4UILH

Crystal structure of quinine-dependent fab 314.1 with quinine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
222
structure length
218
Chain Sequence
AVQLQESGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCTRERGLYYGSSSFDYWGQGTTLTVSSAETTPPSVYPLAPGTSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 314.1
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
total genus 29
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilH02
1MCOL 4I4WA 4LVEA 1M7DA 1T20A 3ULSB 4DKAA 4HWUA 2JB6B 1EX0A 1DVFB 3JVGC 2D31B 3BPLC 2J6EH 3H9HA 2YKLH 2HKFL 4YXHL 5IBUB 1EGJA 3U30B 5IFAH 3NZHH 2DQDL 4PJ9D 3T2OA 3G9VA 5E8EA 2XTLA 4L1DA 3MR9A 1VFBB 2Z4QA 2QQKH 1CLOL 4UV7L 1BIIA 3IU4H 5ALBL 5T5NF 1MCDA 4JB9H 1YN6A 2DBLL 1CDJA 1UACL 2OLDA 2B20A 4HX1B 3GMMB 4K3DH 1A3LH 1AHWC 2E7HA 3K8LA 3QG7H 3BUYA 5DUMH 3WD5H 5FXCH 4OF6A 4MAYD 1NBZA 5AUMA 4KI5C 3GB7A 4XC1L 1WTGT 5D2NA 2VTFA 1W72B 4QRTA 1JNNH 2V2TB 1UM5L 1I1FA 2HWZL 2XG5A 3VRJA 1QOKA 4JM2F 1XCQA 3WHXB 2CDEB 1ZT7A 1L7IL 3BRFA 2Z91B 5DK3A 3I75B 1A6TA 3MRRA 1FFQA 3BT2H 5JW3L 3D85B 5DLML 3NPSB 4X4MA 1XCTB 2D4FA 2GK0B 1F90H 1HHIB 4JDTL 4LLWA 3N0PB 1ZEAH 1BBJB 1YDPA 5MEOB 4P5KA 1HIMH 2I26N 3OQ3B 1EBAA 3PJSA 4PP2B 4H25A 1MAML 2A2QT 4LSDA 3GMLA 1F2XK 4X6DE 4LSSH 3ILQD 3NPZB 1R0AH 1LDPH 4JG0L 1MWAA 3S35X 4G6JH 4OFVA 3DUHA 2LAAA 3SDAD 4MYWB 4GMTL 3UMTA 3BI9X 2D0FA 4G42A 1A7NL 3PABB 4NQVA 4IM8A 1ND0A 4OCMC 2YD8A 2BXZA 4CADA 1FNFA 2VABA 4MD0B 1U41A 4XHQA 5AEAA 5BCAA 3FN0H 1B0GB 3ARYA 4NZUL 5MEPB 3F12B 4MNQE 2GSGA 3AMKA 5F3BB 1JF5A 1YJDH 3O0RH 4R9HA 1QPPA 3FT3B 2EDBA 1T89C 3MYJB 4L8DB 5D7JB 1CXHA 1JI2A 5EORH 2NY7L 3NCJL 2Z92A 4BZYA 4U1IB 3ZKSD 2Q8AL 4RCAA 4MAYB 3LV3B 4AEHH 1YMMD 1ZVSB 5KSBB 2DJ4A 2XZCL 3ZKXC 5IVNA 3I3DA 5D7LE 5EB9A 3EZ8A 4P5MA 1NC4D 4OM0H 35C8H 3GNML 4U1KB 1DANU 4HFUL 1NBVL 4GSDH 5BMFH 3OV6A 3TNMB 1A1NB 1IGIL 1DQJB 5IT2H 3NCEB 4FNLH 2DLGA 1QNZH 1DBBL 5ALCL 2XKSA 1M7XA 1D5MA 3MRJB 1DN0A 2CUHA 2PTTA 5D70H 3STLA 1CICD 1YUHB 1IL1B 1G7HA 5HGBA 5E08H 2YXFA 3GJFK 1QKZL 3CDCA 2EO1A 4PJ8A 5FGSA 3TO4D 1IZJA 1IGYA 1UB5A 2CDGB 4MB5A 1QFHA 4F7EA 1FLRL 2DIJA 3L5XH 5H94B 1KB5L 5LWYH 3MODL 4M3JA 4PRPB 3DMMD 2G75B 4PYHA 4BZ1L 5JQHC 2VL4A 1MCJA 3U83A 3BD3A 4XNQB 5K9OB 1CVSC 2RBLA 3H42H 1FL3A 2CMRL 4RISH 4X6CF 2DOCA 5FOJA 4PJ8C 4KROC 3G6DL 2X9YA 4Y5VA 5ISZB 1EJ6A 4OZ4B 3G6JF 1HDMA 4FQLH 3O9WB 4R7NB 2NR6C 2ZZUT 1CD1B 4N8PA 4D8PA 4PGCB 1OGAB 4LPXA 3E8UL 2UUDK 4OF8A 3MRHA 2HT3D 1A47A 1KBGH 4KTEL 4K7PY 5DMIL 1C12A 4UI2A 4PREA 2WIIB 4PGEA 1AGCA 2YPKA 2HVJA 3PGCB 3VG0H 1UENA 3MRPA 1YMMB 3TFKD 4OKDA 3U79A 1I9JL 1KLFA 3V4PH 4YIQA 3QXAB 3A6CL 5F6IB 2JCCA 3TWCL 5C3TA 4CN6A 4J2XA 4KKAC 1NC4B 4HWBA 3BKYL 2F54A 2GYSA 2XTJD 3SDCB 3SPVB 3FO0H 5CGYD 1CGVA 2F9BT 5GGSB 3RUGB 1BQLL 1JGLL 2UYLA 4QTIL 2ORBH 2UVFA 5C09D 4KRPC 3O11B 1ORQB 3OX8A 3WFZA 4U6VH 5D6DC 3IDGA 4FG6D 4XPGH 4GW1A 3TO4B 5D93B 4IIQA 4MXWL 5GGRA 4X6EB 4KU1A 4R97C 3U0TA 4YPGB 4NN6C 1OSPL 4WHYG 4E9LA 4KGLA 1LDSA 3DMMB 5HYSA 4OCLC 1O0VA 3S36X 3JTTA 2HJKB 2WWKO 1N4XH 3V7MA 2YRPA 1MRCL 2P47B 4YBLC 5CEZD 4DOHE 2PYEE 2IFFH 5FGRA 3VFWB 2NTSP 4N0UB 3WNOA 4EIZC 4YGVB 2FWOA 5DRZB 4IIQC 2HKHL 4GOSA 2DB8A 1UJ3A 3TA3D 5F8QC 1OP5K 4DTGL 5JDJA 3MNZB 4N68A 1TTGA 1F4AA 1KXVC 4BQCA 2EIZB 3VFNB 3W9DA 2IAMA 2H3NA 2G60H 1NSNL 5HI5D 3VA6A 5L6YL 3KLAB 1U92B 4XI5D 4YEEA 4JG1H 4OZHB 3DGGA 4KHTL 4NNYB 4KKBC 1JZ8A 3D9AL 5DHVA 4FS0A 4Z5RA 3H6JA 1S7RA 4H88L 1TLKA 2HG5B 4YDJA 4WV1B 4BZ2H 2VXVL 1FZOB 1WFOA 2ZCHH 3OTTA 2P48B 2BNQE 2F19H 5D5MF 1KENH 1P5UA 2FLRT 3QQ3A 4HXBL 2XTJB 1WC7A 5DD3L 5K9JH 3BP4B 1FL6B 1PX4A 3T0DA 5EUKB 5JR1H 2CKNA 5D8JH 3VXUA 1PKOA 2RAMA 2W0PA 3SKNA 1XEDA 5C09B 5E5UB 4K71C 5F7DB 1NFDF 3IU3B 5F71A 5SWZA 5TH2A 2FEEI 1AGBA 2FYYA 1EEZA 4O2FB 2QEJA 1EUUA 1UCBH 5HGDB 4K94C 1Y6NR 1DQML 4P57A 3SKJH 1NUFA 3W0WA 2Y7QB 3WV0A 4XPBH 5D9SA 3SKMB 3JV6A 2JB5H 4JKWA 5IW3A 1W0VA 5AZ2H 4NRYB 1KIPA 1KTDA 4XVJL 2ATKA 3RWDB 3HCVB 3EYSH 2XG4A 5J11C 3CMGA 3IS0X 1P4LA 1TPXB 1OCWL 1WLHA 1IGJA 3TA3B 3GSQA 4YXLL 4OZGF 1EHXA 2YUXA 4ZXBA 1ZVHA 2VDOH 1NGPH 5DS8A 5GRUL 3WFDH 4ZPTB 1MUJB 4U1LA 2XYCA 4IOFC 1FBIL 1KJ2H 4YDVA 1AE6L 2A77L 4ZO8A 2NZ9D 1IAIL 1T5WB 1KG0B 3A67L 1K8IA 3QDME 1QSFE 3S4SB 3WKNA 4WI8A 3EDDA 2LABA 2F58H 1A7RH 3L3IB 3NABH 3V6OE 1KB5B 3DBXA 3R8BB 2JKXA 4MA8H 4M43H 4LRNH 1LILA 3NGBB 4R4ND 3UYOD 3PDOA 1F4XH 4F57H 4Z0XB 3O3EB 4FTVB 2R0ZL 1JZ3A 3CFBA 5GGRY 5D1XA 1MCQA 2DS4A 2VLJD 4U6HB 3V2AR 3L3JB 1M6OA 3DURB 4C4KT 1A4KB 5CZXC 4EOWH 3B9DA 4HZLA 6CGTA 1KB9J 1Y0LB 1X6LA 1JHLL 4PRIE 4RAUB 3FQRB 4OD3L 2IPUG 5IBLC 3RI5K 4W81A 3OGOE 2XI9A 1I1YA 2DBJA 4F3FB 3F5WB 1KEMH 4JY5L 1AXIB 2ARJA 3EJYC 3BWAA 1R5VB 5D1XC 4KI1A 2AV7A 1I9RL 3T2NL 3LEYL 4ZDHB 1N5AA 1DL7L 1XF2A 3MMEB 5HYIA 2EIEA 5D7IA 5FUOH 3L5JA 3EOBB 4ZSOA 3IAPA 5ILTH 5HI4D 5SWSA 1NGZB 1BOGA 1T1WA 2O5ZL 4L9LC 2OTUB 4TRPL 3BUTA 1NCUA 1PW3A 4TPRH 4KZDH 4U3HA 4QXUH 3TGXA 2CJUH 5IWLC 1HHJB 1Q9WB 5GS0D 1G6RA 4ZPVA 4HUXB 5GRXG 2IANB 3IDNB 4OLYL 3EAKA 4JDVB 1NCDL 5GHWL 1QYGL 4EBQL 1Z0NA 5EZJB 4ODHL 2XRAH 4HFWB 5I8KL 3QEQE 3TH3T 