4UILH

Crystal structure of quinine-dependent fab 314.1 with quinine
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
222
structure length
218
Chain Sequence
AVQLQESGTVLARPGASVKMSCKASGYTFTSYWMHWVKQRPGQGLEWIGAIYPGNSDTSYNQKFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCTRERGLYYGSSSFDYWGQGTTLTVSSAETTPPSVYPLAPGTSSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSQTVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB 314.1
total genus 29
structure length 218
sequence length 222
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilH02
4IOIA 4PJEF 4DWHA 4PB9H 5CEXA 3M1BA 4LARL 1TPXB 4XVUD 1XCQA 4XMPL 5IQ9B 4PJ5D 4LSSL 2WK2A 4EXPX 4X7DC 2OS7A 1ED3A 2P47B 3RVUC 1QRNE 1T2QH 2F74A 3CH1B 3HFML 4KHXL 4Z77A 2PF6A 2Z93B 1A7QH 3RTQA 5BVJA 2IPTH 3U2SA 5BV7L 5D72H 5IT2H 3D0VA 1LDPL 1LP9B 5CSZB 1I9RL 4MNQA 3OKLB 3C08H 4R7NA 1CLYL 2WW8A 1G0XA 3FFDB 2PXYB 1JPTH 3E6FA 3FO0H 4K7PH 5HYJE 4JZJC 5EIIB 4UINH 4G5ZH 5DJXA 4CJ1A 3BW9A 4OCXL 2AJXH 1KIPB 3G5VB 2ZOKA 5IG7A 1J8KA 4YWGL 1MWAA 1RK0A 2XOTA 5TE7L 3K4DA 5E1AB 1ZHKA 2CSPA 3NCYS 2EE2A 4KTEL 3DXAA 2VDQL 3RNQB 5J13C 2QKIB 3EOAB 4D9RD 3EO9L 5DK3A 3SDXE 4EI5C 4GBXA 5C0ND 1YZZA 3QJHA 1JYVA 2VWEC 4LKXB 4NO3A 3RDTB 4PREB 4EQ2A 1TQBB 2XA8L 3EYSL 1R3JB 1CFVH 2YRZA 1ZT4A 1MELA 2VLME 1W0WB 3CX2A 2Z4QA 3P4MA 4G6KH 3U7WH 3BUYA 3L3DB 4GXVH 5FB8B 1WBYA 1QLEH 2VDKH 4KDTA 3QSKB 4XPAH 5F8RC 1G0YR 3O2DA 3JWOC 1VDGA 4QXUH 2CMRL 4JFHE 1EFXA 2CR6A 4YIQB 5FGCE 1NL0H 5ANMA 1DTUA 1X5ZA 4WEMB 3MSPA 3HB3C 3VWJB 4CMHB 3DROA 2AV7A 4PGBA 3DYOA 3MNWA 5CUSL 5HY9A 3CXDL 12E8H 5L9DL 1J0IA 3P9WB 4NHCH 2GJ6D 1YEEH 5F1IB 5JTWA 5E2WL 4EBQH 1FYHB 1PJ9A 4IRSD 3FCTB 5DMKA 5GGTA 2I07B 1FYTA 4MAYD 4WY7H 1L0XA 1FNFA 4PJ8B 4JM2F 3CFBA 1VB9A 1I7UA 2VQUA 1FAIL 4ZFGH 3F7RA 1OAQH 1LMKA 2JJUA 1LO2L 1I85C 2HLFD 3ZKMC 1PSKL 3ZE2F 1ZA3A 5H35A 2BNUB 3KLDA 3VWJD 5TE4L 5CHNB 3I3EA 4K2UL 5FO9A 2Q3ZA 5KSAD 3IFOB 2EYRA 3RY5A 1UJ3C 4OIIH 2VDMH 4P9HC 3O0RH 5I1DA 5I8EA 3THMH 3SDAC 1AKJD 4XWOC 3B9KB 5CD5D 3BMWA 3BAEL 3IKCA 5DDHA 4DJMA 3JTTA 5F6HI 4PGCA 4XHJC 3QWRD 1CGSL 1RZIA 4MA3B 3S34L 1VPOH 4LCCA 1GGBH 3VH8A 4XXDB 4F2MB 3I75A 4HJGA 5D2LB 1BZ9B 3ARGC 3QUXA 3LPGA 2EIZA 1UZ8B 2X2YA 1RUAH 2ICCA 3MRIA 1XAUA 1NEUA 2Y07L 4YHYB 5ANME 4JRXE 3QUZD 5JW3H 1D5BA 4HXBH 3IJHB 4ODTL 4YDLC 5K9QI 4PB0L 3TZVD 4FQHA 1A5FH 3MRJB 2OR7A 2PNDA 3IU4H 4WGWB 3T2QA 2F54D 4TPRL 2UWEA 3QDJE 5LJYH 3BO8A 1NCBL 5HPMA 1RUAL 4N9GB 1RZJH 3NACH 3WUWB 3MA9L 1D9KA 3L1OL 5DYOA 1MIEH 3T4YA 1J86A 5TFSH 4GKSB 1FNAA 4PJEA 2UZXB 3CVHA 1Q38A 4LLQA 5IHBA 5E03A 2JCCB 3H3PH 1RU9L 4NO0A 3RL2B 1JWUA 4PJEB 2VISB 4FXGB 2QSCL 3LMJH 1UKTA 4GG8A 2AS5M 1D5MA 1MH5A 4OZFA 3RGVD 4N90E 5IMLA 5IEKB 1FIEA 2F5AH 5T1DL 1M7IA 5JHLH 3TA3D 1IGIH 5C0EB 3OXSA 5BRZA 4M43L 4ZPVB 1J05A 1QA9B 3GGWA 2B2XL 3GM8A 3L5JA 5IMKB 3TJHD 4ZUWA 4JE4B 2JJSC 3SDYL 3W0WD 2R0KH 5JXEA 1NKOA 1E4KA 4EJ1C 3LKNA 3IDUA 5HXMA 4JFDE 2RAMA 1ZS8B 4P4KB 4Z8FH 3I6GB 3N85H 2P24B 1WC7A 5A2LH 4OZIE 4OV5B 5C0GA 1Q9WB 4PS4H 1R3IH 3P30L 4HF5L 2DQUH 2X10A 3MRLA 4YBQD 3HNTH 3SKJL 1HSAA 1YNLL 4PLKC 5T33H 2DF3A 2PYFB 5F72S 5DJAB 4NQEB 3E2HB 1KXVC 1X5IA 4JRXA 4OGYL 3UTQA 3IFNH 4YHML 3CCHA 2ADGA 1MFDL 4NNXA 1OD7A 2EDNA 2F15A 2P42B 3Q5TA 1MCCA 1UQSA 2W0PA 3GJFB 5I0DA 5EZIL 4WUUD 4LIQE 2W07A 2J8HA 5H94B 3PGFL 1TMCB 2JJVA 5GZOC 2NY5C 4RAUA 3DX6A 4J3OC 4YAQA 3LEYL 1I7UB 1EX0A 4NSKA 4XWOD 1E6JH 2MKLC 3KR3L 4QRUB 3U9UA 4FFVC 1ORSA 1A9BB 1EBAA 3G6DL 1I7TB 5HHOD 2Y06L 4IRSA 1MFBL 4U2ZA 1RZGA 4HIIA 5JW5A 1JWMA 2FX9H 3MV9B 2HJFB 4R90L 5DRWA 3D85D 3BH8B 3HMXL 1H3VA 1U8HA 1MWAL 2HMID 1KLFA 3MGTA 4LPVA 3TPUB 4RDQF 5JXED 2NNAA 4H5SA 1SEQH 3EOBA 4JFPA 5IVZA 1FGVH 5ISZD 4NQVA 5J3HD 5I1AB 5JUEL 4B50A 3EYQC 1NJ9A 4DCQB 2Z8SA 3GSOA 1N2RB 4M93B 3PABB 4MSWB 1AXSA 1JHKL 4OM0L 5DZLA 1WF5A 4Q9CA 4YIQA 3DVFA 3GSRA 1FFRA 3KYOA 2ZNWA 1ZMYA 1H0DB 3QQ4A 1RFDH 3KPSB 3SE9L 3K80A 4I3GA 1U36A 3NPSC 4LLVA 1KENH 4P9ML 2D0GA 2ORBL 3ARDB 5AD0A 4WFFD 4QXGH 1QFPA 2Z4QB 2UUDK 1R5IA 1TNMA 1J18A 1NGYA 1HYSD 1R3JA 3ZDXF 5ESAA 5KSAA 2CK2A 3LN5B 1OPGH 5HYSA 5IW6A 1LO3H 2YEZB 4GRLA 5FM5M 1DQJA 1HIML 5F7HA 3ZKQD 4GAGL 3AVEA 3SDCC 5E1AA 2ADFL 4LBEA 1PW3A 1YEHH 5IW1A 5MEPB 4R2GC 3RZCA 4QRTA 1F6AA 3FOMA 1CGTA 3VFOB 1I3RA 3OB8A 4MCZA 4XNXL 3VFMB 5IOPB 1YDPA 1PQZB 3UAJC 2MOVA 4UV7H 4TUOB 5TF1L 1QOKA 5ID1A 3LCYA 4JG1L 3FFCA 4PY8J 3RWCB 2WSKA 4CMMA 5I66B 3ARGB 3DYMA 5DJZB 5JO5A 5FUZH 4LLDB 4K3DH 3AB0B 5T5FL 4NJ9H 1SYVA 3CVHL 1OP5H 1SEBA 3FOLA 3RIFK 5IKCA 4RA3A 4WW1B 1XGRA 2J4WH 5I30H 3DSNA 1TENA 5E7FA 4L4VE 4IOFC 5HPOA 4RMSA 2QSCH 1S9YA 3X12A 1IFHL 1I1RA 5K9OA 4JFFA 4RMTA 3E3QE 3QDHA 3VXPA 4M1CC 5HDLA 1E4XI 4DKEL 2A6IB 4PRHA 2Q87A 5E6IA 3MUJA 4ODVL 1N59A 3G5YA 1PVHA 3O2DL 1PBYA 2IANB 1YEEL 4Y4KD 4HFUH 4GAJL 5C0JB 4HWEH 5CJXC 4Z7UE 4G7VH 5BS0B 4JN2A 3QEQE 2APBA 3VD3A 3FTGB 3TT3H 5B8CB 3D9AL 9CGTA 4UILH 2Z35A 1C8PA 1KPRB 2UZIL 1BFOB 3PP4H 5IFJB 3UPAA 4F3FA 1CDHA 5CMAA 4RFNB 2FJFB 5DD0L 3U36B 3HNSL 3TH4T 3MR9B 3HCVA 3C9NA 4PJCE 3SOBH 4CN1A 5HYIA 4KI5C 2VXVL 4WV1C 1EHLH 1RJZA 2BMKB 4PS4L 4AM0B 2H2PC 2P5WA 