4UI9L

Atomic structure of the human anaphase-promoting complex
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
182
structure length
182
Chain Sequence
b'TPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVESSIGKFPRCTTIDFMMYRSIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANAPHASE-PROMOTING COMPLEX SUBUNIT 1
publication title Atomic Structure of the Apc and its Mechanism of Protein Ubiquitination
pubmed doi rcsb
molecule tags Cell cycle
total genus 31
structure length 182
sequence length 182
ec nomenclature
pdb deposition date 2015-03-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF03256 ANAPC10 Anaphase-promoting complex, subunit 10 (APC10)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 4ui9L00
5C71A 2QQLA 3LEGA 3IAQA 3WF2A 4QDRA 2YFZA 4DXRA 5LA2A 4XVHA 3T2PA 1UY0A 4ET7A 1JZ8A 1I5PA 2BERA 3VDBA 2VTFA 4XUPA 2J1SA 5A1AA 4LHSA 3T2OA 3HOBA 2VC9A 2ZXQA 2W91A 4P00B 2CDOA 2E31A 2PQSA 4JKMA 2VCAA 3DYPA 3THDA 2VQTA 3MBWA 2VJXA 3CDZB 1JU4A 3IB3A 4CUAA 3OGVA 3WF3A 1UYZA 2VMFA 4M4PA 4QB6A 4Z2AA 2EIEA 4A4AA 1CZSA 4XUNA 3FHAA 1GOFA 3JXSA 2WO2A 4GZ9A 3VD7A 2Y6LA 3WEZA 3SKJE 1UYYA 2JE8A 3ACHA 3CZJA 2C9KA 3WF4A 4LKSA 1NUKA 1OT5A 4A42A 1PMJX 3I2HA 3C7EA 2VZSA 1GOHA 1UX7A 3ACFA 3IIIA 2VMCA 2C4XA 1US3A 2OKXA 4GWJA 4QB1A 4QAWA 2J1UA 2ZEXA 1UY4A 1PMHX 4PF1A 3ACIA 2VO5A 2J1VA 4XURA 2B4KA 2VZPA 4FI9A 5FUIA 4AAXA 3LEIA 2XQXA 1PX3A 1JZ4A 3HPNA 3W5NA 2QQMA 1DLCA 3T0DA 1JZ5A 2L9LA 2Y8KA 4D8MA 3LEKA 1XNTA 3I2FA 3I2IA 4BDVB 2WZEA 3A7QA 4DEQA 2WN2A 3VD3A 4CU9A 2ORZA 2WN3A 3C7HA 1GMMA 4TXWA 2RV9A 2VMDA 4MO3M 3OG2A 4XUTA 3WF1A 1H6XA 1HN1A 4QX3A 1OD3A 3CKHA 1BHGA 5DMYA 3C7OA 3T09A 2V72A 2EIBA 4A3ZA 3ETPA 4DUVA 3MUY1 4RYDA 1OF3A 1NKGA 4QB2A 1O59A 5IJRA 3HNBM 4P5YA 2VL4A 4OYUA 4JHZA 2WABA 3MUZ1 1SDDB 4ZZ8A 2QQIA 3DYOA 4CUBA 3GXUA 3A23A 4CUCA 4MADA 3CQOA 1GNYA 1JZ2A 4QX1A 2WQ8A 3K4DA 2XHNA 4MGSA 2YC2A 3C7FA 2QQJA 4BK4A 4XUQA 2VCCA 3VD4A 1DP0A 3NNGA 4ARXA 1GU3A 3DYMA 1GQPA 1SHWB 2E32A 2JDAA 5I0DA 5JUVA 4PQQA 5LCWL 2VZQA 3LQCA 2W46A 1CIYA 5DPNA 4W8JA 3BGAA 1W99A 5HXMA 5LA0A 1JZ6A 2XONA 1OH4A 3NQHA 3OEBA 1UXXX 5J1XA 3IDAA 1JYNA 3A22A 1MPXA 3LPGA 3P1IA 1CX1A 5EJ1B 1XC6A 3VDAA 2Y64A 3CMGA 1P8JA 2WAOA 1W9SA 4KWUA 2VZ1A 4E8DA 1K42A 4PT6A 4CU8A 1L7RA 1W8OA 3HJRA 3SKVA 2B9VA 1JYXA 1OF4A 3T08A 3SEEA 1W0NA 2ZEZA 4XZUG 4KMQA 3WNPA 3FL7A 1JU3A 3GM8A 3K4AA 2Z4FA 1GUIA 2J22A 2VCBA 3K77A 5G05L 4DUXA 5CZKA 3LE0A 2Y6KA 2YG0A 1JI6A 3K46A 3ABZA 4DXTA 2J1AA 1NAEA 4CU6A 3K4ZA 1W9WA 3NJVA 1ULOA 2VZVA 2YC4A 3WNOA 4UI9L 2V4VA 4LPLA 4P02B 2RVAA 3SEPA 2Y6GA 3OGSA 1J84A 3U37A 4A6OA 2X10A 1TVGA 1K12A 3A21A 4QPWA 3WNKA 4A41A 3C7GA 4CU7A 2HLEA 4D0QA 5EJZB 1UY1A 2VZUA 2W1WA 2EIDA 3VD9A 2VZ3A 1XPWA 5LA1A 2WDBA 2WBKA 4XUOA 5EIYB 3CZUA 3ACGA 2QQKA 2JKXA 3FHQA 1XNAA 3FN9A 2C26A 2BGOA 2RJ2A 1CZTA 1O8PA 1DYOA 1UZ0A 1F4HA 3NJXA 2CDPA 4W50A 2DCJA 4JX0A 2J1TA 1D7PM 2W1UA 1UYXA 3C8XA 4A45A 5IFTA 2W9XA 4AG4A 3MV11 3WNMA 5JXJA 5CYYA 3WNLA 4QX2A 4YPJA 3IAPA 3VD5A 2WO1A 5IYYA 2BGPA 2VM9A 3K75B 4CVUA 3BN6A 2ID4A 2BZDA 3HN3A 4DUWA 1YQ2A 1L7QA 4TTGA 1EUTA 1IQDC 2ZEYA 2KD7A 3P6BA 2W95A 3OEAA 2W1QA 3GGLA 1W9TA 3I2KA 4HG6B 4DEVA 2EICA 3MO4A 2W94A 2VZOA 2Y6HA 2WAAA 4ZZ5A 2X09A 3J7HA 1UXZA 3HNMA 4M4RA 5C70A 4LQRA 1R64A 2W1SA 5F7UA 4A44A 3WF0A 2VMEA 1WKYA 3PUIA 1CZVA 1K45A 3UETA 1EUUA 2DCKA 2VZTA 2WO3A 5B4NA 1GOGA 5IFPA 4BXSV 5G04L 5IHRA 5JXIA 2E33A 2WYSA 3HEIA 3WNNA 2LS6A 3UNPA 2LW8A 1UWWA 3I3BA 2WUHA 4MOAA 2J7MA 4IUGA 4OMDA 4ZXEA 1US2A 5JR2A 3VDCA 3MV01 2J1RA 4GWIA 3WSOA 2JD9A 4BK5A 2QBXA 1JYVA 4QDQA 3I2JA 3T0BA 4L0PA 4MGQA 3THCA 4E8CA 5DQ0A 2WZ8A 4DXSA 1WCQA 2DDUA 1TG7A 3CIHA 2VOTA 3OB8A 4ZY9A 4JKKA 2W87A 1T2XA 5C7GA 3WQBA 1SG3A 4QX0A 1F4AA 2YB7A 2Y6JA 4W4ZA 4QDSA 1ULPA 4RN5A 3OGRA 2XOMA 3ECQA 3GDBA 1H6YA 2VR4A 2W92A 3EB7A 1UY2A 1W8NA 3ZM8A 5DN2A 2HYXA 3OBAA 2E26A 2W3JA 3I2GA 5JMOA 2R7EB 1KGYA 3F2ZA 3T2QA 2BBAA 4OMCA 3EYPA 5B4XA 3UESA 2QQNA 3W5MA 1O8SA 1KEXA 4KI5M 2VQUA 4UOJA 4BJ0A 2VZRA 2W5FA 2ZEWA 1JZ3A 1JHJA 1LNSA 1NX9A 4OUEA 1UMIA 2W47A 2X05A 4UAPA 1UMHA 4OZOA 2V5DA 1J83A 1UY3A 5HPOA 3DECA 1PX4A 2J1EA 3HNYM 3NRUA 3PUHA 3AC0A 4P08A 3E1F1 3D3AA 1JYWA 5JXGA 3I97A 1RYYA 2ORXA 3I3EA 2YFUA 5JXHA 2QQOA 4ARYA 3I3DA 4JKLA 3T0AA 1JZ7A 1K3IA 3LPFA
chains in the Genus database with same CATH superfamily
3USUA 5C71A 1WMDA 5FKBA 1QGLA 4LIUA 4ATEA 2RMU3 1MR5A 5GZDA 5BUVA 1ZBA2 5FZLA 5J3UA 1Y7BA 2QDNA 4BPZA 2W52A 1ZZ7A 5DUUA 3TN93 5BYNA 1VB2A 4IQPA 1GZCA 3PNAA 4LBJA 2HWE3 1I1EA 3WLUA 1LEMA 5FYIA 5A1AA 3CEWA 4LHSA 3HOBA 3HN1A 1QQP1 5EZWA 2JX9A 2HJIA 4P00B 1CAXB 2XGXA 1C57A 2E31A 4AEKA 5I93A 1ZX5A 3PUSA 3UJOA 2VCAA 3DYPA 3THDA 4K3UA 5FZDA 5T5OA 2P3YA 5J48A 1O3QA 1AUYA 3RI8A 3VDDC 2FZ2A 4BQ5A 3QOPA 2PHUA 3I2OA 2HBUA 5FY8A 3MBWA 4MXVA 3H8UA 1NCQA 1G6NA 4CP0A 1AR61 1RUF1 1LOEA 4XIOA 4CXXA 2JKBA 2RS33 2A6ZA 2YZ4A 3FJSA 1O4TA 1PIV1 1UZVA 3KSCA 2VMFA 2W2IA 4M4PA 5F3EA 3NKGA 2BEOA 4JGZA 4XQWA 5A1LA 5IK5A 1HV0A 1W6OA 2ZGQA 5DZGA 2JE9A 1ENXA 2UWCA 4L97A 5FIXA 1ALYA 3CLPA 3VD7A 1UYYA 3JD72 2JE8A 4AWDA 1MEC1 2HWF3 3WF4A 4W6WA 1NUKA 1RUG3 3DEMA 4RSUA 3F95A 1G9AA 3TEZA 3I2HA 1VLNA 1H0BA 3GJBA 1UX7A 2Q1MA 3LA3A 1XXNA 2C4XA 4FFHA 1JBCA 2FMDA 2R1DA 1HB3A 5JOZA 3OOXA 4GWJA 1ULEA 4Q4Y3 4XTPA 3W9AA 1AZDA 4O65A 1VRBA 3BU7A 4Q4X2 2RR13 4LUKA 2RS11 3O1RA 1PMHX 3D4KA 3ACIA 3LA7A 1H2KA 4GJYA 2WINB 1OSGA 4GMP1 2G9GA 4PLMA 3IPVB 1BBT2 4LUMA 3VHPA 4XCAA 1B35C 3ZSKA 1EPWA 3U07A 4AF9A 1TME3 3BPSA 4HKOA 1UOBA 5KHHA 3BTYA 3GNEA 3ZXEA 3VKMA 2FDJA 1HRI3 3MLKA 1PX3A 4GH4A 4QQPA 4OHWA 2XJTA 2VXJA 1YYNA 3NJZA 3PUQA 4FPHA 4QGNA 4QM8A 3T0DA 1SLIA 2LM3A 2Q30A 2EAKA 4IESA 5A7WA 3VZOA 1N47A 1H2MA 2HWD2 4KQ7A 4R9AA 2IXCA 1R092 1S0EA 1YFYA 3PURA 4D8MA 3LEKA 2WLPA 3UGHA 4CCDA 4E2GA 5EHDA 4NVPA 5ABJB 1VBC1 2EXIA 1XNTA 5KHKA 4XJAA 3LGRA 4BDVB 1SLCA 1DU3D 3DPRC 1FI2A 4JRAA 4YLZA 2GC2A 4DEQA 4ES9A 5BNPC 1PO22 1PO11 2B45X 4CDUC 4CU9A 1AX0A 2JDPA 4Q29A 4Q0VA 2BYVE 2VW0A 4MSVA 1RUH2 4I09A 1QH6A 3V0AB 1VBA1 2X8KA 1MS9A 1TNFA 2GH2A 2ZA9A 3GZAA 3MGUA 2R071 4B3NA 2WSVA 3N7MA 4LBKA 4NIGA 1QOSA 1WZXA 3PMEA 3ZXFA 3FFQA 5KC6A 3NAPC 4N43C 4BHPA 1WLTA 5DMYA 4R4XA 1C1LA 2V72A 4COZA 3RVHA 5ERLA 1Y43B 4AQ6A 5A3LA 4E4HA 2IUWA 1NKGA 1O59A 4E4DX 1GWLA 1LOBA 3OUIA 2IFRA 3AZYA 4ZZ8A 2CAUA 1BLZA 2ZX0A 3DYOA 4QKNA 4YVSB 2RM22 1YLLA 5GZCA 1ZRFA 4Z8BA 4IGPA 1U5ZA 3A23A 3JQWA 4M01A 5CKNA 4C91A 3I59A 1NA1A 4IETA 1GNYA 3TNQA 4IGOA 4IE7A 2AREA 3VUOA 2XHNA 1RHI1 3GZTB 3EJKA 3IDBB 2VGDA 2QQJA 2QQVA 1XE0A 1YUDA 4AZZA 5J37A 2RJKA 4BK4A 4QD2A 2VCCA 2D6PA 4OCTA 1Y4WA 4META 1UOFA 1YFWA 2ENRA 1OA4A 3KWVA 3OCPA 5F9TA 5C4WA 2X5IA 4F8AA 5D8AB 5D1IA 2D7FA 1GQPA 3LF7A 4ZS3A 1QJU3 4AHZA 4QPGB 2ZX2A 1WLWA 5JUVA 4E27A 2VZQA 2ZGPA 1A34A 1OFNA 1UOJA 2W46A 4WM7B 5C8WA 3VGIA 5FPUA 1W3XA 4XW3A 2ZTNA 4XOGA 1X82A 4HSJA 4N7IA 4FFIA 5AC93 4X8PA 1WBFA 2VUAA 1S0BA 3K51A 1I9RA 1W99A 3KQRA 4NR1A 3VBOB 2HWE2 3VZMA 1O5UA 2PQQA 4IV3A 2GP3A 4KU7A 1OH4A 1OKQA 4BWOA 3VHNA 2A6XA 3KV9A 3AKPA 4CA9A 3LPGA 1MPXA 4AEMA 1R081 3HQUA 3P1IA 3VBSA 1HXS1 1FOD3 2XQRA 4MHRA 3A0NA 1AL23 2VNOA 3NWKA 1S0CA 4K20A 2HWC3 4XFCA 5GZGA 1K5MB 3MDPA 4Q4V1 3ZFEC 3CMGA 5F32A 4FO9A 5IATA 1O91A 5J09A 4ISQA 4N9HA 5IK7A 1RUE3 3EMRA 4CTEA 2WNUC 4B4RA 3LZZA 1F8VA 1O4ZA 1DBNA 1S0IA 1V6KA 4EZ4A 2RS32 4CEWB 1ACCA 3CJIC 3VHOA 3RS6A 1HQWA 2WKKA 3SKVA 3UK9A 5C33A 1JHNA 2B9VA 1OF4A 3UT0A 4DIQA 4FAHA 1Q8QA 4YGBA 1NLRA 4XXPA 1C8M3 2JECA 1UL9A 2K2SA 5F5AA 4AQSA 3D0SA 2ZKNA 3FL7A 5FYCA 3SLIA 2Z4FA 2AZ5A 2WNVB 1BVP1 4LHLA 1LESA 1IS3A 2IXLA 2VCBA 2CHHA 2A6VA 4HXCA 2HWF2 2D44A 3WQ0A 3ZFGA 3VBUA 3ILNA 1JYTA 3SCHA 3AYDA 5FUNA 2Y6KA 1JI6A 3K46A 4IV1B 3ABZA 1ZZ8A 4DXTA 1QJX1 4GA9A 2J1AA 4AVSA 4XFIA 4HBNA 4DY5A 4WBBA 3RQ0A 2QVSB 5L9BA 5FP4A 3K4ZA 4F7ZA 3NJVA 4BMEA 4OLLA 5GM0A 3X29B 4A7KA 3FE5A 2YPJA 3MIEA 3POJA 1EAH2 1H1MA 2PHTA 4XPVA 5KHGA 4LJHA 2QQPA 3ST7A 3B94A 4J1WA 4AE2A 1GWMA 4ES8A 5JIUA 5LW9A 4CPBA 1J84A 3RZZA 1TME2 3AJYA 4J25A 1R1A3 3KT7A 2ZZJA 1W2OA 3A21A 4QPWA 1XNKA 4XFGA 2BDRA 5I8SA 1DCSA 2HLEA 2VH9A 4QQOA 5FREA 1UY1A 4E2SA 3TWIA 2ZOEB 3HQRA 2W1WA 1KRIA 2D6KA 4L11A 4UWDA 4Y1YA 1OOPB 1J3RA 2E7AA 2R042 1XPWA 4O9EA 3IBMA 1W8WA 4AFDA 3AP7A 3WXPA 2WDBA 5GLZA 4XUOA 5LA1A 1U0AA 1D0HA 2R0FA 1FMD1 2Z79A 3ZYIB 2ILMA 3ACGA 2JKXA 1QJY1 2VOVA 3RZLA 5FQ0A 4QPIC 5ANQA 5A1FA 4F83A 1ZREA 2C26A 4PHZA 1D0GA 1UZ0A 1DYOA 2FCVA 5E88A 4Y22B 3PLQA 3VN4A 1HRV2 4FQZA 2BVVA 2XUMA 4W6YA 1SFPA 1V9U1 2DFCA 2F17A 5FZ6A 2G4IA 3H7YA 1TMF1 4OHXA 3INAA 4MXWA 3VDDA 3AKQA 5GLTA 3MIHA 3C8XA 1RVF3 5E1RA 3M7AA 4XJUA 4A45A 3OJBA 2BNOA 1N1TA 5JXJA 1PMIA 4FOYA 4LBNA 1Y9MA 3OUJA 3MLLA 4FPLA 1SLLA 1VR3A 5F3IA 1ND2C 1W8FA 2WO1A 4BH9A 1W6QA 3N36A 3D82A 3LEMA 1OLMA 4PDWC 5BNNB 1SDWA 1WA4A 1ULGA 1EV12 4M0NA 3P6BA 2W95A 5FO9B 2Q0AA 1SBFA 3GYDA 2G1MA 3H3ZA 2ARXA 4HG6B 3AMMA 3L9JT 2EICA 2OIIA 5FPXA 5AVPA 3WUCA 4K8RB 4D6RA 4JDOA 5CISA 5FZ9A 4QX7A 3S7EA 1VALA 4LXLA 2AEYA 2JDMA 2XJVA 2ADDA 1S4CA 2Q1ZB 4CXWA 3E6DA 2AEZA 2P17A 1H1IA 1OVSA 2WZR1 3WF0A 2VMEA 4GULA 5ACA3 4I30A 5KXDA 2CSGA 2PLV2 4DPNA 5FZFA 3UETA 4CCCA 1EUUA 1PZ8A 1HN0A 1W2AX 3EXUA 3GF6A 4HK9A 5A33B 1VRH1 4P9LA 1F31A 3AVSA 3RYKA 2WQZC 1W05A 3LCPA 4S2FA 3AL5A 4EWAA 3JBG2 5FZCA 3CNAA 5T54A 3M1HA 4MV2A 4MGIE 4R9CA 2PA7A 4JQRA 5A7NA 1AHSA 3VZNA 5JXIA 1KJLA 3H1YA 2HKXA 1B35A 3HEIA 4FVVA 5LEKA 1ULDA 2LS6A 3K48A 4GJZA 2JG8B 2O8QA 1NCRC 2RS51 4P14A 1CN1A 1GP6A 5CVRA 5L9RA 2XJSA 4XACA 4AQ2A 3SCFA 4BQYA 5JSPA 5K8SA 4OHYA 3D6EA 2JEMA 2MNGA 4IEXA 5HI0A 3B93A 4MOAA 1XBFA 3ZX7A 2WJSA 3AX4A 2E9QA 4LHNA 1JUHA 1AL22 5JR2A 1AR71 3ENRA 2HWC2 3ZYGA 2WIIB 1NZCA 3WSOA 3N9NA 4Y5TA 2QBXA 2PHWA 2YUEA 3DPRA 5FJHA 1M4WA 3I2JA 5BNPA 5L7OB 4COVA 1NOVA 4CDUA 4G3YC 3MPBA 1AYN2 5JMCA 4L0PA 2WS92 4Y1XA 5D2AA 2WRAA 4H14A 3CHXA 5GALA 2DU0A 3TOJA 1ZZCA 1PK6B 3DUIA 4DB5A 3ILRA 1TG7A 1NY71 1AR63 1FNYA 1RUF3 3DXUA 3WW4A 1NT0A 2GN3A 4DRVA 3CIHA 3NAPA 4N43A 1H2NA 4WZFA 1C8M2 3MHZA 1YQ8A 5FYMA 4BU2A 4BLIA 2JB4A 1F4AA 4URAA 5FY1A 4W4ZA 3B5LB 2HH9A 3RRDA 1ULPA 3PMSA 4RN5A 4UW4A 3OGRA 4N8MA 3PVBB 2A3YA 2JE7A 3S30A 3R4DB 1H6YA 1YCIA 1VBD2 4NRPA 1YIFA 5CBLA 4HN0A 3AYEA 1MS8A 4NHXA 4CEYB 1S0JA 1DLLA 2W92A 2DCYA 3U4XA 2P1BA 1ENSA 2O8OA 1MS3A 5FYBA 5CB7A 3WQ1A 1NYWA 1W8NA 3B7MA 4GWMA 4W6XA 1IZ3A 1S0GA 3OBAA 5FZIA 2E26A 3DV8A 3IDEA 1QY4A 3POSA 4P9XA 2QFEA 2ZHNA 5LASA 3U75A 3F2ZA 3PU3A 4JDNA 5BNOC 1X9TA 3TRSB 3GBFA 5KBFA 3O1VA 2D97A 3ZR6A 1SLBA 2UYAA 4HPKB 1UOGA 2DVAA 3RG0A 3EYPA 1ENQA 4U2AA 1N3OA 5B4XA 1WMXA 2JENA 3BPZA 3UESA 3BTZA 3JB4C 