5L7XL 4JFDD 5EFIB 1WCBA 4YC2B 5TE6L 1Q9KB 4ODSH 4EQ3A 3A6BL 4QHLA 5GS1B 1EH9A 4I9WD 4ZTPL 1QLFA 4Y4FA 4KK5C 4UINL 1U0QA 4I18B 1IGCL 4KTDL 4LHUB 1RZJH 3RGVA 5HHOE 4MX7A 1ZSDA 1F3JB 4ZS6D 1HE7A 2GTZB 2R29H 4MNGA 5JW4Q 1QR4A 5BZWA 3HE7A 2VLJB 2WANA 2R1YB 4HEPG 3AXLA 4N9GB 2VXTH 3QAZC 4KAQH 4PRDB 1B90A 1UWGL 3LKQA 1V3MA 1DUZA 3BJ91 3VE0B 1PSKH 4OCSH 1F02I 3CMOH 3MV8B 3HI5L 3VXMD 3ULSA 1ZMYA 2JB6A 4RGNE 4MJID 1DVFA 5TF0A 3HE7C 4IEFB 3MLPA 2R8SH 2PR4H 2D31A 3D0VB 3GIZH 3T0ED 2VXSL 4TUJB 5J9PB 2VDNH 4XMLL 3LSOB 4PRNB 5E4EC 2WWMC 5FDYA 4NQDE 3QUYC 3QUZD 3UPRB 4PB9L 2HJLB 5BO1L 3C8DA 1I7ZB 5J56B 4APQD 1VFBA 1JGVL 1JYWA 1CDYA 1TTUA 1P9MA 4Y4HB 4BM7A 1Q0YH 4HX1A 4UILL 3GMMA 4XVSH 1UGNA 2EDRA 4JM4L 1SM3H 3VG9C 1TDQA 3KDMB 4JFDB 4CU7A 2JJTA 5FYJL 3U30C 3C6LD 1DQLL 1D5IH 1BREA 1FAKT 5EIVA 5ID1B 1CXEA 5DRWB 4ZO7A 1W72A 3ET9F 2V2TA 3OKKB 2AJZB 4Q97A 1JPTL 2Q7NA 4KK6C 3WHXA 1P9MC 4UIKL 2CDEA 1P6AB 4FZEH 2X7LB 3D69B 4J3UA 5HHXL 2Z91A 5GS2D 3I75A 3LAFA 1G9EA 2JJTC 3D85A 4FN0A 1A7QH 4UT6L 5D2LA 1XCTA 2IPUK 3PHOB 1HYSD 3WNLA 2GK0A 4M03A 1HHIA 1LO4L 4NQEB 3UTSB 2HP4A 3VGBA 5A2IH 1XGYL 3WIFB 1AQKL 3BPCB 1BBJA 4HPYL 1MI5E 1U3ZA 1UM4L 4PJIE 5KS9E 5MEOA 1ZA6B 1F2QA 1HEZB 4UQ2B 4X6DF 3MRKB 1CT8A 4PP2A 1CDIA 1GGBL 2HLFC 2EC8A 3U0WL 2E27L 2NYYC 3VXMB 2A1WL 2VSDA 4YEFA 3GJFH 15C8H 4G9FD 2AEQH 3NPSC 2LV4A 3WFEL 4MJIB 1BQHG 4OB5H 4HMEA 4XCNB 2HT2D 4PRAB 2J4WL 3ZYJA 4DK6A 1NAKL 1RIHL 2W9DH 3PABA 4HH9B 2R2HB 2WUCL 5TDNB 3QISA 4JQVA 1DFBL 1B0GA 5MEPA 3F12A 4APQB 1HHGB 5F3BA 4X9GA 3WUZA 3OAZK 4HF5H 3S6CA 4LLYB 4OM1H 3FT3A 4HIXL 3MYJA 4L8DA 5D7JA 2EDNA 2K3TA 3V0WH 4NO0D 4U1IA 2UUDH 3LV3A 1HH9B 1ZVSA 5KSBA 1KPRB 4PJ9C 3UEZA 4JQVC 4YR6B 2FIKB 1B4RA 5HDQL 5MHSD 1YPZB 4XNZB 4U1KA 2FJHB 2GW5A 3C2SA 3ZT5A 3TNMA 3OWEA 1A1NA 3NCCB 1DQJA 3B5GA 2YPVL 3IDYC 3DYOA 2BOCB 1OAZH 2R1WB 3KVQA 4MAYC 1S3KL 3LN9A 3MRJA 1U3HB 1ZHLB 2PXYD 4MGXA 2L0DA 1YUHA 1S78D 1DBMH 2YSSB 2J3SA 2A6DB 4P9ML 1J0HA 4FP8L 4UTBH 3W11D 2ICES 5EBWB 2DQJH 5GGVH 2Q8BH 5CJOH 2CDGA 2ILLA 5H94A 3ES6B 3HHRB 4JR9H 4BJLA 1K5NB 4PRPA 1P4IL 4TVPL 4F7PB 1LP9E 3WFCH 3TJHD 5LGJB 2G75A 4CL7A 4XNQA 1QQDB 5K9OA 1ZANH 2X42A 1TNNA 4ONHB 3MLRL 5EO9B 3FOLB 5JXAH 3QDJB 5EN2B 5ISZA 3OAUH 5HPOA 1MCWM 2GIYA 3CDFA 4OZ4A 2XQYG 2F8XC 4YHYC 3O9WA 1ONQB 4R7NA 2O5YL 1H3PL 4PLJD 1CD1A 1RIVL 1RZIB 3EO9L 3MBED 3OG6B 3QDGE 5C08D 4PGCA 1OGAA 3ILQC 4LLQB 1MFNA 5DFVC 4NO2B 3Q1SL 1A02N 1OP5H 2WIIA 3SDAC 3ROLB 3KYOB 1DUYB 4M6NL 3PGCA 4NO0B 5FOBB 3L7FB 3BXNB 5J1TC 4P59L 1YMMA 3FJTA 4YJZL 2Y72A 3O9WC 3FQTB 3QXAA 4LSRH 5GRYA 2ZOKB 1A6ZB 3QFJE 3WL9B 3TT3H 1NC4A 1WIOA 2R1XB 4NP4H 3O3BB 1A9EB 3EJZD 3SDCA 4FQIL 3SPVA 2AGJL 2Y6SD 3BIKB 2VZ3A 5GGSA 3RUGA 1H0DB 1CZ8L 3DXAD 3MJ9L 3RL2B 2PXYB 3ME0A 1X5GA 3LN5B 4IDJH 3O11A 1ORQA 5GRVK 5F6IC 3Q0HA 4N0CD 3HRZB 3P4MB 3MREB 4P3CH 4PIRF 3SDCC 3QIBB 4X6EA 2YZ1A 3MV7D 4YPGA 4L3ED 2VB5A 5KAQG 4KTYA 4PJFA 4Z76B 3DMMA 2IJ0C 4Y2DB 2HJKA 5IHUH 1CICC 4TULL 4O5LL 1EZVY 2C9AA 4H1LB 4MCZB 5C0AE 3BGMB 4YPJA 3VFWA 4EQ2A 3K0WA 4N0UA 4PJXB 3TO4C 4YGVA 5DRZA 1DJSA 3QIUB 5IG7B 3VFRB 2VQTA 3LH2H 4N90E 4P99A 1TJIL 3CVHH 4JFED 3MNZA 4UT7L 2X40A 3AB0B 3DMMC 3HC0B 2EIZA 3MBEB 4JPKH 1D6VH 2DDQL 3VFNA 4BQ8A 5T1DH 2BHZA 1T1ZB 3RVUD 4KDWA 5FIEA 3KLAA 1U92A 3IFNL 3K4DA 1LNUB 5I1CL 4OZHA 5HPMB 1W0WB 4NNYA 2QQLH 5GQBA 4OGAD 4TSBH 2HG5A 4WV1A 5ADPH 3RIFK 4ZS7L 1FZOA 1AO7D 4QNPE 1ZLUK 3L3KB 4TVPD 4XPFL 1MLBB 3RJQB 1YNLH 4D9QD 3HFMH 2EIDA 2HT3C 3TH4T 4HK0B 4RMWA 4O4YL 3RQ3A 3BP4A 1FL6A 2BNRB 1JCKA 3DVNB 4FQ2H 2FSEB 1NLBL 5EUKA 2K9UA 3MRDB 4C56E 3LVEA 5HYQB 3TFKC 3WNPA 1S7TB 2QL1A 3MCKB 4Y1AE 5F7DA 3IU3A 5MERB 3T3ME 3HNVL 4G5ZH 3GMOB 2VZOA 4X9BA 5MENE 3EIFA 2ARJQ 4O2FA 2XTJC 3G5ZB 4HS3B 4M93B 5HGDA 3DX8B 5DD1H 5CGYC 5FYLL 2Y7QA 3H8NA 3RKDD 1LK2B 3SKMA 4AYFA 3WDJA 3L95B 4NRYA 4PJHE 3ESUF 2XQYK 3RWDA 3HCVA 1GIGH 3UBXG 5C8JB 4U1JB 3U82B 5KVEH 3OKNB 4LEOB 5DJZB 3U4BL 1AI1L 4AMKH 4FG6C 3G08B 3N1QC 5MI0B 5JMRA 3K2UL 2HRPL 3CLFH 1NEZB 4KUZH 5HYSG 5JHLH 2PF6A 1RJZB 3QCTH 3QJFB 3TA3A 5KOVC 3OHXB 3SGKC 4JFEB 5EO0B 2B1HL 2FZ3B 3CDGB 2XZAH 3L3GB 2IGFH 4ZPTA 1MUJA 4KJPD 1I9IL 2CGRL 3MOAH 4MAUL 5EIIB 2MQ0A 1GSMA 3LY6A 4ZNCD 1V3LA 3RTQD 1T5WA 1KG0A 1R3HB 5GGSY 4MJ6B 1TPXC 3DYMA 3S4SA 1YEJH 3AY4C 5CKAA 1LWRA 3WLBB 3L3IA 4KZEL 5E2JA 3TA3C 4GW4A 1KB5A 3V6BR 2EDDA 1AO7B 3TH2T 3M45A 3MLUL 2VYRE 2WLZA 3QUML 1QSEB 2I9LB 5CSZB 3O3EA 2D7OA 4FTVA 4Z0XA 43C9B 4IRSB 3SE9L 2ICWJ 4UIMA 4WWKB 5HI5C 4XI5C 4M1GH 4U6HA 3L3JA 3DURA 1A4KA 2PN5A 1R3IH 3LKRB 3WIIL 3HI6H 2YD3A 3OKEB 4PG9B 3MGAA 4RAUA 3FQRA 5GGQL 4G6AD 1BGXL 2MWCA 4M1DH 3IDXL 3Q5OA 3V6ZB 4NO3B 4U4BA 4EI5B 4F3FA 4XP1L 1F4WL 2P5WE 3F5WA 1KPVB 4OLWL 5DWUL 4Q9CA 4NKIL 1R5VA 5B3JE 3ZSSA 4ZDHA 5EOTB 3PHQB 3HRPA 1UCTA 4RA3A 3MMEA 4DCQB 4ERSH 1BFOB 5C0RL 4JHZA 1I9EA 3EOBA 4FQJH 3QCVH 1JGUH 2VDMH 2E9JA 5DO2D 4E5XB 2OTUA 2ESVE 3WJLA 3V9FA 1PZUB 1WBYB 1AFVL 2H32B 5IIEB 4P2YA 1HHJA 2V7NB 4HUXA 4F7TB 1FVCB 2ED7A 2IANA 4GBXD 3IDNA 4JDVA 2EDJA 4F15B 1VGEL 5EZJA 4HFWA 5B8CB 1PFCA 2ARWA 5EFIA 3C5JB 5C6PB 5E2VL 1Q9KA 3HUJB 