4UIGA

Structure of the copper sensitive operon repressor from streptomyces lividans at ph6
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
91
structure length
91
Chain Sequence
HGYHKQKAEHLKRLRRIEGQIRGLQRMVDEDVYCIDILTQVSASTKALQSFALQLLEEHLRHCVADAALKGGTEIDAKVEEATKAIGRLLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COPPER SENSITIVE OPERON REPRESSOR
publication title Structural Insights Into Conformational Switching in the Copper Metalloregulator Csor from Streptomyces Lividans
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Transcription
total genus 41
structure length 91
sequence length 91
ec nomenclature
pdb deposition date 2015-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4uigA00
5FMNA 2HH7A 4UIGA 3AAIA 4ADZA 5LBMA 5LCYA 4M1PA
chains in the Genus database with same CATH superfamily
4AQGA 4BAYB 1N32T 3I0OA 2VVNA 2X9YA 1X9BA 3AA1B 3S4UA 2RA1A 1E2AA 3CKDA 4Q25A 2W66A 3FZHB 1MIWA 4PJJA 3PE0A 5L4EA 2YN6A 4ILAA 4NUVA 5JR9C 3AE4A 4CN4A 1GQEA 2QGSA 3K3OA 4X62T 1H7CA 3AA7B 2WDRA 3QOFA 3PV0F 3HKCE 3TLVA 4ZS2A 3EUHA 2NW9A 3ABVA 5AQKB 5HEUA 1VCSA 2YU1A 5JRCA 4CI2B 2H89A 1UUSA 3CX6B 2LJLA 3C51A 5HEHA 3DTOA 5KMGP 2WDVA 3N2GE 3UU8A 4B6XA 1G73A 2VASA 4QH4A 4U7IA 3P4PA 3AE6A 3N9MA 4B3ST 2XASB 3PU8A 2XM2A 2VKJA 1LVFA 2XHEB 3HA4A 4LFAT 2WWUA 2CM0A 3QC9A 3ESLA 5BR8T 2ACZA 4CN1A 3PUVF 3X1DA 1HR0T 3IEEA 4JI7T 3CWZB 4ANJA 2A3DA 4IDPA 3N2OA 5FXVA 3C98B 3LK2B 1VRBA 2WCAA 4OYJA 1FJGT 3VKGA 2CE7A 5F8PA 2C5JA 3G06A 2JQ9A 5LB7B 2OA5A 3N2KE 4DBRA 2Y48B 2NTXA 4AQFA 3B57A 3KVBA 3BQIA 2VKDA 3NRXA 2KWHA 4HFCA 4NXNT 4KI0F 3Q9DA 2OLTA 3AE7A 5DQVA 5IHYA 5LHHB 1UGOA 3ZC0A 3TLSA 2BS3A 2BKOA 4DUZT 4PK4A 4P09A 3RIUA 2CXLA 4LMKA 2SPCA 4O8SA 2BBJA 5JQGE 3RX6A 2VKOA 4JV5T 4AKLA 2YU2A 3K3NA 4I4TE 4C91A 2UXDT 2IDOB 2XQ8A 3RIAA 1SE7A 3NRYA 5EZYE 1IAPA 5HCMA 3FZMB 4AKHA 1ZP0A 3AB3B 4PFOA 5LJNA 4JUYA 2KSRA 4UXNB 5CA0E 4KMCA 5BMVE 2RPAA 3C64A 3VU7H 4AQFC 1J5ET 1WYCA 3MZKB 4HFVA 3C4WA 5JTGA 2H7OA 3CQXC 3AXJB 4DMVA 5KXJA 5LYJE 4U2ZA 4LMJA 4B3RT 3OJAA 4GKKT 2MPKA 3C50A 2W63A 1YW0A 2LM9A 2IW5B 5LG4A 2WWVA 3P4SA 2WY2A 4UVCB 5J1GA 4JYAT 3ZYMA 3ZYKA 2QA7A 3PUGA 3H3AA 4AI6A 3F31A 1LVKA 2NW7A 2V6XA 5HXSA 2Q9QD 3RC3A 1N34T 2DHRA 4UIGA 2V7IA 4HWHA 5FL0A 5HEOA 2PTFA 4QXHB 2RP4A 4CI1B 3AA6B 5LA6E 5CGMA 2L3LA 3CQGB 5EK3A 3ZSTA 4TNVA 1YD8G 2ODVA 2D2SA 4E7SA 2VL8A 4O4LE 2LRKA 3J7Yq 2VQFT 1BR4A 2LSYA 1M7KA 2M67A 1BR0A 3ZC1A 3UU3A 3CX7B 3LBXB 5DJQC 4HWDA 4MHCA 4TWFA 3UUBA 4DV5T 4LF7T 5FY0A 3UUMA 5KDMC 2MOZA 2W2UA 1KEYA 4A97A 4JI0T 3AE9A 2XQ7A 2Q9QB 2K24A 3L09A 2E9XA 3WI3A 3AE5A 4B3TT 3VRAA 3ZJ1A 3GWHA 4X1KE 3O1JA 4C90A 4PK5A 4UELA 4G2AA 1IZNB 1KNRA 5LOVE 3L8RA 3RYFE 3KINB 3JC6D 1O3XA 2CHNA 3VKHA 2HPLA 4ILBA 2LSKA 4O4HE 5ABFB 4JI2T 5CA1E 2ZLYA 5ADXL 3FXDB 2XQ9A 3PUZF 5AFUL 4YY3T 5HYAA 5LBMA 3QK6A 4MFRA 4U72A 2DI4A 5FXWA 4HFDA 3ZN0B 3PURA 5HXHA 3I1AA 3ZMSB 4O4IE 3T8OA 1OEDC 4DR6T 2X9HA 5E0OA 3JAFA 3QB5A 4DV6T 3Q5EA 3HKEE 2I59A 1J5WA 3EABA 2X51A 3K3QC 3NZQA 4JI5T 3B13A 3TLWA 1Z8UA 2UXXB 2WMNA 4PFPA 1QLBA 2J4GA 2JQQA 4YSXA 4HFIA 2A2FX 3TLUA 1HS7A 4JBWF 2QRXA 1T7SA 5HXCA 1FEWA 4H9RC 3AE3A 4G63A 4JEHB 3P8CD 2XZEA 3P4RA 3OKQA 1XDOA 3AA0B 3M65A 2KXPB 2XQ3A 3E0ZA 4ZI2D 1W09A 4BA9A 2EHOB 3UFGA 3KVAA 2XAGB 2B1EA 3N9QA 3A8YC 3LDQB 2BVMA 4YXDA 5FKYA 4YSZA 2E8IA 3ZT6A 3PUSA 3ANWB 4LF9T 1SA0E 4ILCA 2CLYC 3KBUA 4U33A 2X0HA 3FHNA 2CWOA 4PJNA 5LGNB 4BJNA 4Z8XA 2UUCT 2D0UA 4AXPA 2V8SV 4OK0A 4EIWA 3QNUA 1J1JA 3TKLB 5JDHA 5ABEA 3UFEA 3GMIA 3D0TA 4PW8A 3T1YT 2XQ5A 1HX1B 2CPTA 1HX8A 4EZ4A 5FY1A 3RH3A 2XAHB 4NIQA 3RF1A 4HFBA 4EGWA 2NWBA 4O4JE 4ZS3A 5H6RB 3RQWA 5FMNA 1UURA 2BZBA 1BR2A 4WW0A 1HG5A 1MIYA 4TV8E 4IE5A 2A9UA 3AAEB 1IBKT 3ZCJA 3RKOA 2MYSA 3O1IA 1D0ZA 4U7YA 4DR5T 4O2BE 1IJ6A 3AEDA 4HEAA 4X1IE 4TX5A 3ZT7A 3O4XE 2BG9C 2WP9A 4U31A 3QB5K 2VQET 2WZIA 2CXDA 4I55E 1YQ3A 4GYRA 5AQUB 5FY7A 1MNEA 4X66T 4X64T 4PJMA 4HWIB 3NVOA 5L4HA 4HKAA 4AISA 1ZOYA 5AQNB 2YINA 2KINB 1NAFA 3N9PA 5CFBA 2LLYA 5LHGB 2WBLA 2XAFB 5IYZE 2VL0A 5HWXA 2V1DB 2W0GA 3EDVA 3T1HT 4DBQA 2WU5A 5F3JA 1UX5A 3P7IA 3AEGA 2XAJB 2C5KT 3KBTA 5J0ZA 3AVSA 4DR3T 2W62A 3LBXA 3ZKRA 3R84B 4TZ4C 5LBQB 1XNQT 3CQCB 2V7LA 2XTLA 3PUAA 1MMDA 2IMLA 5HXRA 3U78A 4LF6T 4DV2T 3UTKA 2F4VT 3EVYA 4DR2T 2CEAA 2DNXA 2CRBA 2Q9QA 