3PU8A 1IHMA 2WNEA 4LE3A 3RI9A 4CDQC 3W5MA 3PTRB 2QNKA 4X8NA 5FBJA 1RB8G 4QXCA 1KEXA 4EROA 4YG3A 3JU9A 5LATA 3ZPYA 4LBMA 2VQUA 3W20A 1ULCA 2R1BA 2VZRA 2PHFA 2W5FA 1JZ3A 1JHJA 1LNSA 5A32B 3PVEA 1AJOA 1CX4A 5F5CA 2X05A 2H0BA 4V2WA 2AUYA 1J83A 1UY3A 3ROUA 3N4MA 2VCMA 4TN7A 3R6SA 1AF9A 2BV4A 3J8F1 4AGRA 2RDRA 3J7NA 1VBC3 3U78A 2ZHKA 2JDUA 4NIDA 4AVVA 4XDOA 3I97A 5FY7A 2TNFA 3S6PA 2K0GA 3I3EA 2GMMA 2B9UA 4L2NA 2BOJA 4HKLA 5A6XA 4Q5OA 3I3DA 5FUPA 5T5JA 2BWCA 3B69A 1H8TC 2AC1A 3WW1A 2YGLA 3ZFEA 2IXKA 2QQLA 2VNRA 4LKEA 3RDIA 3WF2A 4FOWA 2C1FA 2X29A 4DXRA 2WNUA 4XVHA 2P3JA 4Y20A 4Q0SA 5LBFA 5A3MA 1I5PA 1AYM1 1W0PA 2K9ZA 2VBBA 2DVBA 3CJIA 3WCRA 3VDBA 3IZOA 1FYUA 1LAJA 4TLFA 3OYWB 2BBVA 2VUCA 4COUA 5AFBA 3ZDVA 2VC9A 3WDYA 4XF3A 4BE3A 1XNCA 4Y4RA 4RHV2 1DQ1A 1SPPB 4I02A 3WV6A 4JGYC 2IWGB 1T6GC 4BZ4A 1KS5A 4IL7A 5C8CB 1XSRA 1W6NB 3JD73 5JZGB 1V6IA 5FYVA 1UU5A 2VTXJ 1IS6A 3CDZB 5FWEA 2ADEA 3IB3A 3WHTA 3WF3A 1UYZA 1W8UA 3USSA 5I0SA 3LDRA 4M3CB 2VUJA 2QDRA 1BCXA 1QNWA 1QNYA 1W6PB 1YI9A 1PVC1 4O9GA 3BIEA 4A4AA 3IN9A 1W2NA 3AZXA 4R52A 1GICA 4J6GA 4Q4X3 1ZBE1 3K2OA 4GXLA 4UFLA 2WO2A 4GB31 3WZ1A 1PZ7A 1KJRA 2Y6LA 3WEZA 3SKJE 5CFCB 1MZ6A 4RQPB 1BBT3 1SLAA 1ZZ9A 3MZHA 1AR93 2C9KA 1HB2A 3LKJA 1C8NA 1UF2C 4AEDB 5ISLA 1KFXL 1PMJX 3C7EA 2VZSA 5A7WB 5FOJB 1YFXA 1HQLA 2R061 3IIIA 3MF9A 2KM2A 2OKXA 4YSFA 1C4RA 4MH0E 5A6YA 2PYTA 4NIAA 1S2EA 4PI0A 1UQXA 3WUDA 1YQ5A 1WBLA 2ZEXA 1RXFA 1W8ZA 1QQP2 1R083 4LA3A 4PF1A 3THTA 1O3RA 1VAMA 2H6BA 5DAQA 4XURA 2DU1A 5GZFA 4XJWA 4ZU7A 4RS5A 3SH3A 3E97A 4LOTA 2VZPA 1PO23 4KWKA 4CXYA 1DDLA 3NV2A 4AYUA 2XJQA 3UKVA 3ZMOA 1URXA 4QPIA 2TEPA 2WYFA 5EWSA 2ZX1A 1RUH3 2N7GA 1SBDA 3DL3A 4DMIA 5K0UB 3HPNA 1OD5A 2GMEA 4XQ4A 1G9DA 3W5NA 3I3MA 5HCAA 1GQHA 4RA0A 2JXAA 1RUF2 1AR62 2L9LA 2Y8KA 4FP2A 3M70A 1PIV2 1VP6A 1XOYA 2BNMA 3I49A 3MW3A 1RIRA 1KDKA 3FZ3A 1LGCA 1CJPA 1NZIA 2WSUA 1SZBA 5FZOB 1N3QA 1X8EA 4CCKA 3KT4A 3RJRA 3VD3A 1UKRA 1ND2A 2ORZA 3KS7A 1NLSA 1C3HA 4EJRA 1APNA 4Z2WA 1PGL1 4I01A 2Q8EA 2WN3A 2DF7A 4FPKA 1YEWA 4PDWA 4TXWA 1MEC2 1WW5A 2VMDA 3WF1A 4TWTA 2OVUA 3VBFB 2UY8A 1OLME 2RM23 4KGQA 1HN1A 3SQOA 2P6CA 4QX3A 1OD3A 3BODA 1BHGA 3OBZA 1J1TA 3C7OA 4I3GA 4RFT0 3B9IA 3V0BB 1HB1A 4LR4A 3RZMA 4DUVA 1REEA 4MGKE 3MUY1 1OF3A 2RS12 1XE8A 1CESA 2DTWA 5FK8A 5FO7B 4QB2A 5JOWA 2NLRA 2GSYA 2VULA 5KC5A 2OX0A 1ASJ3 2YYOA 5T3NA 2YROA 3ELNA 3NNFA 5C9AB 3FBMA 3GZEA 5FZ3A 3MUZ1 3WX5A 5DXDA 2QQIA 4RR3B 2UWAA 2NZ9A 3AKSA 3CO2A 4CUBA 3AZWA 1LB2A 5L36A 5FMOS 4QQ2A 4QX8A 1Y3TA 4LO5B 4KU8A 3ZFFB 2NP0A 1JZ2A 2ZAAA 4QX1A 3MIBA 1NE4A 1CAUA 4PLOA 5TSWA 1M06G 2DV9A 2YC2A 2ETEA 1NCRA 3C7FA 3O0XA 4Q4W1 4Y1VA 2VOXA 3MYXA 4KG0A 2MHFA 4XUQA 4YVWB 5F5IA 1VBC2 2ZGLA 2WT2A 1RTVA 4HL0A 4YW6A 1DP0A 2OT7A 4CDXB 3NNGA 5A6ZA 1JMUB 5SV8A 4LBQB 4ARXA 3IIAA 4EE2A 1PO12 3KCCA 4I0AA 4LKFA 2PXJA 3ZXJA 3GJAA 1LCLA 4GKXA 2JDAA 2E32A 3NMBA 1QJY3 3VBHB 3QD6A 1O4YA 5HV4A 2XWBB 3O1UA 3N9MA 1AJKA 1VBA2 1YFUA 3DKWA 3OPWA 4Y5Z0 4AW7A 3S7IA 5FPAA 2R072 3NNLA 5E6HA 1Q8SA 1CIYA 1LU1A 2MPFA 2P4EA 4NJ4A 4W8JA 1VAVA 3BGAA 3TAYA 3TYJA 5IT6A 3TEYA 2WT1A 2C6SA 4C1WA 5C3PA 4B4QA 5CFDB 4K1ZA 1ND3B 2BNNA 2EXKA 2JICA 4LO4B 5ABJC 4YM2A 4LHKA 2ZGNA 4IE0A 3H1WA 3S5QA 5A80A 3OBTA 5LA0A 5IK4A 1J59A 5J1XA 3RFRA 1SACA 4XMAA 1JYNA 5KHIA 1Q8VA 5T50A 1VAKA 1QXJA 3TB0A 3ZXKA 2ES3A 4A7ZA 4A6SA 4YZ5A 3EO6A 4D6SA 3KZ4C 1CAWA 4ZKTB 5CKMA 2ZHMA 2Y64A 1BMV1 2BJSA 1P8JA 2WAOA 4B7KA 1S2KA 5EP9A 2ZGSA 4KWUA 1JTZX 5FZHA 2VZ1A 3ZN6B 1RUC1 1POV3 3I2DA 4I0BA 4YGEA 1H2LA 1LODA 3AKRA 1RHI2 3HJRA 1CAVA 1H9PA 4XMIA 3ZXGA 3NJYA 2PAEA 1U12A 5FPBA 5IVYA 3UGFA 1W0NA 2G19A 2XJUA 2WZR3 2ZGUA 4IEQA 5A3TA 4KMQA 1EAH3 1MZ5A 4UFHA 2R16A 1JU3A 3K4AA 4YVSC 4CCNA 2VG9A 5BNOA 2NQYA 3HBKA 3LIGA 5DUWA 5IVFA 2J22A 1D4M1 1GZWA 2TUNA 2XBO1 1UN1A 1AXYA 1AR92 1MS5A 4XJZA 3VZKA 3LE0A 1MZEA 4NRMA 3FUQA 4CDQA 2YG0A 4PBPA 3ES4A 2YV8A 4N9IA 2PFWA 1NAEA 3DKQA 4I3PA 4AFAA 4AK3A 4MZUA 4OULA 1W9WA 4CDWB 1ULOA 3H3LA 1YXWA 2VZVA 4B1LA 4YFZA 5BV6A 4YW5A 3O1TA 4UFMA 4YG6A 5D8AC 4CCJA 3Q8BA 1TQ5A 3ATGA 3ZXAC 1R082 1OQDA 3E6CC 1HXS2 4QPGC 4Y1UA 4LPLA 4V1PA 2R043 2QQWA 1WMFA 2BFUS 1AR73 3SEPA 4D6QA 4HMZA 5FQ0B 1DYKA 3H3UA 4WM7C 4OI1A 4CP2A 3H0OA 4M00A 1MS1A 1OC1A 2X10A 4LA2A 2IVIB 1LOAA 3LA2A 4Q4V2 2Y60A 2VD7A 4CP1A 2VTXA 1XU2A 5FRAA 1R1ZA 4XCBA 2MEV1 3VBOC 4FAGA 3VB9A 1HJGA 3GHMA 3I4IA 1GZ9A 5FLIA 4C8DA 1HRV3 4CU7A 1VIWB 5HCBA 5A6QA 5EJZB 1H8TA 5I0TA 5C5TA 4NHKA 1SFYA 3J7LA 1WLCA 2KA3A 2YXSA 4EWEA 4Q26A 2ZMNA 1YHFA 4AL9A 4BMBA 2GZWA 5L9VA 4QXKA 3VHRA 1K5MC 4WVMA 5EIYB 1PM4A 5CIRA 4QKBA 3AP4A 3IM0A 4UF0A 3LFMA 3U14A 4EN6B 2YBPA 1CZTA 1O8PA 4W50A 5HBAA 4GALA 5H9PA 2DCJA 2B42B 4CEWC 4I0WB 3E5XA 3KCXA 4JX0A 1EV13 1SLTA 4LIVA 1QJX2 3U11A 4JGYA 5FP3A 2WO7A 3MLJA 4P9YA 5FZKA 2EA7A 1BZWA 1Q8OA 2DTYA 2JDNA 2XKOA 2PHXA 1BJQA 3HR9A 3UL2A 4AG4A 5JIAA 3Q8EA 3WNLA 3N9LA 4XXAA 3HD8B 4GQ7A 5C6CA 2WNVC 3KVBA 1TEIA 3A0KA 5IVVA 3UYJA 5J96B 5KXCA 1ASJ2 1FAYA 5IYYA 1RUD3 1S1AA 3K75B 2B39A 2ID4A 2PLV3 4TTGA 1CONA 4IV1C 1UYPA 3ZMNA 1EUTA 2ZEYA 5CKQA 3RPQA 2HYKA 1RITA 2XWJB 3JBG3 2W1QA 1VE0A 4QKFA 5FMCA 1OPOA 2P34A 4FPJA 2Y6HA 2A6YA 4UW6A 2X09A 3ME2A 2JJ6A 3J7HA 2A70A 4OHVA 4RFRB 1UXZA 2V09A 1DGLA 4QPYA 3ZYRA 1NLQA 1QHDA 2W1SA 5C5UA 3N3HA 2CGNA 4HFSA 4KGGA 4ZXKA 5F7UA 4N53B 1G9BA 5F5QA 4A44A 3VBRB 1F9KA 2VECA 1WKYA 5IVEA 1E57A 3PUIA 3D8CA 1QMJA 1QJY2 4CP9B 1RXGA 4AI9A 1COV1 2DCKA 3MIFA 2F4PA 2WO3A 2ZGKA 5B4NA 1A3KA 4E2QA 4EN0A 5IFPA 4QXHA 1V70A 3U1XA 3M3QA 3ASIA 3SH5A 1QJFA 5FXWA 2BGCA 5IHRA 4AVCA 4XETA 1V9U2 5DAPA 2D98A 2GALA 1AYN3 2HBTA 2LW8A 1XQNA 4IW3A 1J3PA 2DBNA 2WS93 3OGJA 1OOPC 5CA6A 1VJ2A 4QU2A 1PGW1 1RMU1 4WZCA 5JR7B 4EN7B 4JHTA 3N7KA 1AYM3 3J26N 5CAZA 4IE5A 1LRHA 2P2KA 3WDUA 1US2A 2YU2A 1RUI1 3IWZA 2ARAA 3VDCA 3KVAA 1CGPA 1CAXA 4P9IA 1OBNA 3O0VA 3WY6A 4XABA 4BK5A 3I8TA 5GLUA 3B3QE 2VMGA 1X33A 1LHVA 2GC1A 4BCUA 4AOCA 3T0BA 4R9DA 1IPJA 3SXWA 2CY6A 2EXJA 3J4UH 4E8CA 4OVEA 1VBD3 3ZR5A 1OXCA 2VBDA 4MG2A 5JVVA 4NHLA 1QH7A 3BIWE 4LEJA 4RL7A 4UXAA 4KG8A 2VOTA 2WZR2 1AR83 4LE4A 3OB8A 1CQ9A 1VBB1 2ZHLA 2DUQA 4JKKA 3ZXDA 3IMNA 2FDIA 2QZ3A 2W87A 5BNNC 1W90A 5C7GA 2PELA 3NW4A 3I7DA 1PVC3 2Y0OA 2YB7A 1VRH2 2Y6JA 3RSJA 4FTSA 4NO4A 5FYYA 3U10A 1F35A 2GC0A 1QIQA 1RGSA 2XOMA 3MPPG 3IKWA 5T52A 3GDBA 4WM8B 2VXRA 3AFGA 2VR4A 1UPSA 4FOVA 1OPMA 2BW8A 2RS52 2A5ZA 1LR5A 1DQ5A 1WW7A 2Y0IA 1POQA 1UY2A 4Y3OA 3N9PA 3SISA 3O0WA 4E9KA 4JCKA 3DGTA 5H9SA 4Q0UA 3GHNA 2FDFA 1K5JA 1UO9A 1KGYA 2FBEA 2CNAA 2WFF1 5A3WA 3T2QA 1RL3A 1AR72 2BBAA 1FPN1 5LA9A 3W58A 1OUSA 1WUVA 4U36A 1O6UA 3N9OA 3IPVA 5J36A 2P3KA 2Z2SB 3AK0A 1N3PA 4NMIA 2JG8C 2B7YA 1O8SA 2WA3A 5EQUA 2OW4A 4KH9A 4Z82A 3ZSMA 2RMU1 1XU1A 4UW3A 2RE9A 3POGA 4UOJA 4FFGA 3TNPB 5A3NA 2ZEWA 2GMPA 3TN91 5CG8A 2YDEA 3GCWA 4DQAA 4E4SA 4PBOA 1NY72 2BRTA 2HWE1 4OZOA 3S57A 1CPMA 3HNYM 5C3RA 3PUAA 4PI2A 2D43A 4Q0PA 1IG3A 2HEWF 5L7OC 2JG9B 4ZS2A 3SCGA 1U5IA 1GLHA 1JYWA 5JXGA 4P5HA 1RYYA 3V0AA 1HB4A 1RINA 3SITA 1BXHA 4Q1RA 1WCDJ 4RHV3 4Q1PA 5JXHA 2D5FA 2QQOA 1PK6C 5GJ6A 3APBA 4ARYA 4YZ2A 3R4UA 1NG0A 1E5IA 3NVCA 1JZ7A 2FCUA 5FY4A 4YZ4A 1FV2A 2XLGA 3LEGA 3LSEA 4FXGB 3E5UA 4QDRA 1OUXA 5ANNA 1MZFA 4S2HA 1F5FA 1FNZA 3K3OA 3KV6A 1JZ8A 2VAUA 5FZ0A 2VTFA 4XUPA 3AJZA 2J1SA 1RUD2 3T2OA 2ET1A 4XF9A 5JPNB 2W91A 3AMNA 2EXHA 1G7YA 3TBDA 3IT8A 4CEYC 1VBE1 2OA2A 2PQSA 4YVSA 1AX2A 1PM7A 1RUG1 4X6RB 2ZCWA 4Y26A 5J98B 2DUPA 5FLJA 4QGLA 3VKNA 1Q5OA 4BB3A 3E6BA 2B8MA 4CUAA 4NAMA 1G8WA 3OGVA 5F1RA 1YIPA 2C5DA 2VQ0A 4Q4Y1 1BEV1 2RR11 4XF0A 2EVXA 1OQEA 3J8F2 4JRLA 1FX5A 4Z2AA 4COYA 2O0OA 4FXKB 5D8AA 3FHAA 3FLRA 3M3CA 2JDKA 1DGRN 4BXFA 3AXDA 3JXSA 3LOBA 4CYDA 4RS5B 2Z5WA 4ZHNA 1QQP3 4QPGA 4GZ9A 3LD8A 5A7PA 1DZRA 4AFMA 3Q8AA 2FDKA 1DQ2A 4C0HA 1HRI1 2DCZA 1BK0A 4WM7A 1XE7A 3ZO0B 1W9FA 2XLFA 1E5RA 2WWJA 3U4SA 4AHYA 5E16A 4LKSA 2HEVF 1T6BX 4UW5A 1OT5A 4H7LA 4AI1A 3O1MA 3PVNA 4A42A 4B1MA 3UKNA 2PAKA 3VBOA 1GOHA 1S2BA 5DZFA 4D69A 2VMCA 4DO0A 2OUJA 1AYM2 5F2WA 5CEHA 2VUDA 2F6BA 2WR9A 1LHUA 1PIV3 1KDMA 2GH8A 3L2YA 5LRRA 4AAPA 2E6VA 5BPXA 5IVCA 2NN8A 3BOWA 4XBNA 5FXVA 3A4UA 2GU9A 3QCWA 1G9CA 2YC0A 5FUIA 4AAXA 4CCOA 2PHLA 5JSRA 4NWVA 3LEIA 2XH6A 4HVRA 5FPVA 1MEC3 2PN5A 3AMQA 4QT6A 1DLCA 4CEWA 1ZA4A 2BTVC 1D2QA 1BKZA 4K40A 2ARCA 2GNBA 1AR82 3RWKX 4BYYA 1LGNA 4B8EA 2I2SA 2ZGTA 3AYCA 4IEVA 3I2FA 1PVC2 2WA4A 3I2IA 5GLVA 1RUOA 3KF3A 2BWAA 3A7QA 1OVPA 3M3EA 4K8FA 1WCSA 5FFOC 1MQTB 3T1LA 3RYPA 1ZBE2 2WNVA 2RS13 3B00A 4YZ3A 4C0BA 4FPFA 5C8CC 4GB32 4JTOA 1ONAA 4NIIA 1X8MA 5JZGC 3C7HA 4GMP3 4LOSA 1V6OA 3P3NA 4YWAA 1W6MB 2RV9A 1DQ4A 4MO3M 5I91A 4HETA 3OG2A 4IV1A 4XUTA 4AI3A 2IVJA 2FQPA 5FZBA 5BNQA 3USUB 5FZ8A 1IOAA 1UZZA 3PHMA 4ASLA 1A78A 2VVFA 1YO8A 4P9GA 2EIBA 5EJ3A 3FFZA 4A3ZA 4AHXA 3WT3A 2YU1A 3WHUA 4Y4YA 1W39A 2VU9A 4RYDA 3ALQA 1CJDA 1YJLA 1SCSA 2OZJA 1QJU1 5GKAC 3HNBM 4QGMA 3M8LA 5CFCC 4P5YA 4RQPC 2VOWA 3HT2A 3TEWA 2VL4A 3M3OA 3D0JA 4MGZE 1VB4A 1PO13 2R30A 2WABA 3EQEA 4JHZA 1H9WA 5GLWA 4AEDC 1J3QA 3GXUA 1J58A 5EYYA 1VBA3 1NXMA 1XYNA 4MADA 5SV5A 4ISRA 2UY9A 1H4GA 5AC91 2R073 2WQ8A 1F5JA 3WP3A 1LOFC 1NCQB 1VMHA 2OXBA 4MGSA 4XHBA 3ZIXA 1GSLA 1QU0A 4XC9A 5LZ6A 1L3JA 3L2HA 1OOPA 5A7QA 3OD4A 4BQ2A 1FOD1 1WD4A 3PVOA 1HKDA 4XDPA 1AL21 3N9QA 3BYWA 2XXZA 3NNMA 4JGZB 5F2SA 2HWC1 4D94A 1POV0 1KXGA 5FYUA 1W6OB 3DYMA 4AVTA 3RZKA 4FFFA 1SHWB 2XG3A 4KWJA 1PNFA 1PGL2 4PQQA 5GZEA 2FD8A 2CV6A 1RUE1 2FDHA 2NMNA 5DAXA 2EALA 4PF5A 4RD7A 4XIKA 5DPNA 1IKPA 3LIHA 1E5SA 3ZN5A 3VZJA 1V0AA 5LBEA 3UKTA 5LRSA 3B02A 2GAUA 1REDA 1KITA 3URFA 5LB6A 3ZKYA 2ZZQA 1RHI3 4C1XA 5HXMA 1JZ6A 5FXXA 2XONA 2FHRA 3NQHA 5FZ1A 1UXXX 3VKLA 4AXOA 4AFCA 2XB6C 5BY5A 3ON7A 5FZEA 1CX1A 2K46A 5EJ1B 5FY9A 1W03A 1CR7A 4QHZA 5FOBB 2XJRA 3WG2A 3MIGA 3BOPA 4KWLA 5BNNA 3FBYA 4NHMA 3VBFC 3VDAA 1A8DA 5H9RA 2LALA 3QH7A 2JB8A 2W68A 3OPTA 3VV1A 3AP5A 4LO6B 1HLCA 1RUJ1 4GH4B 2UU8A 2OPKA 1K42A 3WD5A 1A6CA 1Y9QA 5IAVA 1L7RA 4FT8A 3VL8A 4YGCA 1W8OA 3B9CA 4AGVA 3KHCA 4Q4W2 1UZWA 1NQDA 1JYXA 5K4LA 3SHRA 2QZ2A 3MIDA 5CNAA 4Q8LA 1SQ4A 2ZEZA 5C9AC 1O5LA 4YW7A 1HV1A 4BQ1A 1HX6A 3UV9A 5A33A 4RR3C 1OA2A 5A3OA 5LBBA 1HXS3 3NV4A 1R1A1 1SMVA 5FYZA 1QKQA 1COV3 4FOQA 1XRUA 3ZFFC 2VMHA 3K77A 5G05L 2GNTA 1SBEA 3RZGA 3N7JA 3ITQA 4YNIA 4Q4V3 2YY1A 4RGKA 1LEDA 5T55A 2JG8A 1OLQA 1LOCA 2CL2A 2IXIA 3AXEA 3CL1A 4CU6A 1W2UA 3NNJA 4YVWC 1WD3A 3GCXA 2XMLA 1IPKA 2A3XA 4CDXC 3POWA 4UBHA 3BUCA 2YC4A 2D3PA 4BIFA 4DNYA 3POEA 4NRQA 2IXJA 1V6JA 1D4VB 1DQ0A 2VE1A 1JXNA 3ORJA 2P5BA 4P02B 3VBHC 1JYIA 2D6LX 4FP3A 1RUI3 3THPA 5FPZA 4G4FA 4YGDA 3OGSA 1GFF2 