1M A;  1FYU A;  3E5U A;  4CP2 A;  2WNE A;  2O8Q A;  5A7S A;  4Y20 B;  1VPH A;  5BNQ A;  1YWK A;  4CDU A;  2X5I A;  1MS8 A;  4OLL A;  1D4V B;  3K4D A;  4CTE A;  3BTZ A;  1IG0 A;  3NNG A;  1ASJ 3;  2A6W A;  2DCJ A;  2JB8 A;  1Q56 A;  1OVS A;  2BOI A;  3EMR A;  4LNV A;  3SH3 A;  4AYU A;  1FNZ A;  5J3U A;  3THC A;  3OYW A;  1U12 A;  5JXI A;  3E5Q A;  3T09 A;  2W08 A;  4CU7 A;  1O5U A;  1FAT A;  2CU5 A;  3L2Y A;  3E1F 1;  4KGG A;  1RJ8 A;  2Q8D A;  1HXS 3;  4H7L A;  5EYY A;  1OSG A;  1I5P A;  4Z1V A;  1CX1 A;  1PK6 B;  4RFR B;  1CES A;  2E7A A;  1AHS A;  1HIX A;  1LJ7 A;  1X8E A;  4LA2 A;  2N7G A;  1OC1 A;  4LEJ A;  2E53 A;  3CLP A;  5A7N A;  5A70 A;  1QJY 2;  2FD8 A;  1PIV 3;  2WFP A;  2JJ6 A;  3HMY A;  4BLJ A;  5KXC A;  2DVG A;  3GZU C;  4LR4 A;  4MGS A;  3O7O A;  4N90 A;  5EIY B;  2W0X A;  4K6B A;  2WNU A;  3N36 A;  5LEJ A;  2XQR A;  3I2O A;  5L9B A;  5J7M A;  3GBF A;  4WV8 A;  4RFT 0;  2B39 A;  1JYW A;  1UYY A;  4CPB A;  4CU9 A;  4CSW A;  1JXN A;  2IZW A;  2RS5 3;  5AVP A;  3V56 A;  4CP1 A;  4BE3 A;  2PEL A;  4JQT A;  3I49 A;  3AZX A;  4NHL A;  5C71 A;  3DEC A;  1J59 A;  5L73 A;  5DXD A;  1OF4 A;  5FQ0 A;  2YBK A;  1NKG A;  3OBR A;  4DUX A;  1OD3 A;  4AEJ A;  1YJL A;  3AZW A;  1RIT A;  1LNS A;  3ZO0 B;  4IET A;  1ULO A;  4I0W B;  4IEV A;  4XE9 A;  2PMW B;  2WAO A;  2G4I A;  3JXS A;  3ZXG A;  1IQA A;  1H8T B;  4YVW B;  2Q4S A;  3JQX A;  2VCM A;  1Q8V A;  2PLV 2;  3X29 B;  3CZJ A;  2VBB A;  1ND3 A;  2Q5T A;  4JTO A;  4AOC A;  4N8M A;  3S7E A;  4LBQ D;  4D7T A;  3CDZ B;  4FTS A;  1PM4 A;  4LHL A;  2G9F A;  1JUH A;  3TN9 2;  3TNP B;  1N3O A;  3CZU A;  4BK5 A;  4CEY B;  1LHU A;  2YMZ A;  5KXD A;  1G9A A;  1NXD 1;  3O1S A;  2LRO A;  3M70 A;  3Q9O A;  2XLA A;  4GB3 1;  4M3C F;  2VO5 A;  3BN6 A;  5T5L A;  4XBL A;  2R06 3;  4XF9 A;  3WW3 A;  5FY1 A;  5A3U A;  1SLT A;  1DGW X;  2XBO 1;  4FQ4 A;  3ALQ A;  4B1L A;  4WM7 B;  2YUE A;  3HR9 A;  3KT1 A;  4SLI A;  3FHQ A;  1UY2 A;  2ZHK A;  2JD4 A;  1I9R A;  2IXL A;  2Y6J A;  4AED C;  1OH3 A;  3ZDS A;  4KQ7 A;  4RYD A;  4XZP A;  2DBI A;  3ZYB A;  5I93 A;  1QWR A;  1ODM A;  4BU2 A;  4PF1 A;  3O1O A;  2WC2 A;  1NZI A;  2XJQ A;  5ANN A;  3CJX A;  4IEX A;  5A7W B;  4IE0 A;  1REE A;  3IM0 A;  3SCF A;  4B4Q A;  1W0N A;  2YBP A;  1H6X A;  3VN4 A;  3ZXL A;  4DO0 A;  4NMI A;  2OUH A;  4R4X A;  2SLI A;  5EV7 A;  1NY7 2;  4QX5 A;  4FXG B;  5FP7 A;  3ZFF B;  3L9J T;  4CDX C;  1F9K A;  3M3E A;  4ZY9 A;  1KRI A;  1JHN A;  2GNM A;  5C8C C;  5F3I A;  2VOT A;  4YNI A;  1UZV A;  3U75 A;  2PN5 A;  3I7D A;  3UGG A;  2D98 A;  4JAA A;  4Q4W 3;  4MHR A;  3O14 A;  3DCQ A;  1ZVF A;  1W06 A;  4IV1 A;  2AEY A;  2P6H A;  2EA7 A;  2X5I C;  1WLT A;  4SBV A;  4ZZ8 A;  5KXE A;  4Y22 B;  4HSJ A;  1DHK B;  1WD4 A;  2B5H A;  1OI6 A;  3F2Z A;  1ODN A;  4OUS A;  1D2Q A;  3MIB A;  2OQ7 A;  1WA6 X;  4LOS A;  5ACA 1;  5A3O A;  5GAL A;  3R0R A;  3NVC A;  2VME A;  2DUO A;  3WG3 A;  1AYN 1;  4IV3 C;  5FV3 A;  5FWE A;  1N47 A;  2ZGU A;  1GZW B;  3ZSE A;  4IEZ A;  3VD3 A;  1AF9 A;  4QB6 A;  1UU4 A;  3MIC A;  1MZ5 A;  4FFI A;  4FOY A;  1EUT A;  3O1T A;  2PAE A;  2J22 A;  2WLQ A;  5CVR A;  2ZEX A;  2G19 A;  3BTA A;  1HRI 1;  3PNA A;  1V6O A;  2IVJ A;  3VBS A;  2C24 A;  3WCS A;  2Q30 A;  3H8R A;  4DS0 A;  2ARA A;  5IT6 A;  1QHD A;  1VMF A;  2JEM A;  1W3V A;  4BIF A;  2VOV A;  1O5L A;  4MYE A;  1W9S A;  2YU2 A;  2PAK A;  2VBP A;  4RGA A;  4ZU5 A;  2IVI B;  4FPG A;  4RS5 C;  1VP6 A;  5J1X A;  1DLC A;  2RS3 1;  4JV4 A;  5SV5 A;  5A7P A;  4E27 A;  2JB4 A;  1AR6 3;  4MXV A;  2XKP A;  4QGN A;  4QWN A;  2LUW A;  3RZJ A;  4BA6 A;  2Z42 A;  4D8M A;  2WYS A;  4CCE A;  2R6Q A;  5FIX A;  4AFC A;  1XOY A;  3T2P A;  2UWC A;  4DEQ A;  1PO1 2;  4DOU A;  3AC0 A;  4NIG A;  1Y4W A;  5JZG B;  3OGG A;  4NRM A;  1PZ9 A;  1KS5 A;  2YY1 A;  3PUI A;  5F3G A;  3Q8E A;  3POW A;  5FLI A;  5DUV A;  1BEV 3;  3KWV A;  4L11 A;  3KSC A;  3RFR A;  5LK7 B;  4QU2 A;  4JKM A;  1PK6 A;  3DPR C;  3WNO A;  3FHI B;  1AL2 3;  1Y9M A;  2VNV A;  3SKV A;  4LE3 A;  3MFC A;  3ZYI B;  4AVC A;  2A6Z A;  3OYW B;  1S0G A;  2A5Z A;  2W52 A;  1GKB A;  3FUO A;  1B35 B;  1IPJ A;  1VBD 2;  2QQN A;  3GBW A;  4NRO A;  3V0B B;  1W0P A;  1DQ2 A;  1BJQ A;  1IGO A;  4DZG A;  1KFX L;  4URA A;  5IK5 A;  1UX6 A;  3ACG A;  4Q0V A;  3QOP A;  3VDA A;  2ATF A;  5F5Q A;  1VB4 A;  5LZ6 A;  4UW3 A;  1MPX A;  1UMH A;  5J98 B;  4GD4 A;  5DAQ A;  3EXU A;  3T2T A;  1MEC 1;  1MAC A;  4PBO A;  2A73 B;  5EFU A;  5FZ8 A;  3OEA A;  4KWU A;  4GQ7 A;  3WHT A;  3WUC A;  3WY6 A;  5JR2 A;  1A34 A;  1QJF A;  2V4A A;  4ORF A;  1VJ2 A;  1BBT 3;  4CDQ B;  2EIE A;  5CFC A;  1UYP A;  4CUC A;  1RUH 2;  1O3Q A;  3LOB A;  5F32 A;  1DYP A;  4H55 A;  1BCX A;  4NHY A;  3NAP C;  3PUQ A;  3PL0 A;  4HKO A;  1NXM A;  1SZB A;  3ZN5 A;  2ZAH A;  1OA3 A;  1PIV 2;  2CY6 A;  4ATE A;  2HEV F;  4O61 A;  3WG2 A;  1W9Y A;  2Y60 A;  5L7O A;  1GQP A;  2WNV B;  5GZC A;  4PIY A;  2ZEY A;  2CAU A;  4MV2 A;  1NAE A;  2HWB 2;  2QKD A;  1VBE 3;  4HFS A;  1PX4 A;  1SHW B;  3FLT A;  3WZ1 A;  2PHR A;  4K20 A;  2EIC A;  4Q0U A;  