1ZHCA 1WLXA 3BK9A 4V1Av 3KV6A 2ZM0A 2LOSA 1WYBA 3EDUA 3KV4A 5JDMA 4A5XA 4ZOLE 3DJBA 4EAHA 5JR9B 4YTNA 2FJEA 4P0BA 3OBVE 1WRDA 4H9NC 2ZM8A 3IBPA 2JRKA 5FVKA 3PUQA 4EEDA 2V5DA 4CI3B 1D0XA 3KV5A 2AXDS 2UU9T 2YOEA 4YLHA 2L9QA 3K8PC 4DV0T 4CN6A 1FIOA 2Z6EA 3KFWX 5HAXA 2UXNB 1KF6A 3RHWA 1VCTA 3N9OA 4QX8B 3ZJ2A 1W0BA 1SHZC 1HG2A 1HCIA 2X9XA 4IE0A 3F57A 2I6HA 2WDQA 4L5GA 5AQFB 4I0UA 3Q5WA 2CA5A 4IL9A 3RIUC 3Q2MA 4Z91A 1UK5A 4ZXLA 4COFA 2XJ7A 4DUYT 2V6YB 5JVDE 1R8IA 5AQOB 3RRCA 3RYHE 1L0VA 1DU2A 1FMWA 2LRLA 2V26A 1XNRT 2MBGA 5LXTE 1JNZA 3SFDA 4IDNA 4X20E 1ZEEA 4K0KT 2NW8A 2HN2A 4ADZA 4UV9B 2HN1A 1N33T 3AE8A 3HKBE 1FMVA 2WSSV 4YJ3E 5J2TE 1W0AA 2LHNA 3C4ZA 2X0LB 3LG7A 2LKHA 4P1NA 3OYZA 2UXCT 4EV6A 3RLFF 4ZI3C 2DWGA 2EHOA 3JADA 1T72A 2YDQA 3ZLIA 1D1CA 4EEBA 4DR4T 3PTRB 3P4QA 2X0YA 5EK4A 3NBXX 3IA3A 2VWAA 3H37A 2IUBA 3IHRA 2XAQB 3ZT5A 3Q5XA 2XQAA 4DR7T 4F8HA 1D1AA 2OV9A 2LT3A 3E22E 1JNRA 2DWKA 3FXEB 5CB4E 5M4YA 4OFZA 4H63V 3F2EA 1US7B 4UV8B 3LJCA 4JI3T 5HEGA 4HGAA 3JAEA 3SRZA 1VOMA 4IT4A 5AQRB 5AQQB 4JEUB 4WBNE 5LGUB 1I6ZA 3FBLA 2LSGA 2WU2A 2LM2A 3FBZA 3P50A 2HH7A 4EYUA 5AQMB 2E5VA 5LG3A 3UU5A 3CK6A 3AE2A 2YKSA 4ZZBA 4F6RC 3R6NA 3ONJA 4YHHT 3RKGA 2XUEA 2FUPA 2D0TA 3EI0A 4JI4T 3QUJA 4AKRB 1HFAA 4QH5A 5JDNA 2N2NA 1Z0PA 5AQPB 2YDSA 2E9XC 5H6QB 4U74A 2ZM6T 1CHUA 3HI2A 5L3FB 2JIWA 3AAIA 3WAKA 2W67A 3AEEA 2JPFA 5DQWA 2C5IT 1KNZA 3ZMTB 3ZCIA 3TLTA 2E5LT 2MTQA 2H3RA 5A1LA 4K0UA 4DO0A 3N9NA 2PFVA 4MLKA 3NWIA 1HNWT 2C0SA 2V7KA 2M6IA 4IE7A 1HNZT 2IC9A 5ETWA 4EOZB 4JI6T 2KNDA 2WB5A 4HTEA 3PDYA 4CZZB 3NZPA 3LK42 3BQKA 2PBIA 2CWYA 2XM1A 4IDQA 5KX5E 1IBMT 2ZMAA 4IL4A 4NXMT 4UF0B 4A98A 3FZKB 2R6GF 1XWMA 2FJBA 2E2AA 4H9QC 4GIWA 2JQHA 5AQJB 2NOXA 4HFHA 4IDOA 4ISSA 3KV9A 1IBLT 4JI8T 4FI5A 3N9LA 3WAJA 5IWAT 4YTMA 4WZXA 4UR9A 3VR8A 1V9DA 5JDQA 4WYVA 2XSAA 4PAGA 2CHOA 5LP6E 5HXEA 5LGTB 5JR9A 2ACXA 1LKXA 4GYSA 2JMKA 1OEDB 1BR1A 2UUBT 2X9WA 4AKGA 2WS3A 2QYWA 4H63H 4KUMB 5AQHB 2KZ7B 4ILUA 4DR1T 4YHJA 2KLQA 4H9OC 1Y64B 4HE8A 3I9WA 3SFEA 2P9BA 3JCFA 4O2AE 4PK6A 5C2TA 5L3EB 4WNKA 2CMRA 4KBMB 1QUUA 4YFSA 3GN5B 4YSYA 1HF8A 4XBFB 3AXJA 3AEFA 5FXZA 2K5BB 4AIUA 1XDPA 3I9YA 3V5SA 2CCQA 3SS1A 3J9X1 4UVAB 1NWMX 1SUMB 5HCJA 3DP7A 4ASKA 5JDGA 1X79A 4TNWA 1D1BA 4DIDB 3MACA 5JDLA 2V6YA 2V5CA 2CBJA 4EXTA 4GKJT 2VB6A 4IDZA 1MNDA 1D0YA 5JH7E 3VR9A 3CPZA 4PJLA 3HL6A 2XQ6A 2FBWA 3OTOT 3OVUA 1KFYA 2QVAA 4YT0A 1KK7A 2CLYB 3LFMA 3ZN1B 4L0RA 3ZMVB 2WQYA 1WR6A 5FNVE 2BBHA 3ETUA 4TV9E 3UU6A 4EZHA 4M1PA 5EK2A 5FXXA 2KMFA 2LSIA 1M62A 4DV3T 3A7MA 5C3JA 2BS4A 2MAWA 4I50E 1NEKA 4IHJE 3FZFB 3Q5DA 3MK7C 3OYXA 4IREA 4CXXA 4UEMA 2VK9A 4ZZCA 4NPPA 5HWYA 2DLRA 4ZI7E 1U5PA 1KNPA 2XSBA 4TWDA 5FVLA 5GONE 5C8YE 2VVSA 2X68A 2UUAT 1QSDA 2K9AA 3CMLA 2J1DG 3LSVA 2D9DA 2UXBT 3RGLA 1XMOT 2BS2A 3AEBA 1ZV4X 4IGUA 2A72A 2J62A 2FJDA 1T98A 4ZEYA 3MKDA 3UT5E 4BJMA 1WFDA 2LHRA 3B5MA 3NKZA 1CUNA 4P0AA 4JI1T 5DABA 4HWFA 4U3CA 4B3MT 1HTJF 3V5UA 2XQYA 5LMNT 4LF8T 3RI5A 1Y01A 4OYKA 2WAUA 4DNDA 3CIRA 1MMNA 3UUNA 5L2LA 2X67A 2CXFA 2BDEA 3RYCE 2LEHA 1XMQT 4OHFA 4PNIA 4YJ2E 1UCUA 3AAAB 2BG9B 4U2YA 5ABFA 2BKPA 3CVRA 2WM9A 3HR0A 4HFEA 2ODUA 4QX7B 3L3PA 1OEDE 4KHZF 3GA8A 3UQ7A 2Q9QC 4X5TA 4A56A 3PUWF 2N1GA 3LK3B 2LOPA 2AE9A 2GK9A 4NUUA 3OPCA 3MA9A 3VHLA 4L9IA 2VKHA 3FZLB 4QXBB 4LFCT 4MBQA 3UQ4A 5LJMA 4DVDA 1HNXT 1OWAA 2XY8B 2LE8A 3KDSE 4LF5T 5JRCB 3O9XA 1E1HB 1LRZA 2WZHA 3VRBA 3UU4A 3AVRA 4J2CA 1AJ3A 2IAKA 4X1YE 4OX9T 4ISTA 4WBOA 1IJ5A 4QHOA 4UVBB 1I94T 4TN7B 1S35A 2BVLA 2LKGA 2IC6A 4UF0A 5J2UE 2ES0A 4LMLA 2Y6XA 4HWCA 3PU3A 4QWNB 4XZCA 4IE4A 3ANWA 2X66A 2W00A 4H9PC 5FP3A 3PUXF 2JJ9A 4IIJE 1U4QA 2DCFA 4YTPA 4FJOA 3ZMZB 3JC6C 2W4XA 3H3MA 3RPUA 5L3BB 2FJAA 1N36T 4XAXB 2K48A 2YEVC 2PJQA 1OEDA 4TWHA 2ZM2A 4ZI3D 3ETVA 4DV4T 4ERRA 4IE6A 2W61A 3M3ZB 5CJ5A 1T8BA 4N78D 4TUYE 3UULA 2EHOC 3ZSSA 1YXRA 5TAOA 4DV1T 3ZEFB 2JQKA 3AECA 3GN5A 1ZKEA 5L3CB 5L47A 2Y8DA 4H9SE 3UUXB 4EB6E 2LSJA 1NENA 4GOUA 4KX6A 3L39A 5AQLB 3MJXA 3RYIE 2H88A 3PUYF 3BQLA 2VURA 5AQIB 3ZPOA 3SWHA 1EZ3A 3P4WA 1S94A 5IUXA 4X65T 3K1SA 4LF4T 2NR4A 3U3IA 4ZI2C 2BG9E 2EHOD 3AEAA 3RIFA 3RC8A 5HEJA 1MMGA 1W9RA 3ONXA 2NP9A 2XPKA 4E7ZA 5ABGA 3IF8B 2K3WA 4CQIA 5FL1A 5LNKA 2N9DA 2WMOA 3SOLA 4Z90A 2NTYA 3ZMUB 1OXZA 2D5UA 3N5LA 5LCYA 1YQ4A 5L3GB 1G8XA 3ONLC 4QH1A 2BKNA 1XZYA 2E9XD 4AQYT 2J47A 4QXCB 3CX8B 5AQGB 3PJAA 4MALA 2IHR1 4GK5E 4DV7T 5AQTB 1YKHB 3EAMA 5ABHA 4KHPT 4AKIA 3RQUA 4JLEA 4ZHQE 3ZYLA 3MXZA 2M6BA 5FYMA 3W15B 4CXYA 3A5XA 2YDRA 4QKNA 1MIVA 2JMHA 3EHZA 4EYYR 4DMWA 2YK0A 3PJAJ 5F5WA 2IIUA 5JDFA 2HHHT 5AQVB 2KT9A 4GK0E 2H7VC 2CBIA 1E7PA 4LFBT 2V7MA 2V7JA 1WR0A 1WCRA 1MMAA 3E08A 2DL1A 2E9XB 4I43B 3FB2A 3AE1A 2G0UA 1YKEB 2HPJA 3C4XA 2L8KA 3O1HA 3HKDE 2KWIB 1UX4A 5L3DB 4CXWA 2XQ4A 3I0QA 5AQSB 2I0MA 5JREA 4HN9A 4KP3C 2PG8A 5LHIB 2BG9A 5LMUT 2B76A 3RRWA 1B7TA