5A7OA 4LBQD 1ZVFA 4IXLA 4ORFA 5DDJ1 3U37A 4RGAA 3WW2A 4A6OA 1NE6A 2IFWA 5L7OA 3JB8A 1RJ8A 1K12A 3KV4A 2E7QA 2YHJA 2DCTA 5CFDC 2A73B 5T5PA 1ND3C 1WLDA 1LGBA 2QCSB 4NUBA 1RUC2 2I74A 3WNKA 4A41A 3I59B 1NA1B 2AR6A 3C7GA 4N90A 1RVF1 1PK6A 1KQRA 2CU5A 3MW4A 1OA3A 1QJX3 2GC3A 4O7XA 4D0QA 3RZJA 2VZUA 4GAZA 4QU1A 4EV0A 5IK8A 2EIDA 3ZDSA 3VD9A 2XHKA 4LLOA 5HXVA 5FZ7A 4AI8A 4YFWA 4FSJA 2WBKA 3BALA 1WMEA 4GD4A 4Y1ZA 4OUMA 5FZAA 1MVEA 4UFKA 5FKCA 4BQ3A 2CYFA 2X5IB 1I3HA 3R0RA 4XILA 5C4WB 1W04A 2QQKA 4LMFA 2DURA 3FHQA 2A6WA 4BM8A 4IERA 2ZGMA 3ILFA 1RUNA 3FN9A 1D4M2 2XBO2 2BGOA 2KXLA 1FT9A 3NJXA 4YYOA 1W2TA 3WNXA 5JLVA 4FPGA 4QHBA 4NPRA 4URTA 4XBLA 1IKQA 4CEYA 4B7EA 1D7PM 3AZZA 1QWRA 3OY8A 1QDCA 3EHKA 3ZYPA 5FAXA 4ATFA 4GKYA 1W3VA 4PCRA 2NMOA 1ZYBA 3D5OA 2W9XA 4IV3B 3MV11 2JIGA 3WNMA 2QTWB 5CYYA 5ACA1 3AFKA 1Q3EA 3BKZA 1JW6A 3ES1A 3IAPA 4HPKA 3RGBA 4TLGA 5DZEA 3VBSB 3VD5A 4EZHA 1FPN3 2BGPA 2E7TA 2VM9A 2WWUA 3H42B 1FMD3 3KV5A 5D21A 4LO8A 4DZGA 2BZDA 4DUWA 1L7QA 1FV3A 4A2UA 1IQDC 2KD7A 4TZDA 3OEAA 3H50A 2IZWA 5I0UA 2LRPA 1W9TA 4CDWC 3SH4A 4GIQA 3MO4A 3CF6E 2W94A 4C90A 2WAAA 1V6MA 4ZZ5A 4CCMA 5A32A 1V9U3 5M0TA 4ZU4A 3FLTA 3HNMA 1JOBA 1TMF3 1ODNA 1OKOA 3M4FA 1YC61 4K1YA 4M4RA 5FP9A 1RC6A 4GWNA 4SBVA 4MUVA 4LNVA 2H6CA 3ZLIA 3O1OA 5IAXA 1OMIA 3QLQA 4LK7A 2WT0A 4PQ9A 3BTAA 2OPWA 2DVDA 4BISA 2SLIA 1IS5A 1C5HA 4RGGA 1C28A 4YW1A 2GNDA 4XHXA 4TSVA 1O3TA 5G04L 3ZYHA 2HWB1 2PAMA 2Z69A 2C9AA 3ZFGB 5AVAA 2E33A 3VBUB 3PIJA 4EQVA 2E63A 4FPOB 2WLQA 3WP5A 5JI9A 1LECA 1UAIA 4R9BA 1UPIA 1UWWA 3I3BA 2Q8OA 4FTBA 1H1AA 2WUHA 5FPLA 4XBQA 1OURA 1UIJA 4M3CF 5FMDA 4BIOA 5JPMB 4IUGA 4OMDA 4BOWA 1EY2A 3NV1A 3OYWA 1PHMA 1OLRA 3MV01 4GWIA 3ZKUA 1DF0A 2ATFA 2LTNA 2XR4A 2CGOA 4AQTA 1QJEA 3HWJA 1SPPA 1JYVA 1VRH3 4QDQA 1LHWA 4B4PA 5K7PA 4HT1T 1VBE3 2ZAHA 2P37A 4FBFA 5C8CA 2XVKA 1W6NA 4MGQA 4LLFA 5FV3A 1Z7S1 5JZGA 5DQ0A 3ZSJA 4A3XA 1CD3G 1ENRA 1WCQA 2DDUA 3PIGA 4HKWA 4XFFA 2A71A 1Q43A 2BUKA 2XVLA 4R4ZA 2RS53 5IWFA 4PLNA 4IEUA 4LO7A 3VLBB 4M3CA 3ZYFA 4ZU5A 4IEOA 4KBZA 4QQLA 4FTEA 4OZXA 2X53S 1BEV3 1JH5A 1W6PA 3WG4A 1G9FA 3MFAA 1T2XA 1SG3A 1CIWA 5F39A 5F3GA 4DY3A 1COV2 5EXOA 3ZSLA 4QDSA 2P3IA 2Y33A 3HQXA 5CFCA 4RQPA 4WV8A 2GN7A 3KM5A 2XL7A 5C3SA 3RNSA 5KXBA 2Q5TA 4AEDA 2LROA 1DZQA 3RJ2X 1EPZA 4L8QA 1ZBA1 4MXWB 4N53C 3VDDB 3W59A 1QOTA 1PGW2 1RMU2 2VNGA 2NM1A 3VBRC 4QHOA 4MHUA 2RDSA 2HYXA 2VBPA 3ZM8A 2AGSA 1GP5A 1KS4A 1LOFA 2R49A 2SBAA 2W3JA 3AZVA 3BB6A 4PJYA 3I2GA 4KNCA 4XFAA 3ZN4A 5JMOA 1RUI2 5F37A 4H2AA 1LULA 3WDWA 2CGPA 2ZS6B 1W6QB 5FZ4A 1IQAA 2O14A 2G9FA 2QQNA 1W28A 1YQ6A 3R4SA 5HCFA 3FHIB 2A75A 4UBGA 1KFUL 4LBOA 5HV0A 4IE6A 1WGPA 2Y38A 4KI5M 4QMAA 1G86A 3OPZA 4HSLA 2GP5A 2YGMA 4HVQA 5DAVA 1UMIA 2Y26A 1JOPA 4FPEA 1BVVA 1UCXA 3G7DA 3DCQA 2H0VA 4XFBA 1QXRA 4HN1A 4W65A 5A7SA 4A7YA 1GBGA 1VBB2 1KD7A 1WWYA 2J1EA 3NRUA 3O1SA 3KCYA 1ODMA 3PUHA 3AC0A 3NV3A 1RJ7A 3E1F1 5F6KA 5T5LA 5FZOA 5LY1A 1N1VA 3OD0A 3SMHA 1HIXA 1IPSA 4FPYA 5LWBA 3Q8CA 1Y9GA 2YBKA 2ORXA 4OI4A 4QX5A 2YFUA 4NWWA 3JD71 4QM9A 3FX3A 1B35B 3VBFA 5HCHA 3LPFA 1GNZA 4QWNA 1S55A 2DFBA 3IAQA 3POYA 5BXXA 5I8TA 5IVBA 4XDQA 2YFZA 5FYSA 5LA2A 1SFNA 4CCLA 3V0BA 3T2PA 1UY0A 4ET7A 4UT5A 2WL1A 2BERA 3M3IA 2XDVA 4L99A 1NQJA 2WFF2 2YMZA 3DN7A 2FCTA 2JD4A 1QXPA 1FPN2 2JDZA 4Q4X1 5JDBA 4PIXA 1FMD2 2RDNA 3J8F3 3R05A 1W0OA 4YW2A 1XYPA 2QE3A 2ZXQA 4WM8C 4ITCA 5C9AA 1ZRIA 2CDOA 3LFIA 3LAGA 4NN0A 1BBT1 1I5ZA 3DPRB 4JKMA 4LBLA 5L73A 1AR91 4RR3A 3KGLA 1MS0A 5BNPB 5E8AA 4CDUB 5CG9A 2VQTA 4XAAA 2OS2A 1YJKA 2OQ7A 2RMU2 3AP9A 1VMFA 3ZFFA 1W8TA 2R6QA 3TN92 2VJXA 3AL6A 1TMF2 3C2UA 1JU4A 3MICA 3KLSA 3LDKA 5LEJA 3NO8A 4D7SA 4ASMB 5K0UC 1JS9A 2HWD1 2D3SA 1FATA 1YQCA 1XNDA 1C1FA 2ZGOA 4JTNA 5DG2A 4YVWA 1R091 3NAPB 5JAXA 4N43B 4CE8A 3H8OA 1HJFA 4QB6A 2DBIA 4E4ZA 4YM0A 4CDXA 3HAGA 2XPJA 3PJQA 3WG3A 2EIEA 4LBQA 1CZSA 4XUNA 1XNBA 4I2OA 2I45A 1GOFA 3KGZA 1PO21 1V00A 4HONA 3KHBA 3VBHA 3UGGA 5B2GB 5IVJA 4NE9A 4JZRA 4CCEA 1RUH1 1X7NA 4CUGA 1AL0G 3ACHA 3WW3A 5LK7B 3CZJA 2OQ6A 1DGWA 3WOGA 4IDZA 3MFCA 3OF1A 1WCUA 2D3RA 5CFDA 3W21A 1ND3A 2VPVA 3S0MA 3ACFA 3HMYA 3T3YA 3AB0A 2FDGA 1US3A 4KBBA 2JDHA 3KD4A 4UFIA 1VMJA 4GMP0 4EYUA 1GYKA 2JG9C 5FXZA 1PGSA 2EAAA 2R32A 4QB1A 4QAWA 2J1UA 3WP4A 2RDQA 1UY4A 2UYBA 3KB5A 1YWKA 5FCCA 3BCWA 2V5YA 2J1VA 2VO5A 3BU0A 4OQ9A 3Q9OA 3WQ7A 1S0DA 1VBE2 2B4KA 3PDQA 3T30A 1JODA 4FI9A 1ZBE3 2FZ1A 4HANA 4YG0A 3V64A 1S0FA 4LTAA 4LT5A 4Z07A 4GB33 4JV4A 2ARBA 5FO8B 1RUG2 2RM21 3H8XA 3BTXA 2D6OX 4QQHA 3POBA 4OHZA 1WW6A 2XQXA 3ZN6A 2C0ZA 1UX6A 3UJQA 1JZ4A 1RUJ3 2QQMA 2Z42A 3O12A 1JZ5A 1AX1A 2G9ZA 4OI2A 5FR3A 3ZIWA 1U5YA 2A1XA 1H30A 4Q4Y2 5A70A 2R063 1BEV2 2WWSA 3FC0A 3H7JA 1TNRA 2RR12 2ZGRA 3PL0A 4JDMA 3O14A 1ZA7A 4PIYA 4BLJA 1O7FA 2Y34A 1Q8PA 4S2DA 1ASJ1 3Q8FA 2WZEA 2WZPP 5DG1A 4EN8B 2WN2A 3AP6A 2AENA 1UNBA 3O1PA 2VY0A 3E5QA 2WFPA 4XTMA 1W06A 1HRI2 1UU4A 2W08A 4NAOA 2JIJA 1GMMA 4OFGA 4SLIA 5KXEA 1X9PA 3AKTA 4M0HA 1HW5A 4XAEA 2EF6A 1H6XA 3LB9A 4Y33A 3ZFEB 3ZVXA 2VNVA 5JOXA 2ZKLA 2HEYF 5LK5A 3CKHA 1CPNA 4CDWA 1WCKA 3AM2A 4X6QB 3T09A 2WNUB 4Y20B 1OFSA 3KT1A 3ETPA 3GBWA 1QOOA 3CJIB 1AXKA 4DS0A 4AEJA 4RS5C 5ABJA 2A7AA 1XJAA 4HOOA 4NHYA 2ZX4A 5IJRA 2V73A 3QH6A 3SC7X 4HZFA 4LORA 4JVAA 2PMWB 2V4AA 2VQAA 4OYUA 5DDJ3 1SDDB 4XF4A 5FBZA 2ZMLA 2AH2A 3EBRA 4DINB 3QACA 3CQOA 4CUCA 3KMHA 1WW4A 2XJPA 3K4DA 4QKDA 1GQGA 1QEXA 2RJLA 2VMIA 1SCRA 1GANA 2RS31 3VKOA 3GBGA 5F3CA 3WINE 4JQTA 3WDXA 2WQ4A 1GZTA 3PTYA 4HK8A 3VD4A 4N7UA 3ZXLA 4IEYA 2CWMA 1GU3A 1NXD1 1UIKA 5FMOL 5KR7A 4IE4A 3MW2A 5I0DA 1W9YA 1JYCA 5LCWL 2GNMA 4K7JA 4UFJA 3LQCA 5FLHA 2HWF1 3FUOA 1ZRCA 4YZ1A 1POV1 1Q56A 4AHWA 1F2NA 3T4HB 4CSWA 1IGOA 4AGGA 4Y24A 4FCAA 5EYXA 5C3QA 2ZACA 1H4HA 5FK7A 3VL9A 2XLAA 1IG0A 2QUOA 4AR2A 3O5SA 4OI0A 1MQTC 3OEBA 4Q4W3 2D40A 1EAH1 1GKBA 3JZVA 3IDAA 4Q8KA 1I6XA 3A22A 1QDOA 1LKNA 1QJU2 4XQDA 2JWPA 4LULA 1XC6A 3I3QA 4M3CE 4V2VA 4MVTA 3DF0A 2PTMA 1TME1 3MEPA 1GP4A 3FLPA 5KWRA 1CWPA 1LENA 1W9SA 2XVGA 4QPIB 3TEXA 2ZMKA 4E8DA 5AC92 4DFSA 4PT6A 2OZ6A 4CU8A 3RWNA 4O61A 4MLOA 3CU7A 1Z0HA 2JDYA 2O1QA 2ZJCA 3S5AA 4JC1A 2XKPA 3T08A 3SEEA 4N53A 4FPCA 1FOD2 3VBRA 1ZNPA 2R041 2ERFA 4WVVA 4DRRA 4XZUG 5FY5A 3WNPA 5CU1A 3P5BA 4CP9A 3GM8A 1B09A 1TZOA 4H55A 4OUSA 1GUIA 3WP6A 2BPA2 1X36A 1ND2B 1REFA 3WDTA 1JUIA 2BVBA 1U5XA 1K5MA 1RUE2 3AMHA 4HLTA 5CZKA 4DUXA 3WCSA 3POFA 4PDWB 2HWB3 1HRV1 1NCQC 4Z92B 1TE1B 2OUHA 3KQ4B 1HDKA 2Q8DA 1CVNA 3J7MA 1RUC3 4WVWA 4WVZA 2FMYA 2PHRA 4Q2FA 4CZSA 4JGZC 5KHJA 1YNAA 4COWA 3WNOA 2NYYA 3IDCB 4UI9L 2Q1FA 4MGTA 2V4VA 2CAVA 2R0HA 1AXZA 2LUWA 2RVAA 1MVQA 5A3PA 2RHPA 2Y6GA 3SNMA 1V6LA 1ZZ6A 3LWCA 3FWEA 4IEZA 4Y5SA 5FYTA 1OI6A 1TVGA 4J1XA 2P6HA 2ZPXA 4AFBA 4LK6A 3C3VA 4H7MA 3HBZA 4B29A 1EV11 2D6NA 3ZSEA 2GDFA 3N7LA 1D4M3 1VPHA 1DGWX 2XBO3 2VW2A 4EWDA 1RUJ2 4R8HA 1UZYA 3VKFC 3OY8B 3LDBA 3T1MA 5FP8A 5IW0A 1J1LA 1Z7S3 3VZLA 3FMGA 5L19A 1MS4A 1CAUB 1UU6A 2R062 4JAAA 2BFUL 4MYEA 3V56A 5EPAA 1NCRB 3V65A 2VZ3A 3HT1A 3BVCA 4INDA 2QKDA 3JUUA 2F4LA 1RUD1 5FWJA 3CJXA 4EN9B 2PLV1 4KL1A 1AVBA 2ZABA 1WA6X 3CZUA 3MI8A 5LY2A 2A3WA 1R1A2 1XNAA 4IEWA 4AI0A 2B46X 4MGYE 4BQWA 3ZYJB 2UURA 2RJ2A 3JBG1 4GH4C 5IUQA 1F4HA 3I54A 2CDPA 3H1MA 3MF6A 4WM8A 2DYCA 5JOYA 1JN2P 4AVAA 5C3OA 2J1TA 1IS4A 2W1UA 1HQNA 2UWBA 1GV9A 2QQUA 2MEV3 2ZX3A 3T2TA 3LOIA 1W8HA 4LKDA 1GWKA 2CWSA 3NKTA 1UYXA 3WDVA 1A8MA 1ZBA3 5FMBA 1V6NA 1BK1A 1ZM1A 4L9BA 5IFTA 1MACA 5FP7A 3ZOIA 1BYHA 2Q4SA 5K0UA 4QX2A 2VVDA 2C24A 5DABA 1DGRA 4TYSA 4P9WA 5E89A 5FZMA 4YPJA 4L92A 4D7TA 3RZHA 4ZPIA 1SEFA 2VVEA 3WG1A 4CVUA 5DDJ2 3BN6A 1N1YA 5JI7A 1CAWB 4AVBA 3HN3A 1YQ2A 1DIWA 2I07B 2D93A 4YM1A 1FXZA 4Y22A 1AYN1 3GGLA 3I2KA 4DEVA 2WS91 1ST8A 1RVF2 2VZOA 1BQPA 1OHFA 1L7LA 1DZTA 3JCIA 1CAVB 4BA6A 5C70A 4LQRA 1QF3A 1R64A 3M2MA 4F3JA 4BQ4A 2W39A 3K3NA 4NIHA 5FZGA 1UW8A 1C8M1 1DFQA 3AYAA 2AACA 1CZVA 1K45A 3N35A 3ETQA 5DAWA 3AVRA 2JG9A 4Q27A 4AI2A 2YBSA 1PZ9A 5BNOB 5EV7A 5K9YA 2VZTA 1QJZA 1GOGA 4BXSV 3DXTA 1GZWB 1NA1C 2D5HA 4ONUA 4NPLA 1VBD1 1DHKB 2WYSA 2ET7A 4OQ8A 3WNNA 1N1SA 4YW4A 4CDQB 3UNPA 4XJ8A 3OGGA 1UKGA 3BI3A 3O7OA 1EYBA 4P9JA 1Z78A 1AR81 1ULFA 1UMZA 3GALA 1DG6A 2TBVA 5ACA2 3WVJA 5C4WC 2J7MA 2X5IC 5JCTA 1EP0A 3B01A 1DQ6A 5FTTC 4ZXEA 4MX3A 5EFUA 4DOUA 3OBRA 4XJ9A 2OYZA 2EIGA 1D2SA 2J1RA 1LHNA 2E53A 5APAA 4FQ4A 5LBCA 5A3UA 2JD9A 2Q8CA 2BP6A 3U0ZA 5JSOA 1PVXA 1ZRRA 2KR2A 3THCA 3QBQA 4DXZA 2XUEA 4LITA 3PJYA 2WZ8A 4DXSA 5FDBA 4IV3C 2J42A 1H8TB 2IC1A 1ZRDA 3OTFA 5JWPA 1YI7A 2HWD3 3VBSC 2E51A 1RMU3 4H3WA 4NPMA 4ZY9A 1R093 2Y6FA 3IMMA 2XL9A 1DYPA 3WQBA 5F6LB 4QX0A 5DUVA 4G9SB 4WVMB 3KF5A 3HIFA 2DVGA 1YRZA 1OH3A 2DWRA 4IEPA 1LJ7A 3T0AA 3H8RA 5H9QA 2DUOA 3G6JB 4UF0B 2HWB2 1BMV2 2RG4A 3ECQA 4YW3A 3OSDA 3ACLA 3RMYA 3CBNA 4PIZA 1JOJA 1OQ1A 5DUXA 2B5HA 5FYHA 5FY0A 4JGYB 4XYXA 4CRQA 3EB7A 3J9SA 2WC2A 4XF1A 5DN2A 3HVDA 5F8PA 3ZYBA 2NPIA 2VOKA 1UD1A 3P3PA 4D3WA 2VW1A 2R7EB 1LTEA 1ZZBA 3AMPA 1F15A 1VBB3 2D6MA 4HVOA 3GZUC 3OUHA 2IXHA 4XZPA 1XYOA 4OMCA 4IGQA 1O3SA 3LSDA 3ZFGC 2AYHA 3VBUC 4RHV1 1C5IA 3NL1A 4XE9A 1GR3A 2DVFA 5I0RA 4XEZA 2BU9A 3NSTA 1PNGA 1Z7S2 2ZBJA 1XSQA 5J7MA 1XB9A 1LOGA 4NOTA 4BJ0A 4YM3A 1NX9A 2WNOA 2YPDA 3POIA 5CADA 2BQPA 4OUEA 4YRDA 1STMA 2W47A 3ZPOA 4UAPA 1H8VA 1UMHA 2W0XA 5AFEA 2V5DA 2BOIA 4Z1VA 4YARA 4K9SA 5FJKA 4ASKA 3DECA 1PX4A 3H9AA 4NROA 5HPOA 1X50A 4K21A 4P08A 3RMXA 4UYBA 4XFHA 1MQTA 2WFF3 3D3AA 3RYRA 3JQXA 2CTVA 4Q0QA 4S2GA 4QXBA 1LHOA 4CPBD 2PHDA 1W6MA 2QJVA 4D7YA 3T4VA 1GNHA 4K6BA 4ZONA 2MEV2 4JKLA 5I8YA 3WR0A 4BQXA 1LU2A 1K3IA 1E5HA
chains in the Genus database with same CATH topology