4UFM A;  5DDJ 3;  4BDV B;  2RS5 2;  1H8V A;  2ZS6 B;  3ILR A;  4QHB A;  4XJ9 A;  1VBE 1;  5JI7 A;  4GWN A;  2DTY A;  5IYY A;  1VLN A;  3EBR A;  5T5O A;  1WCD J;  4XFH A;  2VVF A;  2VZQ A;  2UWB A;  2PA7 A;  5L9R A;  1C3H A;  4CDW B;  5J96 B;  3DKQ A;  2Z79 A;  4UOJ A;  2FMD A;  2X29 A;  2VZT A;  3VZJ A;  2OPK A;  3HEI A;  2QQL A;  1F5F A;  4Q0P A;  4OUL A;  4RSU A;  1OA4 A;  2Z5W A;  3OY8 B;  4XUO A;  5FYV A;  5FZ7 A;  3O12 A;  2Q1M A;  1IOA A;  3DYO A;  1VAM A;  4HMZ A;  4F8A A;  3UKT A;  3B93 A;  1EPZ A;  4K1Z A;  5K7P A;  1QJX 2;  3FMG A;  2YBS A;  1ZA7 A;  1UY4 A;  2WSV A;  4L99 A;  1LES A;  1LGB A;  5IVJ A;  3PVO A;  2RM2 1;  2F6B A;  1H2N A;  5FXV A;  5JVV A;  3R4U A;  3R05 A;  3WG4 A;  4D6S A;  5LA1 A;  1Q43 A;  4C0B A;  3ECQ A;  4DUW A;  1S2B A;  1O3S A;  4ITC A;  2DU0 A;  4OI4 A;  2JG9 C;  2KM2 A;  2WZE A;  3AKS A;  3B02 A;  4GB3 3;  1RED A;  5IK7 A;  3O1V A;  4JGY B;  4KWL A;  4GJZ A;  1AL2 1;  4LK6 A;  3RJ2 X;  2QUO A;  1N1Y A;  2OKX A;  4KBZ A;  3T0B A;  4TWT A;  2P17 A;  2EF6 A;  3N7J A;  4Q4V 1;  1O8S A;  3NWK A;  1DIW A;  1BEV 1;  4BK4 A;  5EQU A;  4AQS A;  4AHY A;  4AGG A;  4EJR A;  2QJV A;  1BKZ A;  3MW4 A;  4EYU A;  5JZG A;  1CX4 A;  5DAV A;  4QB1 A;  1TE1 B;  2IWG B;  3QLQ A;  1DYO A;  3I2F A;  2X05 A;  1HLC A;  2WRA A;  3B9I A;  1CD3 G;  1POV 3;  3QCW A;  3ZYP A;  1ACC A;  1X36 A;  1VMJ A;  4LO7 A;  5FZ6 A;  3ZFG B;  4A42 A;  1XNK A;  5F5A A;  4ES8 A;  2XL9 A;  1TME 2;  3FE5 A;  3H42 B;  4CP0 A;  2ZOE B;  2UWA A;  5LW9 A;  2H6B A;  2JG8 C;  2JIJ A;  4D94 A;  4YFZ A;  5APA A;  4P02 B;  5CIS A;  3AVS A;  2MPF A;  1W90 A;  3MI8 A;  1ENR A;  4ZKT B;  2PQQ A;  2V5D A;  3GDB A;  1MVE A;  2QQI A;  3N9P A;  4F3J A;  2C1F A;  3BKZ A;  1V0A A;  3RGB A;  4E8C A;  4CEW A;  3VBO A;  4XXA A;  5F3E A;  5C8W A;  2JDK A;  4S2F A;  3Q8B A;  4WVW A;  1PM7 A;  2WO1 A;  4M01 A;  1GLH A;  1W8T A;  4I3G A;  2K9Z A;  5DUW A;  3ZN6 B;  3KMH A;  3N35 A;  3TEX A;  1OOP A;  3I2I A;  1NCQ A;  3LIG A;  4HK9 A;  1T6B X;  5CZK A;  5A7Q A;  3JB8 A;  3KV6 A;  3MW3 A;  1XBF A;  2ORZ A;  5ACA 3;  1U5X A;  5FZB A;  3AKP A;  1ZRR A;  1QH6 A;  1XRU A;  5FY0 A;  3ZXE A;  3VV1 A;  3OY8 A;  5GM0 A;  1UW8 A;  1EV1 3;  1MZE A;  2XWJ B;  4V2V A;  5FMO L;  5EHD A;  2HWF 1;  1RUE 3;  1RVF 1;  4AQ6 A;  5E6H A;  4MGZ E;  4E2Q A;  1JN2 P;  1CAV B;  1W6N A;  1GOG A;  5FBZ A;  3W20 A;  4M4P A;  1HW5 A;  1QJY 3;  4CZS A;  2DUQ A;  2OA2 A;  3IDC B;  3LD8 A;  1SLB A;  2WJS A;  4PHZ A;  2P4E A;  1DBN A;  2YV8 A;  4FPE A;  2RDQ A;  3ZYJ B;  1OQD A;  3FBM A;  5C5U A;  2B42 B;  4FPO B;  2P3I A;  3T2Q A;  1BK1 A;  3EHK A;  1NA1 B;  3MLK A;  4YVS C;  5FTT C;  1ZBE 1;  4FAH A;  3VDC A;  1R08 1;  3B01 A;  3C7E A;  1GP5 A;  4JZR A;  3O0W A;  1GSL A;  1HJG A;  2WAB A;  4F83 A;  3AXD A;  5LBF A;  4LJH A;  2AUY A;  2W94 A;  1BHG A;  3C8X A;  5HV0 A;  2LRP A;  2ARB A;  4MH0 E;  1SFP A;  5I0T A;  2TBV A;  1S0J A;  2Y8K A;  3WNX A;  2YC4 A;  1M06 G;  3LEG A;  1PMH X;  4PLN A;  5F5I A;  4BHP A;  2D3R A;  4E4H A;  4CDW C;  2RS1 2;  4W4Z A;  5T3N A;  2UUR A;  4NAM A;  1VBB 1;  1OQE A;  3OG2 A;  3GHN A;  3NV4 A;  4BLI A;  3I2J A;  4WM8 B;  3D0S A;  4BZ4 A;  2ID4 A;  4QKF A;  4XDO A;  1KIT A;  3WW1 A;  4HON A;  4YW4 A;  3ZVX A;  2QCS B;  4EZH A;  2CV6 A;  1UYX A;  4CXX A;  3A4U A;  1XSQ A;  2O1Q A;  1LB2 A;  1LHN A;  4LBN A;  3LEI A;  1I3H A;  4CVU A;  4FI9 A;  3LA3 A;  2EXJ A;  2YG0 A;  4QDQ A;  4GXL A;  2OS2 A;  1RUF 3;  4I2O A;  2XLF A;  1KS4 A;  3HOB A;  4BMB A;  5JSP A;  3ZIW A;  3SEP A;  4L2N A;  1ZA4 A;  3LQC A;  3M3Q A;  2LS6 A;  1QJX 1;  2ZCW A;  3RQ0 A;  5L7O C;  2E26 A;  2BGO A;  2IXK A;  5CKM A;  2JX9 A;  4FOV A;  4YM1 A;  4AED A;  2BV4 A;  4PBP A;  3OSD A;  2PHX A;  4IUG A;  1RUD 1;  1BYH A;  5JSR A;  1RXG A;  2RMU 2;  4GH4 C;  2OYZ A;  5HI0 A;  2WDB A;  4JRL A;  4L0P A;  3DPR A;  5C33 A;  1MEC 3;  1OKQ A;  4AQT A;  3TEY A;  2CWM A;  2IXC A;  5D8A B;  5F37 A;  5FZM A;  2R06 2;  3J7L A;  2JIG A;  4Y5Z 0;  1RUI 3;  1ZNP A;  5JDB A;  3KV4 A;  3KM5 A;  1V9U 1;  3OTF A;  4UFL A;  5K9Y A;  4LBQ A;  4FFG A;  4HAN A;  3MPB A;  1H9P A;  2VR4 A;  4FPH A;  5JMO A;  3G7D A;  5ERL A;  4CP9 A;  4IQP A;  4MZU A;  3ZFG C;  5CFD B;  3H50 A;  2ADE A;  1GWM A;  5CU1 A;  2Q1Z B;  1DGL A;  3MYX A;  1WCK A;  2WWS A;  3J26 N;  1MR5 A;  4N53 C;  4UYB A;  3VBU B;  3D5O A;  5A1L A;  1TME 3;  4RA0 A;  3K2O A;  4QKB A;  1ASJ 1;  1UNB A;  4RHV 1;  2OPW A;  4AI2 A;  1KFU L;  4N7U A;  1XYO A;  4CDU B;  1FMD 1;  1AX2 A;  1YQC A;  4IER A;  4K21 A;  3VBR C;  1IS6 A;  2YGM A;  3QH7 A;  3ZFE A;  1HKD A;  1ULE A;  4C0H A;  2UYB A;  4IGP A;  2VTF A;  1SG3 A;  3FC0 A;  1W2U A;  1ZZ9 A;  2VVD A;  3RZK A;  1WMD A;  4Q8K A;  2W1U A;  4K40 A;  2PFW A;  3O1P A;  2WNO A;  3RPQ A;  1NCR B;  2VEC A;  3VLB B;  1QGL A;  1OVP A;  5HXV A;  1OF3 A;  3GZT B;  1HRV 2;  3MUY 1;  4JDN A;  4PDW A;  3VKN A;  4IXL A;  4AHX A;  4MXW A;  1UKG A;  2I45 A;  3VL9 A;  4CPB D;  5F3C A;  1W8F A;  1IKP A;  1ONA A;  1ALY A;  4IEY A;  4B4P A;  1QDC A;  4XJZ A;  2HWD 2;  5JXH A;  3CF6 E;  4IGQ A;  2WT0 