1QVOB 2B0SH 2MCPL 2BK8A 1KCRH 5GS1A 3P2TA 3WJLC 1CF8L 5IB4B 2BP3A 1FL5B 1F97A 1A1MB 4I18A 5B22A 5HYJD 3DSFL 1T4KB 5FYLD 4LHUA 1F00I 5FM5O 3KWWB 1MCFA 1JWUB 1F3JA 3SQOL 5JTWA 2GTZA 3KXFE 2MKWA 4LPTA 3QHZH 2NY5L 4D9LH 2VLJA 2NZ9C 2R1YA 2WM0A 3NFSL 3EOYG 4XBGB 1RUAL 4N9GA 3BAEH 4WGVB 2XKUA 2AK4D 1MEXL 2OL3L 4I18C 5L8LB 2BVUA 4PRDA 5IR1B 1LQSR 4J12A 1WQVT 2HFGH 3P9WB 4HEME 1YEIH 3VE0A 4RGOL 5GJSH 3VDBA 1CU4H 4MA7L 3MV8A 4R4NC 4XXCA 4YBQD 4LU5L 3S37L 1KTKE 5E2WL 4S0TD 2OJZL 4ELMB 4N1CA 4W4NA 5B39B 3QEGL 4PG2C 1VENA 3D0VA 2WZPD 4TUJA 5J9PA 2OM5A 3MV11 1LO3H 3QHFH 2WW8A 3LSOA 4PRNA 1RULH 4Y19E 5GRJH 1F13A 3W82A 3UPRA 2HJLA 1MCEA 4XXCC 5E99L 4Y16B 1I7ZA 5JQ6H 3F8UB 3VRIB 4YLQT 4J4PA 2R69L 4GBXB 4Y4HA 1A3RL 5ACMA 2CR3A 3KDMA 4JFDA 3SDDB 1GC1L 5HI4C 4KWUA 4ODWB 5ID1A 1ZLVK 4B0MM 1ACYH 5KSAB 4Z7OE 1DEEB 5DRWA 3S37X 3OKKA 2Q7YB 5T3XL 2AJZA 2VMFA 4G6KH 2UZIH 5HYJB 5GS0C 2J8HA 3QDAA 4YE4H 2X7LA 3D69A 1JE6A 4X5LA 5E8NB 3LPGA 3RVVD 2VDKL 3PHOA 4YQXH 4KV5E 4PLKC 5J57B 1XGTB 4DW2H 1SY6H 4NQEA 3UTSA 1FYTB 4PRHD 5ELIA 4OZIE 4JFFD 2CIIB 2FJGB 3RWEB 3WIFA 1YEKL 5KS9F 3BPCA 1BOYA 1FP5A 5I8EB 5JHDE 3JWOL 1EXUB 4QKXB 5T3ZD 1ZA6A 1CQKA 1HEZA 4UQ2A 5IUSA 2EDQA 3MRKA 1I7TB 4MJ4A 3Q48A 3QXWA 3QWRA 1HKLL 4XT1C 1CLZL 2ENSA 4ZS6C 1OAQH 3MCLL 4MJIA 4L3AA 4NWUL 5EOCL 4ODVH 5D6CB 5CGMA 4XCNA 4PRAA 2P5EE 3VFUA 4EKXA 2XA3A 4M7LH 4HH9A 3UJIL 2G9HB 1MH5B 4TSAH 1AGDB 2R2HA 3LS5H 3ULVH 5TDNA 4O2CB 2C1PB 4PJ5D 32C2B 2VLRB 1S8DB 1HHGA 4APQA 1NCNA 1VFMA 1KB9K 4LLYA 1B6UA 5SX4I 4H20L 3T0EC 5I1JL 4LSUL 3IYLW 4M6ML 1KJ3L 1CBVH 2D03L 1J1OL 1HCFX 1HH9A 1MCKA 4GQ9H 4X7DC 1KPRA 1VESA 2YEZA 3QUZC 1AR1D 3H9ZA 3PQYD 3AVEA 4YR6A 2FIKA 5I9QC 4AG4L 1EEYB 3S5LB 1YPZA 3OKDB 4FQXD 2J8UF 3UC0H 4APQC 3VH8B 1IM9D 1XMWA 2FJHA 5FM8A 2QTEA 1MCIA 2R56L 2NLJB 3INUH 5I30H 2BOCA 3CFDB 2R1WA 4M00A 1YYLH 1RURH 3O8XD 1MJ7H 3LRSB 3C6LC 3D39E 2YN5A 1U3HA 1ZHLA 4HAFA 2OXHA 4ZOCA 2CLVB 2YSSA 2RCSH 3N9GL 2A6DA 4WEBH 3P73B 4NDMB 1CLYH 3A0OA 4HKJB 5D7KD 4DZBB 1U8PB 1TJGL 5EBWA 1MRDH 2UWEE 2DYPB 4NOBA 3ES6A 1CL7I 3FMGH 1CR9H 3BD4A 4I8DA 2APWA 4F7PA 5LGJA 2X6MA 4O02H 1HYSC 1QQDA 1N26A 5T1KB 4JZJC 4ONHA 5EO9A 4JO1H 4HK3J 4OLVH 3QEHB 1DEDA 3FOLA 4JPVH 4JO2H 3QDJA 5I1AB 2EYRB 5KJRH 5EN2A 4JM2D 3PE9A 1EFXD 2IQ9L 5L8KB 4X5XB 3QRFM 4BSVB 1ONQA 2O26U 1DBAH 4YK4B 2HH0L 1RZIA 4JAMB 5F3HB 1A6VL 1FGVL 4PJ5B 4NO2A 2GTWB 4Z7QE 3V0AC 4JEGB 4JKMA 1EGJH 3AROA 5EUOE 2HT2C 3ROLA 3KYOA 3MJGX 4WI3A 1DUYA 1MFAL 2AJYL 4NO0A 5DC0A 3EJJX 5FA3B 2W0LA 5FOBA 1B4JL 3BSZH 3BXNA 3L7FA 3ULVE 2VC2L 3Q5TA 3FQTA 3V5HB 5DJAB 4PV9B 1GGIL 3OKYA 2ZOKA 1A6ZA 3WL9A 1OY3B 5ETUB 3QULB 1RUPH 2AABL 2R1XA 1IM9B 3O3BA 1A9EA 1QRNE 1NAML 3UROR 3BIKA 3MRGB 5I1LB 4E41D 4A6YL 1RAMA 3U7WL 1ZLUH 2WWKT 1H0DA 3O8XB 2QADB 1O5DT 3O6ML 5H8DA 3RL2A 4NO5B 4JHBA 4N8VG 3V6FB 2PXYA 2DQTH 4KKNA 2MSPA 2IPTL 3LN5A 1Z3GH 1S5IH 4Q7DA 4QWWD 3HRZA 4IBLT 3D25B 4M5YL 3EYUL 3V4UH 3P4MA 3MREA 1MQ8A 4QRPD 3QIBA 3JV0A 4KQ3L 4PJCE 2X70B 5DUBB 3IVKB 4P3WA 4Z76A 1R5WB 1JN6B 4NFDA 3FRPA 4Y2DA 1IKFH 2OQJB 3DSNA 4WCYL 5TJWK 2PXYC 2EICA 1INQB 3M17B 3GI8H 1S78C 4H1LA 4MCZA 1WZKA 3BGMA 5DJ2B 4U1NA 1KJMB 4PJXA 2K1MA 3W11C 2YUZA 4JM2B 4EXKA 3QIUA 3QIBC 3VFRA 5IG7A 1KEGL 4OF5A 2X09A 1G9NC 4NWTL 5DURD 4P3DB 4D3CH 3IFLL 2GJ6E 4I3RL 3OXSB 3HC0A 3MBEA 1JFQL 1TMCB 4PJEB 4ZUUB 3TJHC 1T1ZA 1CL7H 2A6KB 3KYMB 3H7BB 4MLIA 4TQEH 1LNUA 5JDSB 1OAYL 3SE3C 5HPMA 1AKJD 4TOYL 1W0WA 4WO4D 3HZYB 3WIHL 4MJ2A 1NGYB 2B4CH 3DHMA 1HQ4B 3KYKL 1VGKB 2ITCB 4QNPF 3BEVB 2J5LB 5J0BA 1JTTA 3ZTJG 5L2KB 4PLJC 3L3KA 1MLBA 1SJHA 1A5FL 1V8HA 3MBEC 2O5XH 4CNIB 4LQ1A 4QXGH 2P45B 2DQFB 4HK0A 4JY4B 3LRHA 1E4KA 1INEL 3LZFL 5D1QD 4YDKL 3T0BA 2BNRA 4E41B 5KBNC 3DVNA 4HBCH 1MJ8L 1BZ9B 2FSEA 4HWEH 4KMTH 4ZUWB 5B4MD 2EC9U 3MRDA 1KN2H 3UBXI 2QKIB 4WFGD 1MCSA 5HYQA 1S7TA 4RZCB 3T3MF 1CFVH 2VLLB 3MCKA 3LCYA 5CBAB 2EXWD 3QUKB 4U0RB 5MERA 3I9GL 1PKQB 3GMOA 3CFJB 4UNUA 1T7YA 1ZA3B 3G5ZA 4QRPB 4HS3A 3EJZC 5IQ7L 1KUMA 2Y6SC 3TIDB 4TNVF 5E8DL 2ZG3A 3MUHL 1LK2A 5BQ7B 5D2NE 2HTKD 5CZKA 5AWNL 2BRQA 1IQDA 3UTPD 3L95A 3OPZL 5C86A 5F9WB 1HZHH 2Q3AA 2DMBA 1RUKH 5C8JA 1MIEL 4U1JA 3OKNA 3B8YA 1J8HE 4LEOA 4N0CC 4OSUL 5DJZA 5F7MC 3RU8H 3G08A 2GQHA 3B9KB 4NIKB 5LGKA 1NEZA 1IT9L 4M93C 4OLZL 1RJZA 1IC4H 3IXAB 1A7BA 3QJFA 4X4ME 5I8OL 3OHXA 2FX8L 4JFEA 5EO0A 3EBAA 2FZ3A 4ZOAA 3DO7B 4QHNB 3CDGA 2Z93B 3L3GA 3ARUA 2P24B 2J88H 2N56A 4Q0XL 2D7NA 2AI0H 5EIIA 2ZSWB 2Z31D 1EMTH 1HCVA 1S5HB 1GHFH 3RGHA 3T2QA 5KSVB 1R3HA 3MLZL 4MJ6A 1CE6B 4XP6L 3RWIB 5FKAB 2NXYB 4Y2OA 5F97E 1AO7A 3GO1H 1A0QH 4OZFB 3PGDB 1N0XL 1QSEA 2DM4A 2Y5EA 43C9A 4XBEL 3RVUC 2VDRH 3GKZA 4IRSA 4WWKA 5D1QB 4LASL 1OTSD 3VCLB 2V2XB 4JHAL 3U2SB 5E2TL 1IQWL 3OKEA 1L0QA 1NL0L 4PG9A 4PJ7B 3ARBD 4OGAC 3G6JB 1GAFH 5IROC 3IDJB 1MQKH 2AVGA 4HCRL 4HH8A 3V6ZA 4I2XB 4NO3A 1ITCA 4EI5A 5F1SA 3S3PA 2NY6D 3WFHB 5B3JF 5BVJB 1KPVA 5FHBH 1FE8L 1MCLA 1P7QD 5FUCE 1QA9B 4ONFL 1T22B 5EOTA 3PHQA 3N50A 2EE3A 4DCQA 1BFOA 3N1FC 4OIIL 5C6WH 4QY8A 4E5XA 1FAIL 2AJXH 2DQHL 5TF1L 1JZ7A 4D2NA 3CK0H 3AREB 1C5BH 3RI5F 3FAXA 1WBYA 2H32A 