5C71A 2QQLA 3LEGA 3IAQA 3WF2A 4QDRA 2YFZA 4DXRA 5LA2A 4XVHA 3T2PA 1UY0A 4ET7A 1JZ8A 1I5PA 2BERA 3VDBA 2VTFA 4XUPA 2J1SA 5A1AA 4LHSA 3T2OA 3HOBA 2VC9A 2ZXQA 2W91A 4P00B 2CDOA 2E31A 2PQSA 4JKMA 2VCAA 3DYPA 3THDA 2VQTA 3MBWA 2VJXA 3CDZB 1JU4A 3IB3A 4CUAA 3OGVA 3WF3A 1UYZA 2VMFA 4M4PA 4QB6A 4Z2AA 2EIEA 4A4AA 1CZSA 4XUNA 3FHAA 1GOFA 3JXSA 2WO2A 4GZ9A 3VD7A 2Y6LA 3WEZA 3SKJE 1UYYA 2JE8A 3ACHA 3CZJA 2C9KA 3WF4A 4LKSA 1NUKA 1OT5A 4A42A 1PMJX 3I2HA 3C7EA 2VZSA 1GOHA 1UX7A 3ACFA 3IIIA 2VMCA 2C4XA 1US3A 2OKXA 4GWJA 4QB1A 4QAWA 2J1UA 2ZEXA 1UY4A 1PMHX 4PF1A 3ACIA 2VO5A 2J1VA 4XURA 2B4KA 2VZPA 4FI9A 5FUIA 4AAXA 3LEIA 2XQXA 1PX3A 1JZ4A 3HPNA 3W5NA 2QQMA 1DLCA 3T0DA 1JZ5A 2L9LA 2Y8KA 4D8MA 3LEKA 1XNTA 3I2FA 3I2IA 4BDVB 2WZEA 3A7QA 4DEQA 2WN2A 3VD3A 4CU9A 2ORZA 2WN3A 3C7HA 1GMMA 4TXWA 2RV9A 2VMDA 4MO3M 3OG2A 4XUTA 3WF1A 1H6XA 1HN1A 4QX3A 1OD3A 3CKHA 1BHGA 5DMYA 3C7OA 3T09A 2V72A 2EIBA 4A3ZA 3ETPA 4DUVA 3MUY1 4RYDA 1OF3A 1NKGA 4QB2A 1O59A 5IJRA 3HNBM 4P5YA 2VL4A 4OYUA 4JHZA 2WABA 3MUZ1 1SDDB 4ZZ8A 2QQIA 3DYOA 4CUBA 3GXUA 3A23A 4CUCA 4MADA 3CQOA 1GNYA 1JZ2A 4QX1A 2WQ8A 3K4DA 2XHNA 4MGSA 2YC2A 3C7FA 2QQJA 4BK4A 4XUQA 2VCCA 3VD4A 1DP0A 3NNGA 4ARXA 1GU3A 3DYMA 1GQPA 1SHWB 2E32A 2JDAA 5I0DA 5JUVA 4PQQA 5LCWL 2VZQA 3LQCA 2W46A 1CIYA 5DPNA 4W8JA 3BGAA 1W99A 5HXMA 5LA0A 1JZ6A 2XONA 1OH4A 3NQHA 3OEBA 1UXXX 5J1XA 3IDAA 1JYNA 3A22A 1MPXA 3LPGA 3P1IA 1CX1A 5EJ1B 1XC6A 3VDAA 2Y64A 3CMGA 1P8JA 2WAOA 1W9SA 4KWUA 2VZ1A 4E8DA 1K42A 4PT6A 4CU8A 1L7RA 1W8OA 3HJRA 3SKVA 2B9VA 1JYXA 1OF4A 3T08A 3SEEA 1W0NA 2ZEZA 4XZUG 4KMQA 3WNPA 3FL7A 1JU3A 3GM8A 3K4AA 2Z4FA 1GUIA 2J22A 2VCBA 3K77A 5G05L 4DUXA 5CZKA 3LE0A 2Y6KA 2YG0A 1JI6A 3K46A 3ABZA 4DXTA 2J1AA 1NAEA 4CU6A 3K4ZA 1W9WA 3NJVA 1ULOA 2VZVA 2YC4A 3WNOA 4UI9L 2V4VA 4LPLA 4P02B 2RVAA 3SEPA 2Y6GA 3OGSA 1J84A 3U37A 4A6OA 2X10A 1TVGA 1K12A 3A21A 4QPWA 3WNKA 4A41A 3C7GA 4CU7A 2HLEA 4D0QA 5EJZB 1UY1A 2VZUA 2W1WA 2EIDA 3VD9A 2VZ3A 1XPWA 5LA1A 2WDBA 2WBKA 4XUOA 5EIYB 3CZUA 3ACGA 2QQKA 2JKXA 3FHQA 1XNAA 3FN9A 2C26A 2BGOA 2RJ2A 1CZTA 1O8PA 1DYOA 1UZ0A 1F4HA 3NJXA 2CDPA 4W50A 2DCJA 4JX0A 2J1TA 1D7PM 2W1UA 1UYXA 3C8XA 4A45A 5IFTA 2W9XA 4AG4A 3MV11 3WNMA 5JXJA 5CYYA 3WNLA 4QX2A 4YPJA 3IAPA 3VD5A 2WO1A 5IYYA 2BGPA 2VM9A 3K75B 4CVUA 3BN6A 2ID4A 2BZDA 3HN3A 4DUWA 1YQ2A 1L7QA 4TTGA 1EUTA 1IQDC 2ZEYA 2KD7A 3P6BA 2W95A 3OEAA 2W1QA 3GGLA 1W9TA 3I2KA 4HG6B 4DEVA 2EICA 3MO4A 2W94A 2VZOA 2Y6HA 2WAAA 4ZZ5A 2X09A 3J7HA 1UXZA 3HNMA 4M4RA 5C70A 4LQRA 1R64A 2W1SA 5F7UA 4A44A 3WF0A 2VMEA 1WKYA 3PUIA 1CZVA 1K45A 3UETA 1EUUA 2DCKA 2VZTA 2WO3A 5B4NA 1GOGA 5IFPA 4BXSV 5G04L 5IHRA 5JXIA 2E33A 2WYSA 3HEIA 3WNNA 2LS6A 3UNPA 2LW8A 1UWWA 3I3BA 2WUHA 4MOAA 2J7MA 4IUGA 4OMDA 4ZXEA 1US2A 5JR2A 3VDCA 3MV01 2J1RA 4GWIA 3WSOA 2JD9A 4BK5A 2QBXA 1JYVA 4QDQA 3I2JA 3T0BA 4L0PA 4MGQA 3THCA 4E8CA 5DQ0A 2WZ8A 4DXSA 1WCQA 2DDUA 1TG7A 3CIHA 2VOTA 3OB8A 4ZY9A 4JKKA 2W87A 1T2XA 5C7GA 3WQBA 1SG3A 4QX0A 1F4AA 2YB7A 2Y6JA 4W4ZA 4QDSA 1ULPA 4RN5A 3OGRA 2XOMA 3ECQA 3GDBA 1H6YA 2VR4A 2W92A 3EB7A 1UY2A 1W8NA 3ZM8A 5DN2A 2HYXA 3OBAA 2E26A 2W3JA 3I2GA 5JMOA 2R7EB 1KGYA 3F2ZA 3T2QA 2BBAA 4OMCA 3EYPA 5B4XA 3UESA 2QQNA 3W5MA 1O8SA 1KEXA 4KI5M 2VQUA 4UOJA 4BJ0A 2VZRA 2W5FA 2ZEWA 1JZ3A 1JHJA 1LNSA 1NX9A 4OUEA 1UMIA 2W47A 2X05A 4UAPA 1UMHA 4OZOA 2V5DA 1J83A 1UY3A 5HPOA 3DECA 1PX4A 2J1EA 3HNYM 3NRUA 3PUHA 3AC0A 4P08A 3E1F1 3D3AA 1JYWA 5JXGA 3I97A 1RYYA 2ORXA 3I3EA 2YFUA 5JXHA 2QQOA 4ARYA 3I3DA 4JKLA 3T0AA 1JZ7A 1K3IA 3LPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C71 A;  2QQL A;  3LEG A;  3IAQ A;  3WF2 A;  4QDR A;  2YFZ A;  4DXR A;  5LA2 A;  4XVH A;  3T2P A;  1UY0 A;  4ET7 A;  1JZ8 A;  1I5P A;  2BER A;  3VDB A;  2VTF A;  4XUP A;  2J1S A;  5A1A A;  4LHS A;  3T2O A;  3HOB A;  2VC9 A;  2ZXQ A;  2W91 A;  4P00 B;  2CDO A;  2E31 A;  2PQS A;  4JKM A;  2VCA A;  3DYP A;  3THD A;  2VQT A;  3MBW A;  2VJX A;  3CDZ B;  1JU4 A;  3IB3 A;  4CUA A;  3OGV A;  3WF3 A;  1UYZ A;  2VMF A;  4M4P A;  4QB6 A;  4Z2A A;  2EIE A;  4A4A A;  1CZS A;  4XUN A;  3FHA A;  1GOF A;  3JXS A;  2WO2 A;  4GZ9 A;  3VD7 A;  2Y6L A;  3WEZ A;  3SKJ E;  1UYY A;  2JE8 A;  3ACH A;  3CZJ A;  2C9K A;  3WF4 A;  4LKS A;  1NUK A;  1OT5 A;  4A42 A;  1PMJ X;  3I2H A;  3C7E A;  2VZS A;  1GOH A;  1UX7 A;  3ACF A;  3III A;  2VMC A;  2C4X A;  1US3 A;  2OKX A;  4GWJ A;  4QB1 A;  4QAW A;  2J1U A;  2ZEX A;  1UY4 A;  1PMH X;  4PF1 A;  3ACI A;  2VO5 A;  2J1V A;  4XUR A;  2B4K A;  2VZP A;  4FI9 A;  5FUI A;  4AAX A;  3LEI A;  2XQX A;  1PX3 A;  1JZ4 A;  3HPN A;  3W5N A;  2QQM A;  1DLC A;  3T0D A;  1JZ5 A;  2L9L A;  2Y8K A;  4D8M A;  3LEK A;  1XNT A;  3I2F A;  3I2I A;  4BDV B;  2WZE A;  3A7Q A;  4DEQ A;  2WN2 A;  3VD3 A;  4CU9 A;  2ORZ A;  2WN3 A;  3C7H A;  1GMM A;  4TXW A;  2RV9 A;  2VMD A;  4MO3 M;  3OG2 A;  4XUT A;  3WF1 A;  1H6X A;  1HN1 A;  4QX3 A;  1OD3 A;  3CKH A;  1BHG A;  5DMY A;  3C7O A;  3T09 A;  2V72 A;  2EIB A;  4A3Z A;  3ETP A;  4DUV A;  3MUY 1;  4RYD A;  1OF3 A;  1NKG A;  4QB2 A;  1O59 A;  5IJR A;  3HNB M;  4P5Y A;  2VL4 A;  4OYU A;  4JHZ A;  2WAB A;  3MUZ 1;  1SDD B;  4ZZ8 A;  2QQI A;  3DYO A;  4CUB A;  3GXU A;  3A23 A;  4CUC A;  4MAD A;  3CQO A;  1GNY A;  1JZ2 A;  4QX1 A;  2WQ8 A;  3K4D A;  2XHN A;  4MGS A;  2YC2 A;  3C7F A;  2QQJ A;  4BK4 A;  4XUQ A;  2VCC A;  3VD4 A;  1DP0 A;  3NNG A;  4ARX A;  1GU3 A;  3DYM A;  1GQP A;  1SHW B;  2E32 A;  2JDA A;  5I0D A;  5JUV A;  4PQQ A;  5LCW L;  2VZQ A;  3LQC A;  2W46 A;  1CIY A;  5DPN A;  4W8J A;  3BGA A;  1W99 A;  5HXM A;  5LA0 A;  1JZ6 A;  2XON A;  1OH4 A;  3NQH A;  3OEB A;  1UXX X;  5J1X A;  3IDA A;  1JYN A;  3A22 A;  1MPX A;  3LPG A;  3P1I A;  1CX1 A;  5EJ1 B;  1XC6 A;  3VDA A;  2Y64 A;  3CMG A;  1P8J A;  2WAO A;  1W9S A;  4KWU A;  2VZ1 A;  4E8D A;  1K42 A;  4PT6 A;  4CU8 A;  1L7R A;  1W8O A;  3HJR A;  3SKV A;  2B9V A;  1JYX A;  1OF4 A;  3T08 A;  3SEE A;  1W0N A;  2ZEZ A;  4XZU G;  4KMQ A;  3WNP A;  3FL7 A;  1JU3 A;  3GM8 A;  3K4A A;  2Z4F A;  1GUI A;  2J22 A;  2VCB A;  3K77 A;  5G05 L;  4DUX A;  5CZK A;  3LE0 A;  2Y6K A;  2YG0 A;  1JI6 A;  3K46 A;  3ABZ A;  4DXT A;  2J1A A;  1NAE A;  4CU6 A;  3K4Z A;  1W9W A;  3NJV A;  1ULO A;  2VZV A;  2YC4 A;  3WNO A;  4UI9 L;  2V4V A;  4LPL A;  4P02 B;  2RVA A;  3SEP A;  2Y6G A;  3OGS A;  1J84 A;  3U37 A;  4A6O A;  2X10 A;  1TVG A;  1K12 A;  3A21 A;  4QPW A;  3WNK A;  4A41 A;  3C7G A;  4CU7 A;  2HLE A;  4D0Q A;  5EJZ B;  1UY1 A;  2VZU A;  2W1W A;  2EID A;  3VD9 A;  2VZ3 A;  1XPW A;  5LA1 A;  2WDB A;  2WBK A;  4XUO A;  5EIY B;  3CZU A;  3ACG A;  2QQK A;  2JKX A;  3FHQ A;  1XNA A;  3FN9 A;  2C26 A;  2BGO A;  2RJ2 A;  1CZT A;  1O8P A;  1DYO A;  1UZ0 A;  1F4H A;  3NJX A;  2CDP A;  4W50 A;  2DCJ A;  4JX0 A;  2J1T A;  1D7P M;  2W1U A;  1UYX A;  3C8X A;  4A45 A;  5IFT A;  2W9X A;  4AG4 A;  3MV1 1;  3WNM A;  5JXJ A;  5CYY A;  3WNL A;  4QX2 A;  4YPJ A;  3IAP A;  3VD5 A;  2WO1 A;  5IYY A;  2BGP A;  2VM9 A;  3K75 B;  4CVU A;  3BN6 A;  2ID4 A;  2BZD A;  3HN3 A;  4DUW A;  1YQ2 A;  1L7Q A;  4TTG A;  1EUT A;  1IQD C;  2ZEY A;  2KD7 A;  3P6B A;  2W95 A;  3OEA A;  2W1Q A;  3GGL A;  1W9T A;  3I2K A;  4HG6 B;  4DEV A;  2EIC A;  3MO4 A;  2W94 A;  2VZO A;  2Y6H A;  2WAA A;  4ZZ5 A;  2X09 A;  3J7H A;  1UXZ A;  3HNM A;  4M4R A;  5C70 A;  4LQR A;  1R64 A;  2W1S A;  5F7U A;  4A44 A;  3WF0 A;  2VME A;  1WKY A;  3PUI A;  1CZV A;  1K45 A;  3UET A;  1EUU A;  2DCK A;  2VZT A;  2WO3 A;  5B4N A;  1GOG A;  5IFP A;  4BXS V;  5G04 L;  5IHR A;  5JXI A;  2E33 A;  2WYS A;  3HEI A;  3WNN A;  2LS6 A;  3UNP A;  2LW8 A;  1UWW A;  3I3B A;  2WUH A;  4MOA A;  2J7M A;  4IUG A;  4OMD A;  4ZXE A;  1US2 A;  5JR2 A;  3VDC A;  3MV0 1;  2J1R A;  4GWI A;  3WSO A;  2JD9 A;  4BK5 A;  2QBX A;  1JYV A;  4QDQ A;  3I2J A;  3T0B A;  4L0P A;  4MGQ A;  3THC A;  4E8C A;  5DQ0 A;  2WZ8 A;  4DXS A;  1WCQ A;  2DDU A;  1TG7 A;  3CIH A;  2VOT A;  3OB8 A;  4ZY9 A;  4JKK A;  2W87 A;  1T2X A;  5C7G A;  3WQB A;  1SG3 A;  4QX0 A;  1F4A A;  2YB7 A;  2Y6J A;  4W4Z A;  4QDS A;  1ULP A;  4RN5 A;  3OGR A;  2XOM A;  3ECQ A;  3GDB A;  1H6Y A;  2VR4 A;  2W92 A;  3EB7 A;  1UY2 A;  1W8N A;  3ZM8 A;  5DN2 A;  2HYX A;  3OBA A;  2E26 A;  2W3J A;  3I2G A;  5JMO A;  2R7E B;  1KGY A;  3F2Z A;  3T2Q A;  2BBA A;  4OMC A;  3EYP A;  5B4X A;  3UES A;  2QQN A;  3W5M A;  1O8S A;  1KEX A;  4KI5 M;  2VQU A;  4UOJ A;  4BJ0 A;  2VZR A;  2W5F A;  2ZEW A;  1JZ3 A;  1JHJ A;  1LNS A;  1NX9 A;  4OUE A;  1UMI A;  2W47 A;  2X05 A;  4UAP A;  1UMH A;  4OZO A;  2V5D A;  1J83 A;  1UY3 A;  5HPO A;  3DEC A;  1PX4 A;  2J1E A;  3HNY M;  3NRU A;  3PUH A;  3AC0 A;  4P08 A;  3E1F 1;  3D3A A;  1JYW A;  5JXG A;  3I97 A;  1RYY A;  2ORX A;  3I3E A;  2YFU A;  5JXH A;  2QQO A;  4ARY A;  3I3D A;  4JKL A;  3T0A A;  1JZ7 A;  1K3I A;  3LPF A; 
#chains in the Genus database with same CATH topology
 3USU A;  5C71 A;  1WMD A;  5FKB A;  1QGL A;  4LIU A;  4ATE A;  2RMU 3;  1MR5 A;  5GZD A;  5BUV A;  1ZBA 2;  5FZL A;  5J3U A;  1Y7B A;  2QDN A;  4BPZ A;  2W52 A;  1ZZ7 A;  5DUU A;  3TN9 3;  5BYN A;  1VB2 A;  4IQP A;  1GZC A;  3PNA A;  4LBJ A;  2HWE 3;  1I1E A;  3WLU A;  1LEM A;  5FYI A;  5A1A A;  3CEW A;  4LHS A;  3HOB A;  3HN1 A;  1QQP 1;  5EZW A;  2JX9 A;  2HJI A;  4P00 B;  1CAX B;  2XGX A;  1C57 A;  2E31 A;  4AEK A;  5I93 A;  1ZX5 A;  3PUS A;  3UJO A;  2VCA A;  3DYP A;  3THD A;  4K3U A;  5FZD A;  5T5O A;  2P3Y A;  5J48 A;  1O3Q A;  1AUY A;  3RI8 A;  3VDD C;  2FZ2 A;  4BQ5 A;  3QOP A;  2PHU A;  3I2O A;  2HBU A;  5FY8 A;  3MBW A;  4MXV A;  3H8U A;  1NCQ A;  1G6N A;  4CP0 A;  1AR6 1;  1RUF 1;  1LOE A;  4XIO A;  4CXX A;  2JKB A;  2RS3 3;  2A6Z A;  2YZ4 A;  3FJS A;  1O4T A;  1PIV 1;  1UZV A;  3KSC A;  2VMF A;  2W2I A;  4M4P A;  5F3E A;  3NKG A;  2BEO A;  4JGZ A;  4XQW A;  5A1L A;  5IK5 A;  1HV0 A;  1W6O A;  2ZGQ A;  5DZG A;  2JE9 A;  1ENX A;  2UWC A;  4L97 A;  5FIX A;  1ALY A;  3CLP A;  3VD7 A;  1UYY A;  3JD7 2;  2JE8 A;  4AWD A;  1MEC 1;  2HWF 3;  3WF4 A;  4W6W A;  1NUK A;  1RUG 3;  3DEM A;  4RSU A;  3F95 A;  1G9A A;  3TEZ A;  3I2H A;  1VLN A;  1H0B A;  3GJB A;  1UX7 A;  2Q1M A;  3LA3 A;  1XXN A;  2C4X A;  4FFH A;  1JBC A;  2FMD A;  2R1D A;  1HB3 A;  5JOZ A;  3OOX A;  4GWJ A;  1ULE A;  4Q4Y 3;  4XTP A;  3W9A A;  1AZD A;  4O65 A;  1VRB A;  3BU7 A;  4Q4X 2;  2RR1 3;  4LUK A;  2RS1 1;  3O1R A;  1PMH X;  3D4K A;  3ACI A;  3LA7 A;  1H2K A;  4GJY A;  2WIN B;  1OSG A;  4GMP 1;  2G9G A;  4PLM A;  3IPV B;  1BBT 2;  4LUM A;  3VHP A;  4XCA A;  1B35 C;  3ZSK A;  1EPW A;  3U07 A;  4AF9 A;  1TME 3;  3BPS A;  4HKO A;  1UOB A;  5KHH A;  3BTY A;  3GNE A;  3ZXE A;  3VKM A;  2FDJ A;  1HRI 3;  3MLK A;  1PX3 A;  4GH4 A;  4QQP A;  4OHW A;  2XJT A;  2VXJ A;  1YYN A;  3NJZ A;  3PUQ A;  4FPH A;  4QGN A;  4QM8 A;  3T0D A;  1SLI A;  2LM3 A;  2Q30 A;  2EAK A;  4IES A;  5A7W A;  3VZO A;  1N47 A;  1H2M A;  2HWD 2;  4KQ7 A;  4R9A A;  2IXC A;  1R09 2;  1S0E A;  1YFY A;  3PUR A;  4D8M A;  3LEK A;  2WLP A;  3UGH A;  4CCD A;  4E2G A;  5EHD A;  4NVP A;  5ABJ B;  1VBC 1;  2EXI A;  1XNT A;  5KHK A;  4XJA A;  3LGR A;  4BDV B;  1SLC A;  1DU3 D;  3DPR C;  1FI2 A;  4JRA A;  4YLZ A;  2GC2 A;  4DEQ A;  4ES9 A;  5BNP C;  1PO2 2;  1PO1 1;  2B45 X;  4CDU C;  4CU9 A;  1AX0 A;  2JDP A;  4Q29 A;  4Q0V A;  2BYV E;  2VW0 A;  4MSV A;  1RUH 2;  4I09 A;  1QH6 A;  3V0A B;  1VBA 1;  2X8K A;  1MS9 A;  1TNF A;  2GH2 A;  2ZA9 A;  3GZA A;  3MGU A;  2R07 1;  4B3N A;  2WSV A;  