4UILL

Crystal structure of quinine-dependent fab 314.1 with quinine
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
213
structure length
213
Chain Sequence
DIVMTQTTSSLSASLGDRVTISCRASQDISNYLSWYQQKPDGTVKVLIYYTSKLHSGVPSRFSGSGSGTDYSLTISNLEQEDIATYFCQQGNTLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 314.1
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
total genus 30
structure length 213
sequence length 213
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilL02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uilL01
1AIFA 1E4KA 3D48R 4H1LA 1JUFB 3E0GA 3HAEA 1MWAL 3RGVB 2R0WL 1ACYL 3C6LA 4PJIB 2OL3B 4DZBA 4OI7A 1A6TA 1NFDB 1MI5B 4JFZH 1I3GH 2VLKB 5D2LB 3RWFB 1ERNA 3SN6N 4QLRA 1I8IB 3TZVA 1PZUB 4UI2A 4YDLB 1UZ6E 3VGBA 2VZVA 1S3KL 4M8QB 4LCWA 5I9QB 3X13A 4D9RD 1GXEA 4G5ZH 1AIFB 5GGTH 1P9MA 1X4XA 2WIIA 4ZFFB 4DZBB 1A6TB 2FECL 3IAQA 5HHPA 1XCTA 3TZVB 4DWHA 5EZIL 3VFNA 1X5GA 1G6RL 5DJDA 3W9EB 2EKSB 3NPZB 3M17B 5DEZA 4MQ7A 5FUCC 1QHPA 3X13B 4WI9A 2WBJC 4OZFA 4DKFL 2NY1B 1YMHA 2OLDA 5DQ9A 4LSVH 4N0UA 2P45B 2F5AL 2WIIB 4RGOL 2Y7QA 3T04D 5HHPB 2NY4D 4WHYH 2P24A 1EK3A 2PUQT 1YEFL 2ID5A 3UTQA 4CUCA 3VFNB 5DJDB 2YA1A 4KK9C 4XVTL 5KSBB 5FUZH 5KSAD 3SDDC 5T1KB 3S98A 2B0SH 1YMHB 5DQ9B 3U0WH 3WIIH 3ARDD 4H8WH 4N0UB 3PWNA 1RZIA 2XWTA 4LLAA 4WFFD 4MNQA 4QOKD 4KK9D 4OGAD 4G3YH 2P24B 4L3ED 1WEJH 2B20A 3QJHA 1OT1A 2NXYC 2ZUSA 2R0ZL 1T0PB 4UT9L 2DJUA 4JZJA 4YDIL 4BZ2L 2E9IA 4Z7WF 3CD4A 2EDHA 2DQTL 2QSCL 3X11B 5E94A 3PWNB 4HH9A 2XWTB 3X3GH 4EN3B 3T2QA 4P2OA 1Z3GL 1D9KA 4ZTPH 1QBLH 1C16A 1ZHBB 3IDNA 4HS3A 3QJHB 1VFOA 4WUUB 1XGRB 2DLTA 4JZJB 3NCFB 4DFIA 1ZGLA 3BHBB 3BSZL 2OP4H 5I71C 1XF3B 3MROA 5F9AC 3E2HC 1BZ7A 4HJ0C 4HH9B 5CIPH 3PGDB 3ZKXC 1D9KB 4IOIB 5E95B 3GNML 4HS3B 3QUMB 5FV2A 8CGTA 1CLZH 4LPWA 2H2SC 3HE6C 3JWOH 3F6IA 1BFTA 4L9LA 5BRZA 5I1IL 1KOAA 2MTPA 5SWQA 4IRJC 3W5MA 3G5XA 1ZGLB 5CJQL 1FNLA 5AG8A 1CGVA 1O0VA 3V2AR 2G2RA 4HS6A 5HY9A 5E8NB 1OGTA 1F90H 3LH2L 3RWDB 2W9DH 3LEYL 4OB5H 3LSOB 3DI3B 5IV2A 2AV1A 1DN2A 1LDSA 2YWZA 3RTQC 4XP4H 5LBSL 4CNIA 4L9LB 2FH8A 5BRZB 1T5WA 2X4UA 5SWQB 3ARXA 2H9GA 2G2RB 1YN6A 4HS6B 4Z7VB 4HPOH 3MRDA 5KW9H 1OGTB 1NAMH 1UZ6F 3OXRA 4MGXA 3RTQD 2HKFL 4RDQF 5IBLC 4PREB 1KXQE 5DJ8B 4LHQB 1MJUL 4GXUN 4KK8D 5IV2B 4MA1C 1GSMA 3B5GA 1T5WB 4P4RA 2X4UB 1J05B 2H9GB 2J8OA 4MJID 3O6MH 1JHLL 2HJFA 1BQHB 4DVRL 2IBZY 2W38A 1H0DA 1QRND 2GK2A 4GKOA 4Q6IB 3OXRB 3ESUF 3KS0J 4G9FD 4XPAL 1OARH 3E6HB 3RJDA 3LY6A 3G5ZA 1MFDH 3F7VB 5F3BA 5FDYA 5GPRA 4OZ4B 5D7LA 2BY1A 1AKJA 2VRAA 4P4RB 1HZHH 2P5WB 5C7XL 4JFFD 2HJFB 2E7BA 4QXGH 1ZTXL 4ZUUA 1H0DB 4HJJH 2FB4H 1JF5A 4GKSA 1MRDL 4YH6A 4ODSH 4HWEH 4LFHD 4LASH 4DGVH 4AIZA 1I8LC 4O2EA 3AREC 3N1MC 3BH8A 2DOCA 3G5ZB 2DQJL 4JM4H 1ORQA 1FVCA 4D0DA 5GIRB 3RVUC 1AKJB 1J86A 3L5JA 2E5EA 3VXMD 4L29A 1NLBL 1MCQA 1PQZB 4ZUUB 4K3GA 2XKUA 2DIBA 5GHWL 2B1AH 4ZS6C 4GKSB 2OTUB 2G75A 3WD5H 1NCNA 4AIZB 3RVUD 1OCWH 4HKZA 4O2EB 3BH8B 4ETYA 5MP6H 3UPRA 1ORQB 1FVCB 5B3JE 1OWRM 3THML 1N2RA 1T22A 4L29B 1S9VB 5HHXL 1TITA 1KLUA 3WIFA 1FLTX 2F8XC 1NSNL 2G75B 5DR5H 5HGDA 4I2XA 1TZIA 5BS0B 3STZA 3T0DA 4PTUA 4HKZB 2R4SH 3GMMA 2VUYA 4K3EH 3T2OA 3QEQE 2IPKA 3UPRB 3MODL 1B90A 3LS5L 2XKNA 1RUMH 1FBIL 3LB6D 2W1NA 2YUVA 3CDFA 4HT1L 4UV7H 6FABH 2DIAA 5D7SL 3RUGA 4NRZA 1ITBB 4JHWL 3DBXA 1I9RL 4H0GA 2AGJH 4M6OH 1KLUB 2QL1A 3VG9B 5DK2A 1U8LB 1TCMA 3WNKA 4I2XB 1TZIB 3STZB 3MLWL 2LV4A 4YE4H 3L5XL 5IJVA 5HGHA 2XKNB 2DDQH 1BOGA 4P23B 1OAQL 3CFCL 1U2CA 3HMXH 1E27A 1AY1H 2V6HA 2JCCE 1A5FH 2X4OA 3CLFH 1JGLL 3NCCB 4L8SC 5HYJA 2PR4H 5DK2B 4EVNA 1P4BL 4G6AD 5E8PB 3NGBC 1AJ7L 1BVLB 2NY5L 4N9GA 1LDPL 3MRRA 1SMOA 4Z78B 1DBBL 3U0TA 5IJVB 5HGHB 3JZ7A 1AE6H 3P2TA 5D7KE 1FLRL 5FGSA 5GS0H 2HVJB 2VDOH 2X4OB 4H0HB 5EU6B 5HYJB 3RQ3A 4JCLA 4QYOA 3C5SA 4EVNB 5EUOA 1S5HA 4NPYA 2IF7A 3MRRB 4F7MA 5L2KE 1RIVH 3U0TB 5EC2A 4OCWL 3KPNA 3CFBA 1AO7B 5J12B 3MJ9H 1T7YA 1QKZH 3TP4A 3CXDL 1UYWH 3OGOE 5E1AB 4S2SA 3QH3A 1ND0B 5BZWB 3LQZA 5EUOB 1NJ9B 1S5HB 2RCSL 5FB8B 1CDUA 3T4YA 4QCIA 2FBJL 3OV6A 4X8XA 2MCPL 2A74B 3QJFA 4WCYH 2W0FB 5E2JA 5JQ6H 4JO2L 3A6CH 5GRJL 3FQXA 3TVMB 4GRLD 5I1CH 4S2SB 4TPRL 3QH3B 4BH7A 1JPST 4DW2H 3VFRA 5JPMB 4M5YL 1D3CA 2R1XA 2VKWA 3T4YB 1F3RB 1QFWI 2BX5A 4JANA 5FXCH 5ILTH 5EOCL 4LPXA 4O4YL 3QI9A 3QJFB 4RFEA 5DRZA 4CMHB 4PJ7F 5BV7H 4CDGC 5CJOL 3WFZA 2L0DA 5DMGC 1I1YB 3FQXB 3S4SG 