4MJIB 3FQWA 3GRWA 3BX7C 5D7LB 2EDFA 4CN4A 1TVBB 5T1KD 5EU3B 1S7RB 3DI2B 2XTJB 3QUYB 3UDWC 1OARH 3T77A 1IMHC 2IAND 4BQBA 2LV4A 3V5HA 4NQDB 3RVWD 3HE6C 1YNKL 1FCCA 4JRXD 1Q8MA 4L8SC 3KXFA 4NKOB 3FB8A 3G5XA 4KQ4L 4IIQA 3EFFA 5ITFB 1CXHA 4OQTH 1YNTB 2J5LC 5HI4C 1YY8A 3OKOB 3KJ6L 5IHUL 1AR1C 3MUGB 4RFNC 1HIMH 2OJEB 3WYRA 3UBXA 2BSED 2W1NA 4U2YA 3T0AA 5FM8A 1I8MA 3TO2B 1MI5E 4PV9A 1G7IA 2GTWB 3P73A 2D0FA 3TCLB 4EI5D 4YDIL 3UJIL 1IAIL 3VD4A 5I18L 1MJJA 1QBLL 4KHTL 3N9GH 1LO0H 4R4FL 1DR9A 2CDFB 3FN9A 3LKSA 2W59A 5LGJA 1IM9D 4R3SA 2QHRH 3MTRA 2NLJA 3CVIH 2ZUWA 3C5ZB 3W0WE 4J1UB 3SJVA 5IP4A 4YHPA 2LU7A 2Z91A 3VD9A 4MCYB 4LLDA 3L3IB 1AD9A 4HAFA 4CMMB 2NY3C 2OL3A 1Q1JL 3ZZ1A 4HKZB 5GS1B 1FDLH 3H7LA 5E08L 5B4MC 3C5ZA 4RAVB 4HG4J 3NCYP 1OTUC 4EKXA 1S9XA 1FLRH 2K3TA 4R3SB 5D8JH 1B4JL 1I8IB 3PP3K 5GGTH 3MV8A 1A7PL 3W9DA 4CRPA 1I1AA 2G9HB 4Y5YB 3DURB 1TZHA 1N0LA 2DOCA 3OHXA 1B0WA 1OSPL 1QSFE 1HZHL 5MEPA 2EE6A 4JQXA 4PJIA 2I5YL 3HI1B 5JORB 1FC2D 5GGTL 3L3GB 4LEOA 4DW2L 1CLZL 1ND0B 2ATKA 1RUMH 5GISL 1N5YH 4ODUA 4YZFE 5A16A 1HSBB 2MCPL 4FQ2L 3HR6A 3QXDB 4OCYL 4OZFG 4K3DL 1MCDA 3OGCA 3MV11 2ED8A 4MNGB 5D71H 5BRZE 4OIAA 4QGYA 2H6PB 1DQMH 2AXHA 4X6BB 1OTTC 4I9WD 1A6AB 4YQXL 1WT5C 2VAJA 5BV7B 1XF3B 2QADD 3K8MA 5FHAL 3AREC 4LSSH 4X9HA 3WN5C 3BPOC 1NGPL 1HHJA 1N26A 2VC2L 4FFYL 4WW2F 3VE0B 5I15H 2FR4B 5ENWB 4APQA 2X7LB 2FO1A 4AMKL 4EI6B 1JN6B 3FT3A 1W0YT 5EO0B 2NY6D 3NFPA 3ULUH 3W0WA 4BK5A 1DLFH 1CD1A 1RUQL 3BH8A 4HWEL 4OI9A 1T0PB 2P5WB 1HXYA 5IB5B 3RY4A 1NQBA 4HIIB 1FGNL 1FL3B 3BFOA 3FQRA 4QRQA 3S96B 1F8TL 4LLUB 3ZHLA 1GZPA 4MJ6B 4JRYA 1BIIB 3S35X 1ROWA 5F3BB 4G5ZL 1WTLA 5FAAA 3F62A 4KI5E 2DRUA 3PDOB 5D7JC 5D1XD 4L3ED 4NWUH 1U8KA 5EBWB 4A2LA 1GC1H 3QFJB 1MHHB 3FONB 1I8KA 4LSRH 2VWEE 5FYLE 4FQJH 3S35L 5FGBA 1KN2L 3BWAA 5DEGA 5F3HB 1OARL 1QSFD 3RRQA 2MHAA 1GGCL 5LWYH 1A7NL 2VLJA 2EE3A 2XKUA 3GUTB 5F7EL 5KW9H 3V0AC 4GMSL 3NFNA 4X8JA 3RWDA 3VW3H 4MWFB 4ELKB 3QEQD 4PJCB 3X13B 4Q2ZA 3LDBC 4XPTL 5B39B 1NBZA 3OKDA 4PJXA 5SX4I 5D1QB 4Y5VB 3RPIB 1FO0H 2Q76B 3RVVC 5GSVB 1G7JB 1PZ5B 3KXFD 1NUDA 3NPSB 1OTUD 3ULVD 4XCCH 2UY7A 5CEZE 3B83A 1ZT1B 4H25B 1ACYH 3IU3B 3AAZB 5ID1B 5ERWB 2PW1A 5C0IB 4FQXD 3PL6B 5IROC 4ONGL 4ZSOB 1VHPA 4LNRB 5AAMA 2OZ4A 3SCMA 4JGMA 1I3RB 1JGUH 2E9IA 2A74B 2HT3C 4TNWF 3T4AB 2C1OB 1LNUA 5F88B 4WU7B 1C5DB 3IB4A 4GQ9H 3VWJC 1LK2B 1MPAL 2R0KL 1D5MB 1JNLL 5T3ZL 4LBEB 1B0RA 2E6JA 4GRWE 4X4MA 3A67L 4M5ZL 4BSVA 3RL2A 1A6VL 3QNZA 5GXBB 1P9MC 2A38A 4XVSH 3CFKB 3O3EA 5DURD 5IK3A 1LVEA 1N6UA 3WFZA 3ZTJH 3I6LD 1YY9D 4Y4FC 2V7NB 1T22B 4ELMF 4K8RC 1KB5A 3EDDA 1NL0L 2HP4A 2VDML 3ARDA 1FAKT 4OCNC 4WFHE 1XGTA 1FDLL 2VAAA 4F9PC 4TULL 1T1YA 4P5MB 2I24N 3ARED 3D85B 1DN0A 6CGTA 1UB6A 3MROA 1D6VH 5INCA 1AXSB 3S7GA 2R56L 3NCMA 2X4SB 3MLYH 3RL1A 4AMKH 3CFDA 4WNQB 4G6JH 3C87A 3QNYB 1UEYA 5F7DB 4Y4KB 4LDEB 3DHMA 1FNHA 4PJXE 1BGXH 4XXDA 4F2MA 4HWBA 3T3PE 5TQ2L 3PWVB 3LRGA 3EIFA 4HS8L 1T03L 3JWDC 2DKSA 5I1GH 3O9WB 1GGUA 4L3CB 3SQOH 3IJSB 4D9QD 1GIGL 3MCG1 3PHQA 1J10A 5I1JL 1CZ8L 4ZAKC 5E8DL 2DM2A 3VMPA 1SEQL 4X98B 3KLHD 5BO1L 5IBTL 4NQED 3E6HB 2IBBA 3WFEH 5FO8A 5CHNA 5HJ3A 2BVPA 2GJ6E 5EA0H 2VH5L 3PQYB 5IEHA 1JHKH 4JJ5B 5EOCH 4PJ7A 5MHSD 1UQSB 3MYZA 3P9LA 4I0KA 3AB0C 5GPRA 1NMAH 1CDYA 1AHWB 1RUPL 4KUCD 4RMQA 1HE7A 4O02H 2EIEA 3WFEL 1JPSL 5L8JB 1L7IL 4L9LC 2YD7A 4QXGL 3WS3B 2VABA 1LEIA 3FCTA 3FFCD 3OG4B 1E6OH 4UT9H 4TVPL 4PRPB 3N1QC 5GJTL 5HGAB 2V2WA 3UPCA 1CFTA 3ULUF 1G7PA 5J11C 4OUUB 5FA3A 4B41A 4KMTL 4P4KA 4O2FB 2NX5E 2H2SC 2CDEB 4P4RB 4NP4L 1KIRB 3TBTB 1JZ8A 2VDOL 2HAZA 2C26A 2GJZB 1MVUB 3FT2A 1WGOA 3GGWB 4HKBA 3IRPX 4G8GD 4MVBC 1BFTA 2F58H 1RUKH 3ARSA 4ZFZB 1UJTA 5C0AB 4P2RA 2GKIA 2I9LB 5GZNC 3RJQB 1IZJA 5GGSA 2X4RA 1XCTA 4E42B 5I75C 4P2QE 3P4MB 3GJEA 3RPKA 1K8IB 4XPFH 1N6QH 1MI5A 4JO3H 4WI8A 1AQDA 2R69L 3MJGX 5TE6H 4R9HA 3SO3B 1NKRA 5IM7A 1ZSDB 3O3UN 5DMJB 3D48R 5DJ2A 4N8PA 1X5KA 2HJLB 5JQ6H 2FEEL 3BKJL 1EHNA 4OZHE 2LAGB 1RIHL 3LV3B 4PGDA 3WIIL 1RK1B 5E2JA 1D9KB 1U3HC 2OTWB 5KS9B 4IRSC 1G7LB 2ZOKB 5IG7B 3G5VA 2DQJH 1TITA 2E8ZA 1KCVH 1Y6MR 4L4JA 3SKNA 3N1MC 5LCVL 5J3HC 3MXVH 4AEEA 2XZZA 3VFUB 3DMMA 1O0VA 5CSZA 4FQ1L 3DTXA 4OGXL 5GRZA 1ETZB 2HG5B 4LRNL 4PGEA 4J3XA 5KOVC 2R8SH 5DJCA 5EUOA 1A6TA 1II4E 3CD4A 4HKXA 2XQBH 1DN2A 1XIWC 4NQCD 4HJGB 4OLXH 1KJMA 4HEME 4OGYH 1VGKB 5AZ2H 4JKMA 4LCCB 3L3KB 4OFPA 1C7SA 3HI5H 1FZOA 4XHJD 2MPAH 5FK9B 1PG7W 1K4DA 2CLVB 1TPXC 5KVEL 3RBGA 1AGDA 4ZUUA 5IW3A 3UTTA 2EKJA 5B38G 1KGCE 2E8YA 3PGFH 1U91A 4XX1E 4Z7VB 1S8DA 3QNXB 1CD8A 2OI9B 2CLVA 3BZFB 4XCEA 1F3JB 4KK9C 2YMXH 2XIDA 2FECI 1TTUA 3IYLW 3HFMH 4KHXH 2EDKA 2EXYD 3L3KA 3KPMB 4NDMB 4NNYA 2QQLL 4HIEB 3MFFA 1S7SB 4M9OA 1QFOA 3H9SD 2XRAL 3SKMA 3GB7B 4M5YL 2DMCA 4Z7OF 3GSVB 2I07A 2B4CL 3HRZB 2G5RA 4RBPK 2MNUA 4Q0XL 2F54A 1B0GA 1URLA 3GHBH 5DJ2B 1KFAL 1MUJB 1FPTL 4Y2DB 2I60L 2ZP0T 4QTHB 1I9IL 4P2CG 2X4TB 4Y16C 3X17A 2V17H 1U92A 4GS7B 4LLAA 3GJEB 4FQIH 1D5IH 1QEWB 2VXUL 3UBXI 2R0LL 2Y07H 2X4RB 1DE4A 1FVDB 4RGOL 4F57H 5HHVH 3TA3B 1G7LA 5F1OB 4OV6F 1WSST 4I0CC 3BZDA 4I1NB 3X3GL 4FHBD 1FG9C 2YUZA 2V9QA 