2AJ3B 5IIEA 4Z9KB 3U7YH 1NAMB 1NBQA 2V7NA 4MJ5A 4F7TA 1FVCA 3HN3A 4A6YB 3RKDC 3GKWH 1G9NH 5B8CA 5HHVL 4YHML 3C5JA 3IF1B 4LSVL 3HUJA 2CIKB 1QVOA 4X99B 5AD0B 4YZFE 2PO6B 2Z31B 5IB4A 1BD2B 4M62L 3NH7H 3P0VL 1FL5A 1ZGLM 5FAAA 1A1MA 4NZDA 3D3VB 1OM3L 1J5OH 1T4KA 3CUPB 3MRMB 4GAYB 4H0IA 1T2QL 3I2CH 4F15C 5IB2B 3KWWA 4F9LA 1ZLVH 3LOWA 5B8CC 2Y5TB 4N8CL 4KJPC 4WENB 5FGCB 5FB8B 4LK4A 5F7EL 1DP0A 3NN8B 3RTQC 3MRLB 4S1RL 3TZVD 1MCRA 1RI8A 4XBGA 2IBBA 4J6RH 4GAGH 2RQ8A 2Z8VC 3TT1L 2BFVH 5DA4A 5IR1A 3GHEH 5DHYB 4S1QH 1TIUA 4F9LC 5JXED 4LVHB 1MF2H 3D2UD 4YHOL 4M6OH 2I9TB 1YMHB 4ELMA 3DV6B 4HBQA 5B39A 1FDLL 3GRWH 2B5IC 2WBJD 3P11H 2JCCE 4LFHD 4EUPB 4LSQL 2XA8L 1VKXB 3LRGA 5KVGH 4Q9RL 2WV3A 2H26B 4G6AC 2OK0H 5DJ8B 3ZT6A 1FNEB 3HNSH 1IFHL 5F8RC 4Y16A 4R0LB 1EHNA 2MNUA 1F4YH 5GXBB 1JMZA 3VRIA 3HC3H 5IK3B 2H6PB 3JV4B 4JFYB 4GBXA 4P5TB 3L1OH 3CVIL 5MP6H 4BFIB 3OG4B 4OT1L 4R96B 5EBLB 4X4ZA 3SDDA 4F8TA 5C71A 4ODTL 4LGPB 1MFEL 5ANME 2E7BA 1NFDB 5DO2C 1T0PB 2VZTA 4ODWA 3R8QA 2GUOB 5KSAA 1DEEA 4OCXH 1FVDB 2DRUA 3OF6D 3E6FB 2Q7YA 2P1YA 1ZHNB 1UEMA 5DC9B 4JFZL 5HYJA 1URLA 1K6QL 2YBRB 3SGEI 1NANH 4GBXC 3C08L 5T1LD 2QR0B 5TQ2L 4NBXB 4LCIL 3QZWG 1HXYA 3BRGC 4KV5F 5E8NA 5IFHH 1XGTA 4PLOB 4OZIF 3RY4A 2LTQB 1FYTA 3PP4L 3TZVB 4DGIH 4XNYL 3SHSA 2CIIA 2FJGA 3RWEA 3CNKA 5I8EA 1EXUA 1I7TA 5EU4B 4WEMB 5F9JB 3KPPB 4KY1L 1S9WB 2NY2D 2AV1B 4RAHA 5FUZL 1X6NA 5E9DD 3D2UB 1NLDH 3S8WA 2UY7A 3MA9H 2D2OA 2DIBA 4MDIB 4MB4A 5LQBH 5DJYB 1AXSB 1FNSH 3QI9D 5D6CA 4JN1H 3VWKB 3DRTB 1O7SA 3E2HB 1RPQA 1QFUL 2WBJB 1HYRC 5EU6E 1FFOB 1RY7B 1FO0H 3C60B 2G9HA 1MH5A 1AGDA 4M7JL 3QUMA 4O2CA 4YBQC 2FECL 4K23L 3WE6B 2C1PA 32C2A 2VLRA 1S8DA 4P2OB 1YY8B 2AJVH 5C0BB 2J6EL 2YKLL 3BZDA 3LDBC 5F9OH 5IFAL 4GKZB 3WXWL 1T7XA 4NKOB 5TE7L 2FH6A 1D7FA 4ZNEA 3WNMA 2IMNA 2QQKL 3PXHA 1G6RH 4PJGB 4GG6E 1OLZA 3IU4L 4XXDB 3U6RB 5IB3B 1EEYA 4JB9L 5TE4H 1X5HA 3S5LA 3OKDA 3U9PH 3VH8A 4AEIH 1A3LL 4MNHB 3MV7E 3IETB 4YAQB 1H15B 5DI8B 1SEQH 1F11B 2NLJA 3WD5L 5T1LB 3NA9H 2D4DA 3NTCH 4P2RB 5I1HL 3MLWL 3HZMB 3CFDA 3FQUB 4UBDD 1EO8H 2MPAH 4HUMB 3LRSA 4LQFL 1IZKA 1VDGA 3FFCE 5FA4B 1JNNL 3RWFB 5DHXB 2CLVA 2A38A 2WUBH 3P73A 3LIZH 3QXDB 3K8MA 4NDMA 4HKJA 2UWEF 4DZBA 1U8PA 3MX0A 5TPWH 3GM0A 3HPJB 2DYPA 3ULUL 1G7IB 3BT2L 2NY2B 2FATH 5E9DB 3AGVA 4ZUSB 3RVVC 3QI9B 5T1KA 4XHJD 1X4XA 3QEHA 1V7NL 2DJUA 5I1AA 1HIML 2EYRA 3W2DH 4HGMA 2HA1A 2YUWA 3O4LB 3D0LB 1YEFL 4P9HC 5I1KH 1F45A 1TZIB 4LEXH 4X5XA 4BSVA 1LDPL 4UDUB 4NKQB 4QLRA 4RQQB 4JAMA 3RRQA 4Z7QF 4PJ5A 1P7HL 5JO5B 2GTWA 4IRJB 5EUOF 4HS8H 1VSCA 1NCWH 4MVBD 3E3QC 1NCCH 3ULVF 1WAAE 4JREB 5FA3A 4P23D 3P0GB 3FN0L 4M7ZB 4X4XB 1HK6A 5DRXB 3V5HA 5DJAA 4WUUB 5FYKH 4PV9A 2ZSVB 4B41A 3FRUB 1ZGLB 4WI9A 1YJDL 1A9BB 3O0RL 4GRWH 4RAVB 5ETUA 1L9MA 4OGYH 3QULA 5D7IE 2NY3D 2NY5C 1IM9A 3VGEA 4ZSOE 5IV2B 1Q1JH 3UO1H 2Z0BA 4XGZB 2UVEA 1A6UH 3MRGA 1RVFH 4R8WH 4AEHL 3MV9B 1AJ7H 4MSWB 1RQ5A 3O8XA 1ZGLP 1RIUH 2IFGA 3VXTB 4NO5A 3V6FA 1AR1C 2BCKB 4MNQD 4OM0L 3D25A 4FQXC 3KYNB 1ZXQA 5E1AB 3CPLB 5IT2L 3ARSA 4FNLL 4PJCF 4JVPA 1XIWD 2B2XL 3TN0B 4CN4A 1AQDB 2X70A 5DUBA 3SE4C 3IVKA 5D70L 1UWXK 1R5WA 1JN6A 3PWUB 3O8XC 2QADC 1MCNA 1YEDB 5D7LD 5E08L 2GAZB 1INQA 4HC1L 3M17A 1JPFB 3VFVB 3W39B 4OQTH 5DJ2A 1KJMA 4JM2A 4RDQG 1KC5L 4MNGE 4OI7A 3S34H 1MFDH 1TJHH 1IBGL 3ILPB 4P3DA 2AXJA 4WGWB 4ZFFB 3K74B 3GK8L 1QHPA 1A8JH 4NKDA 3OXSA 3RFZC 1GC1C 4ZUUA 4PJEA 5DUPH 3H42L 3LN4B 1RHHB 4RISL 4DGYL 2HYMA 2X4RB 2A6KA 1AD0B 3MLYH 1AGEB 3H7BA 3KYMA 3QCUH 1XR9B 5JDSA 3MOBL 3QRGH 4PTUB 1U8QB 1U3JA 5DMGD 3HZYA 3WBDA 1NGYA 4JM2C 2VRAA 5E6ZA 3THML 1HQ4A 4X6DB 1VGKA 2ITCA 4LARH 4X7SL 3BEVA 5IFJB 2IBZY 5L2KA 1OD7A 4CNIA 2AK1H 3QEUB 2KL6A 3BPNC 4JY4A 4JQIH 4TNWF 2MHAB 3OJDB 2X4QB 2BNUB 2FX9H 3VG0L 4E41A 2RHEA 3D48R 4M1CD 4MDJB 1BZ9A 4UB0H 3CLEH 4ZUWA 5IMKB 2QKIA 2VLKE 4KH2A 4BQ6A 1S7SB 5FYKE 3GMQB 4WJ5A 3WHE1 4RZCA 2VLLA 4R4BB 1KIRB 4GRWE 3QUKA 4MNQB 5KANG 2H1PH 2OR8A 4BUHA 1PKQA 3STBA 5HXMA 5J4MA 1YQVH 4NCC1 3CFJA 3R06B 4QEGA 3RIFF 3O6LH 4CDGC 3S88H 1ZA3A 3VGDA 4UTAH 1N8ZB 5C07E 3L6FB 3TIDA 1XIWB 2QSQA 3VXPB 3MBXH 2VZ1A 5E6YA 2HTLD 3NACL 5BQ7A 1D5XB 1J1PH 5D7LB 3EZJB 4U6VL 4JKKA 4AIOA 3UTOA 2BVOB 4HIEB 4U0RC 1KCSL 2BXYA 3D1MC 4QWWC 1G0DA 2JLLA 3B9KA 1P5VA 4K7PL 4FZ8H 5EOCJ 3FRPG 3IXAA 1DLFH 2I27N 3BRDA 5D2LE 3VFPB 4K7FB 4PS4H 3DO7A 4QHNA 1BX2B 2Z93A 1N4XL 1BF8A 2P24A 3H9SE 2WQRA 5HJ3B 1NMAH 1BF2A 4JFOB 4MQ7B 2ZSWA 1OD9A 4P2QB 1S5HA 5IQ9B 5KSVA 4J23A 4XPTL 2WLYA 1CE6A 2VWEE 5F7LB 3RWIA 5FKAA 3U9UB 43CAB 3NIDE 1JYNA 5KOMC 4RWYL 1M1SA 4H0GA 4IRZH 1CVRA 3ZTJH 2YK1H 4OZFA 3PGDA 3TYFB 2NY0D 3I02B 1MWAL 4JG1L 5F9AC 5FO9B 2PYED 1SJEB 4KJQD 4LHJB 5LGHH 5D1QA 3VCLA 2V2XA 1XFPA 3U2SA 4K7PX 1K85A 2H41A 2D7PA 2E5EA 4BZ2L 3ARGB 4U1GB 1IGML 4LDLB 4PJ7A 5EC2B 3G6JA 1UA6L 3IDJA 4LAQL 2BSSB 2LFGA 3CX2A 3ZKND 2GITB 1UKTA 4I2XA 1SMOA 3RZCD 1OB1B 5K9JL 4XNXL 3WFHA 2H9GB 3BQUB 4NJAH 5BVJA 2ICWI 1OWWA 4GXVL 2HKFH 1LK3H 5EA0L 1QA9A 5JR1L 5D8JL 4YXHH 3QPXH 5D1QC 1FGNH 1T22A 4R7DB 3TBYB 1T6VN 1I75A 4Z7NE 5B4MC 1MRFH 4G9DB 4QRRD 1HILB 3ZKMD 3ZMRA 2FX7L 