3O8XC 5EORH 2QADB 2J6EH 1KIQA 3SGKA 4A2LA 2FSEA 5B3JF 1GGUA 2IH1A 4TUKH 2DQGL 2FGWL 2Z4QB 5CJ5A 2YD7A 1T6WA 1A3RH 2R1XB 5M94B 1JRHH 3MACL 3O0RH 5FKPA 3MV01 5F97E 5DRZB 4RFEB 1F6FB 1UM5L 2KKQA 4NYLA 4NOFA 3FMGH 3FONA 3V0WH 4LNVA 3QEGH 1KIQB 3TESA 2F8OA 2FSEB 2W0KA 5SX4I 3WLBB 4YXLH 3Q6FA 4OD1H 3P9MB 2ADFL 4GKZA 4L5FL 4LLDA 4ZS7L 3H9HA 5FKPB 4LLUA 1RY7B 3GHBL 1UCBH 3GJFA 3HHRB 2Z8VC 4NYLB 2F54D 4MD4B 3FONB 3P4NA 4YEEA 3GGWB 5F70A 2P42B 4FQIL 4JRYD 3QRGL 1J1OL 3Q6FB 3B2UC 3SDXA 4U6XA 3UYRL 3DJ9A 4NWTH 1VB9A 2DL9A 2JCCF 4LSSL 4Y1AE 2MCG1 4Y88A 5I1KL 1DBJL 2YMXH 3P4OB 4NN6B 5HGAB 3S37H 1A9EA 2O5ZL 3GJFB 4HWNA 4EI5A 2CLZA 1NBQA 3P4NB 4ZAKD 3PDGA 1H8SA 5BVPL 4YHLL 4U2ZA 4RGNB 1B0GA 3T0XA 2ZUVA 2DQDL 4ZSOE 3MRHA 2ITCA 3ULVE 1BD2E 1EMTH 2V7HA 1BJ1J 5E8OA 3WO3B 1MFCL 4EI5B 4OCSL 4HC1H 2IWGA 4R3SA 3NZHL 2R29H 3SDAD 4CADA 2XZZA 5I16A 5ICZA 4D8PA 4Z5RA 4OLWH 1C1EH 4OFYA 5TFSH 4G6JL 5INDB 4ELME 1NAMB 3PIQA 1MOEA 1IKNA 2AV7B 1FIGL 2DWEA 3EO1A 4F2MA 5E8OB 2CLRB 1YNLL 4OF0A 2B1HL 3QHZH 5EBMB 2IADA 4HKBB 4YHNA 4R3SB 4ERSL 1CDIA 1JPGA 3B6SA 4YHIA 4CADB 4JR9H 1QLFB 3HR5B 1BQUA 5I30H 1JNHB 2X4RA 4Z5RB 3QXWA 4OSUH 3QUYC 3QDME 3PIQB 4U1JA 3CFDA 1JF6A 4V2BA 1T5XA 3ZTJG 3ZYIA 2DWEB 5A2JH 3EO1B 2OXHA 4F2MB 2ED9A 1LP9A 1NPUA 3EHBD 2IADB 4MQXD 4YHNB 2EDYA 4F15C 2R0WH 3QUYD 1QSEA 2CRMA 3B6SB 2F74B 3D69A 5CLTA 4YHIB 2X4RB 1F4WL 3VJ6A 3PV7A 4M93B 1F4YL 4LMQE 1HSAB 2FYYA 1S3KH 1TCRA 4FQHA 1T5XB 2JJTA 3SKJH 4OI8A 3PWVB 1LP9B 3TBSB 2PXYD 3GMNA 4XAKD 1RUQL 5J11B 5ECJE 4GS7B 3DX6B 3D69B 1N6UA 3IDYB 4FQPA 4OIAA 4PJIE 3SPVA 3QDJD 3VJ6B 2PNDA 1NFDE 2NX5D 5EZIH 1J7VR 3GM0A 1G6RH 2FYYB 1TCRB 5EU3B 3DX9A 4FQHB 3G6JE 1J88A 2HT2C 3HZMB 1LEKA 1YUHA 2AVGA 2DF3A 2E7LA 1TJGL 5DO2C 3GMNB 2DLEA 2YUZA 4WEUD 1ZLWK 3HE7D 2APBA 5DGRA 3BPOC 3BW9A 4RGOH 4MAYA 5A2LH 5FOBA 3SPVB 1UKTA 5F7EL 1NL0L 2HT2D 5HHQA 5C3LD 5DO2D 4XVTH 3DX9B 4FQ2L 1LEKB 1MCBA 1YUHB 3WEXA 4QRRA 4HHAA 4LCWE 2F53D 2GUOA 1MJ8H 5KSUA 2J8UA 3BW9B 1FNEA 3QIBD 4HJGA 3ZT5A 5MEPA 1FZMB 5FOBB 1WGOA 1RD6A 2XTLA 5FYLH 1Z9MA 3K2UH 2R0ZH 5KVFL 4GO6B 4YDIH 1NBVL 2EDNA 3LRGA 4X6BA 1G7PB 3QT2A 4QRRB 3CH8A 4D9LH 2QSCH 1H3TA 5KSUB 1G7LA 4NO2A 2XN9A 1K6QL 1I1AC 2JJVA 2X41A 4HJGB 2FLBT 4N0UE 1Z3GH 4K2UH 1CR9L 5EA0L 3ULVF 2ZWLT 4KI1A 4MVBC 4WW2F 2FGZA 3B5TA 3LIZL 5FYKU 3UPCA 3GIZL 1ZHKA 4MYWB 3TA3D 5E9DB 1N6VA 3ZL4L 4QKXB 1FNSL 1Q9OA 4KVCL 4MVBD 2XN9B 4NO2B 1J18A 1LK3H 5C8JA 4OAWA 3TBWB 3S35X 2YD8A 1W0YT 1MJ7H 4J8RA 4MNQE 1BBJA 1YN7B 3UDWC 2DWDA 1I8KA 1ODAA 2YKLH 3U46A 2CRIA 4KTDL 1WAAA 1EV2E 3EW3B 1DN0A 1NFIA 2EDEA 1K5NB 3AS2A 1IQDA 5C8JB 3LH2H 4RISL 2FLRT 4HZAA 3TIEA 1GL4B 3D85B 5E4EB 4BM7A 3C60C 5EU5A 2PW2B 2CMRH 1N64H 2GFBB 3BKYL 2DWDB 1I8KB 1A64A 2PYEA 5LBSH 3U46B 2PW1A 4ODUA 1RVFL 1F2QA 1UM4H 5EOCJ 2OX5A 4KI5D 1FV1A 2X4NA 1NFIB 4XBEL 5KOMC 1NGYA 5IW3A 2BOBB 4AQOA 1IQDB 1FVDB 2E6PA 3TIEB 2HKFH 5C0BD 1HXYB 3AM8A 2VDML 1KJMA 4PV8A 1F4XH 1K4CA 1N26A 1MJUH 1KFAH 5EU5B 1CXEA 3JTTB 5F1IA 2UYLB 2PW1B 4OT1L 4PJIF 5J13C 1FV1B 3W2DL 1J8HD 5ISZD 4U1SA 4DVRH 1NFDF 5E6IA 2HWZH 5D2LF 3WNMA 3V7AG 4YXKL 4OCRH 3PWUA 1KJMB 2BVTA 2VSCA 4PV8B 1J1PH 5BV7B 1CFQA 3F12A 5C0JA 1YECL 5BJTB 2AK1L 5GRUL 5BZDA 5F1IB 1CDGA 3CC5B 4DEPB 4QHUB 5C7XH 5FM5M 2JJWA 1JZ5A 4OJFH 5LKNA 4U1SB 1ZTXH 1DUYA 5E6IB 4F58H 5EUKA 4LHJB 5IW6A 1MRDH 5C0NC 2WP3O 1A9BB 1CFQB 3V5HA 5C0JB 3WFHB 3UTOA 4DZ8A 1QACA 2DQJH 4KMLB 1INDL 5BZDB 1X5YA 3WN5B 4ZO9A 1Q0YH 1JPSH 4WI6A 1NLBH 3HI5L 1DUYB 3FO2A 5EUKB 5GHWH 4PJ5A 2GJ6D 4JZNA 5IW6B 43C9A 1XF1A 2Y9RT 2VDNL 5D1ZC 3FFDA 3F7YA 4JPVL 1XGUA 4ZYKB 1FORH 3FO9A 3U7AA 2KH2B 5CSBA 4X80L 5KSBF 5EZJB 5A3IC 4G8GB 5T3ZL 4CVWA 1JGVL 3THMH 5DK0A 1NGPH 3WIHA 4LCCA 1EGJL 5B4MC 5JXEA 5I0ZA 1U3HC 5D7LE 2FEDD 3WFCL 5J0BA 5J1TC 5HHXH 1BIIB 4WWKD 2WANA 4PJ5B 1V3LA 3VXQA 3EDKA 4JZNB 1KCRL 2PTVA 1NSNH 5IWLC 3O6LL 3SO3C 3FO9B 1PKQA 5HHNA 4J3UA 5B4MD 1NUFA 4DTGH 1KLGA 3FKUS 1EUTA 3ULVC 4HMCA 1RPQA 2EDXA 3GSNA 5DK0B 3LS5H 4LCCB 3RKPA 4WW2C 1WC7A 1UH3A 4HT1H 4PB9L 4JHWH 1U3ZA 1I9RH 5D1QA 5IJKA 2R1WA 1BD2D 1CT8A 3RWGA 1WSST 3PGCA 5HHNB 1HHIB 5MEQA 4BUHA 1KLGB 3MLWH 4UBDC 1FO0A 3L5XH 1GGBL 5E8EB 1WC7B 2FD6L 4BKLB 1OAQH 3N85L 5T3XD 5TDNA 1JZ6A 1PKOA 1VERA 1JGLH 3DO3A 3ZE2E 3PGCB 5MEQB 4J23A 1AJ7H 2HMID 1RIUL 2NY5H 4I2XE 2ICEB 1DBBH 3KPOB 1EFXA 2IPTH 5CEZH 7CGTA 4M7JL 1A6AA 1Q8MA 4XNYH 3RHWF 1J8KA 4E41A 1N59B 