3N7M A;  4LBK A;  4NIG A;  1QOS A;  1WZX A;  3PME A;  3ZXF A;  3FFQ A;  5KC6 A;  3NAP C;  4N43 C;  4BHP A;  1WLT A;  5DMY A;  4R4X A;  1C1L A;  2V72 A;  4COZ A;  3RVH A;  5ERL A;  1Y43 B;  4AQ6 A;  5A3L A;  4E4H A;  2IUW A;  1NKG A;  1O59 A;  4E4D X;  1GWL A;  1LOB A;  3OUI A;  2IFR A;  3AZY A;  4ZZ8 A;  2CAU A;  1BLZ A;  2ZX0 A;  3DYO A;  4QKN A;  4YVS B;  2RM2 2;  1YLL A;  5GZC A;  1ZRF A;  4Z8B A;  4IGP A;  1U5Z A;  3A23 A;  3JQW A;  4M01 A;  5CKN A;  4C91 A;  3I59 A;  1NA1 A;  4IET A;  1GNY A;  3TNQ A;  4IGO A;  4IE7 A;  2ARE A;  3VUO A;  2XHN A;  1RHI 1;  3GZT B;  3EJK A;  3IDB B;  2VGD A;  2QQJ A;  2QQV A;  1XE0 A;  1YUD A;  4AZZ A;  5J37 A;  2RJK A;  4BK4 A;  4QD2 A;  2VCC A;  2D6P A;  4OCT A;  1Y4W A;  4MET A;  1UOF A;  1YFW A;  2ENR A;  1OA4 A;  3KWV A;  3OCP A;  5F9T A;  5C4W A;  2X5I A;  4F8A A;  5D8A B;  5D1I A;  2D7F A;  1GQP A;  3LF7 A;  4ZS3 A;  1QJU 3;  4AHZ A;  4QPG B;  2ZX2 A;  1WLW A;  5JUV A;  4E27 A;  2VZQ A;  2ZGP A;  1A34 A;  1OFN A;  1UOJ A;  2W46 A;  4WM7 B;  5C8W A;  3VGI A;  5FPU A;  1W3X A;  4XW3 A;  2ZTN A;  4XOG A;  1X82 A;  4HSJ A;  4N7I A;  4FFI A;  5AC9 3;  4X8P A;  1WBF A;  2VUA A;  1S0B A;  3K51 A;  1I9R A;  1W99 A;  3KQR A;  4NR1 A;  3VBO B;  2HWE 2;  3VZM A;  1O5U A;  2PQQ A;  4IV3 A;  2GP3 A;  4KU7 A;  1OH4 A;  1OKQ A;  4BWO A;  3VHN A;  2A6X A;  3KV9 A;  3AKP A;  4CA9 A;  3LPG A;  1MPX A;  4AEM A;  1R08 1;  3HQU A;  3P1I A;  3VBS A;  1HXS 1;  1FOD 3;  2XQR A;  4MHR A;  3A0N A;  1AL2 3;  2VNO A;  3NWK A;  1S0C A;  4K20 A;  2HWC 3;  4XFC A;  5GZG A;  1K5M B;  3MDP A;  4Q4V 1;  3ZFE C;  3CMG A;  5F32 A;  4FO9 A;  5IAT A;  1O91 A;  5J09 A;  4ISQ A;  4N9H A;  5IK7 A;  1RUE 3;  3EMR A;  4CTE A;  2WNU C;  4B4R A;  3LZZ A;  1F8V A;  1O4Z A;  1DBN A;  1S0I A;  1V6K A;  4EZ4 A;  2RS3 2;  4CEW B;  1ACC A;  3CJI C;  3VHO A;  3RS6 A;  1HQW A;  2WKK A;  3SKV A;  3UK9 A;  5C33 A;  1JHN A;  2B9V A;  1OF4 A;  3UT0 A;  4DIQ A;  4FAH A;  1Q8Q A;  4YGB A;  1NLR A;  4XXP A;  1C8M 3;  2JEC A;  1UL9 A;  2K2S A;  5F5A A;  4AQS A;  3D0S A;  2ZKN A;  3FL7 A;  5FYC A;  3SLI A;  2Z4F A;  2AZ5 A;  2WNV B;  1BVP 1;  4LHL A;  1LES A;  1IS3 A;  2IXL A;  2VCB A;  2CHH A;  2A6V A;  4HXC A;  2HWF 2;  2D44 A;  3WQ0 A;  3ZFG A;  3VBU A;  3ILN A;  1JYT A;  3SCH A;  3AYD A;  5FUN A;  2Y6K A;  1JI6 A;  3K46 A;  4IV1 B;  3ABZ A;  1ZZ8 A;  4DXT A;  1QJX 1;  4GA9 A;  2J1A A;  4AVS A;  4XFI A;  4HBN A;  4DY5 A;  4WBB A;  3RQ0 A;  2QVS B;  5L9B A;  5FP4 A;  3K4Z A;  4F7Z A;  3NJV A;  4BME A;  4OLL A;  5GM0 A;  3X29 B;  4A7K A;  3FE5 A;  2YPJ A;  3MIE A;  3POJ A;  1EAH 2;  1H1M A;  2PHT A;  4XPV A;  5KHG A;  4LJH A;  2QQP A;  3ST7 A;  3B94 A;  4J1W A;  4AE2 A;  1GWM A;  4ES8 A;  5JIU A;  5LW9 A;  4CPB A;  1J84 A;  3RZZ A;  1TME 2;  3AJY A;  4J25 A;  1R1A 3;  3KT7 A;  2ZZJ A;  1W2O A;  3A21 A;  4QPW A;  1XNK A;  4XFG A;  2BDR A;  5I8S A;  1DCS A;  2HLE A;  2VH9 A;  4QQO A;  5FRE A;  1UY1 A;  4E2S A;  3TWI A;  2ZOE B;  3HQR A;  2W1W A;  1KRI A;  2D6K A;  4L11 A;  4UWD A;  4Y1Y A;  1OOP B;  1J3R A;  2E7A A;  2R04 2;  1XPW A;  4O9E A;  3IBM A;  1W8W A;  4AFD A;  3AP7 A;  3WXP A;  2WDB A;  5GLZ A;  4XUO A;  5LA1 A;  1U0A A;  1D0H A;  2R0F A;  1FMD 1;  2Z79 A;  3ZYI B;  2ILM A;  3ACG A;  2JKX A;  1QJY 1;  2VOV A;  3RZL A;  5FQ0 A;  4QPI C;  5ANQ A;  5A1F A;  4F83 A;  1ZRE A;  2C26 A;  4PHZ A;  1D0G A;  1UZ0 A;  1DYO A;  2FCV A;  5E88 A;  4Y22 B;  3PLQ A;  3VN4 A;  1HRV 2;  4FQZ A;  2BVV A;  2XUM A;  4W6Y A;  1SFP A;  1V9U 1;  2DFC A;  2F17 A;  5FZ6 A;  2G4I A;  3H7Y A;  1TMF 1;  4OHX A;  3INA A;  4MXW A;  3VDD A;  3AKQ A;  5GLT A;  3MIH A;  3C8X A;  1RVF 3;  5E1R A;  3M7A A;  4XJU A;  4A45 A;  3OJB A;  2BNO A;  1N1T A;  5JXJ A;  1PMI A;  4FOY A;  4LBN A;  1Y9M A;  3OUJ A;  3MLL A;  4FPL A;  1SLL A;  1VR3 A;  5F3I A;  1ND2 C;  1W8F A;  2WO1 A;  4BH9 A;  1W6Q A;  3N36 A;  3D82 A;  3LEM A;  1OLM A;  4PDW C;  5BNN B;  1SDW A;  1WA4 A;  1ULG A;  1EV1 2;  4M0N A;  3P6B A;  2W95 A;  5FO9 B;  2Q0A A;  1SBF A;  3GYD A;  2G1M A;  3H3Z A;  2ARX A;  4HG6 B;  3AMM A;  3L9J T;  2EIC A;  2OII A;  5FPX A;  5AVP A;  3WUC A;  4K8R B;  4D6R A;  4JDO A;  5CIS A;  5FZ9 A;  4QX7 A;  3S7E A;  1VAL A;  4LXL A;  2AEY A;  2JDM A;  2XJV A;  2ADD A;  1S4C A;  2Q1Z B;  4CXW A;  3E6D A;  2AEZ A;  2P17 A;  1H1I A;  1OVS A;  2WZR 1;  3WF0 A;  2VME A;  4GUL A;  5ACA 3;  4I30 A;  5KXD A;  2CSG A;  2PLV 2;  4DPN A;  5FZF A;  3UET A;  4CCC A;  1EUU A;  1PZ8 A;  1HN0 A;  1W2A X;  3EXU A;  3GF6 A;  4HK9 A;  5A33 B;  1VRH 1;  4P9L A;  1F31 A;  3AVS A;  3RYK A;  2WQZ C;  1W05 A;  3LCP A;  4S2F A;  3AL5 A;  4EWA A;  3JBG 2;  5FZC A;  3CNA A;  5T54 A;  3M1H A;  4MV2 A;  4MGI E;  4R9C A;  2PA7 A;  4JQR A;  5A7N A;  1AHS A;  3VZN A;  5JXI A;  1KJL A;  3H1Y A;  2HKX A;  1B35 A;  3HEI A;  4FVV A;  5LEK A;  1ULD A;  2LS6 A;  3K48 A;  4GJZ A;  2JG8 B;  2O8Q A;  1NCR C;  2RS5 1;  4P14 A;  1CN1 A;  1GP6 A;  5CVR A;  5L9R A;  2XJS A;  4XAC A;  4AQ2 A;  3SCF A;  4BQY A;  5JSP A;  5K8S A;  4OHY A;  3D6E A;  2JEM A;  2MNG A;  4IEX A;  5HI0 A;  3B93 A;  4MOA A;  1XBF A;  3ZX7 A;  2WJS A;  3AX4 A;  2E9Q A;  4LHN A;  1JUH A;  1AL2 2;  5JR2 A;  1AR7 1;  3ENR A;  2HWC 2;  3ZYG A;  2WII B;  1NZC A;  3WSO A;  3N9N A;  4Y5T A;  2QBX A;  2PHW A;  2YUE A;  3DPR A;  5FJH A;  1M4W A;  3I2J A;  5BNP A;  5L7O B;  4COV A;  1NOV A;  4CDU A;  4G3Y C;  3MPB A;  1AYN 2;  5JMC A;  4L0P A;  2WS9 2;  4Y1X A;  5D2A A;  2WRA A;  4H14 A;  3CHX A;  5GAL A;  2DU0 A;  3TOJ A;  1ZZC A;  1PK6 B;  3DUI A;  4DB5 A;  3ILR A;  1TG7 A;  1NY7 1;  1AR6 3;  1FNY A;  1RUF 3;  3DXU A;  3WW4 A;  1NT0 A;  2GN3 A;  4DRV A;  3CIH A;  3NAP A;  4N43 A;  1H2N A;  4WZF A;  1C8M 2;  3MHZ A;  1YQ8 A;  5FYM A;  4BU2 A;  4BLI A;  2JB4 A;  1F4A A;  4URA A;  5FY1 A;  4W4Z A;  3B5L B;  2HH9 A;  3RRD A;  1ULP A;  3PMS A;  4RN5 A;  4UW4 A;  3OGR A;  4N8M A;  3PVB B;  2A3Y A;  2JE7 A;  3S30 A;  3R4D B;  1H6Y A;  1YCI A;  1VBD 2;  4NRP A;  1YIF A;  5CBL A;  4HN0 A;  3AYE A;  1MS8 A;  4NHX A;  4CEY B;  1S0J A;  1DLL A;  2W92 A;  2DCY A;  3U4X A;  2P1B A;  1ENS A;  2O8O A;  1MS3 A;  5FYB A;  5CB7 A;  3WQ1 A;  1NYW A;  1W8N A;  3B7M A;  4GWM A;  4W6X A;  1IZ3 A;  1S0G A;  3OBA A;  5FZI A;  2E26 A;  3DV8 A;  3IDE A;  1QY4 A;  3POS A;  4P9X A;  2QFE A;  2ZHN A;  5LAS A;  3U75 A;  3F2Z A;  3PU3 A;  4JDN A;  5BNO C;  1X9T A;  3TRS B;  3GBF A;  5KBF A;  3O1V A;  2D97 A;  3ZR6 A;  1SLB A;  2UYA A;  4HPK B;  1UOG A;  2DVA A;  3RG0 A;  3EYP A;  1ENQ A;  4U2A A;  1N3O A;  5B4X A;  1WMX A;  2JEN A;  3BPZ A;  3UES A;  3BTZ A;  3JB4 C;  3PU8 A;  1IHM A;  2WNE A;  4LE3 A;  3RI9 A;  4CDQ C;  3W5M A;  3PTR B;  2QNK A;  4X8N A;  5FBJ A;  1RB8 G;  4QXC A;  1KEX A;  4ERO A;  4YG3 A;  3JU9 A;  5LAT A;  3ZPY A;  4LBM A;  2VQU A;  3W20 A;  1ULC A;  2R1B A;  2VZR A;  2PHF A;  2W5F A;  1JZ3 A;  1JHJ A;  1LNS A;  5A32 B;  3PVE A;  1AJO A;  1CX4 A;  5F5C A;  2X05 A;  2H0B A;  4V2W A;  2AUY A;  1J83 A;  1UY3 A;  3ROU A;  3N4M A;  2VCM A;  4TN7 A;  3R6S A;  1AF9 A;  2BV4 A;  3J8F 1;  4AGR A;  2RDR A;  3J7N A;  1VBC 3;  3U78 A;  2ZHK A;  2JDU A;  4NID A;  4AVV A;  4XDO A;  3I97 A;  5FY7 A;  2TNF A;  3S6P A;  2K0G A;  3I3E A;  2GMM A;  2B9U A;  4L2N A;  2BOJ A;  4HKL A;  5A6X A;  4Q5O A;  3I3D A;  5FUP A;  5T5J A;  2BWC A;  3B69 A;  1H8T C;  2AC1 A;  3WW1 A;  2YGL A;  3ZFE A;  2IXK A;  2QQL A;  2VNR A;  4LKE A;  3RDI A;  3WF2 A;  4FOW A;  2C1F A;  2X29 A;  4DXR A;  2WNU A;  4XVH A;  2P3J A;  4Y20 A;  4Q0S A;  5LBF A;  5A3M A;  1I5P A;  1AYM 1;  1W0P A;  2K9Z A;  2VBB A;  2DVB A;  3CJI A;  3WCR A;  3VDB A;  3IZO A;  1FYU A;  1LAJ A;  4TLF A;  3OYW B;  2BBV A;  2VUC A;  4COU A;  5AFB A;  3ZDV A;  2VC9 A;  3WDY A;  4XF3 A;  4BE3 A;  1XNC A;  4Y4R A;  4RHV 2;  1DQ1 A;  1SPP B;  4I02 A;  3WV6 A;  4JGY C;  2IWG B;  1T6G C;  4BZ4 A;  1KS5 A;  4IL7 A;  5C8C B;  1XSR A;  1W6N B;  3JD7 3;  5JZG B;  1V6I A;  5FYV A;  1UU5 A;  2VTX J;  1IS6 A;  3CDZ B;  5FWE A;  2ADE A;  3IB3 A;  3WHT A;  3WF3 A;  1UYZ A;  1W8U A;  3USS A;  5I0S A;  3LDR A;  4M3C B;  2VUJ A;  2QDR A;  1BCX A;  1QNW A;  1QNY A;  1W6P B;  1YI9 A;  1PVC 1;  4O9G A;  3BIE A;  4A4A A;  3IN9 A;  1W2N A;  3AZX A;  4R52 A;  1GIC A;  4J6G A;  4Q4X 3;  1ZBE 1;  3K2O A;  4GXL A;  4UFL A;  2WO2 A;  4GB3 1;  3WZ1 A;  1PZ7 A;  1KJR A;  2Y6L A;  3WEZ A;  3SKJ E;  5CFC B;  1MZ6 A;  4RQP B;  1BBT 3;  1SLA A;  1ZZ9 A;  3MZH A;  1AR9 3;  2C9K A;  1HB2 A;  3LKJ A;  1C8N A;  1UF2 C;  4AED B;  5ISL A;  1KFX L;  1PMJ X;  3C7E A;  2VZS A;  5A7W B;  5FOJ B;  1YFX A;  1HQL A;  2R06 1;  3III A;  3MF9 A;  2KM2 A;  2OKX A;  4YSF A;  1C4R A;  4MH0 E;  5A6Y A;  2PYT A;  4NIA A;  1S2E A;  4PI0 A;  1UQX A;  3WUD A;  1YQ5 A;  1WBL A;  2ZEX A;  1RXF A;  1W8Z A;  1QQP 2;  1R08 3;  4LA3 A;  4PF1 A;  3THT A;  1O3R A;  1VAM A;  2H6B A;  5DAQ A;  4XUR A;  2DU1 A;  5GZF A;  4XJW A;  4ZU7 A;  4RS5 A;  3SH3 A;  3E97 A;  4LOT A;  2VZP A;  1PO2 3;  4KWK A;  4CXY A;  1DDL A;  3NV2 A;  4AYU A;  2XJQ A;  3UKV A;  3ZMO A;  1URX A;  4QPI A;  2TEP A;  2WYF A;  5EWS A;  2ZX1 A;  1RUH 3;  2N7G A;  1SBD A;  3DL3 A;  4DMI A;  5K0U B;  3HPN A;  1OD5 A;  2GME A;  4XQ4 A;  1G9D A;  3W5N A;  3I3M A;  5HCA A;  1GQH A;  4RA0 A;  2JXA A;  1RUF 2;  1AR6 2;  2L9L A;  2Y8K A;  4FP2 A;  3M70 A;  1PIV 2;  1VP6 A;  1XOY A;  2BNM A;  3I49 A;  3MW3 A;  1RIR A;  1KDK A;  3FZ3 A;  1LGC A;  1CJP A;  1NZI A;  2WSU A;  1SZB A;  5FZO B;  1N3Q A;  1X8E A;  4CCK A;  3KT4 A;  3RJR A;  3VD3 A;  1UKR A;  1ND2 A;  2ORZ A;  3KS7 A;  1NLS A;  1C3H A;  4EJR A;  1APN A;  4Z2W A;  1PGL 1;  4I01 A;  2Q8E A;  2WN3 A;  2DF7 A;  4FPK A;  1YEW A;  4PDW A;  4TXW A;  1MEC 2;  1WW5 A;  2VMD A;  3WF1 A;  4TWT A;  2OVU A;  3VBF B;  2UY8 A;  1OLM E;  2RM2 3;  4KGQ A;  1HN1 A;  3SQO A;  2P6C A;  4QX3 A;  1OD3 A;  3BOD A;  1BHG A;  3OBZ A;  1J1T A;  3C7O A;  4I3G A;  4RFT 0;  3B9I A;  3V0B B;  1HB1 A;  4LR4 A;  3RZM A;  4DUV A;  1REE A;  4MGK E;  3MUY 1;  1OF3 A;  2RS1 2;  1XE8 A;  1CES A;  2DTW A;  5FK8 A;  5FO7 B;  4QB2 A;  5JOW A;  2NLR A;  2GSY A;  2VUL A;  5KC5 A;  2OX0 A;  1ASJ 3;  2YYO A;  5T3N A;  2YRO A;  3ELN A;  3NNF A;  5C9A B;  3FBM A;  3GZE A;  5FZ3 A;  3MUZ 1;  3WX5 A;  5DXD A;  2QQI A;  4RR3 B;  2UWA A;  2NZ9 A;  3AKS A;  3CO2 A;  4CUB A;  3AZW A;  1LB2 A;  5L36 A;  5FMO S;  4QQ2 A;  4QX8 A;  1Y3T A;  4LO5 B;  4KU8 A;  3ZFF B;  2NP0 A;  1JZ2 A;  2ZAA A;  