4W4OC 1QBBA 3MLVL 2P8MA 4HJJL 4YLQT 5IESL 5IM7B 5ESVA 1T1ZA 4HWZB 2BNRA 2A9NL 3L3OB 5HVFB 4ZOCA 3TA3A 3E2HC 4D0CB 5FB8A 5GGSB 4L4TB 4HIHB 1TZGH 2X6MA 1YQ2A 1ZT4B 3F8UB 2HT2D 2X09A 1RY7B 2XTJC 4AG4H 4KXZH 3UTSA 2WUBL 3O45B 1FNEA 2P4AB 4PRID 5D7LD 3KJ4B 1KB9K 3DXAB 2IQAB 3P30H 3DX9B 1MWAB 1RK0B 5HDBE 5T3ZH 1T7ZA 2Z92B 4G8GA 4G9DB 4NBZB 5BMFH 3LKRB 5MP6L 4PJ7B 3W9EB 4JZNA 1M7DB 2GITB 1BBDL 4KRPB 2Y5TB 4KK6C 4PRPA 2PO6B 2HFEB 1F3DJ 4K3GA 1FFOA 1OF2B 5A2JH 1N5YL 1S8DB 3QI9B 1U91B 5L8LB 4ZUUB 5DFWH 1GJIA 3L3HB 4ZG1A 3SGJA 4PRAA 3I50H 1GL4B 1JYNA 1YMHB 5KVEH 4WI9A 2VR4A 4YDJB 4PLJC 4Z18A 4FOMA 1A2YA 5CEXB 4OIIL 3EGSB 3VFWA 2NY6C 3HMXA 3R4DA 5IVXE 2BCKB 5C6TL 3VFGL 2IQ9H 1E4WH 5F1NA 3T65B 5C8JB 5EC1A 1A6TB 3E6HA 2D7NA 4LLYB 4PGEB 3V4VH 4HW6A 1CTOA 4NQEE 4YXLH 3TH3T 3GSQA 1DSFL 2DLFH 3TN0D 5D1XB 4LHUA 5DO2D 4MYWB 4RGNC 3F12A 2PO6D 2YA1A 4EDXB 3QUZA 2BNRE 2DQDH 4X7CC 4EUPB 4MA8H 1MCEA 5GS2H 1DLFL 3FRUA 3HNVH 4PR5B 3PWPB 1U8JB 3UO1H 1QUNA 1MNUH 4Y4FB 3AM8A 5GS1C 3QDMB 4NRYA 3MCKA 4ZOBA 3MODH 2VZOA 4KZEL 2A83A 5ILTH 1CU4L 4GW1A 2XICA 1SHMA 4J7RA 5D96C 5E24E 4TPRH 5LGKA 3PGDB 2Y25A 5GGQL 1BZ7A 5JUEH 4YHZL 3IFLL 2NXYD 5HVHB 2VZUA 1FVEA 4X7TA 1G6RL 3QIWD 4FQCL 3K1KC 3TO4C 3NA9H 4GAGH 2IPTL 3IAQA 5I71B 1ZWIB 4U1SB 1BJ8A 4NRZA 2ZJSL 1I1YB 3NCEB 4LNRA 1AC0A 2WBKA 3LPFA 5KW9L 2FRGP 1RFDL 1ZHLA 3VCLB 3QQNA 3V5KA 2GK2A 2P45B 4OD2A 1YUHB 3LIZL 1A9EB 5D1ZA 3MLTB 4BSVB 5DXWA 5FYJE 4KMTH 5C71A 4G42A 4ODWA 3TBWB 2VOTA 5T1DH 3TBTA 1B0RB 4U6HA 4DUXA 3WFCH 2HFFB 1EEQA 2CDEA 2QQNH 1G7JA 4YGAB 3SEPA 2R2EB 1DBAL 4O2FA 3VJ6A 4BA8A 2VLMD 3IDXL 3O81A 1G7PB 3T4AA 1KIQA 3BGFB 3D3VA 1KXTB 3TVMB 1F58L 4NN6C 2FD6H 4Z7VF 1PZUB 3T1WA 3NMEA 1MHEA 2Q6WB 1R3HB 4C56A 15C8H 3PL6A 4ELKA 5I6XC 4XMLL 5FYKE 2ZOLB 1XZ0B 3HC4H 4XPBL 3C8KA 1YEGL 3BKMH 1RD6A 2IAMA 1LWRA 5K9JL 4LCUA 1BVKA 2NX5D 2AJYH 4N1CA 2H45A 4V1DD 2WBWB 3RHWK 4MB3A 4NYLB 5BZWA 3WSQL 5JQ6L 1NLDH 3V7AE 5KSBF 2NR6C 1JUFB 1XR8A 1A4KA 3GBLA 1Z6JT 2RB8A 5EWIH 4O5LH 1EPFA 5HHMB 5KAQF 4WCYH 3WN5B 4G7YL 3CFEB 1OOAA 3BYYA 3WXWH 4K71C 1H3WM 1RZFL 2YPKA 4X5LA 3HS0A 4U1LB 3STZA 4U1JB 2C5DC 1C5CL 1MHHA 1N3NA 2QL1A 3Q6GH 1MJ8L 2RBLA 3QZWG 3S88H 5HGDA 4YHLL 3T08A 4N0YH 4EI6A 3ZDYF 1BQUA 4Y4KA 1H8NA 5ENWA 3GRWL 4WNQA 4J3TA 1IC5L 2IFFL 4LQFH 5DUMH 5CD5C 3P0VL 3B8YA 3A6BH 1BIIA 4MD4B 1A7RL 1D9KC 1AHWC 1A4JA 3VWKA 3RVWC 4KKNA 5TQ0L 1J7VR 2EDBA 4PPTA 2CUMA 4P5MA 3T04D 3BOVA 1OAYL 5ISZE 4GBXC 4AEFA 2R9HC 2W60A 3DVIA 4LMQI 2VXSL 5TPWL 3A6BL 3V6ZA 5KVDL 4MXWL 3VA2C 1UVQA 4R7DA 4LGPB 1BX2A 4LHJB 3VE0A 1IVLA 3FFCE 1J1XH 3AUVA 3V6ZB 2ERJB 4BM7A 4FTVA 5DUPL 5A16B 5T1KA 1FL5A 5EZJB 1R3LA 3RVTC 4I5BB 5F9WB 4MNHB 5EU4A 1YECL 3QO1A 4CW1A 3C60C 2XXMB 5IJKC 4XI5D 4M7LH 4OZHB 5DJ8B 1MVFA 1OM3L 1DZBA 8FABA 2DM4A 1D5XA 4Y5XB 5D2LE 5I74B 3IAGC 1WUNT 1UACL 3NIGF 2XKNB 3FO2B 1OGAD 5C0CB 3FN0L 2G9HA 4Y5YA 4C54A 3QHFL 4LU5H 1F2QA 3SCMB 3MZGB 3GHEL 3GJFK 3ILQD 5HGDB 4ODUB 1U41A 4NQDD 1INDL 5FDYA 2OJZL 4Z95L 4FNLL 5ERWA 5TGBB 3N1FC 2L7UA 2EDJA 1WEJL 3KJ6H 1RI8A 4W6XB 1T20B 5E5UB 1KN2H 5E4EC 1U95A 1RHHB 1T80A 4U1GC 4DEPB 4YK4C 4KKCD 1NBZB 2GI7A 4WHDA 5I1HL 2A6DB 3SE3A 3B5TA 2F5BH 5E08H 4OD3L 3FZUD 3T0EE 4TUKH 3RWDB 4X8JB 3VRIB 4JREC 4ZDHB 1KENL 1I3GL 4P9MH 3GUTA 4OLYH 1CTNA 2BY1A 3O8XC 1QP1A 2IMMA 3QEUB 3P4OB 5DRXA 1WVZA 2OLDA 1MCKA 3BKYH 2Z91B 4WW2B 5A2FA 4GXVL 5SWZB 4U3CA 4ZAKB 3TCLA 5ISZA 4ZYKA 4KKAC 1NCCH 3TO2A 1S9WA 1JP5A 3QRGH 1R3HA 2G5BB 3MRPA 5DHVB 5ESQA 1AO7E 4BFIA 2P8PB 3QUMH 4U3XA 3F7QA 3SKUD 1EUTA 3QXVA 3U0WH 3VWKC 1IEAB 2EDQA 4L8CB 3ESVF 1MJJB 4HFWB 4X0KB 4Z7NF 1GZPB 4MJ6A 5F3BA 4DFHA 2I25N 3KAAA 3SGEH 5JIIA 2B1HL 1RVFH 1MAML 3MLTA 4IMKC 4DN3H 3AY4C 1ZK9A 2E7MA 2MQCA 2HKFH 1AO7B 3ALWA 3VD5A 5GGUB 3FT3B 5LGHH 4HUXB 4H20L 2XG4A 1KBGL 1I1YA 4OI7A 3GMRB 3TBSB 3G6AA 4LRNH 1MJUH 1HHJB 3CMOH 3QQ9C 2VIRB 3OZ9H 5GISH 1Y18B 2AXFA 4U0RB 5HI5C 3BESR 2J4WL 4M3JA 5C6PB 1RJZB 2BMKA 3WIFB 4W70A 1OY3B 3TP4A 2YK1L 3TA3C 3MRQA 3NN8A 2VIRA 4WO4A 1IGCL 3HZKA 4UDUB 3MXWH 4X6EB 5B3NA 3CK0L 1UZ6E 3QIWB 4M4PA 5F7WC 1YECH 5AYUL 3RIAF 3TIDB 2K7QA 2KKQA 3G6JF 4K23H 3S37X 4JKPH 1OQOA 1U8JA 2ZUXA 3PWPA 5D7LA 4XP1H 3ARZA 1ZVYA 1LDPH 4CJ0A 4GG6E 3SDCA 3QUZB 5C09D 1H5BA 5JDSA 4NBXB 5E6IB 4MVBD 5SWSA 3MODL 5T3XH 5D5ME 3TN0B 4M6OL 1GOFA 2FJFA 3S35H 1V7MH 4I77L 2XRAH 2BVYA 1KPRA 3BP7A 4JFFB 1P5UA 3MV8B 4WEBL 5EC1B 4OI8A 4J12A 3VGHA 1YEIH 3ZDZF 1DQDH 3UYRH 5C2BH 5DHVA 4WI6A 3WFBH 1CE1H 35C8H 3P4NA 4RAVA 3KHQA 5A40E 1I1FB 7CGTA 1P69B 2MMXA 4KJWC 4KJPC 3L3IA 3VA6A 4PRHB 1NANH 2ZUQB 4C58B 4YHPB 1BQHB 1P2CA 5DQDL 4LSVL 4DGYH 1NDMB 5FCUL 2AQ2A 2Y5TA 1QYGL 3IDYB 4LASH 4Z0BL 3LKSB 1HK6A 4QF1A 5AG9A 4M61B 3SDDB 1M7DA 2GITA 4JZNB 2AEWA 1RHHA 5JPNB 1V05A 2BNQA 1VKXB 1LEGA 2V2XA 4NKDA 5F7EH 1F6AB 1UB5B 3DUSB 5LQBH 3BEWB 3KYMA 1NCCL 2APWA 3RWCA 2BVUA 1U3HB 1F58H 1ZHBB 3PV6B 2EDYA 3V8OA 2X4UA 4EN3D 3MGOA 3KHOA 2GTWA 1U3JA 2HA1A 2YEZA 4OQ1A 2ILLA 3LN5A 5F9WC 2VQTA 5JA8B 1PQZA 5HTSA 1OP9A 3ULUC 4HT1H 3V6FB 4QXTA 3FOMB 1F45A 2XKNA 3FO2A 4XVSL 5FO7B 4K9EH 1YY9C 3RZCB 5I17A 2ZUUA 3OKEA 5TDNA 1KXQE 