A;  3ZFF C;  3ES1 A;  1SDD B;  1CIY A;  1F15 A;  4XF4 A;  2QQO A;  5FPA A;  2XR4 A;  4LUM A;  1RUG 2;  2E9Q A;  3BPZ A;  3LDK A;  5IVY A;  4CUA A;  2D6M A;  4A3Z A;  1NQD A;  4LO5 B;  4WVM A;  1LRH A;  3MW2 A;  5H9Q A;  3IDA A;  4XCA A;  3WG1 A;  3VBH A;  1ZRF A;  3NJV A;  5FYU A;  4AG4 A;  1YIP A;  4CDW A;  4IDZ A;  4COZ A;  1W2A X;  1PMI A;  4KL1 A;  4W6Y A;  5JPM B;  1V6J A;  3APB A;  2FHR A;  4YSF A;  3JQW A;  3Q8A A;  2BNM A;  1NCR C;  5FK7 A;  4P9X A;  1VIW B;  2C26 A;  4FBF A;  3VHN A;  1UKR A;  4XAA A;  3LOI A;  1PK6 C;  2YZ4 A;  1U5Z A;  2XL7 A;  1L3J A;  3GCX A;  1RMU 1;  2GH2 A;  3MO4 A;  3HBK A;  3RMX A;  4A4A A;  3PUH A;  4Z8B A;  3VUO A;  1OLM E;  4DRV A;  4ZU4 A;  4LKE A;  2WQ8 A;  4XTP A;  2A3Y A;  4GMP 3;  2R1B A;  1PO1 3;  2ZX2 A;  3RI9 A;  1YLL A;  3Q8C A;  2R07 1;  4BH9 A;  1QNY A;  2BU9 A;  4V2W A;  3K51 A;  2Y0O A;  2PTM A;  2YFU A;  3HNM A;  3PJQ A;  5A33 A;  3ACH A;  1PVX A;  4E4D X;  3GGL A;  2R32 A;  3TWI A;  5FOJ B;  1HQW A;  3ELN A;  5A3P A;  1UCX A;  1APN A;  1AYM 3;  4JGZ C;  5JWP A;  3A21 A;  4Q4X 3;  4QX8 A;  4XHB A;  1JH5 A;  2DYC A;  2Q0A A;  3ENR A;  1RUH 1;  5F6K A;  2BFU L;  4YGD A;  3QD6 A;  1W9T A;  3K77 A;  1LGN A;  4XFA A;  3L2H A;  1AZD A;  4NII A;  4ASK A;  5CFC B;  1Y7B A;  3LCP A;  1LGC A;  5HCH A;  2HBU A;  3SQO A;  2HEW F;  2ZX3 A;  3QAC A;  2XLG A;  2OVU A;  2GNB A;  3NNM A;  5FZE A;  2WO3 A;  2FZ2 A;  4OUE A;  1Q3E A;  1XNT A;  1VRB A;  2P37 A;  4HG6 B;  4A3X A;  4NO4 A;  4EV0 A;  1UOG A;  2HJI A;  4LT5 A;  2RHP A;  2YU1 A;  3AM2 A;  5BNN A;  3WQ7 A;  2DVF A;  2BWC A;  4AXO A;  4FCA A;  4IEQ A;  1QU0 A;  2IFR A;  5E1R A;  1F8V A;  5KR7 A;  3H8O A;  2J1V A;  3BPS A;  1EY2 A;  4IEP A;  4XFB A;  4CCN A;  4IGO A;  4Q1P A;  4OMD A;  4AGR A;  4C1W A;  5FPB A;  5E16 A;  1WCU A;  2IFW A;  1LU1 A;  2X09 A;  3UNP A;  1GU3 A;  1QEX A;  2I07 B;  1L7Q A;  1N3Q A;  4QX3 A;  3S30 A;  3S0M A;  4JGZ B;  5BV6 A;  5C3S A;  5HPO A;  3KHC A;  1J84 A;  2FDH A;  1CR7 A;  1NLQ A;  3ZMN A;  3IPV B;  3M1H A;  5AFB A;  4WVZ A;  3S5A A;  1E5R A;  3QH6 A;  2QDR A;  3RZL A;  3GBG A;  3KF5 A;  4BWO A;  1NA1 A;  3VBR A;  3RI8 A;  2QE3 A;  2MEV 3;  2C4X A;  4OCT A;  5FZD A;  1JTZ X;  4YFW A;  1S2K A;  5KHG A;  1J3Q A;  4ISQ A;  1NUK A;  4PI2 A;  2VM9 A;  4QKN A;  4UXA A;  2K46 A;  4R9B A;  5FK8 A;  4NIA A;  1RB8 G;  1ZRD A;  3WQ0 A;  3B00 A;  1E5I A;  3ES4 A;  2W47 A;  1QF3 A;  3ACF A;  2ZPX A;  3THD A;  1W6N B;  3S5Q A;  1ZRC A;  4J6G A;  3PLQ A;  3D0J A;  3PIG A;  4Q0S A;  3BI3 A;  2XML A;  2WWU A;  1JS9 A;  2CGP A;  2JKX A;  4ZZ5 A;  4XBN A;  2Y33 A;  5EJZ B;  2B9U A;  3AZY A;  1GR3 A;  3WF1 A;  5FPX A;  2WS9 2;  5CG8 A;  2ZX1 A;  3I3B A;  2R04 3;  4YM3 A;  5DG2 A;  2A6Y A;  4AI1 A;  1NE4 A;  2NYY A;  5C5T A;  2QZ3 A;  5JOY A;  1ULC A;  2Y38 A;  1CZT A;  4LBM A;  4U36 A;  4XAC A;  3O1R A;  5A1F A;  3RZM A;  2ZGK A;  4P00 B;  1LHW A;  5FJH A;  2JDY A;  3E6B A;  1CAX A;  2WO2 A;  3U4X A;  3LB9 A;  2HWE 1;  4UW5 A;  4MUV A;  3OUI A;  1XE0 A;  3H1M A;  2VOX A;  2HWE 3;  1H30 A;  4UAP A;  1VBB 2;  4XIO A;  3BOD A;  4KWJ A;  3LE0 A;  3MBW A;  1AYN 2;  1KEX A;  1GZW A;  1CAX B;  1K12 A;  2PHF A;  3I4I A;  3KT4 A;  2HEY F;  4XET A;  2XVK A;  3C7G A;  1F2N A;  4GH4 A;  2VQA A;  4XTM A;  4I01 A;  4UWD A;  1GV9 A;  4AR2 A;  5JIU A;  1WBL A;  3CJI A;  5DUX A;  5G04 L;  4Z92 B;  1QOT A;  4HPK B;  1QNW A;  3OCP A;  4MLO A;  3SH4 A;  4QGM A;  1KDM A;  4COU A;  1GQG A;  5KHI A;  1RUD 3;  4IV1 B;  2I2S A;  4B3N A;  2YYO A;  4TLG A;  2J1T A;  3K48 A;  5SV8 A;  3CMG A;  3MPP G;  1XNA A;  2NP0 A;  4YWA A;  1CN1 A;  1O91 A;  1VBA 3;  1HDK A;  4QPG A;  3V65 A;  2XJT A;  1FPN 3;  5BPX A;  2R16 A;  3K3N A;  2JG8 A;  3AB0 A;  5I0U A;  1GMM A;  4QQP A;  2HWD 3;  1JYT A;  1UZZ A;  2DVD A;  2DBN A;  5EYX A;  1EYB A;  4FPJ A;  1AR8 2;  1QJU 2;  2G9Z A;  2R0F A;  1Z7S 1;  3AZZ A;  3KGZ A;  2BUK A;  2VQT A;  1DGR A;  1FAY A;  3LSE A;  5LRS A;  2VJX A;  3OPW A;  2ZAC A;  4OMC A;  4HKL A;  3ACI A;  2P3K A;  3FFZ A;  1JOB A;  3DPR B;  4H7M A;  4FT8 A;  2VL4 A;  5JUV A;  5FZ1 A;  3AKR A;  3THT A;  1IZ3 A;  5A6Y A;  2BOJ A;  5FY4 A;  3AP7 A;  1O7F A;  2HWC 3;  3GZE A;  3KVA A;  4P9J A;  4TSV A;  5IWF A;  4LBK A;  1FI2 A;  4BQY A;  2YC2 A;  5FLJ A;  1ND2 B;  2ZA9 A;  3OD0 A;  3VHP A;  2DWR A;  1NCQ C;  1UL9 A;  2HWC 1;  3J7N A;  3R4S A;  4IEW A;  2E6V A;  3DXU A;  3HJR A;  5FLH A;  2JDU A;  4AF9 A;  1VBD 3;  1JZ8 A;  1W0O A;  1WW5 A;  5JAX A;  4AI0 A;  2Y6K A;  2C6S A;  1O3R A;  4FTE A;  2RDN A;  5FUI A;  4GJY A;  1ZM1 A;  4YAR A;  1RUG 3;  1UXX X;  1S0I A;  4JKK A;  1ENQ A;  4KH9 A;  1LOG A;  2HWC 2;  2ZML A;  4AEK A;  1I6X A;  3T1L A;  4URT A;  4ATF A;  1I1E A;  3FWE A;  2WZ8 A;  4N43 C;  3TAY A;  3KZ4 C;  5FZ4 A;  2VNO A;  3AYE A;  4HT1 T;  4NUB A;  4O9G A;  4CDQ C;  3AKT A;  5I91 A;  5KWR A;  3SNM A;  4R4Z A;  1PX3 A;  2ZGQ A;  1YUD A;  2YPJ A;  1BMV 1;  2NMN A;  4MAD A;  1OKO A;  1TMF 2;  4Y4R A;  4QAW A;  4CU6 A;  3ATG A;  4A45 A;  1IS3 A;  1VBC 1;  4Q27 A;  1NOV A;  5ABJ C;  4I0B A;  4YVS A;  1AR8 1;  