4QX1 A;  3MIB A;  1NE4 A;  1CAU A;  4PLO A;  5TSW A;  1M06 G;  2DV9 A;  2YC2 A;  2ETE A;  1NCR A;  3C7F A;  3O0X A;  4Q4W 1;  4Y1V A;  2VOX A;  3MYX A;  4KG0 A;  2MHF A;  4XUQ A;  4YVW B;  5F5I A;  1VBC 2;  2ZGL A;  2WT2 A;  1RTV A;  4HL0 A;  4YW6 A;  1DP0 A;  2OT7 A;  4CDX B;  3NNG A;  5A6Z A;  1JMU B;  5SV8 A;  4LBQ B;  4ARX A;  3IIA A;  4EE2 A;  1PO1 2;  3KCC A;  4I0A A;  4LKF A;  2PXJ A;  3ZXJ A;  3GJA A;  1LCL A;  4GKX A;  2JDA A;  2E32 A;  3NMB A;  1QJY 3;  3VBH B;  3QD6 A;  1O4Y A;  5HV4 A;  2XWB B;  3O1U A;  3N9M A;  1AJK A;  1VBA 2;  1YFU A;  3DKW A;  3OPW A;  4Y5Z 0;  4AW7 A;  3S7I A;  5FPA A;  2R07 2;  3NNL A;  5E6H A;  1Q8S A;  1CIY A;  1LU1 A;  2MPF A;  2P4E A;  4NJ4 A;  4W8J A;  1VAV A;  3BGA A;  3TAY A;  3TYJ A;  5IT6 A;  3TEY A;  2WT1 A;  2C6S A;  4C1W A;  5C3P A;  4B4Q A;  5CFD B;  4K1Z A;  1ND3 B;  2BNN A;  2EXK A;  2JIC A;  4LO4 B;  5ABJ C;  4YM2 A;  4LHK A;  2ZGN A;  4IE0 A;  3H1W A;  3S5Q A;  5A80 A;  3OBT A;  5LA0 A;  5IK4 A;  1J59 A;  5J1X A;  3RFR A;  1SAC A;  4XMA A;  1JYN A;  5KHI A;  1Q8V A;  5T50 A;  1VAK A;  1QXJ A;  3TB0 A;  3ZXK A;  2ES3 A;  4A7Z A;  4A6S A;  4YZ5 A;  3EO6 A;  4D6S A;  3KZ4 C;  1CAW A;  4ZKT B;  5CKM A;  2ZHM A;  2Y64 A;  1BMV 1;  2BJS A;  1P8J A;  2WAO A;  4B7K A;  1S2K A;  5EP9 A;  2ZGS A;  4KWU A;  1JTZ X;  5FZH A;  2VZ1 A;  3ZN6 B;  1RUC 1;  1POV 3;  3I2D A;  4I0B A;  4YGE A;  1H2L A;  1LOD A;  3AKR A;  1RHI 2;  3HJR A;  1CAV A;  1H9P A;  4XMI A;  3ZXG A;  3NJY A;  2PAE A;  1U12 A;  5FPB A;  5IVY A;  3UGF A;  1W0N A;  2G19 A;  2XJU A;  2WZR 3;  2ZGU A;  4IEQ A;  5A3T A;  4KMQ A;  1EAH 3;  1MZ5 A;  4UFH A;  2R16 A;  1JU3 A;  3K4A A;  4YVS C;  4CCN A;  2VG9 A;  5BNO A;  2NQY A;  3HBK A;  3LIG A;  5DUW A;  5IVF A;  2J22 A;  1D4M 1;  1GZW A;  2TUN A;  2XBO 1;  1UN1 A;  1AXY A;  1AR9 2;  1MS5 A;  4XJZ A;  3VZK A;  3LE0 A;  1MZE A;  4NRM A;  3FUQ A;  4CDQ A;  2YG0 A;  4PBP A;  3ES4 A;  2YV8 A;  4N9I A;  2PFW A;  1NAE A;  3DKQ A;  4I3P A;  4AFA A;  4AK3 A;  4MZU A;  4OUL A;  1W9W A;  4CDW B;  1ULO A;  3H3L A;  1YXW A;  2VZV A;  4B1L A;  4YFZ A;  5BV6 A;  4YW5 A;  3O1T A;  4UFM A;  4YG6 A;  5D8A C;  4CCJ A;  3Q8B A;  1TQ5 A;  3ATG A;  3ZXA C;  1R08 2;  1OQD A;  3E6C C;  1HXS 2;  4QPG C;  4Y1U A;  4LPL A;  4V1P A;  2R04 3;  2QQW A;  1WMF A;  2BFU S;  1AR7 3;  3SEP A;  4D6Q A;  4HMZ A;  5FQ0 B;  1DYK A;  3H3U A;  4WM7 C;  4OI1 A;  4CP2 A;  3H0O A;  4M00 A;  1MS1 A;  1OC1 A;  2X10 A;  4LA2 A;  2IVI B;  1LOA A;  3LA2 A;  4Q4V 2;  2Y60 A;  2VD7 A;  4CP1 A;  2VTX A;  1XU2 A;  5FRA A;  1R1Z A;  4XCB A;  2MEV 1;  3VBO C;  4FAG A;  3VB9 A;  1HJG A;  3GHM A;  3I4I A;  1GZ9 A;  5FLI A;  4C8D A;  1HRV 3;  4CU7 A;  1VIW B;  5HCB A;  5A6Q A;  5EJZ B;  1H8T A;  5I0T A;  5C5T A;  4NHK A;  1SFY A;  3J7L A;  1WLC A;  2KA3 A;  2YXS A;  4EWE A;  4Q26 A;  2ZMN A;  1YHF A;  4AL9 A;  4BMB A;  2GZW A;  5L9V A;  4QXK A;  3VHR A;  1K5M C;  4WVM A;  5EIY B;  1PM4 A;  5CIR A;  4QKB A;  3AP4 A;  3IM0 A;  4UF0 A;  3LFM A;  3U14 A;  4EN6 B;  2YBP A;  1CZT A;  1O8P A;  4W50 A;  5HBA A;  4GAL A;  5H9P A;  2DCJ A;  2B42 B;  4CEW C;  4I0W B;  3E5X A;  3KCX A;  4JX0 A;  1EV1 3;  1SLT A;  4LIV A;  1QJX 2;  3U11 A;  4JGY A;  5FP3 A;  2WO7 A;  3MLJ A;  4P9Y A;  5FZK A;  2EA7 A;  1BZW A;  1Q8O A;  2DTY A;  2JDN A;  2XKO A;  2PHX A;  1BJQ A;  3HR9 A;  3UL2 A;  4AG4 A;  5JIA A;  3Q8E A;  3WNL A;  3N9L A;  4XXA A;  3HD8 B;  4GQ7 A;  5C6C A;  2WNV C;  3KVB A;  1TEI A;  3A0K A;  5IVV A;  3UYJ A;  5J96 B;  5KXC A;  1ASJ 2;  1FAY A;  5IYY A;  1RUD 3;  1S1A A;  3K75 B;  2B39 A;  2ID4 A;  2PLV 3;  4TTG A;  1CON A;  4IV1 C;  1UYP A;  3ZMN A;  1EUT A;  2ZEY A;  5CKQ A;  3RPQ A;  2HYK A;  1RIT A;  2XWJ B;  3JBG 3;  2W1Q A;  1VE0 A;  4QKF A;  5FMC A;  1OPO A;  2P34 A;  4FPJ A;  2Y6H A;  2A6Y A;  4UW6 A;  2X09 A;  3ME2 A;  2JJ6 A;  3J7H A;  2A70 A;  4OHV A;  4RFR B;  1UXZ A;  2V09 A;  1DGL A;  4QPY A;  3ZYR A;  1NLQ A;  1QHD A;  2W1S A;  5C5U A;  3N3H A;  2CGN A;  4HFS A;  4KGG A;  4ZXK A;  5F7U A;  4N53 B;  1G9B A;  5F5Q A;  4A44 A;  3VBR B;  1F9K A;  2VEC A;  1WKY A;  5IVE A;  1E57 A;  3PUI A;  3D8C A;  1QMJ A;  1QJY 2;  4CP9 B;  1RXG A;  4AI9 A;  1COV 1;  2DCK A;  3MIF A;  2F4P A;  2WO3 A;  2ZGK A;  5B4N A;  1A3K A;  4E2Q A;  4EN0 A;  5IFP A;  4QXH A;  1V70 A;  3U1X A;  3M3Q A;  3ASI A;  3SH5 A;  1QJF A;  5FXW A;  2BGC A;  5IHR A;  4AVC A;  4XET A;  1V9U 2;  5DAP A;  2D98 A;  2GAL A;  1AYN 3;  2HBT A;  2LW8 A;  1XQN A;  4IW3 A;  1J3P A;  2DBN A;  2WS9 3;  3OGJ A;  1OOP C;  5CA6 A;  1VJ2 A;  4QU2 A;  1PGW 1;  1RMU 1;  4WZC A;  5JR7 B;  4EN7 B;  4JHT A;  3N7K A;  1AYM 3;  3J26 N;  5CAZ A;  4IE5 A;  1LRH A;  2P2K A;  3WDU A;  1US2 A;  2YU2 A;  1RUI 1;  3IWZ A;  2ARA A;  3VDC A;  3KVA A;  1CGP A;  1CAX A;  4P9I A;  1OBN A;  3O0V A;  3WY6 A;  4XAB A;  4BK5 A;  3I8T A;  5GLU A;  3B3Q E;  2VMG A;  1X33 A;  1LHV A;  2GC1 A;  4BCU A;  4AOC A;  3T0B A;  4R9D A;  1IPJ A;  3SXW A;  2CY6 A;  2EXJ A;  3J4U H;  4E8C A;  4OVE A;  1VBD 3;  3ZR5 A;  1OXC A;  2VBD A;  4MG2 A;  5JVV A;  4NHL A;  1QH7 A;  3BIW E;  4LEJ A;  4RL7 A;  4UXA A;  4KG8 A;  2VOT A;  2WZR 2;  1AR8 3;  4LE4 A;  3OB8 A;  1CQ9 A;  1VBB 1;  2ZHL A;  2DUQ A;  4JKK A;  3ZXD A;  3IMN A;  2FDI A;  2QZ3 A;  2W87 A;  5BNN C;  1W90 A;  5C7G A;  2PEL A;  3NW4 A;  3I7D A;  1PVC 3;  2Y0O A;  2YB7 A;  1VRH 2;  2Y6J A;  3RSJ A;  4FTS A;  4NO4 A;  5FYY A;  3U10 A;  1F35 A;  2GC0 A;  1QIQ A;  1RGS A;  2XOM A;  3MPP G;  3IKW A;  5T52 A;  3GDB A;  4WM8 B;  2VXR A;  3AFG A;  2VR4 A;  1UPS A;  4FOV A;  1OPM A;  2BW8 A;  2RS5 2;  2A5Z A;  1LR5 A;  1DQ5 A;  1WW7 A;  2Y0I A;  1POQ A;  1UY2 A;  4Y3O A;  3N9P A;  3SIS A;  3O0W A;  4E9K A;  4JCK A;  3DGT A;  5H9S A;  4Q0U A;  3GHN A;  2FDF A;  1K5J A;  1UO9 A;  1KGY A;  2FBE A;  2CNA A;  2WFF 1;  5A3W A;  3T2Q A;  1RL3 A;  1AR7 2;  2BBA A;  1FPN 1;  5LA9 A;  3W58 A;  1OUS A;  1WUV A;  4U36 A;  1O6U A;  3N9O A;  3IPV A;  5J36 A;  2P3K A;  2Z2S B;  3AK0 A;  1N3P A;  4NMI A;  2JG8 C;  2B7Y A;  1O8S A;  2WA3 A;  5EQU A;  2OW4 A;  4KH9 A;  4Z82 A;  3ZSM A;  2RMU 1;  1XU1 A;  4UW3 A;  2RE9 A;  3POG A;  4UOJ A;  4FFG A;  3TNP B;  5A3N A;  2ZEW A;  2GMP A;  3TN9 1;  5CG8 A;  2YDE A;  3GCW A;  4DQA A;  4E4S A;  4PBO A;  1NY7 2;  2BRT A;  2HWE 1;  4OZO A;  3S57 A;  1CPM A;  3HNY M;  5C3R A;  3PUA A;  4PI2 A;  2D43 A;  4Q0P A;  1IG3 A;  2HEW F;  5L7O C;  2JG9 B;  4ZS2 A;  3SCG A;  1U5I A;  1GLH A;  1JYW A;  5JXG A;  4P5H A;  1RYY A;  3V0A A;  1HB4 A;  1RIN A;  3SIT A;  1BXH A;  4Q1R A;  1WCD J;  4RHV 3;  4Q1P A;  5JXH A;  2D5F A;  2QQO A;  1PK6 C;  5GJ6 A;  3APB A;  4ARY A;  4YZ2 A;  3R4U A;  1NG0 A;  1E5I A;  3NVC A;  1JZ7 A;  2FCU A;  5FY4 A;  4YZ4 A;  1FV2 A;  2XLG A;  3LEG A;  3LSE A;  4FXG B;  3E5U A;  4QDR A;  1OUX A;  5ANN A;  1MZF A;  4S2H A;  1F5F A;  1FNZ A;  3K3O A;  3KV6 A;  1JZ8 A;  2VAU A;  5FZ0 A;  2VTF A;  4XUP A;  3AJZ A;  2J1S A;  1RUD 2;  3T2O A;  2ET1 A;  4XF9 A;  5JPN B;  2W91 A;  3AMN A;  2EXH A;  1G7Y A;  3TBD A;  3IT8 A;  4CEY C;  1VBE 1;  2OA2 A;  2PQS A;  4YVS A;  1AX2 A;  1PM7 A;  1RUG 1;  4X6R B;  2ZCW A;  4Y26 A;  5J98 B;  2DUP A;  5FLJ A;  4QGL A;  3VKN A;  1Q5O A;  4BB3 A;  3E6B A;  2B8M A;  4CUA A;  4NAM A;  1G8W A;  3OGV A;  5F1R A;  1YIP A;  2C5D A;  2VQ0 A;  4Q4Y 1;  1BEV 1;  2RR1 1;  4XF0 A;  2EVX A;  1OQE A;  3J8F 2;  4JRL A;  1FX5 A;  4Z2A A;  4COY A;  2O0O A;  4FXK B;  5D8A A;  3FHA A;  3FLR A;  3M3C A;  2JDK A;  1DGR N;  4BXF A;  3AXD A;  3JXS A;  3LOB A;  4CYD A;  4RS5 B;  2Z5W A;  4ZHN A;  1QQP 3;  4QPG A;  4GZ9 A;  3LD8 A;  5A7P A;  1DZR A;  4AFM A;  3Q8A A;  2FDK A;  1DQ2 A;  4C0H A;  1HRI 1;  2DCZ A;  1BK0 A;  4WM7 A;  1XE7 A;  3ZO0 B;  1W9F A;  2XLF A;  1E5R A;  2WWJ A;  3U4S A;  4AHY A;  5E16 A;  4LKS A;  2HEV F;  1T6B X;  4UW5 A;  1OT5 A;  4H7L A;  4AI1 A;  3O1M A;  3PVN A;  4A42 A;  4B1M A;  3UKN A;  2PAK A;  3VBO A;  1GOH A;  1S2B A;  5DZF A;  4D69 A;  2VMC A;  4DO0 A;  2OUJ A;  1AYM 2;  5F2W A;  5CEH A;  2VUD A;  2F6B A;  2WR9 A;  1LHU A;  1PIV 3;  1KDM A;  2GH8 A;  3L2Y A;  5LRR A;  4AAP A;  2E6V A;  5BPX A;  5IVC A;  2NN8 A;  3BOW A;  4XBN A;  5FXV A;  3A4U A;  2GU9 A;  3QCW A;  1G9C A;  2YC0 A;  5FUI A;  4AAX A;  4CCO A;  2PHL A;  5JSR A;  4NWV A;  3LEI A;  2XH6 A;  4HVR A;  5FPV A;  1MEC 3;  2PN5 A;  3AMQ A;  4QT6 A;  1DLC A;  4CEW A;  1ZA4 A;  2BTV C;  1D2Q A;  1BKZ A;  4K40 A;  2ARC A;  2GNB A;  1AR8 2;  3RWK X;  4BYY A;  1LGN A;  4B8E A;  2I2S A;  2ZGT A;  3AYC A;  4IEV A;  3I2F A;  1PVC 2;  2WA4 A;  3I2I A;  5GLV A;  1RUO A;  3KF3 A;  2BWA A;  3A7Q A;  1OVP A;  3M3E A;  4K8F A;  1WCS A;  5FFO C;  1MQT B;  3T1L A;  3RYP A;  1ZBE 2;  2WNV A;  2RS1 3;  3B00 A;  4YZ3 A;  4C0B A;  4FPF A;  5C8C C;  4GB3 2;  4JTO A;  1ONA A;  4NII A;  1X8M A;  5JZG C;  3C7H A;  4GMP 3;  4LOS A;  1V6O A;  3P3N A;  4YWA A;  1W6M B;  2RV9 A;  1DQ4 A;  4MO3 M;  5I91 A;  4HET A;  3OG2 A;  4IV1 A;  4XUT A;  4AI3 A;  2IVJ A;  2FQP A;  5FZB A;  5BNQ A;  3USU B;  5FZ8 A;  1IOA A;  1UZZ A;  3PHM A;  4ASL A;  1A78 A;  2VVF A;  1YO8 A;  4P9G A;  2EIB A;  5EJ3 A;  3FFZ A;  4A3Z A;  4AHX A;  3WT3 A;  2YU1 A;  3WHU A;  4Y4Y A;  1W39 A;  2VU9 A;  4RYD A;  3ALQ A;  1CJD A;  1YJL A;  1SCS A;  2OZJ A;  1QJU 1;  5GKA C;  3HNB M;  4QGM A;  3M8L A;  5CFC C;  4P5Y A;  4RQP C;  2VOW A;  3HT2 A;  3TEW A;  2VL4 A;  3M3O A;  3D0J A;  4MGZ E;  1VB4 A;  1PO1 3;  2R30 A;  2WAB A;  3EQE A;  4JHZ A;  1H9W A;  5GLW A;  4AED C;  1J3Q A;  3GXU A;  1J58 A;  5EYY A;  1VBA 3;  1NXM A;  1XYN A;  4MAD A;  5SV5 A;  4ISR A;  2UY9 A;  1H4G A;  5AC9 1;  2R07 3;  2WQ8 A;  1F5J A;  3WP3 A;  1LOF C;  1NCQ B;  1VMH A;  2OXB A;  4MGS A;  4XHB A;  3ZIX A;  1GSL A;  1QU0 A;  4XC9 A;  5LZ6 A;  1L3J A;  3L2H A;  1OOP A;  5A7Q A;  3OD4 A;  4BQ2 A;  1FOD 1;  1WD4 A;  3PVO A;  1HKD A;  4XDP A;  1AL2 1;  3N9Q A;  3BYW A;  2XXZ A;  3NNM A;  4JGZ B;  5F2S A;  2HWC 1;  4D94 A;  1POV 0;  1KXG A;  5FYU A;  1W6O B;  3DYM A;  4AVT A;  3RZK A;  4FFF A;  1SHW B;  2XG3 A;  4KWJ A;  1PNF A;  1PGL 2;  4PQQ A;  5GZE A;  2FD8 A;  2CV6 A;  1RUE 1;  2FDH A;  2NMN A;  5DAX A;  2EAL A;  4PF5 A;  4RD7 A;  4XIK A;  5DPN A;  1IKP A;  3LIH A;  1E5S A;  3ZN5 A;  3VZJ A;  1V0A A;  5LBE A;  3UKT A;  5LRS A;  3B02 A;  2GAU A;  1RED A;  1KIT A;  3URF A;  5LB6 A;  3ZKY A;  2ZZQ A;  1RHI 3;  4C1X A;  5HXM A;  1JZ6 A;  5FXX A;  2XON A;  2FHR A;  3NQH A;  5FZ1 A;  