3J7HA 3MLRH 4JHAH 5FHBH 4Y4KC 1J88A 2Q7NA 2DN7A 4EN3A 3PWUA 4MNHA 3BIBX 5EU4B 1TTGA 1GCFA 2MWCA 4DVBB 4MDJA 3ZT6A 4ORGA 3PABA 2WBJD 4JO4H 3SDDC 1JFQH 4YBLB 3LQAC 4A6YL 2V5YA 3SPVA 4P46C 4I2XB 7FABH 5BOPA 4RCAA 4H8WC 3RDTC 3ARGD 2R56H 3I02B 4U7MA 3EOBB 5F93C 1TVBA 1A6VH 2NY0D 1GOGA 3WIIH 2DQGH 1T1XA 4GW4A 5JW5B 3WHE0 1P7KB 1MSPA 3UBXG 5T3ZD 3KG5A 3IFPA 3BRGC 4NZDA 3D9AH 3C9NB 1B0GB 2P1YA 2FB4L 4MD4A 4EOWH 1N2RA 1ORSB 4CN6A 4WU5A 1UM6H 2CUHA 4S0TD 4XMKL 5DURB 2EDEA 1I4FB 2FJGB 1WIOA 2PUQT 1U8LA 1PX4A 3OKMB 4YHIB 3U4AA 1T2JA 2ZG1A 4U1LA 2FHFA 3VXRE 4YBHA 2JK5A 5J89A 4P4KC 1BMGA 4XVTL 5SX4H 2FO4B 1OAKL 5GRJH 1KF9B 3W39A 5DI8A 3FRPG 2IADA 3OG6B 4RGOH 2DB8A 4XWGH 4F57L 3VRJB 1FGVL 1T7XA 5DJAA 3MV8D 1FNGB 1EGJA 3CDYA 1AGDB 3DO3A 4YAQB 1R6VA 1K4DB 4AQ1B 3DV6A 1XR8B 1U3YA 2J8UA 1TQBC 1BBJB 1VGEH 4U1HA 3PWLA 4MNQD 3UJTL 1CZ8H 2KQMA 4NWTL 5H37H 3SDXF 4JFEE 4HJJH 1GGCH 2YD9A 5LWYL 3X3FL 2PTTA 4C83B 4OLVH 4U49A 2ADGB 5DJZA 3ARGA 3QUXC 5FV1L 3RY6A 3AS2A 4NBYB 5C08D 1MCSA 1NC2A 3WJJC 3GHEH 4OSUL 3ME0A 4RMWA 3VFRA 4FABH 4NCC2 2XN9D 3MRLB 3T0BA 1IQWL 1TCRA 1HOCB 1Q9WA 1ZHNB 3SDAA 4MCZB 3D3VB 2CRIA 3GHBL 3IF1B 4PJFF 3PQYD 5CJXA 1S7TA 4M48L 3BYTA 3FQTA 3MLUH 5E9DA 1CDCA 2JELH 4EN3C 3LV3A 4JFZH 3MLPA 1QACA 4ZUWB 3UTOA 2DD8H 2V5TA 1Z9MA 1DQJB 4OD2B 1P4IL 4OLWL 1QTYT 1QD0A 3CVHB 3G04A 4L8DA 3A6OA 1AO7D 4GG6B 5EU7C 1QO3A 3OR6B 1ZWIA 1XF4B 5D9SB 5HHMD 5J6HB 2XNAB 5F6IB 2YXMA 3A67H 2BSSB 4DTGH 4PJHF 1ADQA 4IDLA 3KPSA 4OLWH 4P2RD 2VLRB 2WBJC 2IANE 1CXKA 1GC1C 1AGBB 3MRFB 3GSRB 1AH1A 1QSEE 3R0NA 4TSBL 4JFHD 4QHMB 3AREA 1V3MA 2YS4A 2EE9A 1OP5K 3LOWA 3MRIB 2B7DT 3GM0A 1IFHH 2E7HA 4PJDF 4NRYB 3QDMA 2IG2H 1BZ9A 1OWWA 1XT5A 3BPLB 4JY5L 2HKHL 2EZ0C 2HJKA 3BKJH 1CXLA 3QWQB 4M7JL 5F9DC 1A64A 2FL5A 4MA7H 1MCWW 3BP4A 3W5NA 5D1ZC 2QADC 4FQHB 4K3EL 3JTTB 5AWNH 2VXTH 2XZQL 3B9KA 1PEWA 1W0VA 2BRRL 1HILB 2X1WL 1X6LA 3QXUA 2X4OA 4N0YL 1NC2B 3EZJB 4LIQH 3ULSB 4QHNA 1I7ZB 1D3CA 5D6DA 1KB9J 2D7OA 3ECBB 4R96B 1G7HB 3STLB 2BNUA 2DQEH 4XPGL 2XZCH 3H9SB 2C3HA 3GJFA 2BVPB 1NBQA 2J8UB 1IJ9A 1G84A 1E4XH 1CL7L 2OP4H 1BHGA 1CICC 2YSSA 5EZIH 3BD3A 5KJRL 3QQ3A 4QHNB 1WICA 3VRJA 2OZ4H 1VGEL 2X4OB 5AZ2L 4MA1C 4YUEL 3SCMD 4DOHE 3ZYJA 3IJSA 4LP4A 4L3CA 4L9DA 2EDTA 2JK5B 3H9SA 4AIZA 4Q6IC 4OV5A 1NGZB 4ERSL 4Q0XH 1FGNH 2JF1A 2LTQC 3UAJD 2NYYC 2HJKB 3O2VH 4WI2A 3UPRB 4OLZL 3P40A 3ZKXB 3MRNB 5HYEA 1ZS8A 1K3IA 3O6FC 4G9DA 1UM6L 3LKNB 4NCDA 5F7DA 2VDPH 3EYUH 3VWJA 2LU3A 1I7RB 2HT4D 4N8VB 4PRDA 1Y6NR 4XCNA 4X6CE 1F4YH 1CWVA 1D5IL 1KPUA 2VXUH 1KSRA 1G0DA 1D7FA 5KTEL 4DGVH 3MJ8A 5ANMB 2KPNA 3O2VL 3AREB 3GI9L 3MRFA 1PG7X 2YPVL 1FJ1A 4P3WA 1T1YB 2VDPL 1UG9A 4OGZA 1JPST 1MCFA 3KS0J 1CQKA 2DQHH 4L4TA 2QR0A 3U7YH 3ZKNC 4P23C 4Y88A 1J1OL 3S36L 3MLXH 5FUZL 3ZE0F 1QO3B 4I2XA 4PGJA 5FCUH 1QZ1A 2AEQH 1CIUA 4GG6A 1MRFL 2YN5A 4FFVD 4NC1E 3O4LD 3PF2A 4ORGB 1JL8A 3MRKA 4UUJA 2WWMC 3QNZB 1AI1L 2QKIA 1AGBA 3EOAA 4PRHD 3W82A 4FQLH 2X42A 4LCWA 2HWZL 3U0TB 5CJOH 2H1PH 1I1AC 1QSFB 3H8NA 4HXAH 3GKWH 3FFDA 5GGVH 4X8XA 4MZ2A 2E27H 1ODAA 5HDQL 3EHBC 4K71B 1MUJA 3TV3L 5B3JF 4MAUL 5ACMA 3QFDB 1IAII 4PYHA 4G8IB 3U2SB 5K9KB 2EIBA 1TIUA 1WFOA 3HNTL 4ZUTA 4MS8C 1PZ5A 3SKMB 5D93B 3DIFA 1ED3B 1F3DH 5C07E 4HIEA 1XR9A 2XZAL 4PRPD 3EW3B 1EFXD 4JCLA 3UYPA 3TWCH 5HGBA 3MRCB 4OZIB 1BECA 2W38A 3QQ9D 4G6AD 3L7FB 3QCVL 4Y1AB 2BXYA 4B7LA 1W8NA 4XCEB 1LP9A 4PBXA 1XF5A 2RIKA 1U9KA 2HKFL 1MCIA 1FAIH 1NLBH 1OQXA 2VXSH 2C3XA 3TGXA 3B2UD 1P2CB 1BQHA 1B6UA 2BY3A 1PSKH 1ZLVK 3ZYOA 5DEGB 4LMQE 2VDRH 1R3IL 3L7EA 1CL7H 3B6SB 4HF5H 43C9A 5DEFB 3BE1H 4RWYH 3MBEB 3PWLB 4U1HB 5E2VH 4ODVH 1KJMB 5E4EB 1XMWA 3S3JA 2AJUH 4FQXC 3VGAB 4HPOH 2YD1A 1FYTD 4MAYA 4YHMH 3OKYA 1EHAA 4M8QB 1I4FA 5JXAH 3BAEH 1MFCL 5HVHC 4KH2A 1MJ8H 1X5AA 2VC2H 1BGXL 2DS4A 2F19H 3BN9C 5DVKA 4LLUA 3VH8G 1Q9KB 5KVMC 1L6XA 4UDTB 3MOQA 1CVRA 4K3EH 3O41B 3H42H 1KJVA 1Q0YL 4N9OB 1N0XH 1AXTL 3SO3C 3C8HA 3GKZA 4HJ0C 4F33A 2OYPA 1T5WA 3RGVC 3U1SL 3WUWG 2EH7L 5T1LA 2G75A 2DDQL 2DI8A 2RR3A 4KJWD 4Y19B 1QHOA 5CJBA 1I9IH 2Z31A 4EIZC 4MDJB 3Q5YA 5IVXF 4AQOA 4G9FA 1A6AA 4PJIE 3WD5L 3WBDA 4ETQA 3HE7C 4K7FA 4A6YB 1J1OH 4RBPH 1UH2A 3L1OH 4JR9H 4MZ3A 1KTRL 1EVUA 5ID0B 4IDJH 1PYWA 1LE5B 5C0AA 4FQQA 5BV7C 3RY6C 1HSBA 4ISVA 5EBMA 4G6FB 3TZVA 1DBML 4ALAL 1B4JH 4G9FD 4YX2L 3RNQA 1K4CA 1F4XH 1FCGA 4PRHE 4IIQC 3LY6A 1VADB 4N0CC 5GGVL 1F00I 2B39A 4P4RA 4LHQB 4YC2B 4Z95H 3BEWA 4R26H 2FBOJ 4Z76A 3ZT5A 4NKDB 2NXYB 4OUUA 5FA3B 1EEYB 4XX1G 4P46B 1KPVA 3W9DB 4R7NB 2HRLA 1WJ3A 4PJIF 4NFCA 2A73A 5MERA 1I8IA 4NO0D 3QIBD 5ESQB 2Q3AA 2G5BA 3MRPB 5CCKL 2XA8H 1PLGH 3WSQH 1PKQA 1IBGH 1DBAH 4D9LH 1G7MA 2Z93A 5T1LD 5SWZA 2EYSB 4M62H 3OPZL 3TWCL 3KYMB 1XGYH 2LE9A 1AHWA 4GKNA 1BJ1H 4EDWH 1G9MC 4BELD 4UOW0 1LEGB 4NUGH 2DQCL 1S7UB 4JCMA 3IXTB 3MLVH 4P3CH 1G6RA 1WFTA 2HMIC 4CL7A 4D3CH 5IGXL 3KPLA 1JBJA 3DI3B 3UX9B 5HDBF 5FO8B 5CBAB 3NZHH 1NDMA 2R1YB 2YKLL 5JHDD 4X98A 1G9ML 1ZLVH 2NZIA 3RBSA 1E4KC 3C5ZC 3UTTE 1UWEH 5B22A 3VRLE 5JHLL 1OAZL 1BVZA 3EYFA 3PNWB 4YJZL 1EGJH 4G80B 3I6KA 3G6JE 1P6AB 1F4WH 4WDIB 2EC9U 4NM8H 2R1XB 4JHZA 5J56B 