4D0Q A;  4N53 A;  4WZF A;  2O14 A;  4JDM A;  5B4X A;  5FXW A;  5FMB A;  2FDK A;  3UET A;  2FDJ A;  3AMP A;  4MOA A;  4N9H A;  3PTR B;  5LA2 A;  5C4W B;  1WLD A;  1ZBA 1;  4S2D A;  5FMD A;  5FJK A;  3AP5 A;  4UBH A;  4XMI A;  4RR3 C;  2O8O A;  1TMF 3;  4JRA A;  4XQD A;  1KJR A;  2XUM A;  3USU B;  3IN9 A;  3GJA A;  4NRQ A;  5FWJ A;  2JEC A;  1STM A;  1KD7 A;  5CIR A;  1FOD 3;  2QQV A;  2A1X A;  3RMY A;  3NST A;  1OFS A;  5IAX A;  2W5F A;  3OB8 A;  2MEV 2;  2EVX A;  3SXW A;  2D93 A;  3A7Q A;  3GJB A;  4IE6 A;  1RUF 2;  1DGR N;  3MF6 A;  3HBZ A;  3V0A A;  3GCW A;  1XNB A;  3AXE A;  4X6R B;  2WFF 2;  1A3K A;  2A6V A;  1V70 A;  2ZMN A;  1Y9Q A;  4YGE A;  1HN1 A;  1RGS A;  5FRA A;  2ET7 A;  2AYH A;  2YHJ A;  5FYZ A;  5IVV A;  3CKH A;  4LHS A;  1NZC A;  4NWW A;  3VBF B;  1VE0 A;  3GNE A;  4BXS V;  4OZO A;  1JZ6 A;  4OVE A;  3SMH A;  1PVC 1;  2WS9 3;  4HN0 A;  4NIH A;  3POE A;  3I97 A;  3E6C C;  3SKJ E;  2RS1 3;  1C1L A;  3JD7 1;  4YYO A;  3H8U A;  2DCT A;  4AVB A;  1UZW A;  1ZRE A;  5DMY A;  1W05 A;  2ZGT A;  2EIB A;  2WYF A;  4FXK B;  4AVS A;  4A7K A;  3U1X A;  1AR7 3;  1GYK A;  3JD7 3;  2RMU 3;  4YZ1 A;  5BNO A;  2XHK A;  1W8U A;  2H6C A;  1SLI A;  5DAX A;  3LAG A;  4QPY A;  2JG9 B;  1XE8 A;  3P3N A;  4PIX A;  2D97 A;  4ISR A;  1IQD C;  2F4P A;  3WR0 A;  3LKJ A;  4FPL A;  4XAB A;  1JYN A;  2Q8C A;  1PO2 3;  3H1Y A;  2XJV A;  4YW6 A;  4AHZ A;  4IEO A;  4IV3 A;  5CKQ A;  4MVT A;  5DAP A;  2Q8O A;  5CA6 A;  4OQ8 A;  1D0G A;  3UK9 A;  3OPT A;  4DUV A;  4BM8 A;  4PLM A;  1H1A A;  2B46 X;  5F2W A;  5GZE A;  1FX5 A;  4X8N A;  2RE9 A;  5E8A A;  4CCL A;  4B7K A;  4LBO A;  4X8P A;  2RR1 3;  4JCK A;  1G7Y A;  3VBS C;  1UMZ A;  4CDU C;  3PUR A;  3BB6 A;  3LFI A;  4B4R A;  3O1U A;  2NQY A;  2Z2S B;  4P08 A;  1RUO A;  2RM2 3;  2QQK A;  3WCR A;  2GC0 A;  2WN2 A;  4KU8 A;  4IND A;  2HWB 1;  5FZ0 A;  1YRZ A;  3ON7 A;  4J1W A;  3PMS A;  3ZYG A;  2RR1 1;  3BIE A;  2G9G A;  4QXC A;  1H8T C;  2ETE A;  4YVW C;  1VRH 1;  5GZF A;  1S0E A;  1VB2 A;  1G8W A;  2QQP A;  1CAV A;  1AR8 3;  3AYD A;  4YW7 A;  5FP4 A;  5HCF A;  4XJA A;  5FXZ A;  4BME A;  5C3P A;  5J48 A;  4R9A A;  3PJY A;  3ZN4 A;  2HWE 2;  4DQA A;  5A80 A;  1HRV 3;  3JBG 3;  1JI6 A;  2DTW A;  2D6K A;  1XXN A;  3MLL A;  4K1Y A;  1JZ7 A;  5B4N A;  1RIR A;  1UZ0 A;  2GU9 A;  4GWM A;  2WO7 A;  1RUJ 2;  3LDR A;  3HT2 A;  4QXK A;  3FZ3 A;  3WDW A;  5C9A B;  5AC9 2;  1JOD A;  1SAC A;  2R7E B;  1JYV A;  2XB6 C;  3GM8 A;  3GAL A;  3HNY M;  4M0N A;  1SLC A;  5LBE A;  5FYC A;  4HK8 A;  3WHU A;  3AL5 A;  4QT6 A;  4BQ1 A;  1OOP B;  4LO4 B;  2J1S A;  3WDV A;  1LEC A;  4Q2F A;  1UQX A;  4Y1X A;  5FMO S;  3WVJ A;  4DXT A;  1HN0 A;  3WP6 A;  1TZO A;  1E5H A;  3T30 A;  5ACA 2;  4ZHN A;  3P6B A;  1JHJ A;  2VVE A;  3AMQ A;  5C9A A;  1VBD 1;  1CJD A;  4H2A A;  2TEP A;  3AMN A;  5DN2 A;  3NRU A;  1AR9 1;  3DGT A;  1SPP A;  4IE7 A;  4WM8 A;  3B9C A;  1JW6 A;  5FPV A;  1K3I A;  2PQS A;  3ORJ A;  3ASI A;  1MQT A;  3VD7 A;  1REF A;  1VRH 3;  3WUD A;  4E2S A;  1ZZ6 A;  1W8N A;  3C7F A;  4ZXE A;  1RMU 2;  2XJU A;  2ZGR A;  2QDN A;  3VGI A;  5F9T A;  2K2S A;  2JDN A;  2BP6 A;  2GN3 A;  1J83 A;  2W87 A;  3ZYF A;  3D82 A;  2DCZ A;  2I74 A;  5FMC A;  3TNQ A;  2FBE A;  2UU8 A;  4B29 A;  2JG8 B;  2P3Y A;  4KU7 A;  3AKQ A;  3AX4 A;  2DUR A;  1NLS A;  2KR2 A;  1DQ6 A;  5FPZ A;  3WQ1 A;  1WLW A;  3AMH A;  1X9P A;  2IUW A;  1JOJ A;  3O0X A;  1C8M 3;  2A7A A;  5J36 A;  4NAO A;  3M2M A;  3OJB A;  1S4C A;  3RDI A;  4CUG A;  5HBA A;  5HXM A;  3GXU A;  1NQJ A;  4WM7 A;  3C7O A;  5GZD A;  4HPK A;  1DFQ A;  2ILM A;  2OT7 A;  3A0N A;  4YG0 A;  3U14 A;  4ZU7 A;  2IC1 A;  1RYY A;  2R04 1;  2JDZ A;  2XQX A;  4UFJ A;  1PO2 1;  5FYB A;  1YIF A;  2GDF A;  5A3N A;  4K3U A;  4UW6 A;  5DAW A;  3WP4 A;  1AXK A;  4Z2A A;  3AP4 A;  3LGR A;  4FP2 A;  3N9M A;  1J1L A;  4L9B A;  2Q8E A;  4EN9 B;  3ZR6 A;  1DDL A;  1G9B A;  1POQ A;  1CAU B;  2ZAA A;  2VZR A;  4XBQ A;  1WMF A;  3MHZ A;  4Z2W A;  2GMM A;  1LTE A;  1QXR A;  2QQM A;  1A78 A;  4NJ4 A;  1VR3 A;  2WFF 3;  3MID A;  4LHK A;  4Q29 A;  4W8J A;  3NQH A;  3TB0 A;  5FPU A;  4XIL A;  1UY0 A;  4WZC A;  3VKM A;  3AP6 A;  1RHI 2;  2D6L X;  1O4T A;  1PVC 3;  1WLC A;  2HBT A;  1V6L A;  2WS9 1;  3KCY A;  4GAZ A;  4KI5 M;  3TN9 3;  4FPY A;  4QPG C;  2Y0I A;  4LA3 A;  4HET A;  5FZI A;  1AXZ A;  4UFH A;  3ZSK A;  1RUG 1;  2GP3 A;  2VMG A;  5BXX A;  1JYI A;  1T6G C;  3EO6 A;  4R9D A;  5JOW A;  2V72 A;  4YG6 A;  5D1I A;  1RUI 1;  4BCU A;  1UPI A;  4QX1 A;  2IXI A;  4J1X A;  4COV A;  1K42 A;  1RUC 1;  5IFP A;  4HVR A;  3I2G A;  5EJ1 B;  3GZA A;  3SH5 A;  3UGH A;  1DZR A;  2XDV A;  3OUH A;  4OUM A;  1WW6 A;  4A6S A;  4QHZ A;  5FCC A;  1PGS A;  3UES A;  3AFG A;  2WZP P;  5F7U A;  1OD5 A;  1RHI 3;  2BDR A;  1W28 A;  3JU9 A;  3NMB A;  3RS6 A;  3W59 A;  2QVS B;  5JXJ A;  1UIJ A;  1PGL 1;  3RRD A;  3ZR5 A;  1WW7 A;  2Q1F A;  3FL7 A;  3NAP A;  5FPL A;  2LAL A;  3PUA A;  2SBA A;  4YW1 A;  2VZO A;  3ABZ A;  3N3H A;  3RNS A;  2KXL A;  3LPG A;  1W8H A;  2BTV C;  4OI2 A;  3O5S A;  3RYP A;  4NHX A;  