2D9QB 3F5WA 2Y6SC 5CILL 1CLOH 4HAGA 3QDMD 3RUGE 2AJXH 2FR4A 1T80A 4HWZB 3EO9H 5LAXB 5DS8A 2Y6SD 1F8TL 4Z77B 2R9HC 1EFXB 3V0VB 1A6AB 3DUHA 4YUEH 2DBLL 3CVHH 3F5WB 2VAJA 1BFSA 4JFOA 3BQUC 5SWSB 2FR4B 2BVOB 3ZKND 2R9HD 4BSVB 4M1GL 2G60L 3QCUL 1NANI 4HCRA 4WU7A 5DS8B 3T8XA 1TNNA 3BMWA 5AEAA 2MCPH 2NQCA 3BQUD 3I6LE 3QWOB 5I9QC 2ZCHL 4KDVA 4JO2H 4GG6A 1E4KC 1Y6NR 4U05A 5GRJH 5HVGB 4GG8A 1LD9A 3C6LC 3OBAA 1P4IL 2EE6A 1BQSA 1S5IH 4M5YH 3TZVC 2PF6A 5EUOE 4WU7B 5TPWH 1KXTB 3T8XB 2E9JA 1TVHA 1RZ7L 1SBSH 3HS0A 3UBXG 5EOCH 4HIIA 3C6LD 4KHTL 5HHVL 3TNMA 2NY1C 1FGNL 3ROLB 1I3RA 5H94B 4JY4B 1LD9B 3N50A 1WFTA 2D03L 2DQGH 2J3SA 3OKNA 2JELL 1L9NA 5DJ6B 3U4AA 3MACH 3QFDA 3UTSA 4BSWA 1A1NA 2VQ1A 1IGJA 2RHEA 1G0YR 2W60A 1HEZA 3OAYH 3OAUL 2FWOA 4ZO7A 1FL6A 4U1NA 1MCNA 4PTTA 4HDIA 3DLQR 1R24A 4YHOL 2AW2A 2ADJB 2CJUL 3QFDB 5CSZA 3H8NA 3UTSB 4BSWB 3JWDL 4GAJL 2VQ1B 2OXGA 1HEZB 4PJBA 2YOCA 5HDQL 4P5TA 5GRWA 2ARJB 1FL6B 3VD5A 4U1NB 4HDIB 4JG0H 1R24B 2C4XA 3QRGH 2VLJA 3RWJB 4LSSH 4YBQC 3MGTA 4JZJC 4LKCA 3VW3L 3ZT6A 2DLFL 2ZG1A 3ZE2F 1DBJH 4PJBB 1CXFA 4N0CC 5DQJA 2O5ZH 1NCBL 5JA8B 2X6MA 4P5TB 5F8RC 1IKFH 1A1MA 1Y18A 1CDYA 2ILLA 4ZTOL 3B2VL 4JO4L 4KGLA 1JJUA 4P2OC 4KPHL 1D9KC 3R1GL 5BVPH 4YHLH 3S36L 3BP4B 2VLJB 5HHMB 2FH6A 4GMSL 4N0CD 3RUGF 2DQDH 1KCKA 3T3PE 3MGTB 2ATPA 2IBZX 2VIRB 2GI7A 4XC3L 4LKCB 3ULUL 1WQVT 4KRLB 2BNRA 5DQJB 2GTZA 1BVKB 4NJ9L 4WFHE 1Y18B 5D6CA 3NZHH 1OTSD 1D5MB 4Z7QE 4WVRA 3ETBF 4BQ6A 3WSQL 2Z35B 4XMLH 4FQ1L 4XP1L 3SDXE 3I85A 4G6JH 4I18B 2ATPB 4L9LC 2WSKA 3RGHA 1X5LA 1FIGH 1KJ2A 1KNOA 4KRMB 4PRNA 5TF0A 1A7QH 4KZEL 2BNRB 1YNLH 2GTZB 1YQVL 5TE7H 3QIUA 5EU4A 1OWWA 5D6CB 1CK0L 4ERSH 2VN7A 1OY3B 5D6DA 1F13A 1NBYA 5GS1A 1A22B 1QNZL 3B3IA 1KCSL 5DQDL 5FYKD 4APQB 3VD7A 1PG7X 1QR1A 1KNOB 1XGQA 5DFVC 4M6MH 3MCG1 3QIUB 2I07A 5EUOF 1SMAA 5ACZA 4C59B 1UXWA 1BGXL 3E6FA 1JPFA 4P59L 3ZTJH 1S7XA 2R2EA 5BO1H 1FFOA 1ZOXA 2CKBL 1F4WH 2NY0B 5DFVD 1MCJA 3RHWK 2DI8A 3O6FD 5JO5A 2JIXB 2E27H 3NFPB 1QR1B 1XGQB 5FF6A 4CMMA 5IBUB 1RUQH 5ACZB 5C09A 2Q3AA 3KJ6H 3DO7A 1UXWB 3E6FB 1JPFB 2H32H 5EBLB 1S7XB 2R2EB 3FQTB 3O2DA 1FFOB 2EDKA 4LIQE 5GRVK 4JRXA 3K3QA 2JLLA 1OP3H 4NQEB 1K8DB 5ICYA 2B4CC 4P57A 3Q5YA 1TJGH 3BKML 3R0NA 1VFAB 1X3DA 1UWGL 4K94L 4X6DA 5FF6B 5GGVL 4CMMB 3L7FA 1CXHA 5C09B 1VEOA 4KKBD 3ME0A 1QG3A 1NUDA 1QSEE 5F7EH 1XIWB 4JRXB 4WHTA 5I1HL 4J2XA 3SJVB 4RNRA 2Z92A 5ADPH 4KH2A 1AR2A 4FQ2H 4MX7A 4P57B 4GRWB 5EIQA 4ZXBB 4JVWA 4HK3J 3L7FB 2Q7YB 3CIQA 1NMCC 1U8QA 4MNHB 5H2BA 1F11A 2GK0B 5BMFL 1NGWA 5LGJA 4OCNC 3E3QE 4WHTB 1CTOA 5KVFH 1C8PA 1NBVH 2Z92B 4K7PH 1X4ZA 4MX7B 3MOBL 4TSAL 4LSUL 4ZPVA 4IRZH 1ZVSA 4N8CL 1K6QH 5C71A 1B4JH 1JVKA 1U8QB 4DK3A 1CR9H 5EA0H 3VG9C 1F11B 1A7OL 3OKMB 4OLUL 3U0PA 5LGJB 3GSVB 4TUJA 1T0MA 4AJ0A 3GIZH 4Z7QF 3F62A 2ZOKA 3ZL4H 5IF0A 3TCLA 4ZPVB 5CGMA 1KACB 3SDXF 4KVCH 4LCIL 4XP9L 1ZVSB 1U9KA 5E1HB 3KR3H 4D3CL 2J8UE 4OD3L 3WNOA 1VENA 3OXSA 5HPMA 5C2BH 3IXTA 3ZLQC 3W5NA 1T0MB 2DKSA 4K8RL 2DQFA 3X17A 2XZQH 4A6YL 4KTDH 3RFZC 1CFNB 3QISA 2ZOKB 1QLRA 2V2WA 4LCYB 4DKDC 1J0HA 2QR0A 3MV7A 4RISH 2A6KA 5FGCB 2XN9E 3TO4A 3CX5K 4UQ3A 3RVVC 1Y6KR 3CVHB 3IXTB 2FATH 2Z31B 2C7UA 1GZPA 4U33A 3BKYH 1GGYA 4N8PA 1RVFH 2OR7A 4Q9QH 3SDCB 1MHEA 5FUOH 4XBEH 1QLRB 4DJMA 3LKNA 2V2WB 4N0FB 4ZUSB 5IMMB 3MV7B 5T5FL 2A6KB 2VDMH 3D39B 3TO4B 1F00I 3IVKA 1WBYA 1Q9WA 1GZPB 2WIMA 3P0VL 3B9EA 3VWJD 1RUKL 2M2DA 4JKKA 1WAAE 2Q76A 4HX1B 2VE6A 1DE4A 3O45A 1S78C 3LKNB 5J9PB 4ODTH 3ARWA 4KTYA 3PHSA 1HKFA 2IFFL 2UY7A 4YXKH 5JTWA 4K8RD 2CXKA 1VKXA 5I19H 3ELAT 3QQ3A 3IVKB 1KEGH 1Q9WB 2QQQA 3GM8A 3LMJL 3QXAA 5JHDA 1SM3H 4MLIA 4K3JL 2AK1H 3OB0H 1LP9F 1YYLL 4HUKB 5GRUH 5B39G 5DFTA 4LSRH 2MOVA 2PYEE 1HI6A 3PWJB 1IMHC 3SDYH 2VE6B 1DE4B 3O45B 5F1OB 4I3SH 4NM4H 3K74B 1GC1C 1CGUA 2R2HA 5F7HA 1NBZA 3B9DA 1XAUA 15C8L 1MY5A 3W9DA 2NY2D 3QCTL 1ZLUH 4BQ9A 5D1XA 1PX3A 1BJMA 1X5KA 2YEZB 4WI3A 4Y5YA 2GHWB 3QI9C 2FO1A 2VXSL 1RUPL 2IG2L 3EYFA 1MQ8A 5EIVA 1NCCL 2CUIA 5JOPE 3MBXH 1FYHB 2R2HB 2HVKA 1NBZB 2VDNH 5C0CA 3TEUA 3JV4B 3QI9D 4X80H 5D1XB 5T3ZH 1JGVH 4LPVA 4Y5XA 3L5WA 2YHGA 2H8PA 1JE6A 1OAKL 3TN0A 4MAUH 3PQYB 4Y5YB 1EGJH 1CD9B 2F9BT 3RX5A 4W6XB 1KIPA 3IRZA 3WFCH 4H88H 4AY0A 4ACPA 3NH7L 1KCRH 2HVKB 1YJDL 1FE8L 3V8OA 5C0CB 4EXKA 1PGRB 3RAJL 3V4PL 4IS6B 3NPSB 2N1KA 4Y5XB 2H8PB 4KDWA 2YA0A 2J8UF 1NC2D 5HYIA 3MRQB 5C2UB 4DGIL 1U8PA 3VFWA 4NN6C 