1NGXA 2M26A 2W92A 1ZA6B 4DW2H 3DLQR 3VXMB 1X6NA 4LEXH 5DJYB 2FBJH 4F8TA 3V4UL 5EBGA 1D5XB 4Y5XA 1S3KH 1MF2H 1N0XL 5JDSB 4H0HB 3QZWA 4F15B 1CLCA 4DKAA 2GYSA 4O51B 4PTUB 4UILL 1A3QA 2ITDB 3CPLA 4K3HA 2VAAB 2YA0A 3VXTA 5I1KL 3FHAA 4W81A 1WFUA 5EG6C 1DBBH 4NFDA 3V5HB 3MX0A 2NW2A 3DOSA 3KNBA 1ACZA 3QIWA 1UVQB 3MPCA 4KPHL 3HZKB 5BXFA 1U3HD 3CFKA 3OX8B 5BS0D 4JY4A 4YHZH 3MBXL 2XI9A 2A77L 2ED7A 4Q9QH 1NH6A 1HNGA 5KVDH 5GGRB 3GMMA 3RZCC 5DMYA 3VI3E 2VZ1A 5FYKD 3HCVB 3MR9A 4M6AA 5CMAB 4YXLL 2AQ1A 1LK2A 1D6EA 3LHPH 3TBSA 1BZQK 5LVEA 4ZQKB 3FB6B 3G6DH 4TSAL 1NC4B 3DV4B 3REVB 4Y5VC 5BS0A 2YD4A 1J5OH 4H26A 5CFHA 4M4RA 4BFBD 3STZB 2JKXA 3CFJB 3P0GB 4H25A 4HUUB 2XWBB 3SHSA 2B1AL 3CFEA 4LDOB 2YD5A 3IDGB 2A6IA 2BK8A 1UWGH 4PTTA 1JJUA 3AC0A 4OCXH 4WV1A 3IVKB 3DNKA 3QIBC 3CFCL 4N8CL 4XCFL 1HHGB 3MBEC 3KPNA 3TEUA 3OKNA 2F8OA 3VXRD 1JUFA 3QEQB 3X13A 3OPZH 1IE5A 1S9WB 1WAAF 3I6LE 4ZYKB 3LB6C 1KLUB 2F54E 43CAB 3R0MA 4IRZL 4Q74A 4KI5D 1DQQA 2D03L 3FFCB 4JO2H 3H2WA 1WZKA 3F7YB 3QXAA 2GJ6B 3CLFL 4FTVE 4YE4L 4Z7UB 4HV8B 1ZLWK 1KIQB 1HHKA 3RWEB 1R5VB 3SQBA 1T0MB 4OBSA 1T20A 4G6JL 3CH8A 1YN6B 3DECA 3KYKL 4JDTH 1EZVY 8FABB 5CD3B 1IT9H 5IMOA 1MRDH 1DL7H 3NIFF 3QUML 5EB9A 4R97C 4YNYA 3QCVH 3B3IA 5SWZD 5HYJD 1OTSC 1JK8B 3QHTC 3W0WB 4JHWH 2GSIA 3ARPA 3AY4A 4OUOA 5KSAB 4LHUG 1L7TL 3QIBA 4GOSA 5DMGC 3ARVA 4L3AA 3UZEA 1ZLUK 4KV5E 4DK6A 4LLVB 3UTSE 2W60B 4JJHA 5DJ6A 5LAXA 1BZ7B 3S37H 3HG1E 2PKDA 1DBBL 4XXCC 1ORQB 4DZBA 1R3LB 5SV4A 3VGGA 1S5IL 4MNGA 4P3DB 3RX8A 4JVWA 5T1KB 4G8GE 4Y89A 5EOTA 4O9HH 5IR1B 1EIBA 3LEVH 5GS3A 1Z0NA 2A83B 4WIQA 4GH7B 4NQVB 1CF8H 1JPSH 1XGQA 2E6PA 4KU1A 1C16B 3DVGA 4U1KA 5F96L 5A3IC 3IDIA 4J3WA 4W6WB 1ND0A 5E8NB 3CJJA 3V0WL 4R97B 1JPGA 2HVKB 2YMXL 3PNWA 4PY7A 3WL9A 5J0BA 3D0LA 3L3JB 3TT3L 3HI1A 1HXMB 1I7TA 3DSFH 1GVIA 3V4PH 1FP5A 3OF6D 3PP3H 5C0BE 2R1YA 4PJGB 2WP3O 2RFXA 5SWSD 1WWBX 4H1LH 4OM1L 4Z7UA 1UWXK 1G6RB 3D3VE 3RFZC 3F7YA 3QXAB 2Z31C 3O6LH 1JGLL 1JGVL 1H8SA 4XP9H 4JZOB 3VW3L 2R1WB 3NIDE 1P7HL 4N8CH 4UV4H 1BVKB 4CAGA 1ERNA 1BEYL 2L0DA 1KLUA 2ZSVA 4TYUA 3UTQB 2EYSA 3O9WC 2R0LH 4NO5A 4O00A 4HWUA 3DX8A 1SY6H 1HSAB 2NLJB 2PO6A 5F9AC 4Y8AA 4CUCA 2A77H 4Q9QL 2Y1VA 3RHWF 4RMUA 1EUUA 4X6DA 4Y8DC 5BV7H 3TT1L 1CICA 5BZWB 3MV9E 3JV4B 1AI1H 1U8NA 3KPRD 5BZDA 3GSNB 3NA4A 4OF5A 1NC2D 4U6VL 5B38B 4Z7VE 3VGEA 2O5YL 1BJMA 2DLGA 1K4CB 3KLHC 4G9FE 3STBA 2ZOLA 1NAMB 1FNEB 2P46B 3CMGA 3VFVA 1UYWH 2JELL 4MA7L 5BJTB 4M1GL 4U6TA 1I8MB 2FEDC 2K9UA 4L9LB 32C2A 4OCSL 3OXSB 2VDOH 3HPLA 1P84J 3JUYA 2NZ9D 3C09C 1M7IB 3MUGA 2C9AA 4MJ5A 4XCCL 5HI4D 1A14H 4U7KA 5IMLB 3BT2H 4E5XB 4DKFH 2LTQB 3HZMB 2BX5A 4JQXC 1OAUH 4JFDB 3UROR 4Z6AT 5K59E 1OTSD 2BNRB 2OTPA 4R2GB 4P2OC 4U0QB 2VL5A 2XZCL 4HCRA 4MXVE 1F4HA 2N4IA 3TVMC 4NQDA 1C1EL 2QQQA 4PD4K 4KWUA 4Z78B 4D9QE 3BHBA 3VXQB 5JHDA 4GSDL 2J6EL 4WENB 4N9GA 2YK1H 5D7IE 4U1IA 2OTUB 3R06B 1MHPL 1YA5A 4N1EA 5D7KD 3CK0H 3QCTH 4BYHA 2ARWA 2BXZA 1A7PH 3NOIA 1IC4L 2V6HA 3GSXA 4IJ3B 4OLZH 4ZS6C 3ZE2E 5C6TH 3KLAA 5T3XE 1IAOB 4PJBF 4LOUD 1P53A 4DVRH 5CZXD 3V4VL 1QSED 3LS5L 1CGYA 4JN2B 4DGVL 1T1WA 1A2YB 5C0JA 2YC1B 5DF0A 4YHKH 5DEFA 1U58B 2NMSA 2WIIA 5INDA 4JG0H 3S9DB 5DDHB 5DLML 1F13A 5LGHL 1N59B 2VNCA 4XAKE 1FZKA 2OCFD 3ULVC 1P1ZA 2E9BA 5C2BL 2AQ3A 4X6FB 3KPPB 3ILQC 4X6CB 4ZTPH 5K9OB 4J3SA 4NKMA 3T65A 4YHKL 2Q7YA 2IPUK 3ILPB 4M02A 1XGRB 3L7FA 3C5JA 5DSCA 4YUEH 3FOLB 1XH3A 4RAHA 3LKRA 5FYLD 3T0WA 1SYVB 4I9WE 3BD5A 2E7LA 4PRAB 4G8GB 4ZTPL 1NFDE 5JO5B 5EU6E 1T83C 5E8PB 1AXIB 4ACPA 2VL4A 4NQTA 1EJ6A 1FYTB 4G8IA 2XA3A 1I8LA 1OTTD 3BJLA 4IOFD 4WJ5A 1CVSC 5DHXB 2Z8VC 5FDWB 3UTSB 3DMMB 5IMMA 4OCMC 1HQRB 3VFMA 5IOPA 1EJOH 5DA4A 1O7VA 4G6AC 3EYVB 5JMOC 3U9PL 3DBXB 3Q6FA 3MNWB 1QSFA 1Z5LB 4IM8A 3HUJB 2Z92A 5FUCC 3DROB 1YMME 4ESKA 5FYKU 3INUL 4GUPB 4NC1C 1GRWA 5HYQB 3NH7H 3PL6D 2HFTA 3NCJL 3WEXA 4FP8L 5JOFA 2X1QA 4XNYH 2KUTA 3W5MA 5ALBL 1OAUL 4XT1C 5EUOE 3VG0L 4N1HB 1A6PA 1K8IA 4RA0C 5E5RB 1QNZL 4OAWA 5C7XL 3BUYB 3L3DA 2EO1A 1E28A 2DD8L 5D93C 4R2GD 1EXUA 2CO7B 2F58L 5CWSB 4QOKA 3E8UH 3HAEH 5KSBB 4J8RB 4XP5L 1QVOA 1S7XB 3IDMB 2DWDB 4HKBB 4OF6A 3SGKC 4GBXB 2J8UE 1GAFL 1IC1A 4XPHL 1YEFL 1JTPA 2Q8BL 1V3JA 4IRJC 3VI4F 2VYRE 4K94L 1KIPA 3EDKA 2FATH 2NNAB 3K0WA 4H5SB 1QEWA 4ZXBD 4F33B 3DBXA 5EBLB 5HBBA 2P5EE 3B9KC 5F1SA 1NGZA 4QWWC 1PKOA 5EO1A 1FC1A 5HGAA 1GZQA 2MCPH 1K9TA 4OFYA 3HZVA 3OAUH 3GI8L 2ZUSA 4XP4H 4KK8C 4UOW1 3ARDD 3MRHB 4I48A 3GB7A 3TC9A 4S1RH 2CIIA 2F74B 4FMKA 5C2UB 4G6MH 5E9DE 4OQTA 3BP5A 5CS7A 3O0RL 1A1NB 4JJ5A 3T3ME 5DD3H 3KLSA 3TFKD 2MQ3A 4TQEH 1G7HA 4UT6L 3STLA 2AEIT 2WANA 1IGCH 3B6SA 2Q7YB 2M2DA 4NNXB 5IBTH 1NMCB 4ELMA 5I15L 3A6CH 1I7ZA 5JR1H 1HKLH 5JOPE 1JZ7A 3RZCD 3C6LD 1P1ZB 3TJEL 1X4XA 3UTTB 3TNMA 3EJZD 1HCVA 3HUJE 3OL2A 4XP1L 3VU2A 3OB0H 3TF7C 2FIKA 4OKVB 5JW4Q 3VFUA 3DX7A 1LO3L 4KUCF 1J87A 3TM6A 2IH3B 3QCTL 5GGRY 4X5WA 1KJ3H 3HE6B 3BKCL 3FL7A 4FG6C 4EOWL 3SKNB 1QSEA 2JJTA 5HGHA 1A6ZB 3MOAL 4HKXB 1J0HA 1V7ML 4R4ND 5EUOB 2OTWA 3BSZL 5KS9A 4OKDA 4AYFA 2YUWA 4L8BB 1J8HA 1SJHA 1NFIA 2JCCE 3HC3L 4XNXH 1JPTL 3FO0L 3MLXL 1FNSH 2W0LA 5BRZB 