chains in the Genus database with same CATH topology
3OYZA 4AQGA 2X51A 3K3QC 4BAYB 3I0OA 2LHRA 3NZQA 4ZI3C 2DWGA 2EHOA 1CUNA 2X9YA 4P0AA 3AA1B 3B13A 5DABA 3S4UA 3ZLIA 1D1CA 1HTJF 2RA1A 3V5UA 2XQYA 2UXXB 2WMNA 3PTRB 4PFPA 3CKDA 4OYKA 2JQQA 2WAUA 4DNDA 2A2FX 1HS7A 1MIWA 5EK4A 1MMNA 3UUNA 5HXCA 4PJJA 5L2LA 1FEWA 3PE0A 3NBXX 2X67A 4H9RC 2CXFA 2BDEA 2VWAA 4NUVA 3RYCE 5JR9C 4G63A 3H37A 2LEHA 3IHRA 2XAQB 4JEHB 3P8CD 3Q5XA 2QGSA 4OHFA 3OKQA 4PNIA 4YJ2E 3K3OA 3AA0B 1UCUA 1D1AA 3AAAB 1H7CA 3M65A 2KXPB 3E0ZA 3AA7B 2LT3A 3HKCE 4ZI2D 4ZS2A 3CVRA 2WM9A 3HR0A 3E22E 3EUHA 2DWKA 3FXEB 5CB4E 2NW9A 5M4YA 2ODUA 4OFZA 4H63V 3F2EA 4QX7B 4BA9A 3L3PA 1US7B 5JRCA 2YU1A 2EHOB 4UV8B 4CI2B 3LJCA 3CX6B 4HGAA 2LJLA 3C51A 3GA8A 3KVAA 3DTOA 2XAGB 2B1EA 3N9QA 3SRZA 2Q9QC 1VOMA 4A56A 5KMGP 3N2GE 4JEUB 2BVMA 4WBNE 5LGUB 4B6XA 1G73A 2N1GA 3FBLA 2VASA 2LSGA 2E8IA 3PUSA 3N9MA 3FBZA 3ANWB 3LK3B 2XASB 2LOPA 2HH7A 3PU8A 2GK9A 1SA0E 4EYUA 4NUUA 2VKJA 1LVFA 2XHEB 3HA4A 2CLYC 3MA9A 2WWUA 3KBUA 2CM0A 3VHLA 4L9IA 3QC9A 3ESLA 3FHNA 2CWOA 2VKHA 3IEEA 4PJNA 5LGNB 4BJNA 3CWZB 3R6NA 4F6RC 4Z8XA 4QXBB 4ANJA 2D0UA 4MBQA 4AXPA 2A3DA 5LJMA 2XUEA 2D0TA 3N2OA 4DVDA 5FXVA 4OK0A 1OWAA 2LE8A 3KDSE 4EIWA 5JRCB 3C98B 3LK2B 1VRBA 3QUJA 3O9XA 4OYJA 3VKGA 2CE7A 1E1HB 5F8PA 4AKRB 2C5JA 1HFAA 1LRZA 5JDNA 2N2NA 2OA5A 3TKLB 1Z0PA 3N2KE 4DBRA 5JDHA 2Y48B 2NTXA 2E9XC 3B57A 5H6QB 4U74A 3UFEA 3GMIA 3KVBA 4AQFA 3AVRA 4J2CA 3BQIA 2VKDA 1AJ3A 3D0TA 4PW8A 2IAKA 4X1YE 3NRXA 2KWHA 4ISTA 3HI2A 3Q9DA 4WBOA 1IJ5A 4QHOA 4BJMA 5L3FB 4UVBB 3AAIA 3WAKA 5DQVA 5IHYA 2JPFA 5DQWA 5LHHB 4TN7B 2C5IT 1S35A 2BVLA 3ZC0A 1KNZA 2IC6A 3ZMTB 1HX8A 4UF0A 4EZ4A 5FY1A 3RH3A 5J2UE 2XAHB 3ZCIA 2ES0A 4PK4A 2Y6XA 4P09A 3PU3A 4QWNB 4XZCA 2MTQA 2NWBA 2H3RA 4O4JE 2CXLA 5A1LA 4IE4A 4ZS3A 3ANWA 5H6RB 2X66A 4K0UA 2W00A 4H9PC 5FMNA 5FP3A 2SPCA 4DO0A 2BZBA 4O8SA 5JQGE 2JJ9A 1BR2A 4WW0A 2VKOA 3RX6A 4IIJE 3N9NA 2PFVA 1U4QA 2DCFA 4AKLA 2YU2A 1HG5A 3K3NA 4FJOA 1MIYA 3JC6C 3ZMZB 4I4TE 4TV8E 4C91A 4MLKA 4IE5A 3AAEB 2C0SA 3NRYA 5EZYE 1IAPA 2V7KA 3ZCJA 3RKOA 2MYSA 3O1IA 3RPUA 4IE7A 5L3BB 4AKHA 3AB3B 4PFOA 2IC9A 1D0ZA 5LJNA 4XAXB 5ETWA 4JUYA 2K48A 4EOZB 2YEVC 2KNDA 4HTEA 4O2BE 2PJQA 1IJ6A 3PDYA 4UXNB 3NZPA 4HEAA 4KMCA 4CZZB 3LK42 3BQKA 4X1IE 5CA0E 4TX5A 2PBIA 2ZM2A 2CWYA 5BMVE 3O4XE 3C64A 5KX5E 4ZI3D 2ZMAA 3VU7H 4AQFC 3ETVA 4UF0B 4ERRA 4IE6A 2W61A 1WYCA 3MZKB 4HFVA 3C4WA 4H9QC 4GIWA 2H7OA 4N78D 2CXDA 2NOXA 4TUYE 3CQXC 4I55E 4ISSA 4GYRA 3UULA 3KV9A 2EHOC 5FY7A 1MNEA 4FI5A 4DMVA 3N9LA 5TAOA 4PJMA 5LYJE 3WAJA 4HKAA 3ZEFB 3OJAA 2YINA 2KINB 1NAFA 3LG7A 3GN5A 1ZKEA 3C50A 3N9PA 2W63A 1V9DA 1YW0A 5L3CB 2Y8DA 2LM9A 5LHGB 4H9SE 2IW5B 2WBLA 3UUXB 4EB6E 2LSJA 2XAFB 5JDQA 5LG4A 5IYZE 4GOUA 5HWXA 4PAGA 5LP6E 2V1DB 2W0GA 3EDVA 5HXEA 4DBQA 5LGTB 5F3JA 5JR9A 1UX5A 2ACXA 4UVCB 1LKXA 3P7IA 3MJXA 4GYSA 2XAJB 5J1GA 2JMKA 3RYIE 2C5KT 3ZYMA 3ZYKA 1BR1A 3KBTA 2X9WA 4AKGA 3AVSA 4H63H 4KUMB 3BQLA 2W62A 2QA7A 3LBXA 3PUGA 2KZ7B 4ILUA 3H3AA 3R84B 4AI6A 4TZ4C 3F31A 4YHJA 1LVKA 2NW7A 5LBQB 2KLQA 4H9OC 3ZPOA 5HXSA 3CQCB 2V7LA 2Q9QD 2XTLA 3SWHA 1EZ3A 1Y64B 1S94A 3PUAA 3RC3A 1MMDA 5HXRA 3U78A 4HE8A 3I9WA 2DHRA 4UIGA 2P9BA 3UTKA 3EVYA 4O2AE 4PK6A 2V7IA 3U3IA 2CEAA 2DNXA 4ZI2C 4QXHB 2EHOD 5L3EB 2RP4A 3AA6B 5LA6E 4WNKA 2CMRA 2Q9QA 1QUUA 1ZHCA 4KBMB 4YFSA 4CI1B 3RC8A 1WLXA 1MMGA 2L3LA 3CQGB 3GN5B 5EK3A 3ONXA 1YD8G 2ODVA 2NP9A 3BK9A 2D2SA 4V1Av 4E7SA 2VL8A 4O4LE 4E7ZA 1HF8A 3KV6A 3IF8B 2ZM0A 2LOSA 1WYBA 3EDUA 3KV4A 4XBFB 5JDMA 4CQIA 5LNKA 4ZOLE 3DJBA 2N9DA 2WMOA 4EAHA 3J7Yq 5JR9B 1BR4A 5FXZA 2K5BB 2LSYA 3I9YA 4P0BA 3OBVE 1WRDA 4H9NC 3SOLA 2M67A 1BR0A 3V5SA 3ZC1A 2CCQA 2NTYA 3CX7B 3ZMUB 3LBXB 1OXZA 2D5UA 2ZM8A 3IBPA 5DJQC 3N5LA 5LCYA 3SS1A 3J9X1 4UVAB 2JRKA 5L3GB 1G8XA 