1KIPB 4LVHC 1FSKB 1P6FA 2KZ1B 3LOWA 4ZDHB 4QTHA 4UDUA 1KELL 3IU3A 1CL7H 4FFWD 4PJ5E 1LE5B 3NCYS 2E6JA 5KOVC 3BGAA 3SCMA 1E4XL 4L3CA 2GSGA 4PRIB 4WFHD 4EUPH 2BNQA 3K8KA 4PLOB 4M4PA 3BD5A 5LWYH 3BGFB 3OGCB 1UB6A 4DKAA 2FD6H 1QYGH 1G84A 4JGMA 3N85H 1IJ9A 2L7JA 2XI9A 1JWUA 2A83A 4M00A 4N1HB 5M95B 2GT9A 4X9GA 4L3CB 1MCFA 1PKQE 1RIUH 3CGTA 4HIXL 4U0RC 3WHXA 4AEIL 3NIGE 3FO1A 4M7JH 2YRZA 1S9KC 2O5YL 3HC0A 4YGVA 3LS4H 4P3CH 1DANU 4RDQG 1PFCA 5JW4M 2BJML 5I1GL 5K9OA 3MV9A 2KQNA 3IRPX 3VFUB 2HLFD 3FN0L 5J89A 2A83B 4NQSB 2GT9B 3GJFK 5FECA 5D7JC 3WHXB 3BDYL 1F8TH 2IGFL 1EVUA 5EWIL 5FYJE 5CD3B 1DQTA 3UZVB 3HC0B 1IKNC 1TXKA 3SE8L 2Z9TA 5EDXA 3JUYA 3P9WB 5SV4A 3FRUB 2SEBA 1JPTL 3OPZH 3AMLA 4WTZA 4H26A 3MV9B 5D7JD 1MCEA 5CEYA 3EJYC 1KN2L 4M1GH 4KJPD 3G6AA 2G60H 3QCUH 3ZT7A 2V9RA 4P46B 5C0AA 4LBEB 1VPOL 3HKFA 2VL4A 4UQ2A 5EO9A 5HJ3A 5AYUL 2ZCHH 1CICD 4EQ2A 2SEBB 4TVPL 3BX7C 4E41E 3VXOA 1YC8A 4H26B 4YFLF 4GS7C 1DQLH 1EBAA 5GGUA 5CEYB 1P4IH 3BIKA 2AJYL 3VGAB 3G6AB 5IB5B 3DV6A 3RU8L 4I5BA 1LE9A 4JLRA 4LPUA 1K2DA 4OM0L 5C0AB 1RZ7H 4RFOH 2CQVA 5IMLA 2RJMA 5EPMA 4FG6D 5LQBL 4QXWA 4UQ2B 2JJTC 3OR7B 1OAXL 1P5VA 4KHTH 1QSED 1UEYA 2BXZA 5EO9B 4Z0XA 5HHVH 1FGNH 3H9SB 2VC2L 3VXOB 1OGAB 2VDLL 4G43A 4IEFB 5DMYA 1S7QA 4QF1A 1FC1A 3EJZD 3QQ9C 3BIKB 3M8OH 3E3QC 4WJ5B 1N6QH 1TVBA 1C7TA 3DV6B 4I5BB 1LE9B 4POZC 4WO4D 3ULSA 1JHKL 2WBKA 2C3GA 4TOYL 1RZKC 5IVXB 5L6YL 5IMLB 1NCDL 3O9WB 3KYKL 2E7LC 4Z0XB 3OAUH 2BSRA 3GI9H 4G43B 4MNGB 5E7FA 2I5YH 4GG6E 4U3HA 3VH8G 1S7QB 5IHLB 3U7YH 4QF1B 1LVEA 4YHOH 4MAYC 4E5XA 1TVBB 2NXZB 1OSPL 2EIBA 3GBLA 3BWUC 5IFAL 4TVPD 4LPCA 1T2JA 4HIHA 2X05A 3JWDH 3RZWA 1QA9B 5AG9A 1JMZA 4PUBL 5A43C 2BSRB 4MAYD 4MMZC 1QSFD 5HDQH 2DL2A 3HNSH 3MV8A 1XEDA 4HUWA 4KJWD 3SE9H 3B9KA 2BRRL 4E5XB 3SGDI 4U1LA 2OCFD 3LQMA 3ESVF 4HIHB 1GOFA 3NA9L 4CDHA 4LSQL 1J9CT 3NZ8B 4LF3B 3TYGL 3BZDA 1JNNL 5J7CC 3F58L 4WU5A 4ZTOH 3UYOD 3KXFD 4JO4H 5CEXA 4KPHH 3R1GH 3IGAA 3B9KB 3S36H 2OTWB 4U1LB 3MOAL 3A0OA 4PJHE 3MLZL 1RIHH 3MBEA 3WS3A 2DM3A 4XC3H 1OAYL 4ZQKA 5ITBH 5ESVA 3BP6B 4DOHE 3VWKD 5IESL 4NJ9H 1U8MA 4WU5B 4PJBE 3C9NA 5D93B 2PO6A 5EO0B 3CDGA 5CEXB 2Z0BA 3GFUA 3IGAB 4P3WA 3KPQA 5E4EC 1IM3A 4FQXD 3WSQH 1JWSB 5HTSA 4FQ1H 4XP1H 3MBEB 3RX8A 3WS3B 5FHAL 3K4ZA 1DBKL 4ZQKB 5F96H 4L8DB 1KUMA 4MWFB 1OAZL 3MUY1 4KZEH 5ESVB 4L4TA 1JGEA 5CSGA 5DWUL 1YQVH 3C08L 1U8MB 3QHFL 1H8NA 3C9NB 1CK0H 4OLEA 5C0EA 1C5DB 4OQ1A 3GK8L 1V5JA 4TUOB 1IM3B 5DMJB 1QNZH 4XT1C 4R96A 2B8OT 1GOGA 1KCSH 3QFJE 1F3DJ 1MSPA 3OKEA 5I8EA 1S9XB 5DUML 2NMSA 2QBWA 4L4TB 2C3XA 3PHQA 4C54A 3K2MC 1BGXH 5C0EB 3FFCB 4H25A 5C6TH 1OD9A 3AM8C 3PDOA 2CKBH 1E28B 2ICWI 2LTQB 2A2QT 3ISWA 4WNQA 3CSGA 5GSVA 2UUDK 3OKEB 3ES6B 5I8EB 1LK2A 4X7FC 4JKPL 2EH8L 4ZOAA 1HQRA 5E6IC 3SKNB 4H25B 4RCAA 5KZCB 3PDOB 4Z7UB 1NGZB 4XNQA 4KK5C 1EEQA 2W9EL 5E2WL 3K0WA 4XPFL 4WNQB 5GSVB 35C8L 5D71L 3U4EA 3VA6A 5E08L 2ORBL 4K9EL 4KROC 1LK2B 3PP4L 4AMKH 5JORA 1UWGH 5GGVH 1HQRB 1U36A 4X0KB 2H26A 2N7BA 2IEPA 3I6GA 2GCYB 4R2GD 1E6JH 4YX2L 3FAWA 4OLZL 4S1DD 4U6VL 5M7QA 5I8KL 5I1HH 1AGEA 3QZWG 3U4EB 2P8MB 5JNYB 1ZGLM 2WP3T 1CXIA 1IAIH 5JORB 4FQQA 1B6UA 1YEHL 2H26B 4EUPA 2VB5A 4M43L 1V3KA 3I6GB 4G8IB 2VXVL 2IAMD 3CPLA 3Q0HA 3BN3B 5BMFH 3DRQA 2DJSA 2UWEB 2VZSA 5HD8C 1AGEB 1CBVL 4JHAL 1HIMH 1AFVH 1MREL 1XR8A 3RPKA 3MOBH 4LCCC 4LSDA 3RZCC 4FQQB 3P30L 4LKXA 3LPFA 4GRWE 2FZ3A 4EUPB 4M1DL 4OFKA 5HD8D 4X6DE 3INUL 2NZ9C 4LVNB 3IDGA 4XC1L 5EZLA 3BRDA 3CPLB 1A7OH 3IYLW 2MQCA 2A9ML 1I1FA 2H6PB 3DRQB 5HHOD 3RZCD 4GAYA 4PJBF 1UJTA 3QDGA 2HLAA 3FQUA 1NDGB 1U91B 4V1DB 5BVJA 5I1AA 4L4VA 4AK1A 2FZ3B 4LCIH 5EOTA 4JGJA 4XP9H 5IFHL 5D1QC 4D3CH 5IJKC 2IQAA 4OD3H 3IDGB 5EZLB 3BDXA 4QTIH 1YEKH 4ELKA 1I1FB 4GAYB 3BEVA 1MIMH 5CGYD 2HLAB 2L4OA 3FQUB 3TLRA 1NEUA 4GW5B 5BVJB 5I1AB 3V6FA 4YWGL 5TE6L 4JQVC 3MRKA 4KKCC 3STBA 4XI5D 3U4BL 4AT6B 2D0HA 3D0LA 2IQAB 4MS8C 4OIIH 1M05A 5TE4L 4ELKB 5IVZA 3BEVB 4Y5VA 4KKCD 1MCPH 2AQ1A 3FHQA 1L4IA 5JA9A 3DI2B 1T66C 4WW1A 3TH3T 2NR6C 4ZMAT 1WBZA 5E8DL 1MAML 1TPXC 1NCUA 3PWLB 2ZCKL 5MENB 3WFDH 3D0LB 5KJRH 4PD4K 5T5FH 4JG1L 3W0WD 3HZVA 3HN3A 5EB9A 2P4AB 3ILQD 5FGCE 5HI5D 5IVZB 5L0QB 4Y5VB 1R5VB 2WM0A 2Y36L 3O4OC 4XXCA 1WBZB 3BT2L 1ZA6A 4NP4H 4IRSD 2IFFH 3MFGB 3HZVB 2P5EA 3MV7E 5E7BA 4O58H 1J0IA 2MHAA 3RWIA 1KCVL 3OR6A 2OBGA 3UBXB 1A7PH 3W11C 4K3JH 1YYLH 2D9CA 5GSRA 3BIAX 1MLCA 2QSTA 4HUXA 1DSFL 