1UB6B 3MROB 4ZD3L 1MHCA 2VLRA 1X5LA 4HHAB 5JNYA 3EKCA 4YDIH 3UJIH 4JFZL 1A7NH 5I16A 3FT4B 1ES0A 4NN7B 4RFOH 3VXQA 5JHDB 3BHBB 3OR6A 5D9SA 2E7BA 5CEZH 3QFJD 4ODHH 5J6HA 1RK1A 1I1AD 1RURH 4BZYA 3QUYD 2WP3T 5DMIH 1YEJH 1ZLSH 4AEHL 3O3EB 5IK3B 1MLCA 2Q86A 1JZ3A 4IDJL 4UUJB 4NWTH 4PJFE 4LLQB 5ICZB 2PO6C 4KKBD 4IHOA 4Z7WB 5CEZL 4OZFH 4XNMA 1ZTXH 2Z9TA 3WUWA 1A6UH 3VMOA 4P5KB 4PRNA 1G9MH 3K2MC 1XCTB 4E42A 4YX2H 2A6JB 2IJ0C 1KELL 3GIZH 4DGIH 1E6OL 2A74A 2XV6B 4KVNH 2KBGA 4UT9L 2OSLB 1ZHNA 1HOCA 32C2B 4M6MH 3SN6N 1J0YA 1AQKL 1FHGA 1FLRL 1GGYA 5D8JL 5FKPB 1K85A 4LVEA 4MLSA 3QUKA 5LXGH 5TDPA 1KCVL 1ZT1A 2YZ1A 4OD1L 3GMOA 5KBNC 2FWOA 4M7ZB 4ZOAA 1CT8B 1CGWA 1U8NB 2VXTL 3P9LB 3DRTB 5ACLA 2PTTB 4V1DB 3EO9H 1NCWH 4X6DE 5IFHL 3OKDB 3JWNC 4GAFB 1K5NA 3IJYA 3DETC 3F5WB 2DTMH 3IKCB 1V3LA 1FO0A 5DK2B 4HULB 5ALBH 3WNLA 4K3JH 1SMOA 4NZUL 4P2QD 2NY1C 5I1KH 3N50A 4NO5B 1IGTA 4MXWH 2IADB 1XF2A 5DQ9A 3ZDYE 1MJUL 4LSTH 4O5LL 5M7QA 2VLRE 1T21A 4I8DA 4PJ9B 4KTYA 1KCUH 1SYSB 1Z0MA 3WO4B 5LKNA 5GZND 1MRCL 4ZPTA 1HHHB 1CR9H 5HI3D 1S5IH 2GFBA 3RWIB 3CFBB 2FJGA 4AJ0A 5IJVA 1CGSH 3KPTA 4JRYB 4M7JH 2O93L 3HMWH 3D3VD 1H3PH 5CZVH 2PYEE 4CU8A 2IFFH 4WHYG 4GW4B 1JPGB 1EFQA 4GJTB 1Y0LB 4F7CA 2I9TA 5EO0A 4GG6F 3BDXA 3VXSD 2Z31D 3QXWA 2X7LA 2AV7B 3D18A 4HIJB 2FJHA 2H26B 3EDFA 4PV8A 1INEL 4PG2A 3WHE1 3RL1B 3UTPE 1XF3A 3BVNB 2WUCH 1DQDL 3UYRL 3PWUB 1DN0B 2VZTA 2H6PA 2XG5A 3U30C 3WO4C 1RUPH 1MIEL 4TTDD 2BSSA 4XVJL 4DEPC 1DVFC 3QUYC 3FB5B 4MMXC 2XNAA 3MUHL 4QXTB 3MRRA 1RU9H 2R29L 3QIBB 4KZDH 1NBVL 4F15C 4UQ2B 3K2UH 2PXYC 3BZ4B 3MV01 1NCNA 3OJVC 3KYAA 3KPSE 3C08L 3QJHB 4NT6B 4Y4FD 3ET9F 3PV7A 2BNQD 1VEOA 3GSNL 3W81A 2OQJB 3F7VB 4JY6B 2M8XA 4QHKI 5I1LB 5JIKA 4HH8A 3EO0B 5DT1H 3WDHA 5EIIA 3OHXB 5GHWL 1YEGH 3BKML 1UADC 3BI9X 5F88A 5HHME 1N7MH 5KTEH 1RZ8A 4WWKD 5ALCH 4ODTH 2D9QB 3AMLA 1S9VB 2B1HH 6FABH 4QF1B 1PFCA 2DTSA 4Q6IA 1TCRB 3EOYG 4PJCA 4GFTB 2ADIB 2OBGA 1UT9A 1JTTA 5IB3A 4PJ8D 3AAZA 5DVLA 2VDLH 1CE6B 4HKZA 3RTQB 4M9PA 3N85L 2F5BL 2MHAB 1V3KA 3TN0C 1AD9B 3ZL4L 3TBVB 1BD2A 1W72A 4QRRA 1YEJL 4AEHH 3UTZA 2AJ3A 3QUXD 4NOBA 2OX5A 3V0VB 3V79C 3MJ7B 4V1DE 5TF1H 3SGJC 1ZT7B 3H3PL 4PRBB 4Y16D 1BBJA 3RWGB 3QFJA 4YPJA 4HLJA 1YEFH 1X44A 2Y6SD 4HG4K 4XC1H 3QDGE 3LMJL 1EA9C 1HHGA 4UTBL 3FQUB 3BP7B 4EDWL 3C6LA 3P2TA 4S10A 4OF3A 4FFYH 3VXNB 1XGPB 2XQYK 4OZIF 3IDGA 2HKHH 1GXEA 3MRBB 4JPKH 4EQ3A 4FZ8L 4ZODA 2XWBA 3IDJA 4FZEH 1JMXA 1KUMA 3CFJA 1HN1A 1ZV5A 3P73B 3WHXA 1T66C 2QEJA 5ADPH 3KR3H 3MMEA 1U8KB 4YHNB 4N68A 3V6OA 4WY7L 4KJYA 3DV4A 5TQ0H 2R8SL 1HYRC 1MQKL 4HZLA 4K55A 1LD9B 2FB4H 4CNIA 3SCMC 5DC9B 3ULVE 1YNTA 2WQRA 1PY9A 2P5ED 5CIPH 1MCLA 1FFPB 5HHQB 3FQRB 3S96A 2ZCKL 4U1NA 1P7KA 3GMMB 3PHSA 5DS8A 3C6SA 3DXAE 4LEXL 1HEZB 1OT1A 1R0AL 1EEUA 5HHOA 3QDGD 1JN6A 1SJEB 4XGZA 1IM3B 2IALB 5J1TC 4HS6A 3W11C 4H8WL 3ARFA 5F7LB 4APQB 4L4TE 2LABA 3OR7B 1V7NL 3SBWA 4LSTL 4HK3J 3I50L 4QHLB 5BO1H 4P57A 4ONOA 4Q58C 3CPLB 2DI7A 3T0VA 4MJIA 4NFBA 2FEEI 3L3GA 4LEOB 2R2BA 3GDBA 3LQAH 4PJIB 1HH6B 1BD2E 3D39D 4QRRE 5TDNB 2NY4D 1U3ZA 1E6JL 1OPGL 2ZUVA 5FO7A 3F7PC 2EH8L 4XBGA 1BP3B 5KVGL 3QFJE 1NCAH 2H8PA 3WJLA 1Q9OB 2ZCLH 3HMWL 4WHYH 3LS4H 4AH2A 1CFNA 4CVXB 2ATKB 3RWFB 3DYPA 1B90A 3B9DA 5BW7C 3MGOB 3I6KB 3FQNB 4UMGA 3T8XA 4CU7A 1GGTA 4QCIB 2WINB 3S3PA 2R4SL 4HCRL 4AIXA 1NUFA 3CLEH 3G5YB 4WW2A 2DQFB 3QHFH 5ALCL 1A6WH 5I73B 4XP9L 1DCLA 2ICWA 3LS4L 1MPAH 3Q3GB 4LFHG 3T0XA 2ZG3A 2W65B 5F7MC 3T2PA 1CD0A 5EOQL 4MD0A 3KPLB 3H7BB 2FSEB 2A6DA 3RZWA 5IB1B 5L7XL 3QBTB 1S9XB 1U8MA 2C3VA 5EIQA 1JFQL 4FQXA 1LGVA 3GK8H 2ZCHH 2ID5A 4YFEA 3QI9D 5F70A 2WBJA 2ZJSH 2OR9L 1M7XA 4AG4L 3O4LE 5TGBA 2C3VB 3A0OA 3BJ91 1PKQB 2HT4C 3UYOD 4RFEB 4M8VA 4V2BA 2B2XH 3QH3A 3QJFA 5IB1A 3WKNA 4F58L 1TJGL 5IQ7L 1WITA 4WVRA 2CDFA 1Q9OA 3UBXB 4LCIH 1YDPB 3LRSB 5JDJA 4OD1H 4P46A 5FUOH 3OKOA 4WWKA 1YY8B 5C0CA 3CGTA 5ELIA 5C1MB 1NBYB 1U6AH 4FS0A 3TN0A 1NCTA 1TVHB 4JAMA 4NM8L 3GMNB 4NNPH 1AFVL 5IW1B 4KQ3L 5KSBE 2RQ8A 2ICES 5ADPL 1VADA 4YHLH 2UZYB 4FRWA 1J0KA 1NEZG 3R8BB 2X4NB 2MTPA 1T2XA 4PD4J 5EZJA 5EBMB 1X5GA 4FTVB 4JKLA 3J8F7 3GEWB 1JF5A 4RRPA 3ARFB 3CZFA 1SJEA 4IIQB 1CFSB 5I19H 1OAQL 3JSSA 2AJSH 3MC0A 3RQ3A 3WE6A 2YPLE 4HLZG 3IT8D 1WAAA 4PJ5E 5JMRA 1QPPA 4ONFL 4PJEE 3EHBD 2UVEA 2APTA 4UT6H 1C12B 3MNZA 1P84K 2DMBA 3ZHDA 3RIAK 2Z35B 2VRAA 5D2NC 2P44B 5CINH 5B8CA 3FTGA 3MLSH 5J6GA 1NDGA 5GZOD 1N3NB 4JM4L 5FHAH 4M7KL 5DS8B 3QDJB 3SGKA 1U2HA 4AM0A 3T2NH 4O2EA 4ZFOB 1RZGB 3S88L 1EAPA 4U1NB 5IBUB 4XBPA 3GBNL 5AYUH 4OCLC 2VLKA 1J5OL 2HRPL 5E6IC 1WBXA 1X3DA 4UV4L 2UVFA 1A8JH 5F21B 4KJYB 4BFIB 3M8OL 5E8DH 4HEPG 5D1QD 4PRBA 3X11A 3HRPA 2DQTL 1KFAH 1X4ZA 2LAAA 1M71B 1F3RB 3IDJB 2GIYA 4BSWA 1M1SA 2BOBB 1MY7A 5DRXB 3VDAA 4QRSB 3VXNA 3WFDH 3B9VA 1ZANL 3RVUD 4L8SA 3CC5A 1YNKH 4MQXD 1LK3H 1DBMH 5I8CA 4KK6D 1DEEA 3OXRB 5DVMA 4Y1AA 5AUMB 5IKCB 1KCLA 3RI5K 2FEDD 1J1PL 5IESH 3KWWA 2PETA 3GSUB 4ZUTB 5I66A 2XT1B 4U6HB 3S4SB 2ESVA 4Z0BH 2R2HB 4LKCA 5I1CH 5HI5D 5K9KA 1KELH 3CX5J 1BVLA 25C8L 1TZGL 3KXFE 3H0TB 3PDGA 2DIAA 4GT7A 5IMKA 4BQ8A 4LVNB 2ADIA 3S3SA 4TUOA 5DK0A 4BKLA 4KTEH 