2BNQD 3L3DB 5ALBH 1FCGA 2EXWC 4NKMB 1VB9A 1EFQA 3DX7B 2DBLH 1UACH 4TSCL 1UCBL 1L6ZA 3AREA 4KQ4H 1H5BB 2AJ3A 2ADFH 1NAMA 5KAQF 4XPBL 2JB5L 4A6YA 3TP4A 1YYML 5FCUL 4DK3A 1I3GL 4GKNB 5B38G 1JZ2A 1XAUA 4XC1H 1AD9B 2HTKC 3S35H 5CUSH 4X6FB 5DTFB 3IF1A 2AAVA 4YZFF 2HWZH 2CIKA 4X99A 5AD0A 2PO6A 3DETD 2Z31A 2EE6A 5LXGH 1BD2A 5HTSA 1L7IH 2XN9E 3VXRE 1LEIB 4PRPE 3MUY1 4O51B 3D3VA 3MROB 4F7CB 2DD8H 2MQCA 3CUPA 3MRMA 1NGPL 4HIHB 1OW0A 4XPAH 4GAYA 1BJ8A 1X5XA 3SJVE 5IB2A 5I19H 1WZLA 3MLTB 4ODBD 4JDTH 1KJ2L 2NY0B 2Y5TA 4K8RD 1SYVB 1P4BH 3QNYB 5ISZE 4DOHB 5FB8A 1RD6A 4YHLH 3MRCB 3SE8L 2Z31C 1K2DB 4MD5B 1KIUA 3NN8A 2F58L 1A7RL 3MRLA 3NABL 1MAMH 3RX8A 1B3JA 1OGAE 4MD4B 4HPOL 1OW0C 1LHZA 1BJMA 4Q6YA 5DHYA 1BWMA 1F4XL 4JG0H 1CK0L 4F57L 1KXQE 4NC0B 3P9MB 2V5SA 1WCQA 3RZCB 2A6IB 2I9TA 1YMHA 3ECBB 1MNUH 3GSXB 4GMTH 4IMKC 3CCHB 3BPLB 4J3TA 4PJBE 3EHBD 4EOWL 3DV6A 5C0CB 3O41B 3QDMD 1QSFD 4L3CB 3V5DB 1BWWA 1OTSC 5A16B 5JZ7D 1WBZB 2JCCF 2JJSA 1NPUA 4S1SH 3GIVB 4AT6B 5DDHB 3ARBC 4LRIC 4EUPA 4LKCB 1VKXA 4NZUH 4HULB 2H26A 5IBTH 3GBMH 1CDGA 1UYWL 1KEML 3PQYE 5DJ8A 1FNEA 2WBWB 4QOKB 3RVXD 1U8IB 1J05B 4R0LA 2NY6C 4EIGB 3R0NA 1EHLL 2NY7H 1AHWB 1GZPB 1UC6A 2H6PA 5IK3A 3JV4A 4L4VB 4JFYA 1ZT4B 5FUOL 1Q38A 1RZKH 4P5TA 2FRGP 2XZCH 4BFIA 5ILTL 4PRID 3UZVB 5C0FB 4WU5B 2DI8A 3VMPA 3EYOB 1YC8A 4R96A 5EBLA 3BH8B 4TPRL 1BJ1J 2I5YL 4LLUA 1NFDA 4KZDL 4QXUL 1JGDB 4HFUH 4P46D 3KPMB 2GUOA 3DX6B 5LBSL 3X12B 1IGIH 1TCRB 5CAYB 1FVDA 2GKIA 4HLJA 3F58L 3LMJL 3E6FA 4PJFE 1ZHNA 1DBBH 5ALCH 4BA8A 2YBRA 4G80B 1HHHB 2F8OA 2QR0A 3DI2B 4P5TC 1QFWI 2V6HA 3ZL4H 1NGWB 4N0UE 5JPNB 2PETA 1J11A 3P30L 4NC1E 4HMCA 4KPHH 3JSSA 5CBEB 1FLRH 3L5WB 3TZVA 1KB5H 1L9NA 3T65B 2EEAA 3FN3A 3H7LA 3QEQD 5EU4A 5F9JA 2NY1D 5JXEA 3KPPA 1S9WA 2AV1A 4OZHE 3T1WA 3D2UA 5K9KB 3ALPA 4MDIA 3G6DH 5DQ9B 5A2LH 5DJYA 2VZSA 1AXSA 3QDMB 1QSFB 5IW1B 2LTQC 1HNFA 2VXTL 4KAQL 3RY5A 3VWKA 3DRTA 4KUCF 2E9WA 3DX9B 3TZVC 2VH5L 2WBJA 1FFOA 4DVRL 1PSKL 4OCSL 5HHOD 3E8UH 1A14L 1OLLA 3C60A 4Y89A 5IJKA 1CFQB 2NX5B 5JXEC 5DMIH 1GGCH 3WE6A 2JTDA 1S7XB 2R8SL 2PR4L 4P2OA 4K94L 1F6FB 1YY8A 2A9NH 3I6GB 4FFYH 3GIZL 5C0BA 4K2UH 3HNTL 2VDNL 4J8RB 2FBOJ 3LD8C 1I9JH 1GOGA 1GOFA 3E2HC 3S36H 1NUNB 4PRIB 2WBJC 4GKZA 3A6CH 2J2ZA 3KPSE 5EPMB 5JOFB 3TWCH 3TPKA 5DD0H 4NKOA 4JHWH 1PQZB 4HCRA 1ZT1B 1IC7H 2XICA 3BKYH 4NT6B 4GG6F 3R1GL 1TVDA 1FZJB 2F53B 3QB7C 4QCIB 1ZVYA 4PJGA 4RGND 4XXDA 3U6RA 5IB3A 4LOUD 1UKQA 4I0CC 1Q0YL 1NMCB 1S7WB 4XVSL 1JWSB 1Q9OB 1PBYA 2FD6H 3IETA 4YAQA 1H15A 1SM3L 5DI8A 1F11A 1QACA 4QTIH 3VI4E 3ZKQD 3HE6D 4P2RA 4CVUA 3HZMA 4NQDD 3BZEB 3FQUA 3FT4B 2EE2A 2V5RA 5CZVL 3WJJC 4Y0GA 5FA4A 3RWFA 4DN3H 1K9TA 3QXDA 3BIBX 2EXYD 2W07A 4FZEL 2W60B 1J12A 3O2WH 3HPJA 4O2EB 4Q2ZB 1G7IA 5D72H 2NY1B 1MRCH 5E9DA 4POZD 4E42B 1V5JA 5CS7A 1QFWH 4ZUSA 3VXSE 3QI9A 4KROB 5DJDB 5EU7C 1R3JB 1CG9B 2Y1VA 3NAAL 4OUOA 1FFPB 4POUB 2FLBT 1UWXH 2VZUA 3O4LA 3NIFE 3D0LA 4FTVE 3VDAA 1HOCB 15C8L 2AEQL 1KJ2B 3HMXL 1N5YL 2NY2C 2P44B 4UDUA 4OB5L 2QSCL 4RQQA 4AY0A 4KHTH 5I1GH 4CAGA 3V4VL 1GPOL 4JVWA 1UH2A 5JO5A 3QI9C 4IRJA 4H88H 4L29B 4Z18A 2VXVH 4Z95H 4Z7WB 1MI5D 2W9DL 2F74B 1YEHH 4XWGH 3BW9B 3ARFD 5AZEH 2Q1EA 4X4XA 1EA9C 5DRXA 3PIQB 4WUUA 2ZSVA 1G7LB 3FRUA 3ZE2E 1ZGLA 3MA7B 5D7IF 4JE4B 1A9BA 4RAVA 4DKDC 1IJ9A 3H3KA 4OM1L 4OLXL 5IV2A 2FL5B 4XGZA 2X1XR 4HKZB 4WDIB 3OAYH 5C0GB 2VAJA 3MV9A 3HE6B 3BYTA 2IF7A 4MSWA 4YHKH 3PDDA 4KRPB 3Q6FB 1EAJA 4XAKE 3VXTA 1L6XA 4I77L 4M7ZC 4QTHB 5FO7B 4W70A 2BCKA 1UT9A 3RPKA 1DQMH 4XPHH 3BHBB 4OCYH 3GDBA 4WTZA 4R97B 5E7BA 3DI3B 4NN6B 5CIPH 3KYNA 2BSRB 4HSQA 5E1AA 3CPLA 1GJIA 3VW3L 4HQQH 4NNXB 3TN0A 1AP2B 3UXFA 1AQDA 4L4JA 3U0PB 2CK2A 4UBDC 3PWUA 5ERWB 4OD2B 2DWEB 1YEDA 1OCWH 3NVQA 1MPAH 4HW6A 2CH8A 2GAZA 4UTBL 6FABL 2XV6B 4UMGA 4JRWA 1JPFA 3VFVA 3W39A 4G7VH 2DQJL 2Q8BL 4Q9BA 3B3IB 1ORSB 5JW5B 1IC1A 4JR9L 4XCCL 4DQOH 3FQXB 1BVLB 3WFCL 3ILPA 1QBBA 4ZFFA 2H45A 2VERN 4DVBB 3A67H 1ZANL 1Q0XH 3LN4A 1RHHA 2X4RA 5J7CC 2D0HA 1AD0A 1AGEA 4R26H 1XR9A 4XHJC 3OBAA 1YY9D 4PTUA 1U8QA 1WK0A 4NQCE 4PJIB 3CU7A 3QQ9D 4WRLA 4X6DA 2R0ZH 5IFJA 5AYQA 4KMLB 4LPYA 5I66B 1J0ZA 2AEPH 4NQSB 1F6AB 3QEUA 1EIBA 2MHAA 2FJFB 3OJDA 2X4QA 5MEQB 2BNUA 2VR4A 4MVBC 4OD3H 5CEYB 1C5DB 5CP3H 2P4AB 4MDJA 1DE4B 1FSKB 3B83A 2V17H 5IMKA 1OAKH 3O81A 1S7SA 4GRWF 3GMQA 4JZOB 2AJUH 3QDGD 4R4BA 2HJFB 3TT3L 1KIRA 5GJTL 4MNQA 5D5ME 1RJLB 4NP4L 3T2NH 3JZ7A 5J6HB 3X3FL 4BSWB 1DL7H 2M1KA 4WHDA 1FIEA 2VDQH 3R06A 5I71B 2J6EA 2NY3C 1ODAA 1HINL 5K59E 1N8ZA 3L6FA 1XIWA 5F44A 4OLEA 3VXPA 3TCLB 1WZ1H 3VFGH 4U1MB 1D5XA 2YD6A 4IDJL 5D7LA 3QFJD 2BVOA 4HIEA 4P3CL 3BZFB 1NCDH 4EBQH 3AS1A 3OR6B 3ETBF 3TM6A 3LS4H 4L5FH 3UPCA 5D2LF 5L7XH 4XCYB 1XIWC 2PCPB 4WTXA 3VFPA 4K7FA 1MIMH 1PLGL 3UTSE 1BX2A 4AEFA 4UNTA 1RUQH 2ZWLT 1U2HA 5HJ3A 4MQ7A 4QHUB 4JFOA 1IGCH 1NGQH 4KTDH 2VE6B 4P2QA 5IQ9A 3RZWA 3LH2L 3CVHL 3NIDF 3K4AA 5BW7A 4OZGE 3U9UA 43CAA 3SDXB 3MOQA 3FZUD 5F9DC 1D6VL 4NN5B 4Z7UB 1LP9B 3J8F7 3FFDA 4MZ2A 5E8PB 3TYFA 3I02A 3HPLB 5FO9A 4L9DA 5C0AD 1HH6B 3MNWB 1SJEA 1UWGH 4TSBL 1JUFB 4N90D 1R5IB 5DMGC 3HI5H 