4QD2 A;  4QPI A;  2PHD A;  3KV5 A;  2ZJC A;  3TYJ A;  4XUP A;  5LEK A;  4DY3 A;  3IMN A;  4KG0 A;  2NN8 A;  3RSJ A;  3PTY A;  3K4A A;  1S0D A;  3K46 A;  2Y64 A;  4IV3 B;  4N53 B;  4COY A;  5C8C B;  3UJQ A;  5GLV A;  5FO8 B;  2QBX A;  1HRV 1;  5FP8 A;  2DVB A;  1UY3 A;  1PNF A;  5C9A C;  2VW1 A;  1H0B A;  5C3O A;  3M4F A;  4RN5 A;  2X5I B;  3LFM A;  4NRP A;  4UF0 A;  3VZL A;  4AEM A;  1ULG A;  5BUV A;  1RTV A;  1PHM A;  3U07 A;  4LIT A;  1O8P A;  4AVA A;  4D6R A;  2BW8 A;  5BNO C;  4MGY E;  3HD8 B;  3ACL A;  1R1A 1;  4XUN A;  4Z82 A;  2Y6F A;  2VNG A;  4CCJ A;  5KHJ A;  2OII A;  1GIC A;  1OA2 A;  1SMV A;  2DCY A;  5FZA A;  2WII B;  3WNP A;  1NCQ B;  2NPI A;  1C8N A;  3I2H A;  3JCI A;  3OBA A;  3M7A A;  5C3Q A;  3LEM A;  2LM3 A;  4RR3 A;  3VBO C;  1CAU A;  1F4A A;  2AEN A;  1K5M A;  1NT0 A;  1BLZ A;  2WA4 A;  1Q5O A;  3N9N A;  3MV0 1;  4N9I A;  1S0B A;  4GKX A;  3LWC A;  4Y5S A;  3ZKU A;  4CEW B;  4JDO A;  4Z07 A;  1AVB A;  3WF3 A;  1NE6 A;  3POG A;  4EWD A;  4NPL A;  3HWJ A;  4LBJ A;  4AFA A;  5GZG A;  1W3X A;  2BNN A;  3AJY A;  1AL0 G;  1QMJ A;  1JZ4 A;  2WUH A;  1SBE A;  4RQP A;  4NE9 A;  2RMU 1;  4YZ3 A;  2ZEZ A;  2ZGS A;  1K5J A;  2DUP A;  2EIG A;  3OUJ A;  4NPM A;  4XMA A;  2YB7 A;  4QXB A;  1MZ6 A;  4YW5 A;  4YPJ A;  4QX0 A;  3PIJ A;  4AFM A;  1Y9G A;  3WNM A;  1HX6 A;  1YXW A;  4YRD A;  5JZG C;  2VOK A;  4H3W A;  4Q4V 2;  2MHF A;  4LKS A;  2RS3 2;  5HCB A;  5C6C A;  5I0S A;  4HOO A;  3IIA A;  3NJY A;  5A3M A;  2VPV A;  5KHH A;  2ENR A;  5C3R A;  4QXH A;  5FZK A;  3MIF A;  3FLP A;  4I30 A;  1XJA A;  4EN8 B;  2JDP A;  2VW0 A;  1JU4 A;  3MIE A;  3H9A A;  1RUC 3;  1QJU 3;  1O4Z A;  1SDW A;  1UOF A;  3LF7 A;  3QBQ A;  4P5H A;  2E32 A;  3D3A A;  1Z7S 2;  1HV0 A;  2ZGP A;  4K7J A;  1QJU 1;  3UT0 A;  3WW2 A;  3VHO A;  4Q0Q A;  5LY1 A;  3ILN A;  3IBM A;  2XG3 A;  5A6Z A;  4KWK A;  1V6I A;  2ZEW A;  2ZX0 A;  1O6U A;  1GP4 A;  1WMX A;  5BY5 A;  1MZF A;  1HXS 2;  2VMH A;  2VTX A;  3TN9 1;  4C1X A;  1K5M B;  1TG7 A;  1OXC A;  5C4W C;  1JYX A;  4AK3 A;  3OGV A;  5EPA A;  2ORX A;  4GAL A;  2WFF 1;  3OGS A;  1LOA A;  2W1W A;  4Y33 A;  2JIC A;  4AI9 A;  1AJO A;  2JXA A;  3POB A;  3N7K A;  4OHV A;  5DAB A;  4BOW A;  2QNK A;  1ULD A;  1IHM A;  3CIH A;  1VAV A;  4R52 A;  1OBN A;  4XVH A;  3NJX A;  5FQ0 B;  4RGG A;  2CNA A;  1FOD 2;  3VDD A;  2XON A;  5E88 A;  2AZ5 A;  5A1A A;  4P14 A;  2V5Y A;  4AAP A;  3DEM A;  1HXS 1;  1FMD 3;  1R1A 2;  1R08 2;  4XUQ A;  5FP3 A;  3CEW A;  5JOZ A;  4CP9 B;  5FFO C;  3BGA A;  4XPV A;  1TME 1;  2GC2 A;  2RV9 A;  2K0G A;  2C9A A;  3V0A B;  2B8M A;  3WDU A;  1NYW A;  4P9W A;  2C5D A;  2EXK A;  4LPL A;  3ZFF A;  5H9P A;  3SEE A;  2XJS A;  2ZGM A;  3VBF C;  2P1B A;  2FDF A;  4L97 A;  2V73 A;  2ZZQ A;  1IS4 A;  2ERF A;  2WLP A;  3AFK A;  3PU3 A;  4YGC A;  4WM7 C;  4DRR A;  1QY4 A;  2KD7 A;  5AFE A;  2J1U A;  4O7X A;  1R1A 3;  3NKG A;  1TNR A;  4Q8L A;  1VAK A;  5IVF A;  1DP0 A;  1WUV A;  1DQ1 A;  2YRO A;  3TBD A;  1W99 A;  1KJL A;  2VZV A;  4Q4W 2;  4QQ2 A;  2QFE A;  4AED B;  1VBB 3;  1WA4 A;  2C0Z A;  3N4M A;  1CQ9 A;  1S0F A;  3IWZ A;  4LMF A;  3T0A A;  4ASL A;  3CL1 A;  4H14 A;  4YVS B;  3VDB A;  1ZRI A;  3C2U A;  2EXI A;  2J7M A;  2VTX J;  3D8C A;  4Q26 A;  3ZXA C;  4DIN B;  5IFT A;  2VZU A;  4LK7 A;  2H0V A;  2O0O A;  3JB4 C;  3UL2 A;  4B1M A;  3B7M A;  3H1W A;  3HN3 A;  3F95 A;  2Y6H A;  4PF5 A;  4B7E A;  3OBZ A;  1H4H A;  1XU2 A;  2DVA A;  4MO3 M;  4XQW A;  2IXH A;  1VBC 2;  4NHK A;  3VBS B;  1GNY A;  3WNL A;  3RG0 A;  3E97 A;  4HN1 A;  4JX0 A;  5CAZ A;  2JE9 A;  3WQB A;  4TTG A;  4GUL A;  4AHW A;  4J25 A;  3USU A;  1OFN A;  2DDU A;  1LCL A;  5T52 A;  1AYM 1;  1W8W A;  2Y34 A;  3WF0 A;  2FDI A;  1FPN 1;  2WBK A;  1VBA 1;  4R8H A;  2VH9 A;  1UOB A;  2RG4 A;  1LU2 A;  3USS A;  5K4L A;  1JZ2 A;  1QQP 1;  3LDB A;  3PHM A;  1G86 A;  1OLQ A;  3OGR A;  4AAX A;  5DZG A;  5KC5 A;  1RHI 1;  3OGJ A;  1QOO A;  2VZ3 A;  1G6N A;  3LSD A;  3I3M A;  5CB7 A;  1R1Z A;  5IHR A;  3CNA A;  1GWL A;  1UF2 C;  4Y22 A;  4MG2 A;  3TEZ A;  2NLR A;  4Q4Y 3;  3ZOI A;  1JYC A;  4WVV A;  3T3Y A;  4BQ4 A;  3FX3 A;  1FXZ A;  1O4Y A;  2VE1 A;  3NV2 A;  2XOM A;  4DIQ A;  1LOB A;  1FV2 A;  3JBG 2;  5A3T A;  4UI9 L;  4C91 A;  5CG9 A;  4PDW C;  1WME A;  1GOH A;  1SQ4 A;  4E4Z A;  1W03 A;  5TSW A;  1BBT 1;  1CPM A;  3AYA A;  5CNA A;  3P1I A;  3LIH A;  5FY5 A;  5FZF A;  3ZIX A;  4LE4 A;  3AMM A;  3WF2 A;  1U5I A;  1J58 A;  2P34 A;  4BQW A;  3CQO A;  2TUN A;  1BEV 2;  2J1R A;  2A75 A;  1GZ9 A;  2WQZ C;  5C4W A;  3B3Q E;  1AJK A;  2QZ2 A;  1PNG A;  2J1E A;  1ZBA 3;  1DG6 A;  5LB6 A;  1UO9 A;  3B94 A;  1X33 A;  5GJ6 A;  1GOF A;  1Q8Q A;  3SCG A;  1KGY A;  2R1D A;  2Z4F A;  2P3J A;  2UYA A;  1GZT A;  2D6P A;  4MSV A;  1ENS A;  4LHN A;  2JDM A;  2RM2 2;  2V09 A;  4DFS A;  4EWA A;  3VL8 A;  2JE8 A;  3JZV A;  4N43 B;  1RVF 3;  4YW2 A;  4YG3 A;  1C4R A;  3CHX A;  3VDD C;  3WF4 A;  3IMM A;  2GH8 A;  5FUN A;  1NG0 A;  2AEZ A;  4HLT A;  1ZZC A;  5IAV A;  1U0A A;  3E6D A;  1QJE A;  4AVV A;  2E51 A;  1AR6 2;  5L19 A;  1YQ6 