1NWMX 4MHCA 3DP7A 4ASKA 2E9XD 1X79A 5JDGA 1D1BA 3PUQA 5FY0A 3UUMA 4CI3B 5KDMC 2MOZA 3MACA 5JDLA 1D0XA 3KV5A 4QXCB 3CX8B 4EXTA 4YLHA 2L9QA 2VB6A 2Q9QB 3K8PC 4IDZA 1MNDA 4MALA 2K24A 3L09A 2E9XA 4GK5E 1FIOA 2Z6EA 1D0YA 3KFWX 3WI3A 5HAXA 1YKHB 2UXNB 5JH7E 3CPZA 4AKIA 4PJLA 3N9OA 4QX8B 3HL6A 4JLEA 3ZJ1A 3GWHA 4X1KE 3O1JA 4C90A 3ZJ2A 4ZHQE 3ZYLA 1SHZC 3MXZA 4PK5A 5FYMA 1HG2A 4UELA 3W15B 1HCIA 2X9XA 4CXYA 1KK7A 4G2AA 1IZNB 3A5XA 4IE0A 2CLYB 4QKNA 3LFMA 3F57A 5LOVE 1MIVA 3ZN1B 4L5GA 4L0RA 2JMHA 3ZMVB 3RYFE 1WR6A 4EYYR 3KINB 5FNVE 4DMWA 3ETUA 2YK0A 3Q5WA 4TV9E 2CA5A 4EZHA 4M1PA 5EK2A 3Q2MA 5FXXA 2KMFA 2LSIA 3JC6D 1O3XA 5JDFA 2KT9A 3VKHA 4GK0E 4I50E 2H7VC 2HPLA 4IHJE 5JVDE 2V7MA 2V7JA 3MK7C 3OYXA 2LSKA 3RYHE 4O4HE 3RRCA 1MMAA 4CXXA 5CA1E 4UEMA 2VK9A 3E08A 2E9XB 1FMWA 2ZLYA 4I43B 3FB2A 5HWYA 2V26A 5ADXL 2DLRA 2G0UA 3FXDB 2MBGA 5LXTE 4ZI7E 1YKEB 2HPJA 3C4XA 5AFUL 5HYAA 1U5PA 2L8KA 3O1HA 3HKDE 5LBMA 2KWIB 3QK6A 4MFRA 1UX4A 4U72A 2DI4A 5GONE 5C8YE 4X20E 5FXWA 3ZN0B 5L3DB 3PURA 3ZMSB 3I1AA 2X68A 1ZEEA 5HXHA 4CXWA 1QSDA 2K9AA 2NW8A 2J1DG 3CMLA 3I0QA 4O4IE 3T8OA 4ADZA 2X9HA 5JREA 4UV9B 4HN9A 1ZV4X 2PG8A 4IGUA 4KP3C 5E0OA 2A72A 5LHIB 3HKBE 1FMVA 2WSSV 4YJ3E 5J2TE 1T98A 3HKEE 2LHNA 2I59A 3C4ZA 3MKDA 3UT5E 2X0LB 3RRWA 1B7TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FMN A;  2HH7 A;  4UIG A;  3AAI A;  4ADZ A;  5LBM A;  5LCY A;  4M1P A; 
#chains in the Genus database with same CATH topology
 4AQG A;  4BAY B;  1N32 T;  3I0O A;  2VVN A;  2X9Y A;  1X9B A;  3AA1 B;  3S4U A;  2RA1 A;  1E2A A;  3CKD A;  4Q25 A;  2W66 A;  3FZH B;  1MIW A;  4PJJ A;  3PE0 A;  5L4E A;  2YN6 A;  4ILA A;  4NUV A;  5JR9 C;  3AE4 A;  4CN4 A;  1GQE A;  2QGS A;  3K3O A;  4X62 T;  1H7C A;  3AA7 B;  2WDR A;  3QOF A;  3PV0 F;  3HKC E;  3TLV A;  4ZS2 A;  3EUH A;  2NW9 A;  3ABV A;  5AQK B;  5HEU A;  1VCS A;  2YU1 A;  5JRC A;  4CI2 B;  2H89 A;  1UUS A;  3CX6 B;  2LJL A;  3C51 A;  5HEH A;  3DTO A;  5KMG P;  2WDV A;  3N2G E;  3UU8 A;  4B6X A;  1G73 A;  2VAS A;  4QH4 A;  4U7I A;  3P4P A;  3AE6 A;  3N9M A;  4B3S T;  2XAS B;  3PU8 A;  2XM2 A;  2VKJ A;  1LVF A;  2XHE B;  3HA4 A;  4LFA T;  2WWU A;  2CM0 A;  3QC9 A;  3ESL A;  5BR8 T;  2ACZ A;  4CN1 A;  3PUV F;  3X1D A;  1HR0 T;  3IEE A;  4JI7 T;  3CWZ B;  4ANJ A;  2A3D A;  4IDP A;  3N2O A;  5FXV A;  3C98 B;  3LK2 B;  1VRB A;  2WCA A;  4OYJ A;  1FJG T;  3VKG A;  2CE7 A;  5F8P A;  2C5J A;  3G06 A;  2JQ9 A;  5LB7 B;  2OA5 A;  3N2K E;  4DBR A;  2Y48 B;  2NTX A;  4AQF A;  3B57 A;  3KVB A;  3BQI A;  2VKD A;  3NRX A;  2KWH A;  4HFC A;  4NXN T;  4KI0 F;  3Q9D A;  2OLT A;  3AE7 A;  5DQV A;  5IHY A;  5LHH B;  1UGO A;  3ZC0 A;  3TLS A;  2BS3 A;  2BKO A;  4DUZ T;  4PK4 A;  4P09 A;  3RIU A;  2CXL A;  4LMK A;  2SPC A;  4O8S A;  2BBJ A;  5JQG E;  3RX6 A;  2VKO A;  4JV5 T;  4AKL A;  2YU2 A;  3K3N A;  4I4T E;  4C91 A;  2UXD T;  2IDO B;  2XQ8 A;  3RIA A;  1SE7 A;  3NRY A;  5EZY E;  1IAP A;  5HCM A;  3FZM B;  4AKH A;  1ZP0 A;  3AB3 B;  4PFO A;  5LJN A;  4JUY A;  2KSR A;  4UXN B;  5CA0 E;  4KMC A;  5BMV E;  2RPA A;  3C64 A;  3VU7 H;  4AQF C;  1J5E T;  1WYC A;  3MZK B;  4HFV A;  3C4W A;  5JTG A;  2H7O A;  3CQX C;  3AXJ B;  4DMV A;  5KXJ A;  5LYJ E;  4U2Z A;  4LMJ A;  4B3R T;  3OJA A;  4GKK T;  2MPK A;  3C50 A;  2W63 A;  1YW0 A;  2LM9 A;  2IW5 B;  5LG4 A;  2WWV A;  3P4S A;  2WY2 A;  4UVC B;  5J1G A;  4JYA T;  3ZYM A;  3ZYK A;  2QA7 A;  3PUG A;  3H3A A;  4AI6 A;  3F31 A;  1LVK A;  2NW7 A;  2V6X A;  5HXS A;  2Q9Q D;  3RC3 A;  1N34 T;  2DHR A;  4UIG A;  2V7I A;  4HWH A;  5FL0 A;  5HEO A;  2PTF A;  4QXH B;  2RP4 A;  4CI1 B;  3AA6 B;  5LA6 E;  5CGM A;  2L3L A;  3CQG B;  5EK3 A;  3ZST A;  4TNV A;  1YD8 G;  2ODV A;  2D2S A;  4E7S A;  2VL8 A;  4O4L E;  2LRK A;  3J7Y q;  2VQF T;  1BR4 A;  2LSY A;  1M7K A;  2M67 A;  1BR0 A;  3ZC1 A;  3UU3 A;  3CX7 B;  3LBX B;  5DJQ C;  4HWD A;  4MHC A;  4TWF A;  3UUB A;  4DV5 T;  4LF7 T;  5FY0 A;  3UUM A;  5KDM C;  2MOZ A;  2W2U A;  1KEY A;  4A97 A;  4JI0 T;  3AE9 A;  2XQ7 A;  2Q9Q B;  2K24 A;  3L09 A;  2E9X A;  3WI3 A;  3AE5 A;  4B3T T;  3VRA A;  3ZJ1 A;  3GWH A;  4X1K E;  3O1J A;  4C90 A;  4PK5 A;  4UEL A;  4G2A A;  1IZN B;  1KNR A;  5LOV E;  3L8R A;  3RYF E;  3KIN B;  3JC6 D;  1O3X A;  2CHN A;  3VKH A;  2HPL