5F21B 3QIWB 1MCHA 2W65B 2AEWA 1ZA6B 2DN7A 3UO1H 5B8CB 3CFIC 3W11D 4XH2B 15C8H 3RWIB 3B8YA 1H5BC 1BWWA 1F3DH 3BFOA 1HH6A 4KU1A 1FAIH 5GSRB 1JYVA 4HG4K 5L7XL 1MLCB 3V6ZB 5F6HI 4MZ3A 2IG2H 2AQ3A 5JXAL 1YDPA 5F1NA 1YEEL 3FZUC 1KN4L 2VXUH 2X5PA 4E0RA 1BOYA 3KPSD 4CL7A 3C6SB 4XPTH 3MXWL 3PV6A 4GRWF 4YFEA 1ZLVK 1HH6B 2BHUA 3DTXA 2EC9U 3ZHKA 4X6DF 5JHDE 2YD9A 1W8OA 4XPBH 5TH2A 2HJLA 4YK4B 3WFEL 1ZSDB 5FV1L 3ARFB 5CP3A 1YDPB 2R2BA 3NH7H 4P2QA 3V8CA 3BO8B 1HE7A 3DARA 4X9BA 4QRUA 3FT3B 2DQIL 3ULVL 4XVSH 2YWYA 1G7QA 1QOKA 3RAJH 3RWHA 1PZ5B 1BAFL 4JPWH 4U6HB 4Z18A 1FG2B 1ZHLA 1JYXA 5GGSY 4F7EA 4JFPB 5TH2B 2HJLB 4DGIH 3MJGX 1YPZA 2XY1A 3RVWD 4NQXA 5CWSA 1BEYL 1YNTA 5GZND 4QEGA 4P5TC 2RIKA 2R2BB 4HQQL 1FDLH 2WWKO 1KELH 3QAZC 5C6WH 4QRUB 1R3HA 3MLRL 1FNGB 2X1XR 1MUJA 1I9JH 5C0CE 1E4XH 3RWHB 1CTNA 2NW2A 4S1QH 5FGBA 3D25A 2LVEA 4FQLL 4IJ3B 5HPOA 4NQXB 3NFNA 5AD0A 5CWSB 1YNTB 2OS7A 5IB3A 4ORGA 4UT7L 5IR1A 2V5YA 2HN7A 5ITFB 2AEQH 3ARQA 5JR1L 3NIDE 1R3HB 1B3JA 1MUJB 3ZHDA 4U7KA 1DQML 3OKYA 4UUJA 2AKRA 2JKXA 5DVLA 2NW2B 4O2FA 1W72L 5L9DL 1TTFA 5A16A 2O5YH 3D25B 3MRCB 5BQ7A 5ESAA 5B38A 5DJCA 5AD0B 1MFEL 3U83A 4XX1E 1MY7A 5E00A 1QFHA 1MCRA 3CMOL 3QFJD 4I13B 2H2PC 4ORGB 5IB3B 3SBWA 2DQUL 4FMKA 5IR1B 1S9WA 2X4SA 2VLMD 3KHOA 3M07A 5GGRA 3RWEA 1XZ0B 4BQ8A 5JUEL 5IHZA 2XWJA 2AKRB 3BDYH 3LKRA 5HGBA 5EWIH 4O2FB 3OG6B 3AMKA 1IEAA 2BNQE 2H2PD 5E99L 5BQ7B 3SE8H 2FHBA 5B38B 3EDDA 3DYMA 5DJCB 3WUWG 2OL3L 2W0PA 5E00B 3O2WL 2A9NL 1ZLSH 3FHAA 1KN2H 4N5EC 2X4SB 4XHJC 3KG5A 3MOQA 5GGRB 1SY6L 4UILH 4G8FA 4YLQT 4GUPB 5D6DC 4NKOA 3RWEB 2MQ0A 4NQCD 4UTBL 5GS1C 2EDQA 3U36A 5IHZB 5KSAA 4U49A 4EOWL 1NCWL 1FAKT 2HTKC 4ZUVA 4E42A 3LKRB 5HGBB 3ARDA 4XP6L 4PJDA 1IEAB 2WLYA 1K4DA 3B5HA 4QOKA 1K9TA 1F6LL 4N5ED 5F7NC 2NY4B 4L3EA 2KBGA 4H0IA 5KAQF 1WZ1L 1Z0NA 2WBJB 4FNLL 1FJ1A 2MQ3A 2VLRA 3LKSA 5KANG 5LGHL 1IQWL 3PG2A 4XTRC 3WDHA 1KG0A 3MV9E 4NKOB 5KSAB 4O9HL 5KS9B 3X14A 5I1EL 4LQFL 4E42B 1ZT4A 3ARDB 5DJYB 1RV6X 4QOKB 5LQBH 4JFXB 1FNFA 3CZFB 3D0VA 4NO0D 3NCEB 4L3EB 4OM1L 4PJ9D 5SWZB 3SDDB 4POUB 3SGEH 4JN1L 1FJ1B 4PBXA 1KG0B 2FRGP 3VXSE 4S0SD 3CFKA 3LDBB 4MXQC 5A2FA 1JHKH 2F8VA 4TOYH 1MCOL 5E5UB 1MI5D 5L6YH 2WBWB 5C0AE 2VLKD 2DI9A 1BFVL 1XF4B 1RHHB 3KYKH 2VZUA 3MPCA 2AXJA 3L3DB 3LQAC 1RSFA 4I48B 5T1MB 2OMBA 2FHCA 5IB4B 5FKAB 3CFKB 1FZOA 1OSPH 2EH7L 3DMMD 2OR8A 3PL6C 3ARVA 3OKLA 5KVEL 3L7EA 1YYML 4PUBH 1DVFA 1CG9A 4HLZG 3E8UH 5E70A 4AH2A 5ANMA 4J3VA 3EYOA 1QEWA 4RFNC 4RAUB 4QXUH 5I71B 3GJEA 3PL6D 3E2HB 3H42L 1DQDL 4XBPB 1KB5H 4LPYA 1KCLA 1PVHA 4YHML 4GRMB 3NA9H 4NZUL 3OKLB 3L7EB 3NIDF 4C83A 4MA3B 4LSQH 4NRYB 4DFHA 3TYGH 4OZGE 1CG9B 1IBGL 4AH2B 4IRJB 5LG1A 2HKHL 3EYOB 1QEWB 4XGZB 3QUML 3PJSA 1ONQA 4YBLC 1D5BA 4PJGE 4OF5A 1INQA 4DVBA 3MOAH 3VE0A 3ZE0F 4MJIA 2ZJSH 3MLZH 4TQEL 3V7MA 2BHZA 2XPGA 3GDBA 1OAYH 2VNCA 3RTQB 1SEBA 1PW3A 3ZDXE 3JVGC 4Y4FD 1MEXL 4PRBA 4QHKJ 3WFBH 4G9FA 5IESH 1T1YA 3Q6GL 1T20B 4NDMA 3NTCL 1ONQB 3MV8E 1D5BB 4XZUA 2IC2A 2OM5A 1INQB 1R0AL 2P7TB 1CYGA 4JFFA 1WLHA 1WIOA 4IHOA 4MJIB 5FM8A 4EN3D 3BOVA 1G7HB 2HFFB 3KLHD 3U9UA 5FHAH 2XPGB 1QRNB 5GRVL 3UTTB 1MJJA 1OAZH 3PNWA 5JW5B 5ERWA 2DJ4A 4PRBB 4CU7A 5L2JA 4G9FB 2YPLA 3C08H 3WS6A 2VLLA 3QHFH 5C70A 4OCMC 5F72S 3R4DA 5CHNA 4AL8L 1NC4A 2ZSWA 1BQHG 3TO4C 3GK8H 1MAJA 5C07B 1ZLWH 5JW3L 3TNNA 1OLLA 5DJZA 3VXMA 4JFFB 4IHOB 3PP3H 2XNAA 4YNYA 4BA8A 3UX9B 1MJJB 5DUMH 2VH5H 3MRIA 3PNWB 5ERWB 4QGYA 2VLLB 1ORSB 4O2CB 3VD9A 3REVB 2ZSWB 4J3WA 2NY6D 4EXPX 5T1DL 3CDYA 3TNNB 5DJZB 5F7LB 3VXMB 1PLGH 2XNAB 5F7DA 4PP1C 1EEUA 3RY6A 2I60L 3VMNA 3MRIB 4K55A 1KGCE 4EDWL 4L4TE 2NTSP 3VRJA 3GKZA 3B4NA 2R69L 3UCRA 3FT2B 4ODWA 5I6XB 1T21A 5ID1A 1Q94B 2W9EH 4WFGD 2E7MA 2ZKHH 2B4CL 4JJ5A 35C8H 5D71H 1ZA3B 3MJ8B 5F7DB 5E08H 2ORBH 4X6CA 3P11L 3T1FB 1P5UA 2UV3A 2X09A 1EH9A 1CFSA 2EEDA 4Z9KB 3VRJB 1HYSC 2BOCA 3IT8D 1OTTC 5DMIL 5IVXF 4YX2H 4U6VH 3QWRD 5I8KH 4JJ5B 5D1XC 5CP7A 2ZPKL 2QKIA 3L3KA 1EUUA 5L8LB 4KWUA 4Y5YC 1KLFA 3QQ4A 1TQBB 1YEHH 1RU9H 2WUBL 5CINL 4AEFA 3MGOA 4MXVF 4BH8A 2BOCB 5ETUA 3CSYB 4J4PD 4N5UA 2Z8RA 3QP3A 2QQLL 4L3AA 5CP7B 1CBVH 2QKIB 4JHAH 3RP1A 1ZVHA 4Y5XC 5ESQA 1MREH 3TN0C 1J12A 1J5OL 1MFBL 2ZSVA 1W2KT 3QQ4B 4D0CB 3I75A 3NCBB 5I0DA 1F4AA 4KHXH 2WNGA 4M1DH 1AGFA 3CSPA 4HBCL 4KK6C 1NDMA 3DUSA 5ETUB 1L7IL 4XC1H 3C8HA 3TN0D 3LEVL 3ZDXF 4XBGA 3DETD 3NA4A 4ZUTA 4L8SB 2NLJA 2ZUYA 5F89A 