A;  1LOC A;  4R9C A;  3VZN A;  4CEY A;  4NWV A;  4PDW B;  3MIH A;  2YFZ A;  4XIK A;  2BGP A;  4Y26 A;  5F5C A;  1CON A;  2GNT A;  1V00 A;  2BFU S;  1CZS A;  1POV 1;  3NW4 A;  1AR9 2;  4PCR A;  2VY0 A;  1IPK A;  5FY9 A;  1UWW A;  1D0H A;  2YPD A;  1N1T A;  5FAX A;  1COV 2;  1D4M 2;  1EV1 2;  1QXJ A;  2GSY A;  1WGP A;  1UXZ A;  4FFH A;  1C8M 2;  4MGI E;  4TYS A;  4XDP A;  3VBO B;  1C1F A;  4QPI C;  1YQ2 A;  3ZFE B;  2GC1 A;  2ZHM A;  5JR7 B;  4CA9 A;  2J1A A;  4PLO A;  3OBT A;  1SCS A;  2X53 S;  1AR6 1;  5A33 B;  1HB4 A;  1MS5 A;  2RS5 1;  2P5B A;  4NVP A;  5IVE A;  3AL6 A;  3CO2 A;  2VU9 A;  1AR9 3;  4D6Q A;  1S55 A;  3POI A;  1TEI A;  4G9S B;  2J42 A;  3ME2 A;  3NV3 A;  1XNC A;  2DV9 A;  5JLV A;  3HIF A;  3MIG A;  4Y1V A;  2YXS A;  3BCW A;  4XUR A;  1PGW 2;  1GWK A;  1UZY A;  2R0H A;  4YZ5 A;  2XVG A;  2WNU B;  1RUC 2;  3IZO A;  2D5H A;  4QX7 A;  3K3O A;  4S2G A;  2VOW A;  3JUU A;  4CDX A;  4LOR A;  1F35 A;  1Z7S 3;  2Z69 A;  3N9L A;  3HQR A;  5FY7 A;  1H1I A;  3FLR A;  5IUQ A;  1FMD 2;  1QIQ A;  3PUS A;  3KGL A;  4QM8 A;  4Q1R A;  4P9I A;  3RZH A;  2GMP A;  5EXO A;  1HV1 A;  3H3U A;  4WVM B;  4Q4X 1;  1S1A A;  1ND2 C;  1AR7 2;  1MS3 A;  1ND3 C;  1RUH 3;  3IPV A;  5I8S A;  1L7L A;  1U5Y A;  2JWP A;  4GIQ A;  4TXW A;  1US2 A;  1ZZ7 A;  2VZS A;  2JKB A;  1QKQ A;  1D7P M;  1BQP A;  1EAH 3;  2E33 A;  4LIV A;  1OPO A;  2ZGN A;  4L92 A;  1HB2 A;  5FYH A;  1OLM A;  4AWD A;  2FDG A;  1MEC 2;  5FR3 A;  4GH4 B;  5GLW A;  1EUU A;  2VXJ A;  3D4K A;  3I59 A;  1BK0 A;  1W2T A;  1EV1 1;  4BIS A;  1SFN A;  4FPF A;  4OHZ A;  4DPN A;  5L36 A;  2HWB 3;  1OLR A;  4U2A A;  4P9Y A;  1CJP A;  1XQN A;  1EPW A;  2JEN A;  3BUC A;  5A7O A;  1ND3 B;  1VAL A;  3IDB B;  5FP9 A;  5A3L A;  2BVV A;  5AVA A;  4LXL A;  1AX1 A;  1URX A;  4JHT A;  4ARX A;  2YDE A;  3B69 A;  4UBG A;  1SLL A;  5K0U A;  1RL3 A;  3VKO A;  2E7Q A;  3M3I A;  4RS5 A;  1CVN A;  2W95 A;  3HPN A;  4NPR A;  2A70 A;  5DUU A;  5JIA A;  5AC9 1;  2BBA A;  5C70 A;  1DZT A;  4N43 A;  3VBF A;  2EAL A;  3V64 A;  4FTB A;  3HNB M;  3JD7 2;  1V6N A;  5FYT A;  4DXZ A;  5C8C A;  1YFU A;  4PI0 A;  1OUR A;  5E89 A;  4BB3 A;  1DLL A;  5DQ0 A;  2ES3 A;  3W21 A;  3WD5 A;  1O59 A;  4E4S A;  5J37 A;  5CKN A;  3Q8F A;  1PO2 2;  3KCC A;  1W2N A;  1S2E A;  1PZ7 A;  1V6K A;  2JE7 A;  3KT7 A;  3EJK A;  1RUJ 3;  4Y24 A;  2GAL A;  3O0V A;  4MGQ A;  1C28 A;  4BPZ A;  3MV1 1;  4NHM A;  2WZR 3;  4A41 A;  5EZW A;  1R64 A;  3VBR B;  4UW4 A;  2B7Y A;  3NAP B;  3FJS A;  3ZPO A;  1LED A;  1Y3T A;  3MEP A;  2JD9 A;  3I54 A;  1UX7 A;  3POJ A;  5CBL A;  4PIZ A;  2P6C A;  4M0H A;  2HKX A;  5FZH A;  5GLZ A;  1VBC 3;  1NLR A;  1W04 A;  2WNV C;  5D2A A;  5H9S A;  4GKY A;  4AFB A;  5LCW L;  4MGK E;  1H2K A;  4RL7 A;  4FOW A;  1XYN A;  3K75 B;  4A44 A;  1UD1 A;  4OFG A;  4ET7 A;  3AVR A;  2A6X A;  4AGV A;  2Y6L A;  2D40 A;  2OXB A;  3C7H A;  1HJF A;  1ST8 A;  4XQ4 A;  1XU1 A;  1FPN 2;  3DYP A;  4QPW A;  1C8M 1;  1YO8 A;  4LKD A;  1SBD A;  3VDD B;  2VZ1 A;  4IES A;  4RS5 B;  1UAI A;  3AYC A;  1WWY A;  4N7I A;  2OUJ A;  1FOD 1;  1QQP 2;  3CBN A;  3T0D A;  4M00 A;  1AUY A;  3ROU A;  2JDH A;  1M4W A;  1RUD 2;  2P2K A;  2QQJ A;  2VW2 A;  5FDB A;  5T5P A;  1XC6 A;  2HLE A;  2WWJ A;  4RHV 2;  1RUN A;  1B35 A;  1VMH A;  2AH2 A;  5FYY A;  1LR5 A;  1H2L A;  5JSO A;  2GP5 A;  4EN6 B;  4FAG A;  4Q4Y 1;  4NID A;  2XH6 A;  2OZ6 A;  3OEB A;  4A2U A;  4LLF A;  5LA9 A;  5M0T A;  4GMP 0;  2PHU A;  2F17 A;  3B5L B;  4FO9 A;  3SIS A;  3ZSM A;  1OUX A;  4QDR A;  1QQP 3;  1RXF A;  2CHH A;  3NO8 A;  5H9R A;  3CU7 A;  3SIT A;  3I2D A;  4AI8 A;  4AQ2 A;  1W6O B;  3M3C A;  5FZ3 A;  1RC6 A;  3H7J A;  1ND2 A;  2NZ9 A;  4GWI A;  2GZW A;  1WCQ A;  2DFC A;  2VAU A;  3CJI C;  4FQZ A;  1A8D A;  5LY2 A;  3VBU A;  1N1S A;  4PQ9 A;  4KBB A;  3BU7 A;  2IXJ A;  3I3E A;  4ARY A;  3IAQ A;  5F6L B;  1W2O A;  2XXZ A;  2BEO A;  1H6Y A;  3BOP A;  2X8K A;  5CFD A;  1VRH 2;  3FBY A;  2QQU A;  1QJZ A;  4QDS A;  2HWD 1;  2AGS A;  2GME A;  2VCB A;  3S7I A;  4TZD A;  1W8Z A;  2W91 A;  1W6P A;  4ES9 A;  2FCV A;  4DMI A;  4LLO A;  4RQP B;  4CDX B;  1H1M A;  4BQ5 A;  4IV1 C;  3HVD A;  1XYP A;  3JBG 1;  4RD7 A;  5J09 A;  3MLJ A;  3VBH B;  5FZO A;  2ADD A;  1BBT 2;  2VC9 A;  2JDA A;  1UPS A;  4QPG B;  3EQE A;  1DQ0 A;  3J7H A;  3N9Q A;  2ZZJ A;  2W68 A;  1ZBE 2;  4OHY A;  2CTV A;  5K8S A;  5IK8 A;  5CFC C;  4O9E A;  1V6M A;  1GP6 A;  1ZZB A;  2RJK A;  1YQ5 A;  2PLV 3;  3GHM A;  3H3Z A;  4M3C B;  2BWA A;  1WW4 A;  5DG1 A;  5DDJ 2;  1L7R A;  1S0C A;  1IKQ A;  1YC6 1;  1D2S A;  2D44 A;  2VXR A;  4RR3 B;  4MGT A;  4DXR A;  1BMV 2;  4NOT A;  5T55 A;  2WN3 A;  1YI9 A;  4ZS3 A;  2QQW A;  1XND A;  2W3J A;  4XUT A;  5FOB B;  2FCT A;  1YFW A;  2VQU A;  2HWF 2;  1QOS A;  2WT2 A;  1R08 3;  2VUC A;  3WNN A;  2CSG A;  4UFI A;  1ZBE 3;  5FZ9 A;  3WDT A;  4Y1U A;  2LW8 A;  1H9W A;  1YNA A;  4XEZ A;  1SLA A;  5FBJ A;  3VZK A;  3ZM8 A;  5GLT A;  4QX2 A;  3VD5 A;  4FPC A;  1F5J A;  3ZYH A;  1GNH A;  4XJU A;  1PVC 2;  3I3D A;  3U10 A;  2BBV A;  1TNF A;  1LKN A;  1QJY 1;  2E7T