1UXX X;  3VKL A;  4AXO A;  4AFC A;  2XB6 C;  5BY5 A;  3ON7 A;  5FZE A;  1CX1 A;  2K46 A;  5EJ1 B;  5FY9 A;  1W03 A;  1CR7 A;  4QHZ A;  5FOB B;  2XJR A;  3WG2 A;  3MIG A;  3BOP A;  4KWL A;  5BNN A;  3FBY A;  4NHM A;  3VBF C;  3VDA A;  1A8D A;  5H9R A;  2LAL A;  3QH7 A;  2JB8 A;  2W68 A;  3OPT A;  3VV1 A;  3AP5 A;  4LO6 B;  1HLC A;  1RUJ 1;  4GH4 B;  2UU8 A;  2OPK A;  1K42 A;  3WD5 A;  1A6C A;  1Y9Q A;  5IAV A;  1L7R A;  4FT8 A;  3VL8 A;  4YGC A;  1W8O A;  3B9C A;  4AGV A;  3KHC A;  4Q4W 2;  1UZW A;  1NQD A;  1JYX A;  5K4L A;  3SHR A;  2QZ2 A;  3MID A;  5CNA A;  4Q8L A;  1SQ4 A;  2ZEZ A;  5C9A C;  1O5L A;  4YW7 A;  1HV1 A;  4BQ1 A;  1HX6 A;  3UV9 A;  5A33 A;  4RR3 C;  1OA2 A;  5A3O A;  5LBB A;  1HXS 3;  3NV4 A;  1R1A 1;  1SMV A;  5FYZ A;  1QKQ A;  1COV 3;  4FOQ A;  1XRU A;  3ZFF C;  2VMH A;  3K77 A;  5G05 L;  2GNT A;  1SBE A;  3RZG A;  3N7J A;  3ITQ A;  4YNI A;  4Q4V 3;  2YY1 A;  4RGK A;  1LED A;  5T55 A;  2JG8 A;  1OLQ A;  1LOC A;  2CL2 A;  2IXI A;  3AXE A;  3CL1 A;  4CU6 A;  1W2U A;  3NNJ A;  4YVW C;  1WD3 A;  3GCX A;  2XML A;  1IPK A;  2A3X A;  4CDX C;  3POW A;  4UBH A;  3BUC A;  2YC4 A;  2D3P A;  4BIF A;  4DNY A;  3POE A;  4NRQ A;  2IXJ A;  1V6J A;  1D4V B;  1DQ0 A;  2VE1 A;  1JXN A;  3ORJ A;  2P5B A;  4P02 B;  3VBH C;  1JYI A;  2D6L X;  4FP3 A;  1RUI 3;  3THP A;  5FPZ A;  4G4F A;  4YGD A;  3OGS A;  1GFF 2;  5A7O A;  4LBQ D;  1ZVF A;  4IXL A;  4ORF A;  5DDJ 1;  3U37 A;  4RGA A;  3WW2 A;  4A6O A;  1NE6 A;  2IFW A;  5L7O A;  3JB8 A;  1RJ8 A;  1K12 A;  3KV4 A;  2E7Q A;  2YHJ A;  2DCT A;  5CFD C;  2A73 B;  5T5P A;  1ND3 C;  1WLD A;  1LGB A;  2QCS B;  4NUB A;  1RUC 2;  2I74 A;  3WNK A;  4A41 A;  3I59 B;  1NA1 B;  2AR6 A;  3C7G A;  4N90 A;  1RVF 1;  1PK6 A;  1KQR A;  2CU5 A;  3MW4 A;  1OA3 A;  1QJX 3;  2GC3 A;  4O7X A;  4D0Q A;  3RZJ A;  2VZU A;  4GAZ A;  4QU1 A;  4EV0 A;  5IK8 A;  2EID A;  3ZDS A;  3VD9 A;  2XHK A;  4LLO A;  5HXV A;  5FZ7 A;  4AI8 A;  4YFW A;  4FSJ A;  2WBK A;  3BAL A;  1WME A;  4GD4 A;  4Y1Z A;  4OUM A;  5FZA A;  1MVE A;  4UFK A;  5FKC A;  4BQ3 A;  2CYF A;  2X5I B;  1I3H A;  3R0R A;  4XIL A;  5C4W B;  1W04 A;  2QQK A;  4LMF A;  2DUR A;  3FHQ A;  2A6W A;  4BM8 A;  4IER A;  2ZGM A;  3ILF A;  1RUN A;  3FN9 A;  1D4M 2;  2XBO 2;  2BGO A;  2KXL A;  1FT9 A;  3NJX A;  4YYO A;  1W2T A;  3WNX A;  5JLV A;  4FPG A;  4QHB A;  4NPR A;  4URT A;  4XBL A;  1IKQ A;  4CEY A;  4B7E A;  1D7P M;  3AZZ A;  1QWR A;  3OY8 A;  1QDC A;  3EHK A;  3ZYP A;  5FAX A;  4ATF A;  4GKY A;  1W3V A;  4PCR A;  2NMO A;  1ZYB A;  3D5O A;  2W9X A;  4IV3 B;  3MV1 1;  2JIG A;  3WNM A;  2QTW B;  5CYY A;  5ACA 1;  3AFK A;  1Q3E A;  3BKZ A;  1JW6 A;  3ES1 A;  3IAP A;  4HPK A;  3RGB A;  4TLG A;  5DZE A;  3VBS B;  3VD5 A;  4EZH A;  1FPN 3;  2BGP A;  2E7T A;  2VM9 A;  2WWU A;  3H42 B;  1FMD 3;  3KV5 A;  5D21 A;  4LO8 A;  4DZG A;  2BZD A;  4DUW A;  1L7Q A;  1FV3 A;  4A2U A;  1IQD C;  2KD7 A;  4TZD A;  3OEA A;  3H50 A;  2IZW A;  5I0U A;  2LRP A;  1W9T A;  4CDW C;  3SH4 A;  4GIQ A;  3MO4 A;  3CF6 E;  2W94 A;  4C90 A;  2WAA A;  1V6M A;  4ZZ5 A;  4CCM A;  5A32 A;  1V9U 3;  5M0T A;  4ZU4 A;  3FLT A;  3HNM A;  1JOB A;  1TMF 3;  1ODN A;  1OKO A;  3M4F A;  1YC6 1;  4K1Y A;  4M4R A;  5FP9 A;  1RC6 A;  4GWN A;  4SBV A;  4MUV A;  4LNV A;  2H6C A;  3ZLI A;  3O1O A;  5IAX A;  1OMI A;  3QLQ A;  4LK7 A;  2WT0 A;  4PQ9 A;  3BTA A;  2OPW A;  2DVD A;  4BIS A;  2SLI A;  1IS5 A;  1C5H A;  4RGG A;  1C28 A;  4YW1 A;  2GND A;  4XHX A;  4TSV A;  1O3T A;  5G04 L;  3ZYH A;  2HWB 1;  2PAM A;  2Z69 A;  2C9A A;  3ZFG B;  5AVA A;  2E33 A;  3VBU B;  3PIJ A;  4EQV A;  2E63 A;  4FPO B;  2WLQ A;  3WP5 A;  5JI9 A;  1LEC A;  1UAI A;  4R9B A;  1UPI A;  1UWW A;  3I3B A;  2Q8O A;  4FTB A;  1H1A A;  2WUH A;  5FPL A;  4XBQ A;  1OUR A;  1UIJ A;  4M3C F;  5FMD A;  4BIO A;  5JPM B;  4IUG A;  4OMD A;  4BOW A;  1EY2 A;  3NV1 A;  3OYW A;  1PHM A;  1OLR A;  3MV0 1;  4GWI A;  3ZKU A;  1DF0 A;  2ATF A;  2LTN A;  2XR4 A;  2CGO A;  4AQT A;  1QJE A;  3HWJ A;  1SPP A;  1JYV A;  1VRH 3;  4QDQ A;  1LHW A;  4B4P A;  5K7P A;  4HT1 T;  1VBE 3;  2ZAH A;  2P37 A;  4FBF A;  5C8C A;  2XVK A;  1W6N A;  4MGQ A;  4LLF A;  5FV3 A;  1Z7S 1;  5JZG A;  5DQ0 A;  3ZSJ A;  4A3X A;  1CD3 G;  1ENR A;  1WCQ A;  2DDU A;  3PIG A;  4HKW A;  4XFF A;  2A71 A;  1Q43 A;  2BUK A;  2XVL A;  4R4Z A;  2RS5 3;  5IWF A;  4PLN A;  4IEU A;  4LO7 A;  3VLB B;  4M3C A;  3ZYF A;  4ZU5 A;  4IEO A;  4KBZ A;  4QQL A;  4FTE A;  4OZX A;  2X53 S;  1BEV 3;  1JH5 A;  1W6P A;  3WG4 A;  1G9F A;  3MFA A;  1T2X A;  1SG3 A;  1CIW A;  5F39 A;  5F3G A;  4DY3 A;  1COV 2;  5EXO A;  3ZSL A;  4QDS A;  2P3I A;  2Y33 A;  3HQX A;  5CFC A;  4RQP A;  4WV8 A;  2GN7 A;  3KM5 A;  2XL7 A;  5C3S A;  3RNS A;  5KXB A;  2Q5T A;  4AED A;  2LRO A;  1DZQ A;  3RJ2 X;  1EPZ A;  4L8Q A;  1ZBA 1;  4MXW B;  4N53 C;  3VDD B;  3W59 A;  1QOT A;  1PGW 2;  1RMU 2;  2VNG A;  2NM1 A;  3VBR C;  4QHO A;  4MHU A;  2RDS A;  2HYX A;  2VBP A;  3ZM8 A;  2AGS A;  1GP5 A;  1KS4 A;  1LOF A;  2R49 A;  2SBA A;  2W3J A;  3AZV A;  3BB6 A;  4PJY A;  3I2G A;  4KNC A;  4XFA A;  3ZN4 A;  5JMO A;  1RUI 2;  5F37 A;  4H2A A;  1LUL A;  3WDW A;  2CGP A;  2ZS6 B;  1W6Q B;  5FZ4 A;  1IQA A;  2O14 A;  2G9F A;  2QQN A;  1W28 A;  1YQ6 A;  3R4S A;  5HCF A;  3FHI B;  2A75 A;  4UBG A;  1KFU L;  4LBO A;  5HV0 A;  4IE6 A;  1WGP A;  2Y38 A;  4KI5 M;  4QMA A;  1G86 A;  3OPZ A;  4HSL A;  2GP5 A;  2YGM A;  4HVQ A;  5DAV A;  1UMI A;  2Y26 A;  1JOP A;  4FPE A;  1BVV A;  1UCX A;  3G7D A;  3DCQ A;  2H0V A;  4XFB A;  1QXR A;  4HN1 A;  4W65 A;  5A7S A;  4A7Y A;  1GBG A;  1VBB 2;  1KD7 A;  1WWY A;  2J1E A;  3NRU A;  3O1S A;  3KCY A;  1ODM A;  3PUH A;  3AC0 A;  3NV3 A;  1RJ7 A;  3E1F 1;  5F6K A;  5T5L A;  5FZO A;  5LY1 A;  1N1V A;  3OD0 A;  3SMH A;  1HIX A;  1IPS A;  4FPY A;  5LWB A;  3Q8C A;  1Y9G A;  2YBK A;  2ORX A;  4OI4 A;  4QX5 A;  2YFU A;  4NWW A;  3JD7 1;  4QM9 A;  3FX3 A;  1B35 B;  3VBF A;  5HCH A;  3LPF A;  1GNZ A;  4QWN A;  1S55 A;  2DFB A;  3IAQ A;  3POY A;  5BXX A;  5I8T A;  5IVB A;  4XDQ A;  2YFZ A;  5FYS A;  5LA2 A;  1SFN A;  4CCL A;  3V0B A;  3T2P A;  1UY0 A;  4ET7 A;  4UT5 A;  2WL1 A;  2BER A;  3M3I A;  2XDV A;  4L99 A;  1NQJ A;  2WFF 2;  2YMZ A;  3DN7 A;  2FCT A;  2JD4 A;  1QXP A;  1FPN 2;  2JDZ A;  4Q4X 1;  5JDB A;  4PIX A;  1FMD 2;  2RDN A;  3J8F 3;  3R05 A;  1W0O A;  4YW2 A;  1XYP A;  2QE3 A;  2ZXQ A;  4WM8 C;  4ITC A;  5C9A A;  1ZRI A;  2CDO A;  3LFI A;  3LAG A;  4NN0 A;  1BBT 1;  1I5Z A;  3DPR B;  4JKM A;  4LBL A;  5L73 A;  1AR9 1;  4RR3 A;  3KGL A;  1MS0 A;  5BNP B;  5E8A A;  4CDU B;  5CG9 A;  2VQT A;  4XAA A;  2OS2 A;  1YJK A;  2OQ7 A;  2RMU 2;  3AP9 A;  1VMF A;  3ZFF A;  1W8T A;  2R6Q A;  3TN9 2;  2VJX A;  3AL6 A;  1TMF 2;  3C2U A;  1JU4 A;  3MIC A;  3KLS A;  3LDK A;  5LEJ A;  3NO8 A;  4D7S A;  4ASM B;  5K0U C;  1JS9 A;  2HWD 1;  2D3S A;  1FAT A;  1YQC A;  1XND A;  1C1F A;  2ZGO A;  4JTN A;  5DG2 A;  4YVW A;  1R09 1;  3NAP B;  5JAX A;  4N43 B;  4CE8 A;  3H8O A;  1HJF A;  4QB6 A;  2DBI A;  4E4Z A;  4YM0 A;  4CDX A;  3HAG A;  2XPJ A;  3PJQ A;  3WG3 A;  2EIE A;  4LBQ A;  1CZS A;  4XUN A;  1XNB A;  4I2O A;  2I45 A;  1GOF A;  3KGZ A;  1PO2 1;  1V00 A;  4HON A;  3KHB A;  3VBH A;  3UGG A;  5B2G B;  5IVJ A;  4NE9 A;  4JZR A;  4CCE A;  1RUH 1;  1X7N A;  4CUG A;  1AL0 G;  3ACH A;  3WW3 A;  5LK7 B;  3CZJ A;  2OQ6 A;  1DGW A;  3WOG A;  4IDZ A;  3MFC A;  3OF1 A;  1WCU A;  2D3R A;  5CFD A;  3W21 A;  1ND3 A;  2VPV A;  3S0M A;  3ACF A;  3HMY A;  3T3Y A;  3AB0 A;  2FDG A;  1US3 A;  4KBB A;  2JDH A;  3KD4 A;  4UFI A;  1VMJ A;  4GMP 0;  4EYU A;  1GYK A;  2JG9 C;  5FXZ A;  1PGS A;  2EAA A;  2R32 A;  4QB1 A;  4QAW A;  2J1U A;  3WP4 A;  2RDQ A;  1UY4 A;  2UYB A;  3KB5 A;  1YWK A;  5FCC A;  3BCW A;  2V5Y A;  2J1V A;  2VO5 A;  3BU0 A;  4OQ9 A;  3Q9O A;  3WQ7 A;  1S0D A;  1VBE 2;  2B4K A;  3PDQ A;  3T30 A;  1JOD A;  4FI9 A;  1ZBE 3;  2FZ1 A;  4HAN A;  4YG0 A;  3V64 A;  1S0F A;  4LTA A;  4LT5 A;  4Z07 A;  4GB3 3;  4JV4 A;  2ARB A;  5FO8 B;  1RUG 2;  2RM2 1;  3H8X A;  3BTX A;  2D6O X;  4QQH A;  3POB A;  4OHZ A;  1WW6 A;  2XQX A;  3ZN6 A;  2C0Z A;  1UX6 A;  3UJQ A;  1JZ4 A;  1RUJ 3;  2QQM A;  2Z42 A;  3O12 A;  1JZ5 A;  1AX1 A;  2G9Z A;  4OI2 A;  5FR3 A;  3ZIW A;  1U5Y A;  2A1X A;  1H30 A;  4Q4Y 2;  5A70 A;  2R06 3;  1BEV 2;  2WWS A;  3FC0 A;  3H7J A;  1TNR A;  2RR1 2;  2ZGR A;  3PL0 A;  4JDM A;  3O14 A;  1ZA7 A;  4PIY A;  4BLJ A;  1O7F A;  2Y34 A;  1Q8P A;  4S2D A;  1ASJ 1;  3Q8F A;  2WZE A;  2WZP P;  5DG1 A;  4EN8 B;  2WN2 A;  3AP6 A;  2AEN A;  1UNB A;  3O1P A;  2VY0 A;  3E5Q A;  2WFP A;  4XTM A;  1W06 A;  1HRI 2;  1UU4 A;  2W08 A;  4NAO A;  2JIJ A;  1GMM A;  4OFG A;  4SLI A;  5KXE A;  1X9P A;  3AKT A;  4M0H A;  1HW5 A;  4XAE A;  2EF6 A;  1H6X A;  3LB9 A;  4Y33 A;  3ZFE B;  3ZVX A;  2VNV A;  5JOX A;  2ZKL A;  2HEY F;  5LK5 A;  3CKH A;  1CPN A;  4CDW A;  1WCK A;  3AM2 A;  4X6Q B;  3T09 A;  2WNU B;  4Y20 B;  1OFS A;  3KT1 A;  3ETP A;  3GBW A;  1QOO A;  3CJI B;  1AXK A;  4DS0 A;  4AEJ A;  4RS5 C;  5ABJ A;  2A7A A;  1XJA A;  4HOO A;  4NHY A;  2ZX4 A;  5IJR A;  2V73 A;  3QH6 A;  3SC7 X;  4HZF A;  4LOR A;  4JVA A;  2PMW B;  2V4A A;  2VQA A;  4OYU A;  5DDJ 3;  1SDD B;  4XF4 A;  5FBZ A;  2ZML A;  2AH2 A;  3EBR A;  4DIN B;  3QAC A;  3CQO A;  4CUC A;  3KMH A;  1WW4 A;  2XJP A;  3K4D A;  4QKD A;  1GQG A;  1QEX A;  2RJL A;  2VMI A;  1SCR A;  1GAN A;  2RS3 1;  3VKO A;  3GBG A;  5F3C A;  3WIN E;  4JQT A;  3WDX A;  2WQ4 A;  1GZT A;  3PTY A;  4HK8 A;  3VD4 A;  4N7U A;  3ZXL A;  4IEY A;  2CWM A;  1GU3 A;  1NXD 1;  1UIK A;  5FMO L;  5KR7 A;  4IE4 A;  3MW2 A;  5I0D A;  1W9Y A;  1JYC A;  5LCW L;  2GNM A;  4K7J A;  4UFJ A;  3LQC A;  5FLH A;  2HWF 1;  3FUO A;  1ZRC A;  4YZ1 A;  1POV 1;  1Q56 A;  4AHW A;  1F2N A;  3T4H B;  4CSW A;  1IGO A;  4AGG A;  4Y24 A;  4FCA A;  5EYX A;  5C3Q A;  2ZAC A;  1H4H A;  5FK7 A;  3VL9 A;  2XLA A;  1IG0 A;  2QUO A;  4AR2 A;  3O5S A;  4OI0 A;  1MQT C;  3OEB A;  4Q4W 3;  2D40 A;  1EAH 1;  1GKB A;  3JZV A;  3IDA A;  4Q8K A;  1I6X A;  3A22 A;  1QDO A;  1LKN A;  1QJU 2;  4XQD A;  2JWP A;  4LUL A;  1XC6 A;  3I3Q A;  4M3C E;  4V2V A;  4MVT A;  3DF0 A;  2PTM A;  1TME 1;  3MEP A;  1GP4 A;  3FLP A;  5KWR A;  1CWP A;  1LEN A;  1W9S A;  2XVG A;  4QPI B;  3TEX A;  2ZMK A;  4E8D A;  5AC9 2;  4DFS A;  4PT6 A;  2OZ6 A;  4CU8 A;  3RWN A;  4O61 A;  4MLO A;  3CU7 A;  1Z0H A;  2JDY A;  2O1Q A;  2ZJC