3ARGA 5EC2A 5EULV 3GJFB 2BSSA 3HFML 5F7UA 3QDGB 2GITA 3QXVA 2FBJL 2VJXA 1OB1A 2WP3O 4RMQA 2H9GA 3BQUA 2OMNA 5KSBF 5IVXE 3BDXA 4LF3B 4OFKA 4Z7NF 3WSQH 2MMXA 4R7DA 2VXUL 5HDLA 3TBYA 4M1CC 4PB9H 2C5DC 4L9LB 2X10A 1U8OB 4G5ZL 4G9DA 1HILA 3QFJB 1GVIA 5C6TL 5JA8B 3HLAB 4K3GA 3L3DA 3ZE0E 4NKMA 4BQBA 3DX7A 2FIRT 1E6JL 3HAEG 1ZTXL 4UILH 3MLSH 5DD1L 5EZLB 1H5BA 4JM4H 1T6WA 5ID0B 1JV5B 3BKJH 5FYJH 1WBXB 1U8KB 4C56D 2HTLC 2RR3A 4XP4H 4EZMA 1AD9A 1GIGL 1UQSB 4Y1AD 4X6FA 5DTFA 7CGTA 3TNNB 5KVEL 3C5SB 5HD8D 1FIGL 5MEND 1X3DA 3VD7A 2MFNA 1V7MH 4KUZL 5EWIL 1EZVX 3QCTL 1LEIA 1WT5A 4RMVA 3EW3B 5HHXH 2N7BA 4O51A 1GCFA 5KZCB 3MROA 4F7CA 5F1KC 4HIHA 3MQIA 4C83B 4N9OB 2IGFL 4UT6H 1S7QB 1NUGA 3MLTA 1RHFA 1GXEA 2GSIB 5DVKA 1SYVA 3QDJE 2BY1A 3QNYA 2VKWA 4HC1A 3I84A 3JWDH 4L1HA 1PY4A 3MRCA 1YEJL 1K2DA 1Z9OA 4MD5A 1F58H 4UOW0 1W8NA 4KK9D 1WT5C 4MZ3A 4RRPG 1IARB 5IM7B 2E27H 3U0WH 1FFRA 4OZFG 4ETQB 4F9PC 1J1XH 3TBWB 1I7UB 4MD4A 4NSKB 3BOVA 3WFBH 3VD3A 3T0WA 2ZNXA 3P9MA 4P2CG 4IHOB 3RZCA 4PJBF 2NY0C 2A6IA 5DT1H 4M1GL 3ECBA 3GSXA 1JNJA 2IBGA 2R4RH 1NAKH 1RIHH 5C0CA 3O41A 4KJQC 3HI6L 4L3CA 4LDEB 4OCNC 5A40E 1DQDL 5IESH 5A16A 5E4EB 1WBZA 3ZHKA 5C2BL 4HJ0D 3GIVA 5C3LD 4AT6A 1DFBH 3QUYB 4M1DL 5DDHA 4DWHA 1NDMB 5ECJE 4LKCA 2F15A 4Q74A 2IMMA 3ZKNC 3IDMB 1L0XA 3K81A 3VD4A 5H37G 3SOBH 3RZCC 4QOKA 1U8IA 5FO8B 1J05A 4HIXH 5F21B 1L7TH 2CXGA 4PBXA 1MVUB 4KHXH 3LPWA 1AHWA 1GZPA 2FR4B 2YS4A 4L4VA 4LMQI 5T1MB 1ZT4A 3VG9B 3MXWH 1HSBA 5IKCB 4FQJL 4D0DB 1YNTB 3QCVL 1JGUL 2VDML 5C0FA 4WU5A 3EYOA 2Q87A 4NZJA 3BH8A 5KVDL 4G8GE 2AW2A 3ZKMC 2P5WD 3VFSB 5MENB 1JGDA 3M1BB 3KPMA 3K80A 4FMFA 3DX6A 3X12A 4PJFF 1TCRA 2Q76B 2YPVH 5JNYB 1DDHB 4YHZL 1C5CH 5FYJE 4YUEL 5IJVB 2LVCA 3UCRA 3Q5YA 4G80A 1HHHA 4X8JB 3REVB 4PGBB 2I60H 3KJ6H 1NGWA 2B0SL 4PJHB 4P9MH 1KCRL 1UZ8B 5JPNA 3BGAA 3ZDYE 2DQIH 2ESVD 3O45B 3DETC 1YC7A 5CBEA 1C16B 3PWLB 3L5WA 4BYHA 2YA1A 5FYKU 4WHCA 3VGAB 4ZODA 2JJWA 5ESQB 3T65A 1EHAA 1BFVH 1KCVH 1PY9A 2OTPA 4OZHF 4B7IA 2NMSA 3QHZL 2VXQH 1IVLA 5K9KA 4K8RC 1FFNB 1XF4A 3MRBB 3CSYB 5DQ9A 3BGFB 1I8KB 1B2WH 3BAEL 3QDMA 1QSFA 2VQUA 5IW1A 1I7RB 4JFQB 4D9RE 3CVHB 3DX9A 4WTWA 2O5YH 1H3PH 3BFOA 5E6ID 1YEIL 1RIVH 5F93C 1CU4L 5J13B 4P0DA 3GFUA 4X83A 4NRZB 3Q1SH 1CFQA 5DVNA 2NX5A 3KXFD 5BS0E 2BNRE 4XP5L 1HN1A 1S7XA 3I6GA 1T89A 1W2KT 4PJDE 3EHBC 4M6NH 3N06B 5I18H 1KTRL 1BVKB 1LO3L 2BRRH 2X5PA 2PKDA 3MCG1 3QHFL 4J8RA 5JZ7C 4TUOB 1JNHB 2E6PA 4PRIA 3V6OC 5GRJL 3FAWA 2ZKHL 4HT1H 5EPMA 4HUUB 3GZKA 4PJ9B 5JOFA 3V7AE 1E6OL 1QLRB 1PQZA 1ZT1A 1I3VA 4NT6A 3KJ4C 5HDOA 1FZJA 5JQ6L 3A6OA 2F53A 4FQIH 4QCIA 2AGJH 5ESAB 3RVXC 2X4NB 2M2DA 1JWSA 3IDYB 1CZ8H 1Q9OA 2IADB 3MJ9H 3VI4F 3AFLA 1CGWA 3HG1E 2EH7H 4U2ZA 2ZNWA 4G43B 4Y19D 1IEAB 3BZEA 5TQ0L 1D5ZB 2ZUTA 2H2PD 5CEZL 2BVPB 3LQAH 5JORB 4P46C 1PDKA 4G6KL 1PVHA 4LCUB 4NJ9L 1QLEH 1NMCC 4YE4L 1WFUA 2W60A 3TYGH 4O2EA 2X1PA 1PD6A 4Q2ZA 5FV2A 1CXLA 1QPXA 2P42B 3BWUC 4GRLD 4W68A 5CMAA 2Z8WC 4TULH 4YQXL 3FB8B 1CDCA 2EE9A 4E42A 3WO4C 3RNQB 5EU3B 5DJDA 2XXMB 1CG9A 1TJIH 3GBLA 1FFPA 1U9KA 5FDWB 1HSAB 4UT7H 3NIFF 5F7KC 4YHYB 2EECA 4OD1H 3OGCB 5FGBC 5HY9B 3BE1H 5IB1B 2VITB 3FOMB 1HOCA 2XWTB 3I6LE 4HXAH 1OAQL 3IFNH 1KJ2A 2NY1C 3KXFB 5I1CH 2ZG2A 3T4AB 5CFHA 3SDAB 1TITA 5KN5B 4PJAE 1JBJA 4ZAKD 1PZ5B 4L29A 4Z7WA 5JHDD 2F74A 4N0RA 4XPFH 2XKNB 3QO0B 3ULVL 3LS5L 1GH7A 3E6HB 3BW9A 2CUIA 3G6AB 3MRFB 3ZE2F 5I2IB 1OAXH 3PIQA 4O4YH 2Y06H 1G7LA 2FH8A 4NHCL 4KDTC 3MA7A 1S9YB 1Y6MR 5L9DH 4UDTB 1A3QA 2P5ED 2FL5A 4XCEB 2OZ4H 2E7CA 1KOAA 4HKZA 1VEMA 4WDIA 4U7MA 5C0GA 1CBVL 3HE6A 4Y19B 3RDTD 5DYOB 3Q6FA 3G9AB 2YMXL 4QTHA 5D6DA 5FO7A 3WUWG 3UC0L 1MLCB 1G0XA 4NYLB 4RGNC 3BHBA 5DMKB 4LOUC 4PY7B 2ZCLH 3S3SA 5DZOA 5J6GB 2BSRA 5I30L 5JOPE 1UXSB 3HUJE 4V1DD 1YYLL 4J7RA 1RURL 4PGJA 1AP2A 5A2FA 4WW2B 4LMQE 3HE6C 2P8LB 1BECA 1JHKH 3U0PA 1BPVA 1CICB 5ERWA 4OD2A 2DWEA 2YPLE 4K8RH 3MLXL 4WEBL 3PUCA 1CLYL 3AC0A 4LSPH 2B1HH 1MRDL 5CP7B 2EXYC 3QUXD 4BQ9A 3B3IA 2OCFD 1ORSA 5JW5A 5GRVL 2EIBA 1CR9L 1I9IH 3FQXA 1BVLA 4MAUH 4MQTB 1WZMA 3D39D 1UVQA 1OPGL 4O02L 4DVBA 1WUNT 4HHAB 4POZC 2GJZB 5C70A 2P43B 4JO1L 4JPVL 1FZKB 1QBAA 1XGUB 4OZIB 5KJRL 2GFBB 1T2XA 3C6SB 4ZAKB 4URTB 1CDUA 3FO1B 3G04B 4PJIA 4BFEA 4U05A 1EDQA 1K3ZA 1I3UA 3QUMH 2IG2H 1DBAL 4DZ8B 3VDCA 3SE9H 2GHWB 3DNKA 2GY7B 5I66A 4NQSA 1OVZA 4W6WB 1F6AA 3WIIH 4KDVA 4F37F 2L4OA 2P5EB 5MEQA 5GGQH 5CEYA 1C5DA 1H3TA 1RZJC 3OKLB 3IDXH 1DE4A 3WMSA 1X9QA 3RDTB 5IMOB 3SCMD 1F4WH 4QRRE 5JW4M 3ARFC 5CD5D 4RX4D 4JZOA 1TQBC 4OLWH 5DWUH 4TNVK 2HJFA 4XTRD 1RUPL 1C1EL 1RJLA 5GS0L 5J6HA 5M7QA 4BSWA 3G5XB 1FJ1B 2YZ8A 4FQ1L 5LAXB 5ICXB 5K59F 4XAWH 3WXVH 5C0RH 4N0YH 1J87A 2FEDD 3TCLA 4PFEA 1FSKC 3ULVD 1SQ2N 5E2UH 4U1MA 3T0AA 2GJJA 1Z3GL 1S5IL 1MFCH 1EVUA 4DUVA 3V4UL 3BZFA 4IJ3C 3E0GA 3KPRE 3OR6A 5ESVB 1QRND 3QUXB 5I71C 5GGTL 1JPST 4EVNB 4XCYA 4HWNA 4J3XA 2O61B 3UTTE 2PCPA 1IKFL 1ZK9A 3D39B 4XH2B 1OF2B 1CF8H 2ZUSA 5DEGB 1EUTA 5KG9B 4O58H 1H8SA 3AM8A 4Q9QL 4QHUA 3DSFH 4YHIB 2UZYB 3LEXB 2VE6A 1I4FB 4ZUVB 3EFDH 4D3CL 1LE9B 3SQOH 1NMBH 3OZ9H 1FQ9C 3UPAA 2DJSA 3SDXA 1S9XB 