A;  3FN9 A;  3H0O A;  5IK4 A;  2W9X A;  4KGQ A;  2BVB A;  3ZXJ A;  5LWB A;  2HWF 3;  2XUE A;  4DXS A;  2XPJ A;  1AXY A;  1W9F A;  2UY8 A;  1LOD A;  1YHF A;  2AAC A;  1Q8S A;  5CYY A;  4LUL A;  1EP0 A;  2L9L A;  5KBF A;  3MDP A;  2WSU A;  2D3S A;  1I5Z A;  5CAD A;  1IS5 A;  3UGF A;  4IE4 A;  2RS1 1;  1HQN A;  1HB1 A;  4IW3 A;  1DQ5 A;  4LBQ B;  2AC1 A;  1B09 A;  1KXG A;  4PT6 A;  1SBF A;  4TN7 A;  1N3P A;  4D7S A;  5JI9 A;  4P9L A;  4Y1Y A;  3D6E A;  2D7F A;  1X8M A;  4AVT A;  1OT5 A;  4YW3 A;  2XGX A;  1K45 A;  3MZH A;  4IE5 A;  1MQT B;  5L7O B;  3BIW E;  1CAW A;  2E63 A;  2RJL A;  1W9W A;  3J9S A;  1SEF A;  2XBO 3;  3LA2 A;  2GC3 A;  3EYP A;  1UYZ A;  4KG8 A;  2VMD A;  3I2K A;  4E2G A;  2JG9 A;  4XFC A;  2XHN A;  1DZQ A;  1FV3 A;  4XZU G;  5T5J A;  4E9K A;  1UY1 A;  2BPA 2;  5F39 A;  4A7Y A;  4QQO A;  1VBA 2;  1QJX 3;  3KHB A;  5DPN A;  4Q4Y 2;  3ZMO A;  2D3P A;  5BNO B;  1YEW A;  4X6Q B;  4M3C E;  3S57 A;  5FZL A;  2BZD A;  5K0U C;  2RVA A;  1LHV A;  4JC1 A;  2TNF A;  5GLU A;  3RYK A;  2B9V A;  3VB9 A;  3A0K A;  1SCR A;  1JU3 A;  2ZXQ A;  4XCB A;  5FXX A;  4XFI A;  1YYN A;  3HQU A;  3IKW A;  4LO8 A;  5A32 B;  3TOJ A;  1JBC A;  2WA3 A;  3TEW A;  5KC6 A;  4XC9 A;  4JGY C;  2OX0 A;  3ITQ A;  4RHV 3;  3DN7 A;  3U11 A;  4Q4V 3;  1AYN 3;  3LEK A;  4I0A A;  4KNC A;  1MS4 A;  4UF0 B;  3SCH A;  1JZ3 A;  1W39 A;  1X50 A;  3BOW A;  5F2S A;  4LBL A;  2NM1 A;  2R49 A;  4HSL A;  4W6X A;  4Y1Z A;  3IDE A;  4A6O A;  4ASM B;  5FO7 B;  1R09 3;  3RVH A;  1QXP A;  2WZR 2;  4QB2 A;  3T4H B;  3U4S A;  2ARC A;  4P9G A;  1ENX A;  1CAW B;  4QM9 A;  1DGW A;  2GN7 A;  2F4L A;  4G3Y C;  3W58 A;  5CEH A;  5ISL A;  4JVA A;  4OI1 A;  4Q4W 1;  2X10 A;  3AJZ A;  3AP9 A;  3DV8 A;  4BYY A;  4CEW C;  4FSJ A;  1CZV A;  4XJ8 A;  4GA9 A;  1PIV 1;  4QPI B;  3ZFE C;  3KLS A;  1BXH A;  2YGL A;  4E8D A;  4CXY A;  5FKC A;  5BNP C;  3NKT A;  2D6O X;  4BQX A;  2VBD A;  5FUP A;  4D3W A;  4I02 A;  4G4F A;  2WNV A;  3VZM A;  4D7Y A;  4WM8 C;  2RS3 3;  1OOP C;  3T2O A;  1Z78 A;  4QKD A;  4AL9 A;  3T1M A;  1QDO A;  5LAS A;  1A6C A;  4FVV A;  1COV 3;  1D4M 3;  1UU6 A;  4K8R B;  2VG9 A;  1QH7 A;  2VUJ A;  1H2M A;  4WBB A;  5C7G A;  2VMI A;  4LUK A;  5LAT A;  3BYW A;  4XXP A;  5IVB A;  4EN7 B;  2ARX A;  2WNU C;  4Y20 A;  4KMQ A;  1DQ4 A;  1LUL A;  2ZHL A;  1BZW A;  2BYV E;  3KVB A;  4HBN A;  1CPN A;  4MX3 A;  1IG3 A;  1Z0H A;  4W50 A;  5FZG A;  5DZE A;  3UJO A;  5BNP B;  1B35 C;  1P8J A;  2AR6 A;  2XVL A;  1AYM 2;  4S2H A;  5D8A C;  4FPK A;  2HH9 A;  4Y5T A;  1RMU 3;  3URF A;  3U0Z A;  1W6M B;  4XDQ A;  5EWS A;  3N9O A;  4F7Z A;  5LK5 A;  3MFA A;  2EAA A;  2VZP A;  2CDP A;  4ONU A;  2CYF A;  2VUL A;  2FQP A;  2VNR A;  3N7M A;  4HL0 A;  3V0B A;  3PVN A;  5JPN B;  3NV1 A;  1BVP 1;  1ULF A;  1GQH A;  4K8F A;  3ZXD A;  4CCC A;  4XAE A;  3ZYR A;  4DEV A;  2GAU A;  2DU1 A;  1NCR A;  4OQ9 A;  2ARE A;  3ZDV A;  2ZX4 A;  3PU8 A;  4HVQ A;  1JZ5 A;  1WZX A;  2DCK A;  3GYD A;  2PHL A;  2PAM A;  4AE2 A;  2XKO A;  3I3Q A;  1VBE 2;  3VBU C;  1HRI 2;  2OW4 A;  4GWJ A;  3KQR A;  3DF0 A;  4ZON A;  3ETQ A;  2V4V A;  1LOE A;  4MET A;  5CFD C;  3WOG A;  3FHA A;  1X82 A;  4Q4X 2;  1C5H A;  3T4V A;  2VCA A;  3K4Z A;  1GAN A;  4BIO A;  3DKW A;  4NR1 A;  1YCI A;  3WIN E;  3ILF A;  1W6P B;  4EE2 A;  2RDR A;  3WX5 A;  3R6S A;  5BYN A;  1F31 A;  3ZFG A;  1GFF 2;  4PQQ A;  4YZ2 A;  1DU3 D;  1V9U 3;  1EAH 2;  4YM2 A;  3ETP A;  4B8E A;  2BER A;  4QQH A;  1GUI A;  3DYM A;  3NJZ A;  5I8T A;  1LOF A;  1IPS A;  1G9C A;  2NMO A;  2R30 A;  1XB9 A;  4OZX A;  1POV 0;  2WT1 A;  5IAT A;  1Q8O A;  4GZ9 A;  2BQP A;  1J3R A;  4XFG A;  2YC0 A;  4JHZ A;  1MVQ A;  4OHW A;  2B45 X;  2UY9 A;  2ZGO A;  1NY7 1;  5BNN C;  3RWK X;  3AZV A;  4I09 A;  4I3P A;  4JGY A;  2A3W A;  5DZF A;  5D21 A;  4IEU A;  3WNK A;  3DXT A;  5IW0 A;  3SHR A;  5FKB A;  2ZHN A;  3NNL A;  3T08 A;  2PXJ A;  3A23 A;  3M3O A;  2W1Q A;  1N1V A;  3VHR A;  4DY5 A;  2WR9 A;  5B2G B;  4MHU A;  1H8T A;  4YVW A;  3DUI A;  3OOX A;  4ZS2 A;  4Y4Y A;  2E31 A;  1HB3 A;  2XBO 2;  3J8F 1;  1HQL A;  2DF7 A;  3IB3 A;  5F8P A;  4ERO A;  4EZ4 A;  4ZPI A;  4XF0 A;  5FYS A;  2EAK A;  3RYR A;  1RUJ 1;  2FCU A;  3HT1 A;  1PMJ X;  5FYI A;  4LO6 B;  4M3C A;  4Y3O A;  4NN0 A;  5BNP A;  2BGC A;  2BNO A;  5T54 A;  1OQ1 A;  3IT8 A;  3H8X A;  2ET1 A;  3G6J B;  2ZKL A;  3LPF A;  3VKL A;  4PJY A;  4A7Z A;  1ZYB A;  2D43 A;  2OZJ A;  3VD4 A;  1E5S A;  1CGP A;  2H0B A;  3GF6 A;  1PZ8 A;  2HYX A;  4QU1 A;  1CIW A;  3RJR A;  5IVC A;  2WQ4 A;  3POF A;  2CL2 A;  4AFD A;  1RUF 1;  3WV6 A;  4CYD A;  5AC9 3;  3ZXK A;  5EJ3 A;  4CCM A;  5FO9 B;  1GNZ A;  1PGL 2;  2R07 2;  4HVO A;  2ZKN A;  4YZ4 A;  3U78 A;  4JKL A;  4XW3 A;  1ASJ 2;  5I0R A;  2PYT A;  5LA0 A;  3RZG A;  3H7Y A;  1WKY A;  3KCX A;  4W6W A;  4P5Y A;  1ZZ8 A;  2PHW A;  4EWE A;  3P3P A;  2XWB B; 
#chains in the Genus database with same CATH homology