2EXYC 4OGYL 4NFDA 5ESQB 3K1DA 5HBBA 3OG4B 2R8SH 3BXNB 3VXRA 2ZSVB 1DEEA 1AXSA 5CBEA 4B41A 1P84J 1JI1A 4PLJD 5IFHH 4OUOA 1AGFB 4NCC2 4R4FL 1D5IL 3DUSB 1UA6L 4PLNC 2BFVL 2RR3A 4ZUTB 3S5LA 2NLJB 2C4FU 3SCMC 5IVOA 5F89B 2V9QA 5IEKA 1T6VN 2Q1EA 1NCAL 4GRLA 2ICCA 3QULA 1Z5LB 3W81A 1AXSB 5KN5A 1GAFL 4YWGH 3M1BB 4LP4A 3AAZA 5CBEB 4I8DA 2D31A 4H20L 3SCMD 3U4BH 2V5SA 4JB9H 3T4AB 1BWMA 1I9IL 2XTJD 5TE4H 4OBSA 1FNAA 1O7VA 4OBRA 5IEKB 3WNPA 1DLHB 4JFZL 1I3GL 3QDGE 4NSKA 4XB8A 1MAMH 2YZ1A 2YUWA 2OSLA 3AAZB 1T2QL 3ARGD 4L4VE 2D31B 4S1RL 4G5ZL 4JVPA 4LRNH 2D7MA 4P23D 1VDGA 2R1YA 4PGEA 3CCHA 5DHXB 1X5JA 3BZFA 2Y07L 2AK4E 3MRFA 4NNXA 4YPGA 4HBQA 2X7LA 3BT2H 2OSLB 2EYTA 2GQHA 2OK0H 4LSVL 2HJKA 4H5SA 2R39A 3GMQA 2WW8A 3V9FA 5EU6D 1WBXA 3FRPG 3VXUA 4LQ1A 4XCYB 1EEZA 2F54A 2ATKA 4NNXB 1GC1L 3RPIB 3VXSD 4JAMA 4JRYA 2X7LB 5DJ0A 1R5WA 1A2YA 3SE4C 2OJZH 3EFDH 4FABL 3MV11 4MQTB 1G7MB 3U0WL 1N7ML 1IZKA 4NO5B 4LLQB 2HJKB 4H5SB 12E8H 2XA8L 4X7SH 3DHMA 5C6PB 1WBXB 4PJAA 4NWUH 1D6VH 5I1LB 4G3YL 1EEZB 1W0WA 2ATKB 2F54B 2NPLX 4M9OA 1GZQB 4ZAKA 2Y5TA 1UT9A 4JAMB 1KB5A 1R5WB 4M1CC 3ALXA 1H3XA 2Y06H 4X6FA 5JXAH 4U7MA 4WI8A 4LOUC 4HIEB 2XXMB 3C2AH 3MXWH 2P5EE 1WITA 3RVTC 3TVMD 5IM7A 3NIFE 1QBLL 1W0WB 4Y16D 1LO3L 3H7LA 3FQWA 4XRCB 3GZKA 3I2CH 3SDAA 2DYPD 1KB5B 3WFEH 4XHQA 1G9MC 2GITB 3IS1X 4TNVF 3U82B 4X7EC 1WF5A 3I3DA 4NC1E 2DQIH 3ULVH 4UIKL 3OKKB 3PUCA 4XVJL 2B2XH 2QADD 2MMXA 1R3KB 3TJEL 1CLZL 1ZWIA 3CH1B 3JWOL 1FZKA 3TBYA 3MCKA 1BEYH 4WDIA 1KENL 4NZJA 4HQQH 1BZQK 5I17B 4U1IA 3U6RB 5CCKL 4LHUD 2JF1A 2W9DL 2ZP0T 2YR3A 2EDJA 3QUYA 3VI3E 5DD0L 4FQLH 4XP4L 3TBYB 3MCKB 3ROOA 3GO1L 1VGKB 4TVSa 2EDTA 4PR5A 5CZVL 4P2QE 5JR1H 4HPOL 4DAGL 1W0VB 3DX8A 3TBTA 3MBEC 5EC1A 5H37G 2PXYA 1U8IA 3VXPA 3QUYB 4ISVA 3MZTA 4B5EA 1VFMA 3ROOB 5HYSA 5IOPB 3QDJA 2VITA 1YPZE 4JDTL 4OCLC 4CJ1A 4FOMA 2NX5A 2PO6C 2YC1A 2Q3ZA 3O6ML 4OZIA 4F15B 3DX8B 4GFTB 1XGYH 4U31A 1BFOB 4NUJA 5C0GA 5EC1B 2PXYB 3K46A 4QRPD 5IQ7L 1OARL 3HE7A 2PO6D 2D7PA 3MFFA 4ISVB 3R06A 2LAAA 3LKQA 3D87B 3JV5A 5CZXC 5IB1A 5HYSB 3BE1H 3QDJB 4M02A 2VITB 4PY8I 1HZHL 2A9NH 2NX5B 3UTPE 4OZIB 2YC1B 4KTEL 3FTGB 4QXGL 2Q6WA 1SY6H 2FB4L 5DZOA 1KGCD 4ODSL 1QPPA 4EOWH 1NCWH 4URTB 2ESVD 2F53A 2LE9A 5DDHB 4DGVL 5C0GB 4D9RE 1AQDB 2OZ4A 1R5IA 4H1LH 3HE7B 3QIBA 3HAEH 3R06B 2FEEI 3LKQB 4JM4L 2BSED 5D96C 4R4NC 1WZ1H 4G42A 4FNLH 1MCKA 2ZUWA 5E2UH 1LEGA 4O9HH 5DJAB 2F53B 4LQFH 2CGRL 3CX5J 3QEQB 4KZDL 5TQ0L 3AVEA 3QIBB 8FABA 1K85A 1KTLA 1WIPA 2NYYC 4OM1H 1T4KA 2WV3A 4HULB 1FCCA 3NIFF 5MHSD 3IKKA 4G42B 4MB4A 4ESKA 1I7ZB 4HUVB 4LSTL 5IK3A 4HF5H 1PY9A 3TA3A 3AC0A 3GMPA 4I0KA 3SHSA 4OZFH 5F7MC 4LAQL 1MCOH 8FABB 3O3BA 5J56B 4IOFC 4M62L 3DSFL 4PJDE 1KTLB 4QOKE 4WFFE 2W59A 2VERN 1RUML 5CKAA 3PWPA 5C0DB 1FN4A 2JCCB 5IK3B 4LEOB 3GRWA 4POYA 2VLRE 2J88L 3GMPB 1ZLUK 4IOFD 1LMKA 3CVIH 4CU6A 1AGDB 3O3BB 1YYMH 3WDJA 3QNYA 3WKML 1N5YH 4Q97A 5E03A 5BOZG 4RGMC 1FN4B 4P2RE 1QQDA 4IIQA 3VI3F 3H42H 4HWBH 1AY1L 4HLZH 3KPPB 2X2YA 3CLFL 5F9JA 2BVPA 3L6FA 2LAGB 2LQRA 2PR4L 5E0QA 3P73B 4MLSA 1OSZB 5JW4N 4YHMH 5L2KB 5CAYB 5FO8A 4C56A 4NZUH 3KPLB 5C0BA 3QNYB 4PV9A 1UWEL 3X3FL 1XR9B 2GYSA 1KCUL 4YO0A 1EZVY 1E4JA 1QQDB 4IIQB 5GS0L 4RWYL 5HXMA 5D9SA 5F9JB 1AD0A 3SQOH 2BVPB 3L6FB 5D2NA 1Q1JL 1YPZF 1J8HA 3C60B 4PJEA 5ISZA 5CD5C 1EXUB 4G6MH 3CXHK 1OW0A 4BFGA 2Q86A 1L9MA 3P0GB 2JK5A 2ERJC 4PV9B 4HIJA 4TNVK 3Q6GH 1GH7A 3MJ9L 5E5MA 4YO0B 5JHLH 3QDGD 5ANME 4DQOL 4ZFOA 1UYWL 5D9SB 1AD0B 1IC7L 4YDKH 4HKJA 5KVGH 1J8HB 1CGXA 1DZBA 5I73B 2Q86B 4ZFZA 1KIUA 4HIJB 3VXNA 5J13B 5E5MB 3WJLA 4HWUA 5LXGL 2VMFA 2AK4D 3HRZA 3T08A 4ZFOB 5DD6B 1SYSA 7FABL 5JW3H 5FO9A 4HKJB 5L0QC 4Y5VC 4DW2L 1N8ZA 3MRGA 4MJIE 3WO4B 3HUJE 3O4LD 3QXUA 2GJ6A 2HH0H 4YFDB 4YFLI 5ILTL 3MLUH 4ZFZB 1UC6A 5EBGA 1MFAL 3VXNB 3TM6A 4G9FE 5B21A 2FX8L 3C8KA 1JRHI 1SYSB 5KVMC 4K7PY 5JZ7C 4YBHA 3FO0H 5FO9B 2BSSA 4F7PA 2XIDA 4WWKA 1N8ZB 4JFFE 3MRLA 2I60H 1A3RL 3O0RL 4XXCC 5A2IH 1FFQA 1T1XB 3JWNC 4U1MA 4EDWH 1D7FA 5JZ7D 4X4ME 2NNAA 2YPLE 3C8KB 1KT2A 1N4XL 2ZG2A 3V0WL 3BP7A 4D0BA 5D1ZB 2B4CH 4F7PB 3HG1D 3MO1A 4YXLL 1HOCB 4WWKB 1YNKL 3VXME 3MRLB 5JDSB 4DN3L 3IJHB 2AJ3B 1OTUC 1BD2A 2C26A 5DRNA 2P5ED 2DI7A 4U1MB 3SQBA 3OJMB 4NC1C 1UCBL 4XNUH 3F8UB 4LDEB 4L4JA 1DQQA 1I85A 1WWAX 1PAMA 1CZ8L 2XA3A 4P5MA 1G9NC 2ZPKH 3SO3B 1IEHA 1XF5A 4MCZA 4CAGA 1SJHB 4HS8L 3MLXH 5DRNB 1BD2B 4N90D 2LU4A 2WUBH 