A;  4ILB A;  2LSK A;  4O4H E;  5ABF B;  4JI2 T;  5CA1 E;  2ZLY A;  5ADX L;  3FXD B;  2XQ9 A;  3PUZ F;  5AFU L;  4YY3 T;  5HYA A;  5LBM A;  3QK6 A;  4MFR A;  4U72 A;  2DI4 A;  5FXW A;  4HFD A;  3ZN0 B;  3PUR A;  5HXH A;  3I1A A;  3ZMS B;  4O4I E;  3T8O A;  1OED C;  4DR6 T;  2X9H A;  5E0O A;  3JAF A;  3QB5 A;  4DV6 T;  3Q5E A;  3HKE E;  2I59 A;  1J5W A;  3EAB A;  2X51 A;  3K3Q C;  3NZQ A;  4JI5 T;  3B13 A;  3TLW A;  1Z8U A;  2UXX B;  2WMN A;  4PFP A;  1QLB A;  2J4G A;  2JQQ A;  4YSX A;  4HFI A;  2A2F X;  3TLU A;  1HS7 A;  4JBW F;  2QRX A;  1T7S A;  5HXC A;  1FEW A;  4H9R C;  3AE3 A;  4G63 A;  4JEH B;  3P8C D;  2XZE A;  3P4R A;  3OKQ A;  1XDO A;  3AA0 B;  3M65 A;  2KXP B;  2XQ3 A;  3E0Z A;  4ZI2 D;  1W09 A;  4BA9 A;  2EHO B;  3UFG A;  3KVA A;  2XAG B;  2B1E A;  3N9Q A;  3A8Y C;  3LDQ B;  2BVM A;  4YXD A;  5FKY A;  4YSZ A;  2E8I A;  3ZT6 A;  3PUS A;  3ANW B;  4LF9 T;  1SA0 E;  4ILC A;  2CLY C;  3KBU A;  4U33 A;  2X0H A;  3FHN A;  2CWO A;  4PJN A;  5LGN B;  4BJN A;  4Z8X A;  2UUC T;  2D0U A;  4AXP A;  2V8S V;  4OK0 A;  4EIW A;  3QNU A;  1J1J A;  3TKL B;  5JDH A;  5ABE A;  3UFE A;  3GMI A;  3D0T A;  4PW8 A;  3T1Y T;  2XQ5 A;  1HX1 B;  2CPT A;  1HX8 A;  4EZ4 A;  5FY1 A;  3RH3 A;  2XAH B;  4NIQ A;  3RF1 A;  4HFB A;  4EGW A;  2NWB A;  4O4J E;  4ZS3 A;  5H6R B;  3RQW A;  5FMN A;  1UUR A;  2BZB A;  1BR2 A;  4WW0 A;  1HG5 A;  1MIY A;  4TV8 E;  4IE5 A;  2A9U A;  3AAE B;  1IBK T;  3ZCJ A;  3RKO A;  2MYS A;  3O1I A;  1D0Z A;  4U7Y A;  4DR5 T;  4O2B E;  1IJ6 A;  3AED A;  4HEA A;  4X1I E;  4TX5 A;  3ZT7 A;  3O4X E;  2BG9 C;  2WP9 A;  4U31 A;  3QB5 K;  2VQE T;  2WZI A;  2CXD A;  4I55 E;  1YQ3 A;  4GYR A;  5AQU B;  5FY7 A;  1MNE A;  4X66 T;  4X64 T;  4PJM A;  4HWI B;  3NVO A;  5L4H A;  4HKA A;  4AIS A;  1ZOY A;  5AQN B;  2YIN A;  2KIN B;  1NAF A;  3N9P A;  5CFB A;  2LLY A;  5LHG B;  2WBL A;  2XAF B;  5IYZ E;  2VL0 A;  5HWX A;  2V1D B;  2W0G A;  3EDV A;  3T1H T;  4DBQ A;  2WU5 A;  5F3J A;  1UX5 A;  3P7I A;  3AEG A;  2XAJ B;  2C5K T;  3KBT A;  5J0Z A;  3AVS A;  4DR3 T;  2W62 A;  3LBX A;  3ZKR A;  3R84 B;  4TZ4 C;  5LBQ B;  1XNQ T;  3CQC B;  2V7L A;  2XTL A;  3PUA A;  1MMD A;  2IML A;  5HXR A;  3U78 A;  4LF6 T;  4DV2 T;  3UTK A;  2F4V T;  3EVY A;  4DR2 T;  2CEA A;  2DNX A;  2CRB A;  2Q9Q A;  1ZHC A;  1WLX A;  3BK9 A;  4V1A v;  3KV6 A;  2ZM0 A;  2LOS A;  1WYB A;  3EDU A;  3KV4 A;  5JDM A;  4A5X A;  4ZOL E;  3DJB A;  4EAH A;  5JR9 B;  4YTN A;  2FJE A;  4P0B A;  3OBV E;  1WRD A;  4H9N C;  2ZM8 A;  3IBP A;  2JRK A;  5FVK A;  3PUQ A;  4EED A;  2V5D A;  4CI3 B;  1D0X A;  3KV5 A;  2AXD S;  2UU9 T;  2YOE A;  4YLH A;  2L9Q A;  3K8P C;  4DV0 T;  4CN6 A;  1FIO A;  2Z6E A;  3KFW X;  5HAX A;  2UXN B;  1KF6 A;  3RHW A;  1VCT A;  3N9O A;  4QX8 B;  3ZJ2 A;  1W0B A;  1SHZ C;  1HG2 A;  1HCI A;  2X9X A;  4IE0 A;  3F57 A;  2I6H A;  2WDQ A;  4L5G A;  5AQF B;  4I0U A;  3Q5W A;  2CA5 A;  4IL9 A;  3RIU C;  3Q2M A;  4Z91 A;  1UK5 A;  4ZXL A;  4COF A;  2XJ7 A;  4DUY T;  2V6Y B;  5JVD E;  1R8I A;  5AQO B;  3RRC A;  3RYH E;  1L0V A;  1DU2 A;  1FMW A;  2LRL A;  2V26 A;  1XNR T;  2MBG A;  5LXT E;  1JNZ A;  3SFD A;  4IDN A;  4X20 E;  1ZEE A;  4K0K T;  2NW8 A;  2HN2 A;  4ADZ A;  4UV9 B;  2HN1 A;  1N33 T;  3AE8 A;  3HKB E;  1FMV A;  2WSS V;  4YJ3 E;  5J2T E;  1W0A A;  2LHN A;  3C4Z A;  2X0L B;  3LG7 A;  2LKH A;  4P1N A;  3OYZ A;  2UXC T;  4EV6 A;  3RLF F;  4ZI3 C;  2DWG A;  2EHO A;  3JAD A;  1T72 A;  2YDQ A;  3ZLI A;  1D1C A;  4EEB A;  4DR4 T;  3PTR B;  3P4Q A;  2X0Y A;  5EK4 A;  3NBX X;  3IA3 A;  2VWA A;  3H37 A;  2IUB A;  3IHR A;  2XAQ B;  3ZT5 A;  3Q5X A;  2XQA A;  4DR7 T;  4F8H A;  1D1A A;  2OV9 A;  2LT3 A;  3E22 E;  1JNR A;  2DWK A;  3FXE B;  5CB4 E;  5M4Y A;  4OFZ A;  4H63 V;  3F2E A;  1US7 B;  4UV8 B;  3LJC A;  4JI3 T;  5HEG A;  4HGA A;  3JAE A;  3SRZ A;  1VOM A;  4IT4 A;  5AQR B;  5AQQ B;  4JEU B;  4WBN E;  5LGU B;  1I6Z A;  3FBL A;  2LSG A;  2WU2 A;  2LM2 A;  3FBZ A;  3P50 A;  2HH7 A;  4EYU A;  5AQM B;  2E5V A;  5LG3 A;  3UU5 A;  3CK6 A;  3AE2 A;  2YKS A;  4ZZB A;  4F6R C;  3R6N A;  3ONJ A;  4YHH T;  3RKG A;  2XUE A;  2FUP A;  2D0T A;  3EI0 A;  4JI4 T;  3QUJ A;  4AKR B;  1HFA A;  4QH5 A;  5JDN A;  2N2N A;  1Z0P A;  5AQP B;  2YDS A;  2E9X C;  5H6Q