4Q6IB 3QULB 2PR4L 1DVFB 4BUGA 2OI9C 2A0LD 1NGYB 4IRJB 1ZKAA 4RQQB 3VFOA 2O5YH 4QHUB 4I4WB 4R4BA 3V6BR 5AD0B 4X7TB 3EO0A 1CLZH 3W2DL 5MI0B 3C2AL 2IAMC 4GG8B 2DIBA 3GFUA 1CFVL 2OQJA 3F7VA 4JY6A 1GPOL 2NY2C 3X14B 3BIKB 2AP2A 3VFTB 2H3NA 4NN5B 3WNNA 3EJZC 2XTJD 2YKLH 1FL5B 2B4CC 4UT7H 5L8KB 3GSOB 3WXVH 4WUUB 4X80L 4UQ2A 5E8OA 4K2UH 1JNLH 1IARB 3MREA 1T3FB 5EZLB 2HH0L 2HTLD 1Q0XH 4YGVA 4KVCH 4D0BA 3F58L 1E4JA 3HB3D 3VXSA 1EGJL 4F7CB 3NAAL 4N0UB 3MCLH 4GAJH 5A2IH 1FJ1B 2G2RA 1R24A 3NZ8A 1JNNL 4IMKA 1NGPH 2EC8A 2NY5L 4HGWB 2QQLH 4DCQA 3VFPB 3S98A 1SQ2N 4LGRB 4NKIL 5F89A 3U0PB 1HHHA 3DX6B 1HNFA 5L0QB 3BPCB 3EGSA 3VFWB 4U1JA 1U8HB 4OGAC 1RZIB 4PB0H 2EIDA 1JWMB 4Z5RB 4HAGA 3H42L 4KAQL 1UZ6F 3CCHB 5ICYB 2EEDA 2ESVE 3L3HA 3DGGA 5DD3L 5AZEL 5DQ9B 4KKBC 3HI5L 5I1DB 5IJVB 2ZKHL 1JYXA 4QRPD 1TJIH 1JTOA 1LP9F 4JANA 4O4YL 4NQXB 3QQ3B 1IGJA 1IM9B 1IEBA 3ARUA 2VUYA 5GRWA 1MLBA 4LRIA 4YXHL 4Z7OE 3T0EA 5GQBA 1K5NB 3IJYB 5C0GB 2QSTA 1ZA3B 3V6OE 3AU1A 4TVPH 2P24A 1EO5A 4GRLC 1T21B 1JGDB 3ECBA 4R96A 1A7OH 3DXAD 2GEEA 3V7MA 3LHPL 3ZDZE 3QHZL 1U8PA 2FHBA 3QUKB 1DBJL 5DWUH 4ZFOL 1KTDA 1A3LL 1QA9A 4K7PX 1MHEB 2Q6WA 4C56B 3ZDXE 5LQBL 3AMKA 5ICXA 1ZLUH 3N1GC 3NH7L 3FQXA 1AIFA 1ULVA 2JB6B 5IEKA 3VGAC 5BCAA 5GS2D 4I3SH 1I1CA 1XF1A 5KN5B 4OB5H 2A6KB 3L3OA 5LBSL 4WEBH 5J8OA 1O7SA 1I75A 4U31A 2Q1EA 4DQOL 1A9EA 5D1ZB 5F7NC 5TJWK 2IH1A 4Y7MA 5FKPA 3MA9H 1HWGB 3CXHJ 4ZPVA 1JGVH 1JGLH 2CLRA 3O3AA 3JXAA 4FTVD 4HIXL 5LBSH 3FAXA 2ZNXA 4NQUA 4WFGE 5HPMB 1U92B 3FJTA 2YWZA 5DD5H 4JRYD 4PLOB 4K07A 5CIPA 4QGTA 4FXGA 4XXCA 5GIRA 4G6FD 1FVCA 1FIGH 4MDIB 1MCBA 3T1FA 1S7QA 1OWRM 4QWWD 3I2CH 4KJPD 2ESVD 4QHKJ 5KSUB 1FO0L 4GW1B 4K9EC 2CO6B 4HPOL 3TV3H 2PW2B 5K59F 5HHNB 1IAMA 3OAZH 1V5JA 3ISWA 1JPFA 4YR6A 3FT4A 2QV2A 4JPIA 4HKJA 4X5XA 5JNYB 3O6ML 3VH8B 3IGAB 4HHAA 2GY5A 4JHWL 2IH3A 4F7MA 3S5LA 4UQ3A 2GHWB 3F12B 2O61B 5BMFL 4KKLD 2EEBA 1D5BB 3WKML 4PY8I 3LS5H 3SKOA 1A22B 12E8L 3VXUA 2JTDA 3CH1A 3I9GL 4Z77B 3SKJH 5F1NB 5FO9B 1A6ZA 4Y4HC 5AWNL 2BCKA 3JWDL 4KAQH 5E2WH 1OAKH 3O11B 5IROA 3L95B 3M1BB 3WS6C 1EHLL 4IOIB 2DWEB 3MNVB 1F6FB 1VEMA 4KRMB 4P23B 1EO8H 1WZ1H 5CGYD 4UOJA 2W0FA 1TZIB 4JKWA 4ZFGL 4XCYA 3MACH 2J12B 5F9OH 4LF3A 5CINL 1ETZA 2HG5A 4KDWA 1FFOB 2QQKL 1KGCD 2DQGL 2GSGB 4P2OA 1RIVL 5F1IA 4WFEE 4HK0B 4JVPA 4MNQE 5CEZD 5EO1B 1JNNH 2V9TA 3OGOE 2BDNL 4E41E 1L7IH 4IS6A 3MLYL 3D69B 3LQAL 3CSBA 2SEBB 2QQKH 1U8IB 4EI5B 3MUZ1 2VLKD 1FBIH 1PDKA 5SX5H 4NQSB 2YPLA 5L2JA 4PJGF 4WRLA 3EYQD 5DRZB 4UINL 3BGAA 2XN9E 3T0EC 3D39E 3NCBB 2YD6A 5CWSA 4EUPG 3G08B 4RGMB 4S0SD 2FLBT 3P0YL 3HC4L 4XPBH 1R5WA 1XIWB 5C07D 4PGBB 5D7JD 2Y6SC 4IJ3C 4XNYL 5E94B 1UWGL 2IF7A 3SPVB 1FSKB 5IBLC 1FFQA 4ZFZA 4JFED 5BOZG 4KJQD 3LZFH 5H8DA 5JA9A 1FRGH 4P4KD 3TT1H 3MRMB 1MVUA 4M6NH 4J8RA 3MLZH 1EFXB 1BFVL 2AI0H 1WZMA 3QEHB 5I2IA 4G43B 5DD5L 1OSZA 3AXLA 1NGWA 3I3BA 3LN4B 2VSDA 3OKEB 4WCYL 4OAWB 1R5WB 1KC5L 4X9IA 5C9JA 2X4TA 4FZ8H 2D03H 1UCBH 3RDTA 3MRDA 3GSWB 5DR5H 3O6FA 5D7IA 3VGFA 1AGCB 1NUGA 5CKGA 2AJVH 5MENA 2CIKB 5L2JB 3ZHKA 5IUSA 4WEUD 3WS3A 3GSVA 5AYQA 2IC2A 3ARFD 3BP6B 1T4KA 5CZKA 1Z5LA 1GPOH 2ARJQ 2YBRA 4LSDA 3WFHB 3IS1X 3T09A 5DR5L 3P0VH 5DD1H 4IS6B 2V2XB 5IQ9A 3V4UH 4NNPL 1XCQB 1TQCC 2C3WA 1DL7L 2UWEE 2EXWD 1NEZB 3O6FD 1KLGB 1FZJB 2N7AA 4WJ5B 1IC7L 7FABL 3QISA 2XQBL 4AEIH 3SE4C 2FYYA 1NPUA 1JV5B 4M1DL 4AL8H 4YZFF 5KG9A 4N0CD 5ECJE 1WBZB 2R4RL 5C09A 1TZIA 5D6DC 1SMAA 3RP1A 4M1CD 4LSPH 4KPHH 4X9BA 1ONQA 5TE4H 1I1FA 4ZNCD 1T7WA 4J4PD 2YA2A 2YC1A 1JWSA 3PWVA 5KSAC 3C5JB 1MFBH 2XPGB 1RIHH 5A2KH 3O3BA 4GMTH 4MQ7B 3IDNB 5K9QG 4NQCA 1JI2A 3RAJH 1C5CH 1F90L 4PUBH 1UM4H 1G1CA 3QCUH 5D70L 4HDIA 4KROD 5HGGS 1CF8L 1IQDA 3I84A 3NIGE 4JFYB 3LEXB 3VDBA 1T03H 3H6JA 5IV2B 2AK4B 4JLRA 4M5YH 3B8SA 4U1IB 3MV7A 3FMGH 5EU6B 3QXTA 4JDZA 1QHPA 3GO1L 4MXQD 2FGWL 2F19L 1JPFB 3TIDA 3O3DB 4FXLA 1JHTA 5I18H 2EZ0D 5SX5K 1A3RH 2VR5A 4XVJH 1G6RH 4FN0A 1VACA 3QO0B 4R4FH 3BQUA 4X4XA 5E2UL 4H1LB 2AABH 4NCC1 1HH9A 2YD2A 3T1FB 1ZSDA 2VLLB 4ONHB 5CIPB 3LQMA 4LAQH 4OLVL 4X4ME 4ODSH 2OL3H 4UTAH 3QHZH 3KVQA 1G1YA 4OM0H 4D0DA 5FOBB 5GS0D 1KB5L 1IGMH 2FZ3B 2MKWA 4ZSOA 2X4PA 2V5SA 2VO5A 1YEKL 2B0SL 2JJTC 2BFVL 2X4QB 4Y4HB 5CKAA 3WIHL 1UKSA 1BQLL 5L2KB 1A6UL 3GIVA 5IFAH 3OAYH 3KDMA 3U9PH 2VDNL 4NO2B 4XTRD 4P5TC 1KIRA 2OJZH 3QDME 4PJ8C 1OP3H 2NY0C 5GSVA 2A9ML 4L8CA 1QBAA 5CP3H 4BSJA 3RPIA 4Y5VA 5T3XD 4MJ5B 4BQCA 5F71A 3S4SG 4ENEC 1DLHB 4PJXB 2CK0H 2EDHA 4U6XA 3BDYL 4Y5XC 1OB1A 4GKZB 1KTDB 3DX8B 1BD2D 4QRRD 4F37F 3GNMH 4OFDA 5GRYA 4TN9A 4UIMB 4WO4C 3VXUD 5B38A 2ZSVB 4OIBA 2BHZA 3BN9D 5JZ7D 5KVFL 4JDVB 3HKFA 5F3HA 3QIUD 3GSNA 4UU9B 4NZRL 2BP3A 1FV1A 2R69H 2R1WA 3VRIA 1FZMA 2VB5A 5K93A 2V2TA 4PRIA 4LCYA 3AU1B 3CU1A 1IL1A 2Q8AL 3S37L 4IRZH 3FONA 3NFSH 2ZSWA 5HJ3B 3P9MB 1MCQA 1UA6H 2RFXB 1Q94B 4P23D 4NQXA 4JO4L 4JFQB 2QHLA 1ZLWH 4G7VL 3QRGL 1HI6A 3AS3A 2RGSA 3ROLA 1MAKA 4U1GB 4TRPL 1T89C 4ZO8A 3PHQB 3NFSL 4LLWB 1ZE3C 1JRHH 1CD9B 4LLMA 1UCBL 5IB5A 1HXYB 1ADQL 4JZOA 4M43H 2HFGH 1AGEA 2ICEB 3PIQA 2O5ZL 3GI8H 1S7WB 2E9WA 4S1QL 1C16A 4TRPH 4H0GA 5F89B 1CK0H 3K46A 