4XNMB 3NN8B 2F15A 4WW2B 2YMXL 4UB0L 4JQIH 3S37L 9CGTA 1DQQB 4QO1A 1M71B 2VYRE 1MVUA 1CS6A 1QBMH 1REIA 3EYSL 2X4QB 3ALWA 1ZT7A 1URLA 2LVCA 3MNZA 4YHYC 1XF5B 4MCZB 3QDMA 1JZ4A 1U58B 4EIGB 4ELMB 1TTUA 1J5OH 2R0KL 4NN7B 4X6CE 2QSQA 2WWMC 3TO2A 3BWAA 2YUXA 3L3HA 4HC1L 4HW6A 1MVUB 4PFEA 2EE9A 4QRTA 3VRIA 2WWMD 3MNZB 3HMWL 3QRFM 4M8VA 3QDMB 3RIFF 1C1EL 2FHFA 1C12B 1P4LA 4G8GD 3K8MA 3FCTB 2WK2A 1KULA 4R4FH 1OP5K 3ZKMC 5FYJL 4LRIC 4OLVL 2BFVH 2O93L 2RGSA 3HNTL 1OB1B 1S7SB 4GSDL 4QRTB 4ETQA 4JR9L 4QY8B 2G9HB 2WWKT 4G7YH 3S8WA 2VAAA 3VD3A 1NCAH 4OSUL 5FGBC 3RNQA 3DV4A 2EYRA 5DHYA 3ZKMD 1P4LB 4KJYA 3T3ME 1GAFH 1U3YA 4JN2B 2J2ZA 4OLYL 5H8DA 4H20H 1IGML 5FM4A 4NRXB 1I9IH 2C1PA 2VN4A 1NGXA 3BQUB 2VWEE 4Y2DD 4ETQB 3UTPD 1PY4A 2VAAB 1EJOL 4M3KB 3MREB 4KV5E 4ZPTA 3RNQB 2EYRB 5DHYB 3G6JB 3WUWB 1I3VA 3VXRE 1T2QH 2FECI 4S1RH 3SKJL 3SBWC 1AHWA 2BMKA 3KPMA 4H1LB 4RAHA 2F19H 4RX4D 3T2NL 4OTXL 2C1PB 3HAEB 3C6LB 3CFJA 3GKWH 2Y07H 4LU5L 4ZPTB 3S96A 3SKOA 2NY4C 4LCWB 2BY0A 2ZOLA 1LO4H 1MPAL 3KPMB 5GISL 2P46B 4HCRL 4KDTA 3CFJB 5KSAC 3IETA 2ED8A 3UC0H 1XCTB 2D4DA 1V3JA 3ARDC 1OAUH 3QG6A 1GC1H 1HWHB 2RFXA 3FB5A 1X9QA 3S96B 1L6XA 1TIUA 4U3XA 4OGAC 1LGVA 4MQ7B 5CBAA 4FABH 4OZFB 3TT3H 1N7MH 3IFPA 4LGSB 1MJ8L 1VESA 1IGTA 4W4NA 4UT6L 3GSQA 3MNWA 1HHHA 2MKLC 2XA8H 5SWSD 3IETB 3LDBC 2Y7QB 2FX9L 3LVEA 3AS0A 3DXAE 3V52H 3NFSH 5FYLL 3K2UL 3UTQB 5E6YA 4JKLA 5BW7C 3QG6B 4HWBA 2VLRD 3MNVA 3SY0A 5CBAB 3RNKA 4AIXA 1PD6A 4D9LL 3IFPB 1A47A 4PJXA 1IGTB 1RZIB 3MNWB 4MNQB 4X6CF 1HHHB 4K2UL 2OMNA 1CLYL 4P2RD 1LO3H 3T0EE 3VXUE 1PYWA 2H45A 2AI0H 2F54E 1WFUA 3BD4A 3MNVB 2YK1H 3ILPA 3QHTC 3EOAA 1XF2A 4JRYE 3RNKB 1BPVA 4GXVL 4PG2C 4PJXB 5E94B 3OAZK 1LK3L 4UIKH 3MX0A 3DUUA 4P2OB 4XVJH 3D3VD 3LKPA 1MJ7L 1C16B 1RULH 2K7PA 3GJFH 3IDNB 3TJEH 1PYWB 4OF7A 4PJAE 3IDMA 1A6UH 2YKLL 1DVFC 4KRPD 2DMKA 3RVXD 4XMKH 3L3GA 3QG7L 1IT9L 1KENH 2ENSA 3MLYL 3MSPA 5TDOA 1KJ3L 5LJYH 4ZOEA 3MROB 3TBVA 5D7IA 5CCKH 5FYLD 1BZ7B 4BFEA 5EZOL 3T3MF 2A6DA 4NFBA 1DVFD 2NY3D 5EOQL 1H3UA 2VDPH 2PTTA 2CMRL 1N64L 3BRGC 3IDMB 5DD0H 4HUMB 3GO1H 4JQXC 1UM4L 1GPOL 2WUCH 5CMAA 4KK8C 3G5XB 5JW4R 5TDOB 2HYMA 5CZVH 4KV5F 3O6FA 4J1UA 3TBVB 5HY9B 4DAGH 2X9XA 5I74B 4P9MH 1F4XL 4PY7A 4ENED 3G08A 1KFAL 3H0TA 3LKOA 1VADA 2PTTB 1TJIH 2AV1B 3EGSA 4CNIB 3UP1A 4QWWD 3HCVA 5H37H 5CMAB 2HG5A 4UNVA 4JDTH 4K23L 3KHQA 1PJ9A 1YN6B 3O6FB 2HWZL 1DANT 2W9LA 3MRDB 2OYPA 3VU2A 3RIFK 2ED7A 4OCRL 1FG9C 4K3HA 4C55A 4P2CG 1J1PL 4PY7B 3G08B 5IQ7H 3H0TB 3LKOB 4QRSA 4JO3H 5HHMD 3EGSB 3MRMA 4LIQH 3HCVB 3WS6C 3DVGA 4KTEH 4OJFL 4F58L 5F7UA 5IBUG 2AERT 5GRYA 4P3DA 5AAMA 2YPLD 4XAKE 4F33A 4EDXA 1NC4D 2AEIT 2IBBA 3JV6A 4UINL 5CJBA 5F3BB 5D7LB 1Q0YL 4TSBH 1UH2A 4HFUL 3QDJE 1JPSL 4KQ3H 3LN9A 2NX5E 4OZIE 1DTUA 2VQUA 2OI9B 2VDKH 5I6XC 4MDJA 1IAOA 3V4VH 1DLFH 2V5RA 1FORL 3MLVH 5HDBE 2CGRH 4XAWH 4KZDH 3RY6C 5TQ0H 3U1SL 4LVOC 4F33B 3P77A 5FO7A 3RDTD 3RY5A 2YXMA 4D0DB 1NGPL 3VGHA 4Y19A 4APQD 2MFNA 5IT2L 4LSTH 5L88L 3O41A 1NMCB 1RZJC 1RZKH 3LB6C 1FCGA 4PD4J 1JYWA 4PJCA 4LAQH 2F53E 1AD9A 3L3OA 2DRUA 1I7TA 2NY0D 4M62H 3DSFH 1FYTD 3LQAL 3P77B 1TQBC 3O11A 4JFDE 3VDCA 1ADQA 1N2RB 5HVHB 2H41A 3QDHA 4UDTA 1T22B 4YHZL 3GSUA 4PJAF 1CGWA 3S88L 3O41B 4QHLA 1FH5L 2J88H 1HXMA 3WIFB 5K9KA 1IGFL 5EO1A 4W6WB 5HGDB 4XCEA 3DYPA 4PTUB 4KXZH 3GMMB 2IPKB 3WKMH 4NQED 4G6AC 3P0YL 1ZANL 4UDTB 4JZOA 3RUGB 4NRZB 2CUHA 3DBXB 1YMMD 4FQJH 4FTVE 4QHLB 3QUXD 1HXMB 3MRNA 1JNJA 1EDQA 4XCEB 4MD0A 1OM3L 1I8MA 3LRSA 1XIWD 4JPIA 1UWEH 2IPTL 5CEZL 3X3FH 1KCUH 4XNYL 3SJVD 1RK1A 4HG4J 1BOGB 4JZOB 2VOTA 4ZXBD 2D7QA 3EIFA 3C5ZA 1CLOL 1E27B 3PWPE 5JOFA 2VWEC 2JJSA 4RWYH 3B8SA 3VWJA 2CIIA 2AJXL 3MJ7A 3MRNB 5AZ2L 1Q1JH 3EO9L 3UAJD 2X4PA 1I8MB 1YY9D 3LRSB 4N9GB 1GYAA 3T0AA 2UUDH 5TF1H 1RK1B 1R3JA 1VACA 2DQCL 4YUEL 1U8NA 1OQXA 3CVHL 4DQOH 1BMGA 2MJWA 4PJ8A 2CIIB 3MJ7B 1IC7H 3VXRD 1EEYA 4I4WA 4OF6A 1BLNA 3C5SB 4QYOB 5GGVY 4KI5E 2N56A 4NPYB 4XNZC 3G5VA 4GRLC 25C8H 4F7MB 4C56E 3E1F1 5EC2B 2H3NA 5C0BE 3KPNB 3CFBB 1IL1A 1R3JB 1VACB 4X7TA 1U8NB 4LP5A 5LXGH 4FA8A 4NT6A 7FABH 1DBML 2VDRH 3AS3A 2WMPA 4I4WB 3LQZB 1S5IL 1WV7T 4YHPA 5D2NE 1J8HE 3QPQD 4PJEE 3UTZA 5KAQG 5ISZE 4OZIF 5TPWL 4GQPH 1SBSL 3MR9A 4QCIB 3MQIA 2H3NB 2NY2B 4M7ZB 2E7CA 3TPKA 5HDBF 1MFAH 1I1CA 1Z9SA 2FX8H 3N1FC 1T7ZA 5GRXG 2Z8WC 4NT6B 3AXLA 4BH7B 4ODXA 4M3JA 3VI4E 4YHPB 3VFRB 3BGMA 1GVIA 3UTZB 3Q5OA 