B;  4U74 A;  2ZM6 T;  1CHU A;  3HI2 A;  5L3F B;  2JIW A;  3AAI A;  3WAK A;  2W67 A;  3AEE A;  2JPF A;  5DQW A;  2C5I T;  1KNZ A;  3ZMT B;  3ZCI A;  3TLT A;  2E5L T;  2MTQ A;  2H3R A;  5A1L A;  4K0U A;  4DO0 A;  3N9N A;  2PFV A;  4MLK A;  3NWI A;  1HNW T;  2C0S A;  2V7K A;  2M6I A;  4IE7 A;  1HNZ T;  2IC9 A;  5ETW A;  4EOZ B;  4JI6 T;  2KND A;  2WB5 A;  4HTE A;  3PDY A;  4CZZ B;  3NZP A;  3LK4 2;  3BQK A;  2PBI A;  2CWY A;  2XM1 A;  4IDQ A;  5KX5 E;  1IBM T;  2ZMA A;  4IL4 A;  4NXM T;  4UF0 B;  4A98 A;  3FZK B;  2R6G F;  1XWM A;  2FJB A;  2E2A A;  4H9Q C;  4GIW A;  2JQH A;  5AQJ B;  2NOX A;  4HFH A;  4IDO A;  4ISS A;  3KV9 A;  1IBL T;  4JI8 T;  4FI5 A;  3N9L A;  3WAJ A;  5IWA T;  4YTM A;  4WZX A;  4UR9 A;  3VR8 A;  1V9D A;  5JDQ A;  4WYV A;  2XSA A;  4PAG A;  2CHO A;  5LP6 E;  5HXE A;  5LGT B;  5JR9 A;  2ACX A;  1LKX A;  4GYS A;  2JMK A;  1OED B;  1BR1 A;  2UUB T;  2X9W A;  4AKG A;  2WS3 A;  2QYW A;  4H63 H;  4KUM B;  5AQH B;  2KZ7 B;  4ILU A;  4DR1 T;  4YHJ A;  2KLQ A;  4H9O C;  1Y64 B;  4HE8 A;  3I9W A;  3SFE A;  2P9B A;  3JCF A;  4O2A E;  4PK6 A;  5C2T A;  5L3E B;  4WNK A;  2CMR A;  4KBM B;  1QUU A;  4YFS A;  3GN5 B;  4YSY A;  1HF8 A;  4XBF B;  3AXJ A;  3AEF A;  5FXZ A;  2K5B B;  4AIU A;  1XDP A;  3I9Y A;  3V5S A;  2CCQ A;  3SS1 A;  3J9X 1;  4UVA B;  1NWM X;  1SUM B;  5HCJ A;  3DP7 A;  4ASK A;  5JDG A;  1X79 A;  4TNW A;  1D1B A;  4DID B;  3MAC A;  5JDL A;  2V6Y A;  2V5C A;  2CBJ A;  4EXT A;  4GKJ T;  2VB6 A;  4IDZ A;  1MND A;  1D0Y A;  5JH7 E;  3VR9 A;  3CPZ A;  4PJL A;  3HL6 A;  2XQ6 A;  2FBW A;  3OTO T;  3OVU A;  1KFY A;  2QVA A;  4YT0 A;  1KK7 A;  2CLY B;  3LFM A;  3ZN1 B;  4L0R A;  3ZMV B;  2WQY A;  1WR6 A;  5FNV E;  2BBH A;  3ETU A;  4TV9 E;  3UU6 A;  4EZH A;  4M1P A;  5EK2 A;  5FXX A;  2KMF A;  2LSI A;  1M62 A;  4DV3 T;  3A7M A;  5C3J A;  2BS4 A;  2MAW A;  4I50 E;  1NEK A;  4IHJ E;  3FZF B;  3Q5D A;  3MK7 C;  3OYX A;  4IRE A;  4CXX A;  4UEM A;  2VK9 A;  4ZZC A;  4NPP A;  5HWY A;  2DLR A;  4ZI7 E;  1U5P A;  1KNP A;  2XSB A;  4TWD A;  5FVL A;  5GON E;  5C8Y E;  2VVS A;  2X68 A;  2UUA T;  1QSD A;  2K9A A;  3CML A;  2J1D G;  3LSV A;  2D9D A;  2UXB T;  3RGL A;  1XMO T;  2BS2 A;  3AEB A;  1ZV4 X;  4IGU A;  2A72 A;  2J62 A;  2FJD A;  1T98 A;  4ZEY A;  3MKD A;  3UT5 E;  4BJM A;  1WFD A;  2LHR A;  3B5M A;  3NKZ A;  1CUN A;  4P0A A;  4JI1 T;  5DAB A;  4HWF A;  4U3C A;  4B3M T;  1HTJ F;  3V5U A;  2XQY A;  5LMN T;  4LF8 T;  3RI5 A;  1Y01 A;  4OYK A;  2WAU A;  4DND A;  3CIR A;  1MMN A;  3UUN A;  5L2L A;  2X67 A;  2CXF A;  2BDE A;  3RYC E;  2LEH A;  1XMQ T;  4OHF A;  4PNI A;  4YJ2 E;  1UCU A;  3AAA B;  2BG9 B;  4U2Y A;  5ABF A;  2BKP A;  3CVR A;  2WM9 A;  3HR0 A;  4HFE A;  2ODU A;  4QX7 B;  3L3P A;  1OED E;  4KHZ F;  3GA8 A;  3UQ7 A;  2Q9Q C;  4X5T A;  4A56 A;  3PUW F;  2N1G A;  3LK3 B;  2LOP A;  2AE9 A;  2GK9 A;  4NUU A;  3OPC A;  3MA9 A;  3VHL A;  4L9I A;  2VKH A;  3FZL B;  4QXB B;  4LFC T;  4MBQ A;  3UQ4 A;  5LJM A;  4DVD A;  1HNX T;  1OWA A;  2XY8 B;  2LE8 A;  3KDS E;  4LF5 T;  5JRC B;  3O9X A;  1E1H B;  1LRZ A;  2WZH A;  3VRB A;  3UU4 A;  3AVR A;  4J2C A;  1AJ3 A;  2IAK A;  4X1Y E;  4OX9 T;  4IST A;  4WBO A;  1IJ5 A;  4QHO A;  4UVB B;  1I94 T;  4TN7 B;  1S35 A;  2BVL A;  2LKG A;  2IC6 A;  4UF0 A;  5J2U E;  2ES0 A;  4LML A;  2Y6X A;  4HWC A;  3PU3 A;  4QWN B;  4XZC A;  4IE4 A;  3ANW A;  2X66 A;  2W00 A;  4H9P C;  5FP3 A;  3PUX F;  2JJ9 A;  4IIJ E;  1U4Q A;  2DCF A;  4YTP A;  4FJO A;  3ZMZ B;  3JC6 C;  2W4X A;  3H3M A;  3RPU A;  5L3B B;  2FJA A;  1N36 T;  4XAX B;  2K48 A;  2YEV C;  2PJQ A;  1OED A;  4TWH A;  2ZM2 A;  4ZI3 D;  3ETV A;  4DV4 T;  4ERR A;  4IE6 A;  2W61 A;  3M3Z B;  5CJ5 A;  1T8B A;  4N78 D;  4TUY E;  3UUL A;  2EHO C;  3ZSS A;  1YXR A;  5TAO A;  4DV1 T;  3ZEF B;  2JQK A;  3AEC A;  3GN5 A;  1ZKE A;  5L3C B;  5L47 A;  2Y8D A;  4H9S E;  3UUX B;  4EB6 E;  2LSJ A;  1NEN A;  4GOU A;  4KX6 A;  3L39 A;  5AQL B;  3MJX A;  3RYI E;  2H88 A;  3PUY F;  3BQL A;  2VUR A;  5AQI B;  3ZPO A;  3SWH A;  1EZ3 A;  3P4W A;  1S94 A;  5IUX A;  4X65 T;  3K1S A;  4LF4 T;  2NR4 A;  3U3I A;  4ZI2 C;  2BG9 E;  2EHO D;  3AEA A;  3RIF A;  3RC8 A;  5HEJ A;  1MMG A;  1W9R A;  3ONX A;  2NP9 A;  2XPK A;  4E7Z A;  5ABG A;  3IF8 B;  