1G9MH 5J12C 4Z7UA 4ORGB 1LP9A 5CLWA 3PL6D 3K3QA 1H3UA 4LNRB 5E8PA 3NFSH 3HPLA 4TQEL 3F7VB 3MJ8B 1S9KC 1SHMA 3AM8C 4MMXC 3ZYIA 2OL3H 3GM8A 1HH6A 1D6EB 3MPCA 4UU9B 2B4CL 4NUGH 4NC2B 4JJ5B 1YY9C 3RWCB 1JUFA 4HUVB 2JIXD 4MA7H 1R5IA 3SCMB 1Q72H 3QQ9C 4POYA 2VLRE 2GJ6D 3S37H 1KLGB 1Y18B 2O5XL 1OTUD 4NN5C 3QDGA 3HMXA 4QXGL 1QEWB 3OJ2C 4MS8D 3MJ6A 5IVXF 1FPTL 2Z8RA 3EYVB 5JIKA 1QBLH 2JJVA 4HBCL 4ZFGL 4HWEL 1X5LA 1T0MB 3MLVH 4LF3A 3FHQA 2VNCA 3K4ZA 4ZNEE 2NCMA 3O3DB 4K9EC 1CFVL 4L9LA 1U8OA 5E99H 3TIEA 4OBSA 3ZE0F 4U0QB 2AXFB 3TLRA 3QFJA 3HC4L 1BVZA 4C55A 3HLAA 1AY1H 2EKJA 5IWLA 4DGVL 5HDBE 1QHOA 2R69H 4F2MB 5F7WC 2BY3A 5E56A 3IDUA 1QRNB 4JFPB 4YDIH 5EZLA 1A3RH 2RFXB 3B8SA 1VHPA 3X11B 4XMKH 1JV5A 1WBXA 2W0FB 1U8KA 1WISA 4JRXE 1DBKH 1HZHL 1UQSA 1RUKL 5F1IB 3CFEB 4GG8B 3TNNA 4AL8H 3C5SA 3RU8L 1SVZA 2M26A 2CPCA 1X4ZA 4RDQF 5DVMA 5AYUL 4M5ZH 1IC4L 1JPGB 4O9HL 3TESA 3BKCH 1DBJH 2DKSA 5CJXC 2LVEA 2W91A 4RA0C 4C83A 1S7QA 2VDKH 1CFNB 4GJTB 1YEEH 3AUVA 2VL5B 2DLTA 1YNKH 2GSIA 3PWVB 1EMTL 1YEKH 1J8HD 4J3OC 4BKLB 1MCPH 3JWOH 1U93B 4WFEE 3AMLA 1U91B 2VIRB 1IEHA 5IM7A 2DLIA 2P7TB 4LVOC 1CLZH 2AQ3A 4ETQA 3TBWA 1I7UA 3GO1L 4NSKA 1F8TH 3FZUC 4OI9A 3AAZB 5K93A 1RUMH 4NWUH 3QJHA 4NPYB 5EOCH 2VDRL 1BQHB 4IHOA 4R6UA 1A6WL 1SYSB 3X3GH 1DSFL 1G7JB 3RNKB 1KGCE 1GAFL 1KTLB 4XC3L 1MQKL 4Z7VE 2C3XA 3QUYA 1LE5B 1FC1A 2E6JA 4Q58C 1NDMA 3JUZA 1J0YA 4QGTA 3O2DH 2DTMH 4GAFB 3IDMA 3U4EB 3KHQA 3CXHJ 4YX2H 3BMVA 5FO8A 3HAEH 1T1YB 3NCYS 4LPUA 1MVUA 2GK2A 2FR4A 3TJEH 5T1MA 5ACZB 5GSVB 3P40A 5IKCA 2F5BL 4D0DA 1YNTA 1P69B 2YC1B 1QSVA 4I13B 2AJXL 1CE1H 3RWHB 5I73C 3H3PH 4X7TB 3VFSA 3M1BA 4LGRB 2R56H 3U7YL 1RZ7H 1YECL 5DJ6B 1EJOL 2Q76A 5JNYA 1DDHA 5IJVA 1G9NL 4X8JA 3REVA 3EDEA 4PGBA 2Y07H 1P2CB 2CKBH 1EO5A 3ZDYF 4PJHA 4XWOD 4RBPK 5T3XE 1UZ8A 5HI3D 4EI6B 3BEWB 4XNUH 1J8HB 5HD8C 3O45A 1C16A 3PWLA 4WI6A 3B2VL 4PJEE 2PTUA 2X9XA 4OZFH 1RU9H 3RPIB 1YA5A 1JF6A 4LLWB 4UQ3B 1EEUA 5CILH 3PF2A 1MOEA 1FFNA 4FQPA 1MCWW 3MRBA 3CSYA 1I8KA 4GAGL 1I7RA 4JFQA 4WY7H 3CVHA 3GHEL 4RMRA 5L2KE 4KK9C 1FNGB 3VGAC 2HH0H 4CUCA 4S1QL 4K9EH 3E1F1 1A6VH 3KGRA 1MF2L 2DQUH 4M6OL 4NRZA 2DICA 2VQ1B 5H37H 4PJDF 2IEPA 1KFAH 3T0EB 1R3LB 2NNAB 5EDXA 5L88H 3BGFC 1MJUH 3P11L 4Y5XC 2X44D 1BVKA 3ZYZA 2EDWA 3QSKB 4TUOA 4MQSB 1JNHA 3EO1B 3IB4A 4HJ0C 1GGIH 2B7DT 4HUUA 3QUZB 4PJ9A 4MD0A 3HNSL 4HWZB 5J13C 5I9QB 1QLRA 2APBA 2AABH 1NAMH 5ESAA 5GGVY 1KCUL 1SMAA 4L4TE 2X4NA 2BVTA 4DFIA 3L1OL 5BV7H 2IADA 5F89B 4D0BB 2B1AL 2BX5A 4MAYA 3C6LB 4G43A 1IEAA 1CS6A 3P4OB 1OQOA 3RA7H 3QPQD 2BY0A 3EYUH 2BVPA 5JORA 3SKOB 2VLME 2J8UE 1JVKA 4LCUA 2IALB 5KSUB 5D71L 2QV2A 2R2BB 5J89A 2RGSA 2QHLA 2YN3A 4WCYH 1IAOB 5DSCB 4ZYKB 2R0KH 3FB8A 4MLSA 5I17B 3L5HA 3PWPE 4DUXA 4JZJB 2EEDA 1IL1A 1A7OH 1SEBB 3S9DB 5CJQH 3C8KB 5TGBB 5EU3A 3RNQA 5JIIA 1KEGH 3GSNL 5FDWA 3RHWF 1BJ1H 5IEKB 1HSAA 1LO0L 4LPCA 3LQMA 3RL1B 2BJMH 4I3RH 3IRZA 4NZTL 3GEWB 4LHQB 1JFQH 3OGCA 1VPOH 1XGQB 5HY9A 3UJTH 4JFHE 2VITA 3FOMA 5IB1A 1NLDL 2XWTA 3KHOA 4G9FB 4EEEA 3KXFA 3MTRA 1CFSB 4B7LA 1RJYB 4TOYH 3T4AA 3WIHH 3UTZB 4PJ7E 4PJAF 3SDAA 5KN5A 4QYOB 1HWHB 2OMBA 2E9IA 1FO0L 5F1OB 2IAMD 5E6IC 2NXZD 4LAJH 4PB0H 2DLFH 4R4FL 2XKNA 1A5FH 3QO0A 1RZGB 3E6HA 3G6AA 3MRFA 5I2IA 1ADQH 1WEJL 1D5BB 2X4TB 3FT2B 1SBBA 1S9YA 7FABL 1ETZB 4UDTA 4TUKL 4U7SA 2GEEA 5F9OL 1A7PH 2FGWH 4BSJA 2OJEB 5EU6D 4XCEA 2JELL 4KUCD 3HI1B 3KNBB 5A3ID 5C2UB 1Z0MA 4Y19A 2D9QB 5DYOA 2ZPKH 3KS0J 1OT1A 3ELAT 4LGSB 3FKUS 5TE4L 1RK0B 4HUWB 1MLCA 5JPMB 1ZAGA 3U9PL 4AEIL 4NYLA 3UYPA 5DMKA 4FFZH 4PY7A 5J6GA 2ERJB 3HUJF 3MRQB 5AWNH 4GO6B 5ICYB 2JF1A 1UXSA 5CD3B 1EO8L 1CDHA 3KPQB 4EXPX 1FNAA 2MPAL 1S7VB 2XY1A 3OL2A 4LLAA 4WW2A 4FA8A 1EV2E 4PD4J 2P8LA 2C3HA 5ANMB 1BD2E 3UBXB 1CICA 4OSUH 2D7TH 5GGUB 3JXAA 1F3DJ 5F6HJ 4M61B 4DEPC 2WUBL 2H2PC 3LIZL 2EO9A 3D3VE 4G6ML 4LIQH 4YFDB 1TVBB 3TO4A 1IT9H 4OLZH 2DLEA 2D7QA 5HYSB 4QHMB 2FX8H 3MGOB 5TPWL 5CP7A 3WDHA 5GISH 4X8XA 4ZTOL 4KJYB 4WW2C 4GRLC 4ZOEA 1JWMB 3FFCD 4HHAA 1BEYH 2GJZA 3MLZH 1UWEL 1FZKA 2G5BB 4K3JH 1XGUA 4XP6H 4ZXBD 1JJUA 1RMFL 4OZIA 3P0YH 1I85C 2GFBA 3C6SA 2APXA 4ZAKA 2LQRA 3FO1A 3G04A 1RFDL 2NXZB 2DQGH 5I1KL 4LEXL 4TNWK 4DZ8A 2DQEH 4XBEH 5C08B 4ZQKB 4ZD3H 3T8XB 5FYJU 5DD6B 1FG9C 4HS8L 1NCWL 1IQWH 1E4WH 1NL0H 2P5EA 5EU6B 2Y25A 1NCCL 4W4OC 4KJWD 4ZAKC 5DVLA 1I1RA 3OKLA 4HCRH 3RDTA 5IMOA 2ZUYA 4XMPH 3N1MC 5FYKL 4OJFH 5JUEL 1FE8H 4OGYL 1VCAA 4CDHA 4ONFH 5J1SC 4N5ED 3UO1L 3G5XA 1FJ1A 1A6UL 5LAXA 4OKVB 5ICXA 3SKNB 1NGXB 1RVFL 3CH1B 5BOZG 3H2WA 4OIIH 3V5KB 4EN3D 5T5FH 1T2JA 3DXAB 2C3VB 4UZGA 5C0IB 1I3RB 5DK0B 3ESVF 1FAIH 4U6TA 2GY5A 3RDTC 1EEZB 4JO3L 5C09A 1XGPB 5FECB 4GG6B 4G3YL 2L7UA 2N7AA 1TZGL 3CAFA 3MV7B 5ESVA 5SWSD 3QUXA 4L3EB 5CJ8A 3SGKA 4EVNA 5HHVH 4YHMH 3HR5B 2O61A 1TXKA 4LVNC 12E8H 2M8XA 3D39A 3LB6D 4XH2A 1OF2A 3FFCB 5DEGA 4M62H 4LIQE 5E70A 3AS3A 5KG9A 2QQQA 4OQTL 4YHIA 4D0CB 3LEXA 1G1CA 5DS8B 3AY4A 3C2AH 5IGXL 2CQVA 1I4FA 5BJTB 1VFAB 3RY6C 1T2QH 4HKXB 1MREL 4PTTB 4ZUVA 5TDOB 1MFDL 3DGCR 1CXFA 3QUXC 1BBDH 1CGSL 3JUYA 1LE9A 1S9XA 4Y4FD 2WP3T 2EZ0D 5IVZB 3V52H 4ORGA 