 2W92 A;  5LA1 A;  1UXZ A;  2W5F A;  3ECQ A;  4DUW A;  1YQ2 A;  3OB8 A;  2J1A A;  3III A;  2WZE A;  3A7Q A;  2W1S A;  2C9K A;  2OKX A;  2B4K A;  3T0B A;  1HN1 A;  1O8S A;  2W46 A;  5JXG A;  3CKH A;  4LHS A;  4BK4 A;  4BXS V;  1US3 A;  1JZ6 A;  4OZO A;  4CUA A;  4XUR A;  4QB1 A;  3WEZ A;  3I97 A;  1DYO A;  3I2F A;  2X05 A;  3SKJ E;  3U37 A;  5DMY A;  2EIB A;  4A42 A;  4CU8 A;  4P02 B;  4M4R A;  1IQD C;  1NX9 A;  1JYN A;  2V5D A;  3GDB A;  2QQI A;  4TXW A;  1UMI A;  1US2 A;  2VZS A;  1D7P M;  4E8C A;  2Y6G A;  2E33 A;  1XPW A;  2WO1 A;  4DUV A;  1EUU A;  3VD9 A;  5G05 L;  3MUZ 1;  2CDO A;  3I2I A;  3W5N A;  4P08 A;  5CZK A;  3IAP A;  2QQK A;  4ARX A;  3VD4 A;  2WN2 A;  2ORZ A;  4CUB A;  4LQR A;  5IJR A;  2W95 A;  3HPN A;  5C70 A;  2BBA A;  2EID A;  3HNB M;  2VMF A;  2WAA A;  4OYU A;  1GOG A;  4M4P A;  1JI6 A;  1JZ7 A;  5DQ0 A;  5B4N A;  1UZ0 A;  1O59 A;  2R7E B;  1JYV A;  3GM8 A;  3HNY M;  3T2Q A;  3VDC A;  3C7E A;  4MGQ A;  3MV1 1;  4A41 A;  2J1S A;  1R64 A;  2WAB A;  1ULP A;  4DXT A;  3P6B A;  2W94 A;  1JHJ A;  1BHG A;  2JD9 A;  3C8X A;  1UX7 A;  5DN2 A;  3NRU A;  2Y8K A;  1TVG A;  2YC4 A;  3LEG A;  1PMH X;  5LCW L;  1K3I A;  2PQS A;  3A22 A;  1W8O A;  3K75 B;  3VD7 A;  4A44 A;  4ET7 A;  1W8N A;  3C7F A;  4W4Z A;  4ZXE A;  2Y6L A;  3C7H A;  3OG2 A;  1J83 A;  4QPW A;  3DYP A;  3I2J A;  2W87 A;  2VCC A;  2ID4 A;  2VZ1 A;  3T0D A;  2RJ2 A;  2QQJ A;  1UYX A;  1T2X A;  1XC6 A;  2HLE A;  2VMC A;  3LEI A;  4CVU A;  4FI9 A;  3W5M A;  2YG0 A;  5HXM A;  4BJ0 A;  3GXU A;  4QDQ A;  3C7O A;  3OEB A;  3HOB A;  1F4H A;  3SEP A;  3WSO A;  1OH4 A;  1RYY A;  2XQX A;  3LQC A;  2LS6 A;  4QDR A;  2E26 A;  2BGO A;  4Z2A A;  4IUG A;  4GWI A;  2WDB A;  4L0P A;  1WCQ A;  3EB7 A;  5I0D A;  2VZR A;  2QQM A;  3I3E A;  4ARY A;  4W8J A;  3IAQ A;  3NQH A;  1H6Y A;  1UY0 A;  4QDS A;  2VCB A;  4KI5 M;  2W91 A;  2VR4 A;  5JMO A;  2V72 A;  4QX1 A;  3K4D A;  1K42 A;  2VC9 A;  3NNG A;  2JDA A;  5IFP A;  3I2G A;  5EJ1 B;  3J7H A;  2DCJ A;  3UES A;  5F7U A;  3THC A;  5JXI A;  3T09 A;  4CU7 A;  5JXJ A;  1L7R A;  3E1F 1;  3FL7 A;  2VTF A;  1SG3 A;  1I5P A;  1CX1 A;  4DXR A;  3ABZ A;  2W1U A;  2VZO A;  3LPG A;  2WN3 A;  4XUT A;  2W3J A;  2VQU A;  1OF3 A;  3WNN A;  3MUY 1;  4XUP A;  2LW8 A;  4MGS A;  5EIY B;  3ZM8 A;  3K4A A;  3K46 A;  2Y64 A;  4QX2 A;  3VD5 A;  5JXH A;  2QBX A;  1SDD B;  3I3D A;  1UYY A;  1JYW A;  1CIY A;  4CU9 A;  2QQO A;  1UY3 A;  3FN9 A;  2W9X A;  4RN5 A;  4A3Z A;  5C71 A;  3DEC A;  4DXS A;  3IDA A;  1OF4 A;  1NKG A;  4DUX A;  1OD3 A;  5CYY A;  3NJV A;  2L9L A;  4AG4 A;  1O8P A;  1LNS A;  1ULO A;  3JXS A;  2WAO A;  4XUN A;  4PT6 A;  3CZJ A;  2C26 A;  4ZZ5 A;  3WNP A;  3MO4 A;  3CDZ B;  4A4A A;  3I2H A;  3PUH A;  3OBA A;  1OT5 A;  2WQ8 A;  1K45 A;  1F4A A;  3CZU A;  4BK5 A;  1W9W A;  3MV0 1;  2VO5 A;  2YFU A;  3BN6 A;  3HNM A;  3ACH A;  3GGL A;  3EYP A;  1UYZ A;  3WF3 A;  2VMD A;  3I2K A;  3A21 A;  2XHN A;  4XZU G;  3FHQ A;  1UY1 A;  1UY2 A;  5DPN A;  2Y6J A;  4RYD A;  1W9T A;  3K77 A;  1JZ4 A;  2WUH A;  2BZD A;  4PF1 A;  2RVA A;  2ZEZ A;  2YB7 A;  2B9V A;  2WO3 A;  4YPJ A;  2ZXQ A;  4QX0 A;  1JU3 A;  1W0N A;  4OUE A;  3WNM A;  1H6X A;  1XNT A;  4LKS A;  4HG6 B;  4ZY9 A;  2VOT A;  3LEK A;  1JZ3 A;  1JU4 A;  2J1V A;  4A6O A;  4OMD A;  2E32 A;  3D3A A;  4QB2 A;  2X09 A;  4ZZ8 A;  3UNP A;  1GU3 A;  1L7Q A;  4QX3 A;  3F2Z A;  5HPO A;  2ZEW A;  1J84 A;  2X10 A;  2VME A;  1TG7 A;  1CZV A;  1JYX A;  3OGV A;  2ORX A;  3VD3 A;  4QB6 A;  4E8D A;  3OGS A;  2C4X A;  1EUT A;  2W1W A;  1NUK A;  2VM9 A;  2J22 A;  2ZEX A;  2W47 A;  3T2O A;  3ACF A;  3CIH A;  3THD A;  4XVH A;  3NJX A;  2XON A;  5A1A A;  2JKX A;  5C7G A;  5EJZ B;  1W9S A;  4XUQ A;  3WF1 A;  3BGA A;  4KMQ A;  3I3B A;  2RV9 A;  5J1X A;  1DLC A;  4LPL A;  4W50 A;  3SEE A;  1CZT A;  1P8J A;  4P00 B;  2WYS A;  4D8M A;  2WO2 A;  3T2P A;  4DEQ A;  2KD7 A;  3AC0 A;  2VZP A;  2CDP A;  2J1U A;  4UAP A;  3PUI A;  1DP0 A;  3LE0 A;  3MBW A;  1KEX A;  4DEV A;  1W99 A;  1K12 A;  2VZV A;  4JKM A;  3C7G A;  1JZ5 A;  2DCK A;  3T0A A;  3WNO A;  5G04 L;  3SKV A;  3VDB A;  2J7M A;  4GWJ A;  2V4V A;  3FHA A;  5IFT A;  2J1T A;  2VZU A;  3CMG A;  1XNA A;  2QQN A;  2VCA A;  3K4Z A;  3HN3 A;  2Y6H A;  3ACG A;  3VDA A;  4MO3 M;  1MPX A;  1GMM A;  1GNY A;  4PQQ A;  1UMH A;  3WNL A;  4JX0 A;  3WQB A;  4TTG A;  3ETP A;  2BER A;  3OEA A;  3DYM A;  1GUI A;  4KWU A;  2DDU A;  2VQT A;  5JR2 A;  3WF0 A;  2VJX A;  2WBK A;  4OMC A;  2EIE A;  3ACI A;  4CUC A;  1JZ2 A;  2VL4 A;  4GZ9 A;  5JUV A;  3OGR A;  4AAX A;  4JHZ A;  2VZ3 A;  5IHR A;  2YC2 A;  3WNK A;  1GQP A;  2XOM A;  1JZ8 A;  3HJR A;  3T08 A;  2ZEY A;  4UI9 L;  3A23 A;  1NAE A;  1GOH A;  2W1Q A;  2Y6K A;  1PX4 A;  1SHW B;  3P1I A;  5FUI A;  2EIC A;  3WF2 A;  4BDV B;  1UXX X;  3CQO A;  4JKK A;  2E31 A;  5IYY A;  2J1R A;  3IB3 A;  2WZ8 A;  1PMJ X;  2J1E A;  2VZQ A;  1PX3 A;  1GOF A;  1KGY A;  2Z4F A;  4UOJ A;  4MAD A;  2VZT A;  3LPF A;  3HEI A;  4QAW A;  2JE8 A;  2QQL A;  4A45 A;  4CU6 A;  3WF4 A;  4D0Q A;  2HYX A;  4XUO A;  5B4X A;  3UET A;  3DYO A;  4MOA A;  5LA2 A;  2YFZ A;  4JKL A;  2BGP A;  1UY4 A;  5LA0 A;  1CZS A;  1WKY A;  4P5Y A;  1UWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...