2K3W A;  4CQI A;  5FL1 A;  5LNK A;  2N9D A;  2WMO A;  3SOL A;  4Z90 A;  2NTY A;  3ZMU B;  1OXZ A;  2D5U A;  3N5L A;  5LCY A;  1YQ4 A;  5L3G B;  1G8X A;  3ONL C;  4QH1 A;  2BKN A;  1XZY A;  2E9X D;  4AQY T;  2J47 A;  4QXC B;  3CX8 B;  5AQG B;  3PJA A;  4MAL A;  2IHR 1;  4GK5 E;  4DV7 T;  5AQT B;  1YKH B;  3EAM A;  5ABH A;  4KHP T;  4AKI A;  3RQU A;  4JLE A;  4ZHQ E;  3ZYL A;  3MXZ A;  2M6B A;  5FYM A;  3W15 B;  4CXY A;  3A5X A;  2YDR A;  4QKN A;  1MIV A;  2JMH A;  3EHZ A;  4EYY R;  4DMW A;  2YK0 A;  3PJA J;  5F5W A;  2IIU A;  5JDF A;  2HHH T;  5AQV B;  2KT9 A;  4GK0 E;  2H7V C;  2CBI A;  1E7P A;  4LFB T;  2V7M A;  2V7J A;  1WR0 A;  1WCR A;  1MMA A;  3E08 A;  2DL1 A;  2E9X B;  4I43 B;  3FB2 A;  3AE1 A;  2G0U A;  1YKE B;  2HPJ A;  3C4X A;  2L8K A;  3O1H A;  3HKD E;  2KWI B;  1UX4 A;  5L3D B;  4CXW A;  2XQ4 A;  3I0Q A;  5AQS B;  2I0M A;  5JRE A;  4HN9 A;  4KP3 C;  2PG8 A;  5LHI B;  2BG9 A;  5LMU T;  2B76 A;  3RRW A;  1B7T A; 
#chains in the Genus database with same CATH homology
 3OYZ A;  4AQG A;  2X51 A;  3K3Q C;  4BAY B;  3I0O A;  2LHR A;  3NZQ A;  4ZI3 C;  2DWG A;  2EHO A;  1CUN A;  2X9Y A;  4P0A A;  3AA1 B;  3B13 A;  5DAB A;  3S4U A;  3ZLI A;  1D1C A;  1HTJ F;  2RA1 A;  3V5U A;  2XQY A;  2UXX B;  2WMN A;  3PTR B;  4PFP A;  3CKD A;  4OYK A;  2JQQ A;  2WAU A;  4DND A;  2A2F X;  1HS7 A;  1MIW A;  5EK4 A;  1MMN A;  3UUN A;  5HXC A;  4PJJ A;  5L2L A;  1FEW A;  3PE0 A;  3NBX X;  2X67 A;  4H9R C;  2CXF A;  2BDE A;  2VWA A;  4NUV A;  3RYC E;  5JR9 C;  4G63 A;  3H37 A;  2LEH A;  3IHR A;  2XAQ B;  4JEH B;  3P8C D;  3Q5X A;  2QGS A;  4OHF A;  3OKQ A;  4PNI A;  4YJ2 E;  3K3O A;  3AA0 B;  1UCU A;  1D1A A;  3AAA B;  1H7C A;  3M65 A;  2KXP B;  3E0Z A;  3AA7 B;  2LT3 A;  3HKC E;  4ZI2 D;  4ZS2 A;  3CVR A;  2WM9 A;  3HR0 A;  3E22 E;  3EUH A;  2DWK A;  3FXE B;  5CB4 E;  2NW9 A;  5M4Y A;  2ODU A;  4OFZ A;  4H63 V;  3F2E A;  4QX7 B;  4BA9 A;  3L3P A;  1US7 B;  5JRC A;  2YU1 A;  2EHO B;  4UV8 B;  4CI2 B;  3LJC A;  3CX6 B;  4HGA A;  2LJL A;  3C51 A;  3GA8 A;  3KVA A;  3DTO A;  2XAG B;  2B1E A;  3N9Q A;  3SRZ A;  2Q9Q C;  1VOM A;  4A56 A;  5KMG P;  3N2G E;  4JEU B;  2BVM A;  4WBN E;  5LGU B;  4B6X A;  1G73 A;  2N1G A;  3FBL A;  2VAS A;  2LSG A;  2E8I A;  3PUS A;  3N9M A;  3FBZ A;  3ANW B;  3LK3 B;  2XAS B;  2LOP A;  2HH7 A;  3PU8 A;  2GK9 A;  1SA0 E;  4EYU A;  4NUU A;  2VKJ A;  1LVF A;  2XHE B;  3HA4 A;  2CLY C;  3MA9 A;  2WWU A;  3KBU A;  2CM0 A;  3VHL A;  4L9I A;  3QC9 A;  3ESL A;  3FHN A;  2CWO A;  2VKH A;  3IEE A;  4PJN A;  5LGN B;  4BJN A;  3CWZ B;  3R6N A;  4F6R C;  4Z8X A;  4QXB B;  4ANJ A;  2D0U A;  4MBQ A;  4AXP A;  2A3D A;  5LJM A;  2XUE A;  2D0T A;  3N2O A;  4DVD A;  5FXV A;  4OK0 A;  1OWA A;  2LE8 A;  3KDS E;  4EIW A;  5JRC B;  3C98 B;  3LK2 B;  1VRB A;  3QUJ A;  3O9X A;  4OYJ A;  3VKG A;  2CE7 A;  1E1H B;  5F8P A;  4AKR B;  2C5J A;  1HFA A;  1LRZ A;  5JDN A;  2N2N A;  2OA5 A;  3TKL B;  1Z0P A;  3N2K E;  4DBR A;  5JDH A;  2Y48 B;  2NTX A;  2E9X C;  3B57 A;  5H6Q B;  4U74 A;  3UFE A;  3GMI A;  3KVB A;  4AQF A;  3AVR A;  4J2C A;  3BQI A;  2VKD A;  1AJ3 A;  3D0T A;  4PW8 A;  2IAK A;  4X1Y E;  3NRX A;  2KWH A;  4IST A;  3HI2 A;  3Q9D A;  4WBO A;  1IJ5 A;  4QHO A;  4BJM A;  5L3F B;  4UVB B;  3AAI A;  3WAK A;  5DQV A;  5IHY A;  2JPF A;  5DQW A;  5LHH B;  4TN7 B;  2C5I T;  1S35 A;  2BVL A;  3ZC0 A;  1KNZ A;  2IC6 A;  3ZMT B;  1HX8 A;  4UF0 A;  4EZ4 A;  5FY1 A;  3RH3 A;  5J2U E;  2XAH B;  3ZCI A;  2ES0 A;  4PK4 A;  2Y6X A;  4P09 A;  3PU3 A;  4QWN B;  4XZC A;  2MTQ A;  2NWB A;  2H3R A;  4O4J E;  2CXL A;  5A1L A;  4IE4 A;  4ZS3 A;  3ANW A;  5H6R B;  2X66 A;  4K0U A;  2W00 A;  4H9P C;  5FMN A;  5FP3 A;  2SPC A;  4DO0 A;  2BZB A;  4O8S A;  5JQG E;  2JJ9 A;  1BR2 A;  4WW0 A;  2VKO A;  3RX6 A;  4IIJ E;  3N9N A;  2PFV A;  1U4Q A;  2DCF A;  4AKL A;  2YU2 A;  1HG5 A;  3K3N A;  4FJO A;  1MIY A;  3JC6 C;  3ZMZ B;  4I4T E;  4TV8 E;  4C91 A;  4MLK A;  4IE5 A;  3AAE B;  2C0S A;  3NRY A;  5EZY E;  1IAP A;  2V7K A;  3ZCJ A;  3RKO A;  2MYS A;  3O1I A;  3RPU A;  4IE7 A;  5L3B B;  4AKH A;  3AB3 B;  4PFO A;  2IC9 A;  1D0Z A;  5LJN A;  4XAX B;  5ETW A;  4JUY A;  2K48 A;  4EOZ B;  2YEV C;  2KND A;  4HTE A;  4O2B E;  2PJQ A;  1IJ6 A;  3PDY A;  4UXN