4J6RL 4BH8A 1CLOH 3QDAA 2DBJA 2BHUA 3CFDB 3NCCB 4MD5B 3O4OC 2X4SA 2D7TL 2BNRD 5E6ZA 2Z0BA 4NM4H 1IZKA 2VZVA 4PJBE 3B43A 3VFSB 1FN4A 2DAVA 5HVGB 4TVSa 3PWNA 3D2UD 5LAXB 4K3JL 1XGTB 5HHPA 4I0PB 1NAMH 2DKUA 1IKFH 4O2CB 2VDRL 5IR1A 3DUUA 4P2RE 1ZANH 2NY3B 5DQDH 3MXWL 3FO9A 5IWLA 5E99H 1OLZA 3QUMA 4K8RH 3DARA 4P9HH 3WLWD 3H3KA 5MI0C 2CRMA 3MOAH 3D2UA 1JGEB 3B2UC 5DJ6B 2P8LB 1A4JB 1J1PH 1IRAY 1QFWH 3OJDB 3TYFA 3C60A 4RZCA 2VN7A 5GS0C 1F11A 2H32B 3MO1A 4PJCF 1FH5H 4R4BB 1C5DA 2IWGA 1R5VA 3O6KH 2A0LC 1KV3A 4EIGB 4HXBL 2VXQH 2D7PA 3FO1A 3E3QC 2BSRA 1GGIL 1AE6L 4LVHC 2V7HA 3BH9B 4MA8L 3IU4L 1DBKL 2QSQA 1Q9LA 1K6QL 3L5HA 3B3IB 3H0TA 4YNYB 1EDQA 2AGJH 3GMQA 5H2BA 5FF6B 5EN2B 2R2HA 4LKCB 3M07A 3IDXH 3VFNB 2FGWH 5IMOB 1DQQB 3BPNB 2JIXD 5C07A 4HC1L 4K9EL 2UUDH 5FGSA 5E2TH 2F53A 1Q72L 3QI9C 1HHKB 3RWEA 2WM0A 5E00B 5D1QA 5ABDE 2BERA 2P5WE 2P7TB 3HR5A 5AUMA 5J1AB 5A3ID 3L9RB 3WD5H 2ZSWB 1BFVH 2AI0L 4PG2C 1S78C 4Y2DD 4FQLL 3ZKXC 1WWCA 3CC5B 4LCYB 5DTFB 3BRFA 4MX7A 5DFVD 4L8SB 2VLJB 4OF8A 5E2TL 3V95A 2Y7QB 2X05A 1NGQH 2GQHA 1VA9A 2BSTB 1M6OA 1SBSL 2EICA 4P3CL 1HDMA 3JV0A 3U82B 2IAMB 1EH9A 2F9BT 2N1KA 3JWOH 4JO1H 5DRNA 4MX7B 5C08B 4F9LC 4NN5C 4CVWA 4HUNB 4HBCH 4PJBB 5EBWA 1LO4L 3CDGB 2JB5H 4N0FB 2ADFH 4MJIE 3QT2A 2AV1A 4WV1B 1YYMH 1IEHA 4HWBH 4O58H 1NCWL 3S6CA 4NHUA 3S36X 4HUUA 1AC6A 3TBWA 1LO4H 2ADJA 3RWHA 4XH2A 3QDJA 4OZ4B 4XP6H 3FKUS 3RU8L 3QWRA 4OZGA 2LVCA 3U0WL 2X5PA 3P77A 3QIUA 1MCNA 1NDGB 3BN3B 5J6GB 4PP2B 2HLFC 3ZKMD 1J11A 4D9LL 2FBJL 2FZ3A 5FOBA 5F7KC 4NRZB 1X5FA 1VEPA 1G7QB 3IRZA 1VFOA 5DUBA 1Z2KA 4S1RL 2XN9A 2ITDA 1EAJA 3IETA 2YUVA 5GGRA 3SDAD 3UJTH 1L7TH 1GH7A 3FO9B 5FYJU 3BQUB 4X4XB 5HVWA 4Z7WF 1N5AA 4N90D 2F53E 3U36A 3T2NL 4KRPC 3HE6D 3RUGE 5C0AE 1YJDH 3EJJX 3PWJB 2Y06H 4PLJD 5BVPH 1KG0A 3EFDH 2ENSA 4U6YB 4HUVA 2X4NA 3V5DA 1BLNB 3PL6C 4EDXA 4JQIH 4OF7A 1MFAH 3DJ9A 1H3TA 4JFYA 1CE1L 35C8L 3TZVC 3LQZA 4Y16A 3MYJB 4MQSB 3MQIA 4LLYA 1UM5L 3RGVA 4NQCB 3IDNA 5I1JH 1QRKA 3TLRA 4XC3H 3Q0HA 5K33A 1JZ4A 2QBWA 4G8EA 4WW1A 4LAQL 5T3XL 4O4YH 2YUXA 1FNSL 4Z7WE 4G80A 4LNVA 3RUGF 3DO7B 4GRWH 1LO0L 2IPKA 1UM5H 4LLWA 2WWKO 4QOKD 3QDMD 5DZNA 4ZFFA 3QG7H 2J3SA 3QI9A 4LHUD 5AAWA 1OD9A 1ZGLP 4M3KB 5JIHA 1W8OA 4XPAL 2FNBA 2V5RA 5E9DD 1BOGB 3BXNB 4P48A 4XNZC 4W4NA 4RDQG 5IB4B 3D25B 3WS6A 4MD0B 3PXJA 1FRGL 3B9KD 3K8KA 4BUHA 1KPVB 5DMGD 3VXME 4KMLB 5DT1L 1FV1B 1H5BC 2J88H 2J8UF 5BQ7B 3ARBD 4TVPD 3WUZA 3GMPB 1BAFL 2AAVA 4NPYA 2VXQL 3DX9A 5IF0A 4NUJA 4UIMA 5J12B 3RVXD 1INDH 3O45A 1F2XK 3MLRL 4JHAL 2CGRH 3GMLB 3O6FB 5D7IB 2CXKA 2I27N 1FFNB 3QWOA 1GHFH 4M6ML 5KZCD 2X44D 1K8DB 4JDTL 2GAZB 3H9HA 1A6WL 1SBBA 1U2CA 4NC2B 4UT7L 2YRPA 4KK5C 3TBYA 1CDGA 4TTDC 2ARJA 3G5XB 2YD8A 2KQNA 2P49B 4G43A 1T66D 4ONGH 5CP3A 1KCRH 3MV7E 1KEGH 5HD8D 4TUKL 3NAAH 4IMLB 5I75B 2MPAL 1B9ZA 4JO3L 4N5EC 4W68A 4Y19A 2BVOA 5AEAA 1FG2A 1NJ9B 2XACC 4WI5A 4FQQB 4CKVX 2G75B 4D0DB 1SM3L 1PYWB 4HS6B 5F9OL 4Q9RL 1OAZH 3EUUA 5HHOB 4FZEL 4WFHD 1X7QA 4LP5A 4PJHB 4K7FB 4A6YA 4ZUVB 3O41A 3WO3B 2NY1B 1QFHA 3U30B 3NABL 1FFPA 2YPLB 5HHQA 2F54B 4Y1AE 4FFWD 4KVCL 4PP1D 4KV5F 1OLLA 4F3FB 5MHSE 1U6AL 4JM4H 3SQOL 4NSKB 2CJUH 4HWBL 4O58L 4M8QA 2NX5A 4KKAD 1U8OB 2SEBA 3BPLC 5JHDE 1T7YA 3MMEB 4HPYH 4NNYB 3DMMC 1CGXA 3WHXB 4NJAH 1UH4A 1MQ8A 1M05B 5TDOA 1JF1B 1ZVHA 4HSQA 4LF3B 5EH1A 3C6LB 1QBMH 1NMAL 2JLLA 1CU4H 4RNRB 5DMIL 1MCPH 3ZE0E 2R2CA 3O2WH 4P23A 4P9HL 2D4DA 5FK9A 1HYSC 2NZ9C 2AABL 1JRHI 3MJ7A 2VQ1B 2G60L 3B5GA 4DAGH 4DKDC 2PTVA 2EDWA 1W72B 1NCDL 43C9B 3KPOA 3RTQC 1FL6A 4N0RA 1UC6A 3TBVA 5EUOF 3O2WL 2H1PL 4P5TD 4F7TB 4P2OD 3RVTD 2D3VA 3M17A 3QA3B 5F96H 2Y72A 3HAEG 4MJ2A 5I0ZA 3DTXB 4XMPH 2E27L 4Y19E 1REIA 4LSUH 4XRCA 1T2QL 2Y36H 1N4XL 3VMNA 3AFLA 5JW3L 5IFAL 1OHQA 4XNUH 4YO0A 1XR9B 4HKJB 4X5XB 2CXGA 4L5FL 25C8H 2NCMA 3DIFB 4I77H 4YR6B 3SY0B 3WFCL 1NFDA 4X83A 4M1GH 4TUJB 5F8QC 2C3GA 2V17L 4WO4D 2I26N 1GSMA 4GO6B 5KSUA 3B9EA 4UBDC 2PYEB 2AK1L 5MENB 1AGCA 2DQTH 4WTWA 2XWTB 1EEZA 3SE4A 5IW6B 1RMFH 5GGSY 3D87B 4D9RE 3MRDB 1ZAGA 5CILH 1I3GH 4GKSA 5GIRB 1AQDB 1MI5B 1RJLB 1A7BA 4U4BA 4YBLC 4M1DH 1OGAA 2AXGB 2VE6A 5FUCE 5E8EA 2HLAB 1OSZB 3AXLB 1SY6L 1TQCB 3CLFH 3MRJA 1Z9SA 1P5VA 1YN7A 5GJSH 1KCUL 2DMKA 5KSVA 4QTIH 3MRKB 3FB7B 4PJ7F 1X5XA 5I30L 4RIRA 2GUOB 1KULA 4M03A 2DLIA 1YYML 2DYPD 4PV8B 4N8VA 1I7RA 4PRDB 4BZ2L 1E27B 2EIZB 5C6WH 5I76A 5KN5A 1CBVH 3D18B 3RGHA 5IVZB 4JFPB 4OBRA 4UB0H 5J13B 2NTFB 5D2LA 5J9PA 3TPUA 5D70H 1ACYL 5E5MA 5EO9B 3LPWA 3WXWL 1JI1A 2D4FA 2P5EB 5SV3A 5L0QC 4MA3A 4QT5A 4WFED 4AIZB 4C55A 3G5ZA 1RZ7H 2AKRA 4PP1C 1NSNH 4ORZC 1CFBA 5C0DB 1JYWA 5FECB 4BQ9A 3FMGL 5FYJD 4DZ8B 1A9BA 5CUSH 5L88L 4QRUA 5T3ZE 1E4XL 4X99B 4UIKL 4F7EA 5ACZA 3EOTL 2VLKE 4NZTH 5DLMH 3ULVF 5HHXH 4K7PY 3F6LA 5H35B 3WLBA 5E56A 2DYPB 3C8DA 4RGNE 5GGVY 1DFBL 3T0EB 4OJFH 5DHYB 1IEBB 1WQVT 1X9QA 4JM2C 5T5NG 5ACZB 4UTAL 3U46A 4YXHH 1P7QD 4PJAE 1C08A 3QG6A 2DM7A 4S1DC 1MRCH 3DGGB 1W0VB 4TULH 4U1MA 1IGML 1KB5H 1QKZL 5DHYA 3O9WA 2BJML 5DUPH 2A1WL 5FYLL 4JQIL 3QCUL 5ETUB 1JIBA 4ZS7L 5DFTA 3LKOB 4HUKB 1T83A 2FWOB 3MRGB 4J3VA 2CJUL 3VXUB 3FHQA <