5DUPL 5F7EH 5HHNB 3EOAB 3S97C 1QD0A 1GGYA 4LNRA 3QCUL 3F7VA 3MJ8A 3SBWA 1BM3H 4HIJB 3VMOA 3RGVD 1NUDA 2KDGA 1D6EA 3TT1H 3RAJL 4UU9A 3GSNB 4ONGH 1CD8A 4NZRL 3RIAK 4JJ5A 2FNBA 3RWCA 4HUVA 4LARL 1N6QH 3SCMA 1A1OB 4YHOH 2X4SB 5GRZA 5C0BE 3HTLX 1KLGA 1Y18A 2VSCA 3VFTB 1QEWA 1U95B 4PUBL 4NNPH 3EYVA 3SO3C 3SBWC 2FX9L 2LU7A 5F96H 1N64H 3BDYL 4UB0L 3EYQD 1T0MA 4EN3B 3CLEL 4Q9RH 1FO0B 5DD5H 1Y0LA 2W92A 3J7HA 3O3DA 5HYEA 3SCMC 1DVFD 5CD5C 2ZOLB 2AXFA 5HDBF 4WI7A 1N5AB 4XTRC 2DAVA 5J06A 5ABDE 2XACC 4QRUB 4F2MA 3CVIH 4P2RE 1QRNA 4JFPA 2RFXA 2F5AL 3I85A 3X11A 2D3VA 2VN4A 8FABB 2W0FA 4ODTH 1MFEH 2FEDC 2VLKD 4U33A 1NGZA 3ULVC 2BDNL 5FYKD 4LLMB 4JGUA 5F1IA 1ZKAA 3CFEA 4GG8A 4GKOA 2Q86B 4ALAH 4JFZH 3ROOB 1K6QH 2D0GA 1Q9WA 2A74B 3NMEA 1JPGA 1DLFL 4NBYB 1FV1B 5T3ZL 1H3WM 4P9HL 5C07D 3F7YB 5HYFA 4PS4L 1CDBA 1MY7A 1CFNA 1NMAL 3I50H 2K7QA 2VL5A 3PWVA 1AH1A 3N85L 3RTQB 2VDLH 2B8OT 3O4LE 3REWB 1LEGB 4BKLA 1U93A 3BN9D 3LQZB 3WKMH 5CHNB 2DQCL 5DK2B 1RSFA 1FYHB 1U91A 2VIRA 1HXMB 2P7TA 5C0JB 4RBPH 1C7TA 4BK5A 3AAZA 1M4KA 3TBSB 3PL6C 4NPYA 5E5MB 3H9SD 1BQHA 3W9EB 1SYSA 4TN9A 5LGHL 3DLQR 4PG2A 3VGFA 2B5IB 4ZUTB 1RZFL 4M9OA 5F7YC 1G7JA 3RNKA 5HVHB 4Z7VF 1KTLA 4WUUE 2FHBA 2MCG1 3V79C 4M7JH 1LE5A 4CW1B 4K23H 2LAGB 1C8PA 1OTUC 3ARQA 1KJVB 3U4EA 4PPTA 4NJAL 4OFIA 3T0VA 1LK3L 4HJJH 4MS8C 3MV9E 3QPXL 1T1YA 1DLHB 1WIUA 3WXWH 1FGNL 2PW2B 4R3SB 1CIDA 1T03L 3OR7B 5TE7H 4R90H 5GSRB 5ACZA 5F7FA 5GSVA 1MRFL 2VLKB 2YC1A 3TPUB 1WFTA 4GRWB 3RWHA 1LO2H 3T0XA 4LSTL 4X7TA 4KQ4L 5D7JD 5EZOH 1U3YA 2ADFL 5DJ6A 4JKPH 2BY2A 4M48H 8CGTA 2A9MH 1IKNA 4FXGB 1IRAY 5I1HH 3MLWH 5C07B 2APFA 4X80H 1OHQA 4LQFH 3S35L 4FABH 5CUSL 2XPGB 1P2CA 1CTOA 1DTUA 1INDL 2I25N 2QHRH 4DKFL 2OR9H 4EI6A 1OARH 3D18B 3BEWA 4S11A 5LXGL 1MCHA 3LHPL 1J8HA 3ZHLA 5DJXB 1MFBH 2DD8L 3ULUH 5GGTA 4PJEF 4XPAL 1FN4B 1IKNC 3P9LB 5D2LB 3MXVH 5I19L 2ENYA 4LDOB 3RPIA 3SQBA 5D2NC 3WS3B 5JIPA 1IILE 5CJ5A 1P4BL 4PYGA 3H9SB 4UQ3A 4YHLL 4I5BB 1V7NH 3NFNB 1CT8B 3C87A 1YEFH 2XN9D 2AK4B 3G5VB 3VXRD 4PRPD 4DKEH 1FNGA 1IM3B 5DFVD 2XWJB 3SJVD 2HAZA 4QXWA 5D7SH 3VXMA 2KZWA 3PNWB 1MNUL 5CJBA 2VQ1A 5ISZD 4H5SB 4MQXD 2Y36H 1N3NB 4QHKJ 4XP9L 3LDBB 4S2SB 3O9WD 5K9QG 1R3LA 2NNAA 3T0EA 4S1SL 3T4YB 1OGAD 1BP3B 3EO1A 5IBTL 1QO3B 3GBML 2E9BA 3SGDI 3QUZA 1D9KD 3GSVB 4HWZA 2R0WH 3BMWA 4JRYE 5IBUG 3KLHD 2YD4A 1FG2B 1RZKL 2AERT 5LCVH 3C09B 5BRZE 2B4CC 5I1IL 5F89A 4V1DE 3HR6A 1KELL 4D0BA 2CLRB 3EDFA 1ZS8B 3C6LA 2XIDA 4N8VB 4NOFA 3P4OA 2FHFA 3SDCD 1QR1B 4I1NB 2OP4H 4F58H 5J8OA 4WUKL 4GXUM 3SKOA 1WJ3A 4OLUH 2B2XH 2IALA 4KGJA 5FUCC 5KSUA 2R2BA 1IAMA 1T3FB 3GBNL 3ZL4L 4H0HB 3ALXA 1IAOA 3IDIB 3L7EB 4YH6A 5DSCA 4HC1H 4ZYKA 1NQBA 4P2QE 5J1AB 4KPHL 4PV8B 4XWOC 1JNLH 4Y5YB 5I17A 4TTGA 4JZJA 5HI3C 4PRHB 1SEBA 3O2VL 4AH2B 4JFFB 1KC5H 2EDHA 3C8KA 4QT5B 4X9FA 5TGBA 2XN9B 5HGGS 3VXRB 3ULUE 5LKNA 4Y4KD 3I3EA 1IBGH 1CWVA 2VISB 5IEKA 2ZCKL 3U1SL 3RL1A 3GK8H 4HMDA 1AC6A 5HHQB 1MJJB 4ACPA 3SJVB 4ZMAT 1H3GA 1XGQA 1K5NA 4DGYH 4G9FA 1MHPH 5I6XB 3ZDXE 1OP3K 1CFSA 3MOBH 5F1NB 1RJYA 4PJ7F 4NQTA 5EOQL 4ZFZB 3UTZA 2XT1B 5I0DA 4ZFOL 3THMH 4LCWE 4QYOA 4HDIB 1FORL 1CFBA 4X7SH 4HV8B 4UT9H 3EDKA 1X5AA 1D9KB 1RZGA 1GGCL 1HKFA 4RFOH 2HFTA 1RV6X 4LLQA 4NCDA 1D5BA 1UM6L 2A9NL 4FFYL 3TCXA 4PJBB 2X4TA 3FT2A 4Y5VC 2WBKA 4K2UL 1NC2D 4HIIB 1ETZA 2ZJSH 3KPLB 3KR3L 2XQBH 1R6VA 3S36L 2FB4H 2OJEA 3L3HB 5GS3A 3HI1A 3KNBA 1MAKA 3C8HA 5DD0L 5M94B 4JHWL 5T33H 1IC7L 5D96C 3CXHK 2E7MA 2CD0A 2XNAB 3PQYB 4Y88A 4XX1E 4B50A 3UAJD 3PV6B 1AXTH 3QDHA 5EZIL 1E28B 1RK0A 4FQXB 3SGDH 5KW9H 4HUWA 5JPMA 2W9EH 1QFWM 2FD6L 3QIWD 4C54A 4K3EL 3NACH 4I48B 3GHBH 3MRQA 5ICYA 4YWGL 5CD3A 3KPSD 3KPQA 1S7VA 5SX4H 4L8CB 4G7YL 5ANMA 1NCAL 3UBXA 1KCSH 1ACZA 4DN3L 4U3CA 5GGUA 4M61A 3QPQC 4K7PH 1FHGA 1TVBA 3RKPA 4PJFB 4Y4KB 5IP4A 3STZB 4QHMA 3KG5A 3MGOA 3MUJA 3O2WL 2ERJC 4NFCA 4OTXL 4X7FC 5D72L 1REIA 5CINL 2XZQH 4KJYA 1EERB 4ENED 1M7IB 1QFWL 1JWMA 3SE3A 4XPTH 2G5BA 4M8QB 5CSBA 2YRLA 1EFXB 1K4CB 4XVUD 1MSPA 3IKCB 4RWYH 4Y8AA 1T0NB 1NBYB 1FRGH 3UYRH 1MWAH 5C08A 4ZQKA 5C0CE 1PG7W 1U2CA 5EH1A 3RVTD 3T8XA 1J7VR 5I1GL 4HUNB 3BPNB 4AENB 5DD6A 3VXSD 1NC2B 3LKNB 3HMWH 1UJ3C 4FXKB 1MAJA 4Z95L 1IGMH 1UA6H 1YEHL 1Z5LB 5EU6A 1JRHL 4LAQH 4XWGL 3PWNB 2IAMC 4FTVD 3SN6N 1ERNA 2NXZC 5AZEL 3Q6GL 1NCBH 4QOKE 4QRSB 5HHME 1IC5H 2O93L 3PGFL 5CWSB 4XNXH 1F6LL 2HLAB 3BKMH 1LMKA 4GXVH 2R4SL 4L4VE 5EA0H 5I15H 3S96B 2AJSH 4ELKB 1PEZA 3QIWB 3GRWA 4KI5E 1DN2A 2KPNA 4OKVA 1NGXA 2QLVB 3BPOC 1DANT 3CH1A 3CXDL 3V5KA 4NM4H 3T2PA 4YHKL 2DL9A 3KPSB 3DXAA 2C3VA 5A3IC 4KRNA 1A6AB 3QO1B 5C0IA 1I3RA 2W38A 2FX7H 3GMPB 3GI9H 5DK0A 5LVEA 5DC4B 5F72S 1J88A 1XGPA 4TSCH 5FECA 4M02A 4QXTB 1QP1A 3WDIA 4XPHL 4OCYL 3X14B 4GG6A 3SY0B 1AIFB 1TCMA 1IAIM 5FHAL 4KVCH 3ZTNH 1YYMH 5FCUH 5ITBH 1I3GH 3H9YA 3DX8A 3MV7A 4HQQL 2ICWB 4L3EA 4HZAA 5JIHA 2WNGA 5JW4N 3HR5A 1ZLWK 2E8YA 4XVTL 2GCYB 4XAKD 2OBGA 1MPAL 1KULA 3MYZA 3QHTC 1G84A 3FFCA 3K2MC 4Y7MA 3MACH 2IAND 3F7QA 3KPNB 4G7VL 2Z35B 4D0CA 3MJ7B 5BJTA 4FMKA 1VFAA 4HKXA 4PTTA 5TDOA 3CFCH 3SDYH 3VRLE 4DQOL 1N0LA 5DURB 5TFSH 4OGZA