B;  3NZP A;  4HEA A;  4KMC A;  4CZZ B;  3LK4 2;  3BQK A;  4X1I E;  5CA0 E;  4TX5 A;  2PBI A;  2ZM2 A;  2CWY A;  5BMV E;  3O4X E;  3C64 A;  5KX5 E;  4ZI3 D;  2ZMA A;  3VU7 H;  4AQF C;  3ETV A;  4UF0 B;  4ERR A;  4IE6 A;  2W61 A;  1WYC A;  3MZK B;  4HFV A;  3C4W A;  4H9Q C;  4GIW A;  2H7O A;  4N78 D;  2CXD A;  2NOX A;  4TUY E;  3CQX C;  4I55 E;  4ISS A;  4GYR A;  3UUL A;  3KV9 A;  2EHO C;  5FY7 A;  1MNE A;  4FI5 A;  4DMV A;  3N9L A;  5TAO A;  4PJM A;  5LYJ E;  3WAJ A;  4HKA A;  3ZEF B;  3OJA A;  2YIN A;  2KIN B;  1NAF A;  3LG7 A;  3GN5 A;  1ZKE A;  3C50 A;  3N9P A;  2W63 A;  1V9D A;  1YW0 A;  5L3C B;  2Y8D A;  2LM9 A;  5LHG B;  4H9S E;  2IW5 B;  2WBL A;  3UUX B;  4EB6 E;  2LSJ A;  2XAF B;  5JDQ A;  5LG4 A;  5IYZ E;  4GOU A;  5HWX A;  4PAG A;  5LP6 E;  2V1D B;  2W0G A;  3EDV A;  5HXE A;  4DBQ A;  5LGT B;  5F3J A;  5JR9 A;  1UX5 A;  2ACX A;  4UVC B;  1LKX A;  3P7I A;  3MJX A;  4GYS A;  2XAJ B;  5J1G A;  2JMK A;  3RYI E;  2C5K T;  3ZYM A;  3ZYK A;  1BR1 A;  3KBT A;  2X9W A;  4AKG A;  3AVS A;  4H63 H;  4KUM B;  3BQL A;  2W62 A;  2QA7 A;  3LBX A;  3PUG A;  2KZ7 B;  4ILU A;  3H3A A;  3R84 B;  4AI6 A;  4TZ4 C;  3F31 A;  4YHJ A;  1LVK A;  2NW7 A;  5LBQ B;  2KLQ A;  4H9O C;  3ZPO A;  5HXS A;  3CQC B;  2V7L A;  2Q9Q D;  2XTL A;  3SWH A;  1EZ3 A;  1Y64 B;  1S94 A;  3PUA A;  3RC3 A;  1MMD A;  5HXR A;  3U78 A;  4HE8 A;  3I9W A;  2DHR A;  4UIG A;  2P9B A;  3UTK A;  3EVY A;  4O2A E;  4PK6 A;  2V7I A;  3U3I A;  2CEA A;  2DNX A;  4ZI2 C;  4QXH B;  2EHO D;  5L3E B;  2RP4 A;  3AA6 B;  5LA6 E;  4WNK A;  2CMR A;  2Q9Q A;  1QUU A;  1ZHC A;  4KBM B;  4YFS A;  4CI1 B;  3RC8 A;  1WLX A;  1MMG A;  2L3L A;  3CQG B;  3GN5 B;  5EK3 A;  3ONX A;  1YD8 G;  2ODV A;  2NP9 A;  3BK9 A;  2D2S A;  4V1A v;  4E7S A;  2VL8 A;  4O4L E;  4E7Z A;  1HF8 A;  3KV6 A;  3IF8 B;  2ZM0 A;  2LOS A;  1WYB A;  3EDU A;  3KV4 A;  4XBF B;  5JDM A;  4CQI A;  5LNK A;  4ZOL E;  3DJB A;  2N9D A;  2WMO A;  4EAH A;  3J7Y q;  5JR9 B;  1BR4 A;  5FXZ A;  2K5B B;  2LSY A;  3I9Y A;  4P0B A;  3OBV E;  1WRD A;  4H9N C;  3SOL A;  2M67 A;  1BR0 A;  3V5S A;  3ZC1 A;  2CCQ A;  2NTY A;  3CX7 B;  3ZMU B;  3LBX B;  1OXZ A;  2D5U A;  2ZM8 A;  3IBP A;  5DJQ C;  3N5L A;  5LCY A;  3SS1 A;  3J9X 1;  4UVA B;  2JRK A;  5L3G B;  1G8X A;  1NWM X;  4MHC A;  3DP7 A;  4ASK A;  2E9X D;  1X79 A;  5JDG A;  1D1B A;  3PUQ A;  5FY0 A;  3UUM A;  4CI3 B;  5KDM C;  2MOZ A;  3MAC A;  5JDL A;  1D0X A;  3KV5 A;  4QXC B;  3CX8 B;  4EXT A;  4YLH A;  2L9Q A;  2VB6 A;  2Q9Q B;  3K8P C;  4IDZ A;  1MND A;  4MAL A;  2K24 A;  3L09 A;  2E9X A;  4GK5 E;  1FIO A;  2Z6E A;  1D0Y A;  3KFW X;  3WI3 A;  5HAX A;  1YKH B;  2UXN B;  5JH7 E;  3CPZ A;  4AKI A;  4PJL A;  3N9O A;  4QX8 B;  3HL6 A;  4JLE A;  3ZJ1 A;  3GWH A;  4X1K E;  3O1J A;  4C90 A;  3ZJ2 A;  4ZHQ E;  3ZYL A;  1SHZ C;  3MXZ A;  4PK5 A;  5FYM A;  1HG2 A;  4UEL A;  3W15 B;  1HCI A;  2X9X A;  4CXY A;  1KK7 A;  4G2A A;  1IZN B;  3A5X A;  4IE0 A;  2CLY B;  4QKN A;  3LFM A;  3F57 A;  5LOV E;  1MIV A;  3ZN1 B;  4L5G A;  4L0R A;  2JMH A;  3ZMV B;  3RYF E;  1WR6 A;  4EYY R;  3KIN B;  5FNV E;  4DMW A;  3ETU A;  2YK0 A;  3Q5W A;  4TV9 E;  2CA5 A;  4EZH A;  4M1P A;  5EK2 A;  3Q2M A;  5FXX A;  2KMF A;  2LSI A;  3JC6 D;  1O3X A;  5JDF A;  2KT9 A;  3VKH A;  4GK0 E;  4I50 E;  2H7V C;  2HPL A;  4IHJ E;  5JVD E;  2V7M A;  2V7J A;  3MK7 C;  3OYX A;  2LSK A;  3RYH E;  4O4H E;  3RRC A;  1MMA A;  4CXX A;  5CA1 E;  4UEM A;  2VK9 A;  3E08 A;  2E9X B;  1FMW A;  2ZLY A;  4I43 B;  3FB2 A;  5HWY A;  2V26 A;  5ADX L;  2DLR A;  2G0U A;  3FXD B;  2MBG A;  5LXT E;  4ZI7 E;  1YKE B;  2HPJ A;  3C4X A;  5AFU L;  5HYA A;  1U5P A;  2L8K A;  3O1H A;  3HKD E;  5LBM A;  2KWI B;  3QK6 A;  4MFR A;  1UX4 A;  4U72 A;  2DI4 A;  5GON E;  5C8Y E;  4X20 E;  5FXW A;  3ZN0 B;  5L3D B;  3PUR A;  3ZMS B;  3I1A A;  2X68 A;  1ZEE A;  5HXH A;  4CXW A;  1QSD A;  2K9A A;  2NW8 A;  2J1D G;  3CML A;  3I0Q A;  4O4I E;  3T8O A;  4ADZ A;  2X9H A;  5JRE A;  4UV9 B;  4HN9 A;  1ZV4 X;  2PG8 A;  4IGU A;  4KP3 C;  5E0O A;  2A72 A;  5LHI B;  3HKB E;  1FMV A;  2WSS V;  4YJ3 E;  5J2T E;  1T98 A;  3HKE E;  2LHN A;  2I59 A;  3C4Z A;  3MKD A;  3UT5 E;  2X0L B;  3RRW A;  1B7T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...