A;  3S5A A;  4JC1 A;  2XKP A;  3T08 A;  3SEE A;  4N53 A;  4FPC A;  1FOD 2;  3VBR A;  1ZNP A;  2R04 1;  2ERF A;  4WVV A;  4DRR A;  4XZU G;  5FY5 A;  3WNP A;  5CU1 A;  3P5B A;  4CP9 A;  3GM8 A;  1B09 A;  1TZO A;  4H55 A;  4OUS A;  1GUI A;  3WP6 A;  2BPA 2;  1X36 A;  1ND2 B;  1REF A;  3WDT A;  1JUI A;  2BVB A;  1U5X A;  1K5M A;  1RUE 2;  3AMH A;  4HLT A;  5CZK A;  4DUX A;  3WCS A;  3POF A;  4PDW B;  2HWB 3;  1HRV 1;  1NCQ C;  4Z92 B;  1TE1 B;  2OUH A;  3KQ4 B;  1HDK A;  2Q8D A;  1CVN A;  3J7M A;  1RUC 3;  4WVW A;  4WVZ A;  2FMY A;  2PHR A;  4Q2F A;  4CZS A;  4JGZ C;  5KHJ A;  1YNA A;  4COW A;  3WNO A;  2NYY A;  3IDC B;  4UI9 L;  2Q1F A;  4MGT A;  2V4V A;  2CAV A;  2R0H A;  1AXZ A;  2LUW A;  2RVA A;  1MVQ A;  5A3P A;  2RHP A;  2Y6G A;  3SNM A;  1V6L A;  1ZZ6 A;  3LWC A;  3FWE A;  4IEZ A;  4Y5S A;  5FYT A;  1OI6 A;  1TVG A;  4J1X A;  2P6H A;  2ZPX A;  4AFB A;  4LK6 A;  3C3V A;  4H7M A;  3HBZ A;  4B29 A;  1EV1 1;  2D6N A;  3ZSE A;  2GDF A;  3N7L A;  1D4M 3;  1VPH A;  1DGW X;  2XBO 3;  2VW2 A;  4EWD A;  1RUJ 2;  4R8H A;  1UZY A;  3VKF C;  3OY8 B;  3LDB A;  3T1M A;  5FP8 A;  5IW0 A;  1J1L A;  1Z7S 3;  3VZL A;  3FMG A;  5L19 A;  1MS4 A;  1CAU B;  1UU6 A;  2R06 2;  4JAA A;  2BFU L;  4MYE A;  3V56 A;  5EPA A;  1NCR B;  3V65 A;  2VZ3 A;  3HT1 A;  3BVC A;  4IND A;  2QKD A;  3JUU A;  2F4L A;  1RUD 1;  5FWJ A;  3CJX A;  4EN9 B;  2PLV 1;  4KL1 A;  1AVB A;  2ZAB A;  1WA6 X;  3CZU A;  3MI8 A;  5LY2 A;  2A3W A;  1R1A 2;  1XNA A;  4IEW A;  4AI0 A;  2B46 X;  4MGY E;  4BQW A;  3ZYJ B;  2UUR A;  2RJ2 A;  3JBG 1;  4GH4 C;  5IUQ A;  1F4H A;  3I54 A;  2CDP A;  3H1M A;  3MF6 A;  4WM8 A;  2DYC A;  5JOY A;  1JN2 P;  4AVA A;  5C3O A;  2J1T A;  1IS4 A;  2W1U A;  1HQN A;  2UWB A;  1GV9 A;  2QQU A;  2MEV 3;  2ZX3 A;  3T2T A;  3LOI A;  1W8H A;  4LKD A;  1GWK A;  2CWS A;  3NKT A;  1UYX A;  3WDV A;  1A8M A;  1ZBA 3;  5FMB A;  1V6N A;  1BK1 A;  1ZM1 A;  4L9B A;  5IFT A;  1MAC A;  5FP7 A;  3ZOI A;  1BYH A;  2Q4S A;  5K0U A;  4QX2 A;  2VVD A;  2C24 A;  5DAB A;  1DGR A;  4TYS A;  4P9W A;  5E89 A;  5FZM A;  4YPJ A;  4L92 A;  4D7T A;  3RZH A;  4ZPI A;  1SEF A;  2VVE A;  3WG1 A;  4CVU A;  5DDJ 2;  3BN6 A;  1N1Y A;  5JI7 A;  1CAW B;  4AVB A;  3HN3 A;  1YQ2 A;  1DIW A;  2I07 B;  2D93 A;  4YM1 A;  1FXZ A;  4Y22 A;  1AYN 1;  3GGL A;  3I2K A;  4DEV A;  2WS9 1;  1ST8 A;  1RVF 2;  2VZO A;  1BQP A;  1OHF A;  1L7L A;  1DZT A;  3JCI A;  1CAV B;  4BA6 A;  5C70 A;  4LQR A;  1QF3 A;  1R64 A;  3M2M A;  4F3J A;  4BQ4 A;  2W39 A;  3K3N A;  4NIH A;  5FZG A;  1UW8 A;  1C8M 1;  1DFQ A;  3AYA A;  2AAC A;  1CZV A;  1K45 A;  3N35 A;  3ETQ A;  5DAW A;  3AVR A;  2JG9 A;  4Q27 A;  4AI2 A;  2YBS A;  1PZ9 A;  5BNO B;  5EV7 A;  5K9Y A;  2VZT A;  1QJZ A;  1GOG A;  4BXS V;  3DXT A;  1GZW B;  1NA1 C;  2D5H A;  4ONU A;  4NPL A;  1VBD 1;  1DHK B;  2WYS A;  2ET7 A;  4OQ8 A;  3WNN A;  1N1S A;  4YW4 A;  4CDQ B;  3UNP A;  4XJ8 A;  3OGG A;  1UKG A;  3BI3 A;  3O7O A;  1EYB A;  4P9J A;  1Z78 A;  1AR8 1;  1ULF A;  1UMZ A;  3GAL A;  1DG6 A;  2TBV A;  5ACA 2;  3WVJ A;  5C4W C;  2J7M A;  2X5I C;  5JCT A;  1EP0 A;  3B01 A;  1DQ6 A;  5FTT C;  4ZXE A;  4MX3 A;  5EFU A;  4DOU A;  3OBR A;  4XJ9 A;  2OYZ A;  2EIG A;  1D2S A;  2J1R A;  1LHN A;  2E53 A;  5APA A;  4FQ4 A;  5LBC A;  5A3U A;  2JD9 A;  2Q8C A;  2BP6 A;  3U0Z A;  5JSO A;  1PVX A;  1ZRR A;  2KR2 A;  3THC A;  3QBQ A;  4DXZ A;  2XUE A;  4LIT A;  3PJY A;  2WZ8 A;  4DXS A;  5FDB A;  4IV3 C;  2J42 A;  1H8T B;  2IC1 A;  1ZRD A;  3OTF A;  5JWP A;  1YI7 A;  2HWD 3;  3VBS C;  2E51 A;  1RMU 3;  4H3W A;  4NPM A;  4ZY9 A;  1R09 3;  2Y6F A;  3IMM A;  2XL9 A;  1DYP A;  3WQB A;  5F6L B;  4QX0 A;  5DUV A;  4G9S B;  4WVM B;  3KF5 A;  3HIF A;  2DVG A;  1YRZ A;  1OH3 A;  2DWR A;  4IEP A;  1LJ7 A;  3T0A A;  3H8R A;  5H9Q A;  2DUO A;  3G6J B;  4UF0 B;  2HWB 2;  1BMV 2;  2RG4 A;  3ECQ A;  4YW3 A;  3OSD A;  3ACL A;  3RMY A;  3CBN A;  4PIZ A;  1JOJ A;  1OQ1 A;  5DUX A;  2B5H A;  5FYH A;  5FY0 A;  4JGY B;  4XYX A;  4CRQ A;  3EB7 A;  3J9S A;  2WC2 A;  4XF1 A;  5DN2 A;  3HVD A;  5F8P A;  3ZYB A;  2NPI A;  2VOK A;  1UD1 A;  3P3P A;  4D3W A;  2VW1 A;  2R7E B;  1LTE A;  1ZZB A;  3AMP A;  1F15 A;  1VBB 3;  2D6M A;  4HVO A;  3GZU C;  3OUH A;  2IXH A;  4XZP A;  1XYO A;  4OMC A;  4IGQ A;  1O3S A;  3LSD A;  3ZFG C;  2AYH A;  3VBU C;  4RHV 1;  1C5I A;  3NL1 A;  4XE9 A;  1GR3 A;  2DVF A;  5I0R A;  4XEZ A;  2BU9 A;  3NST A;  1PNG A;  1Z7S 2;  2ZBJ A;  1XSQ A;  5J7M A;  1XB9 A;  1LOG A;  4NOT A;  4BJ0 A;  4YM3 A;  1NX9 A;  2WNO A;  2YPD A;  3POI A;  5CAD A;  2BQP A;  4OUE A;  4YRD A;  1STM A;  2W47 A;  3ZPO A;  4UAP A;  1H8V A;  1UMH A;  2W0X A;  5AFE A;  2V5D A;  2BOI A;  4Z1V A;  4YAR A;  4K9S A;  5FJK A;  4ASK A;  3DEC A;  1PX4 A;  3H9A A;  4NRO A;  5HPO A;  1X50 A;  4K21 A;  4P08 A;  3RMX A;  4UYB A;  4XFH A;  1MQT A;  2WFF 3;  3D3A A;  3RYR A;  3JQX A;  2CTV A;  4Q0Q A;  4S2G A;  4QXB A;  1LHO A;  4CPB D;  2PHD A;  1W6M A;  2QJV A;  4D7Y A;  3T4V A;  1GNH A;  4K6B A;  4ZON A;  2MEV 2;  4JKL A;  5I8Y A;  3WR0 A;  4BQX A;  1LU2 A;  1K3I A;  1E5H A; 
#chains in the Genus database with same CATH homology
 5C71 A;  2QQL A;  3LEG A;  3IAQ A;  3WF2 A;  4QDR A;  2YFZ A;  4DXR A;  5LA2 A;  4XVH A;  3T2P A;  1UY0 A;  4ET7 A;  1JZ8 A;  1I5P A;  2BER A;  3VDB A;  2VTF A;  4XUP A;  2J1S A;  5A1A A;  4LHS A;  3T2O A;  3HOB A;  2VC9 A;  2ZXQ A;  2W91 A;  4P00 B;  2CDO A;  2E31 A;  2PQS A;  4JKM A;  2VCA A;  3DYP A;  3THD A;  2VQT A;  3MBW A;  2VJX A;  3CDZ B;  1JU4 A;  3IB3 A;  4CUA A;  3OGV A;  3WF3 A;  1UYZ A;  2VMF A;  4M4P A;  4QB6 A;  4Z2A A;  2EIE A;  4A4A A;  1CZS A;  4XUN A;  3FHA A;  1GOF A;  3JXS A;  2WO2 A;  4GZ9 A;  3VD7 A;  2Y6L A;  3WEZ A;  3SKJ E;  1UYY A;  2JE8 A;  3ACH A;  3CZJ A;  2C9K A;  3WF4 A;  4LKS A;  1NUK A;  1OT5 A;  4A42 A;  1PMJ X;  3I2H A;  3C7E A;  2VZS A;  1GOH A;  1UX7 A;  3ACF A;  3III A;  2VMC A;  2C4X A;  1US3 A;  2OKX A;  4GWJ A;  4QB1 A;  4QAW A;  2J1U A;  2ZEX A;  1UY4 A;  1PMH X;  4PF1 A;  3ACI A;  2VO5 A;  2J1V A;  4XUR A;  2B4K A;  2VZP A;  4FI9 A;  5FUI A;  4AAX A;  3LEI A;  2XQX A;  1PX3 A;  1JZ4 A;  3HPN A;  3W5N A;  2QQM A;  1DLC A;  3T0D A;  1JZ5 A;  2L9L A;  2Y8K A;  4D8M A;  3LEK A;  1XNT A;  3I2F A;  3I2I A;  4BDV B;  2WZE A;  3A7Q A;  4DEQ A;  2WN2 A;  3VD3 A;  4CU9 A;  2ORZ A;  2WN3 A;  3C7H A;  1GMM A;  4TXW A;  2RV9 A;  2VMD A;  4MO3 M;  3OG2 A;  4XUT A;  3WF1 A;  1H6X A;  1HN1 A;  4QX3 A;  1OD3 A;  3CKH A;  1BHG A;  5DMY A;  3C7O A;  3T09 A;  2V72 A;  2EIB A;  4A3Z A;  3ETP A;  4DUV A;  3MUY 1;  4RYD A;  1OF3 A;  1NKG A;  4QB2 A;  1O59 A;  5IJR A;  3HNB M;  4P5Y A;  2VL4 A;  4OYU A;  4JHZ A;  2WAB A;  3MUZ 1;  1SDD B;  4ZZ8 A;  2QQI A;  3DYO A;  4CUB A;  3GXU A;  3A23 A;  4CUC A;  4MAD A;  3CQO A;  1GNY A;  1JZ2 A;  4QX1 A;  2WQ8 A;  3K4D A;  2XHN A;  4MGS A;  2YC2 A;  3C7F A;  2QQJ A;  4BK4 A;  4XUQ A;  2VCC A;  3VD4 A;  1DP0 A;  3NNG A;  4ARX A;  1GU3 A;  3DYM A;  1GQP A;  1SHW B;  2E32 A;  2JDA A;  5I0D A;  5JUV A;  4PQQ A;  5LCW L;  2VZQ A;  3LQC A;  2W46 A;  1CIY A;  5DPN A;  4W8J A;  3BGA A;  1W99 A;  5HXM A;  5LA0 A;  1JZ6 A;  2XON A;  1OH4 A;  3NQH A;  3OEB A;  1UXX X;  5J1X A;  3IDA A;  1JYN A;  3A22 A;  1MPX A;  3LPG A;  3P1I A;  1CX1 A;  5EJ1 B;  1XC6 A;  3VDA A;  2Y64 A;  3CMG A;  1P8J A;  2WAO A;  1W9S A;  4KWU A;  2VZ1 A;  4E8D A;  1K42 A;  4PT6 A;  4CU8 A;  1L7R A;  1W8O A;  3HJR A;  3SKV A;  2B9V A;  1JYX A;  1OF4 A;  3T08 A;  3SEE A;  1W0N A;  2ZEZ A;  4XZU G;  4KMQ A;  3WNP A;  3FL7 A;  1JU3 A;  3GM8 A;  3K4A A;  2Z4F A;  1GUI A;  2J22 A;  2VCB A;  3K77 A;  5G05 L;  4DUX A;  5CZK A;  3LE0 A;  2Y6K A;  2YG0 A;  1JI6 A;  3K46 A;  3ABZ A;  4DXT A;  2J1A A;  1NAE A;  4CU6 A;  3K4Z A;  1W9W A;  3NJV A;  1ULO A;  2VZV A;  2YC4 A;  3WNO A;  4UI9 L;  2V4V A;  4LPL A;  4P02 B;  2RVA A;  3SEP A;  2Y6G A;  3OGS A;  1J84 A;  3U37 A;  4A6O A;  2X10 A;  1TVG A;  1K12 A;  3A21 A;  4QPW A;  3WNK A;  4A41 A;  3C7G A;  4CU7 A;  2HLE A;  4D0Q A;  5EJZ B;  1UY1 A;  2VZU A;  2W1W A;  2EID A;  3VD9 A;  2VZ3 A;  1XPW A;  5LA1 A;  2WDB A;  2WBK A;  4XUO A;  5EIY B;  3CZU A;  3ACG A;  2QQK A;  2JKX A;  3FHQ A;  1XNA A;  3FN9 A;  2C26 A;  2BGO A;  2RJ2 A;  1CZT A;  1O8P A;  1DYO A;  1UZ0 A;  1F4H A;  3NJX A;  2CDP A;  4W50 A;  2DCJ A;  4JX0 A;  2J1T A;  1D7P M;  2W1U A;  1UYX A;  3C8X A;  4A45 A;  5IFT A;  2W9X A;  4AG4 A;  3MV1 1;  3WNM A;  5JXJ A;  5CYY A;  3WNL A;  4QX2 A;  4YPJ A;  3IAP A;  3VD5 A;  2WO1 A;  5IYY A;  2BGP A;  2VM9 A;  3K75 B;  4CVU A;  3BN6 A;  2ID4 A;  2BZD A;  3HN3 A;  4DUW A;  1YQ2 A;  1L7Q A;  4TTG A;  1EUT A;  1IQD C;  2ZEY A;  2KD7 A;  3P6B A;  2W95 A;  3OEA A;  2W1Q A;  3GGL A;  1W9T A;  3I2K A;  4HG6 B;  4DEV A;  2EIC A;  3MO4 A;  2W94 A;  2VZO A;  2Y6H A;  2WAA A;  4ZZ5 A;  2X09 A;  3J7H A;  1UXZ A;  3HNM A;  4M4R A;  5C70 A;  4LQR A;  1R64 A;  2W1S A;  5F7U A;  4A44 A;  3WF0 A;  2VME A;  1WKY A;  3PUI A;  1CZV A;  1K45 A;  3UET A;  1EUU A;  2DCK A;  2VZT A;  2WO3 A;  5B4N A;  1GOG A;  5IFP A;  4BXS V;  5G04 L;  5IHR A;  5JXI A;  2E33 A;  2WYS A;  3HEI A;  3WNN A;  2LS6 A;  3UNP A;  2LW8 A;  1UWW A;  3I3B A;  2WUH A;  4MOA A;  2J7M A;  4IUG A;  4OMD A;  4ZXE A;  1US2 A;  5JR2 A;  3VDC A;  3MV0 1;  2J1R A;  4GWI A;  3WSO A;  2JD9 A;  4BK5 A;  2QBX A;  1JYV A;  4QDQ A;  3I2J A;  3T0B A;  4L0P A;  4MGQ A;  3THC A;  4E8C A;  5DQ0 A;  2WZ8 A;  4DXS A;  1WCQ A;  2DDU A;  1TG7 A;  3CIH A;  2VOT A;  3OB8 A;  4ZY9 A;  4JKK A;  2W87 A;  1T2X A;  5C7G A;  3WQB A;  1SG3 A;  4QX0 A;  1F4A A;  2YB7 A;  2Y6J A;  4W4Z A;  4QDS A;  1ULP A;  4RN5 A;  3OGR A;  2XOM A;  3ECQ A;  3GDB A;  1H6Y A;  2VR4 A;  2W92 A;  3EB7 A;  1UY2 A;  1W8N A;  3ZM8 A;  5DN2 A;  2HYX A;  3OBA A;  2E26 A;  2W3J A;  3I2G A;  5JMO A;  2R7E B;  1KGY A;  3F2Z A;  3T2Q A;  2BBA A;  4OMC A;  3EYP A;  5B4X A;  3UES A;  2QQN A;  3W5M A;  1O8S A;  1KEX A;  4KI5 M;  2VQU A;  4UOJ A;  4BJ0 A;  2VZR A;  2W5F A;  2ZEW A;  1JZ3 A;  1JHJ A;  1LNS A;  1NX9 A;  4OUE A;  1UMI A;  2W47 A;  2X05 A;  4UAP A;  1UMH A;  4OZO A;  2V5D A;  1J83 A;  1UY3 A;  5HPO A;  3DEC A;  1PX4 A;  2J1E A;  3HNY M;  3NRU A;  3PUH A;  3AC0 A;  4P08 A;  3E1F 1;  3D3A A;  1JYW A;  5JXG A;  3I97 A;  1RYY A;  2ORX A;  3I3E A;  2YFU A;  5JXH A;  2QQO A;  4ARY A;  3I3D A;  4JKL A;  3T0A A;  1JZ7 A;  1K3I A;  3LPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...