3WCYA 4GMTL 2Z31D 5JDJA 4JANB 4WI2A 3QI9B 5L8JB 3DXAD 2MPAH 3DROA 5DD1H 3SDCD 5C9KA 4WEBL 4X83A 1NC2A 3DOSA 1N4XH 3N1PC 1YEGL 3KS0H 2XRAL 4MJ6A 2IH1B 4ODXB 3LAFA 1WTLA 4OKVA 3T0EC 5AUMA 4F7TA 5F7KC 2FX7H 1YNKH 3D39D 2J4WL 4DN3H 2E3VA 2GJ6E 5CZKA 4XCFH 1ZV5A 4OUUA 3T0ED 3DROB 3VXUD 1NC2B 3W39A 4F8TA 5KG9A 1CZ8H 4XXDA 3EOBA 4MJ6B 4F7TB 4JG0L 3QSKB 4GKZB 2EDBA 3ZKSD 4HS8H 4ZAKC 4LLDB 4F57L 3H9HB 4LLUB 4UB0H 4DUVA 4Z7WA 4WFED 4OUUB 4LVHB 3MA9H 1IKFL 1AR1D 3W39B 3EYSH 4XXDB 3WIHH 2CRZA 3EOBB 3GB7A 3SDXB 1EVTC 4U6XB 1EIBA 5FHBH 4MXWL 1NMBL 2HT3D 2R0KH 4QRQA 2YN5A 3SDAC 5DYOA 2A0LD 4AG4H 4BFIA 1A9EB 3KAAA 3CK0L 2CLZB 3U9PL 3GSNH 2XXCB 1A6VH 1MELA 1KTKE 3HMWH 4MB3A 4XMLL 1B0GB 2DBJA 5T3XE 5D7JA 2JE8A 4W81A 4U0RB 1BF2A 3GMOA 4QRQB 2WQ8A 3MRHB 2ITCB 4G7VH 4B0MM 2V7HB 3PQYD 1A7QL 4KI5F 2IAND 1TMCB 2IPUK 5FYJH 5TE7L 3MUHL 3O3UN 1FO0H 4OLVH 3HNTH 4GSDH 3SEPA 1CICA 5I16B 4N68A 5ICZB 2D2OA 2K3TA 3EHBC 4MQXC 4D8PB 1U95A 3AY4A 5D7JB 3IF1A 4GQ9H 4OLYH 5DHVA 3NCJL 1BF8A 4I0PD 2E6QA 1IGMH 5KTEH 1WVZA 4M6ML 3HC4L 5EIIA 3OTTA 4KY1L 1JPGB 5BO1L 1CICB 1RFDL 2PXYC 1V7NL 4JKMA 3B83A 1EJOH 3AUVA 3IXAA 2HRLA 2BY3A 4PRID 1EO8L 3IF1B 4U1JB 3CFDB 1CF8L 5DHVB 2E27L 3VI4F 4WO4A 1OF2A 3T2NH 1NGQH 4OTXH 1WTGT 3KJ6L 4WTZG 4B50A 1QSEB 1CFVL 3L3JA 1CD8A 4LU5H 2XG5A 3HE7C 4DGYL 1YY8A 1ZLVH 4ZUWA 2FJHA 3TGXA 4PBWD 5TGBA 1OF2B 2ZUXA 2Q7NA 1MPAH 4J6RL 5GISH 3BZEA 1HSBA 4HCRH 3BI9X 1C08A 3VFVA 3PP3K 1BZ9A 5IROA 1QSFA 3L3JB 3KYNA 4NNYA 3MLPA 3QIBC 4PG9A 1ZEAL 2FJHB 5ADPL 3TYFA 2VZTA 4C58B 1VCAA 5C0RL 1U93A 1LO2L 1HSBB 4RMRA 5JW4Q 4UT6H 5GS2H 1FQ9C 4JFDD 3VFVB 4FFZH 3WXVH 3LZFL 4MAYB 4JDVA 1QSFB 2FX9H 5C1MB 3KYNB 4NNYB 1IGCL 2VXTL 3SKUD 3KXFA 1EZVX 5HHQB 3RA7L 4G6FD 5IUSA 1QO3A 4P46D 4K7PL 1Q72L 3TYFB 4FN0A 1Q9KA 3WEXB 4HHAB 2GUOB 4LARL 1U93B 3Q3GA 4U1HA 1RJLA 4IRZL 2J8UB 4F37F 3TA3C 1B4JL 1FNEB 1MCLA 5MEPB 1UB5A 1CLYH 4JDVB 3VWKA 4CN1A 4NNPH 4FTVD 2QHRH 1UXSA 2YN3A 5F9WC 2EZ0D 4FQXA 3EO0A 4X6BB 2AEPH 4ZO8A 4PLKD 4GXVH 1OHQA 4U1HB 2WZPD 3Q3GB 1G7LB 1HKLL 5C0FA 3H9SD 3KR3L 2YSSA 4ELMF 1OGAD 4JFED 1UB5B 3V6BR 3H6JA 5C2BL 3FN9A 4GAFB 3PWPD 1A3LL 2IQ9L 4LVEA 1RMFH 1IEBA 4PP2A 4GLRH 1ZHKB 2XZQL 3N0PB 4FQXB 3QG7H 4NZRL 4YR6A 1IT9H 3MLYH 1Q9OB 1KJ3H 3FQRA 5EULV 4IIQC 3QUKA 4D94A 2YSSB 5E4IA 4OAWB 1E4WL 5EZOH 4PJXE 4KI5C 5EOQH 3VXTA 4LDLB 3DSNA 3FQNA 4J8RB 5DUBA 2FATL 1BBJB 2DMBA 4HGWA 5FA4A 4UTAL 1BBDH 4PP2B 1T04A 2NXZD 5I8CA 1U6AH 1FC2D 4K7PX 4OCYH 1GPOH 4YR6B 4Q9QL 3JXAA 5FUOL 2WAHA 1DN0B 3FQRB 3QUKB 3G9AB 4C56D 2ARWA 4ZODA 3P4MA 5FIEA 5D2NC 3FQNB 1MHHA 5FA4B 1OW0C 5I73C 5C0IA 2PYEB 2P1YA 1T04B 5I8CB 4I1NB 1BJ1H 1MFNA 4ODUB 3RBSA 1WFOA 3EDFA 4K23H 2VTFA 4HLJA 2X4NB 3KPRA 1IAIM 1NGYB 4W6YB 3V4UL 3IFNL 4O5LH 4ODTL 5DT1H 3H3KA 4OFPA 5FYKE 2NY7L 4Q7DA 5D7IE 3P4MB 1YEJH 3G6JF 3MGAA 1KJ2H 5I19L 1K4CB 4CW1A 1KEGL 1MHHB 3WO4C 3GSOA 4EI6A 2C1OA 3V79C 1SM3L 4IMKA 1MF2L 4LSRL 4Z0BH 2HFGH 1WWWX 3SDYL 3WJLC 3ULUE 4I3SL 1AP2A 1P69B 4NM4L 4XNXH 1P53A 1IFHH 4BSJA 3PWUB 4CW1B 3G04A 4EI6B 3F12B 3QNZA 2C1OB 2R4RL 1U8OA 2IAMA 4UINH 4KROB 1JZ8A 5I18H 4HFUH 1P7QD 3HB3C 5I66A 2ICWA 1KBGL 1LILA 1AP2B 2I9TA 1MRFL 3MBXL 3S9DB 2FEDC 4BK5A 4WWKC 3V5HB 3K7UA 3QNZB 3HB3D 3U1SH 4DZ8B 4MAUL 4KJQD 3O2DH 4B7LA 3FOMA 3UJJL 2YD5A 4R8WL 1OVZA 5HHOA 3WNLA 3RZCA 1OPGL 4CVXA 2XACC 1JN6A 4U1GC 5I66B 4NBYB 4H88L 5IT2H 2F5BL 5HYQA 5L88H 2WINA 3FO2B 3CFEA 43C9B 3FFDB 3F7YB 4WIQA 1XGUB 3MUJA 4GRWH 1CE1L 5J6GA 2DICA 3LQAH 5I2IA 3LPWA 1CL7I 3FOMB 3PXHA 3RZCB 3ZO0A 4HFWA 4CVXB 1JN6B 4YHZH 5HYQB 3S88H 2A6IA 2WINB 1I85C 3IDJA 1FH5H 2X1WL 3CFEB 1Q9LA 3VXQB 4EUPG 1IGFH 3BPLB 1CL7L 3IFLL 4JFHD 3SO5A 1PKQB 2XZCH 4GBXC 5KZCD 5SV3A 4CGTA 3OKOA 4NN7C 2PN5A 2AJSL 3GSNB 4PJXF 5LWYL 1X5HA 3BJ91 3PF2A 2MKWA 3P0YH 1QYGL 1ZANH 4FXGA 2HMIC 3SOBH 2C3HA 3IB4A 4GBXD 4JQVA 4Y19E 4L8BA 1TJHH 4UOJA 3IDJB 1HCFX 5D1QB 5T3ZD 2R1WB 1CT8B 3EOTH 3OL2A 3RWGB 4W68A 3ZTNL 1OM3H 4OQTA 4PJCE 3OKOB 1FO0B 2HP4A 3IS0X 3W0WA 4G9DA 3LS4L 4P3CL 4F37K 5ACLA 2BCKA 5TDNB 4WENB 2O61A 4L8BB 3A67L 1ETZA 5GJSH 1DEDA 1CIDA 2DS4A 4JM2C 4J3SA 2CDGA 2YRLA 5DRWA 5AZ2H 1WIUA 2YD1A 1QRKA 4IRSA 5GZOD 3H3PH 3W0WB 3ZKNC 1ZHNA 5D7IF 1P7KA 2ZZUT 2E9BA 2XQBH 1AGBA 2DQCH 4JM2D 4E41B 3MMEA 1TPXB 2O61B 3OPZL 1ETZB 1B4RA 3P40A 5C9JA 5F7FA 1G7JA 4JCMA 1LWRA 2APVA 4X98A 2CDGB 5DRWB 1B2WH 3FOLA 4NQTA 3OB8A 2BC4A 3O4OB 4DN4L 1AGBB 4V1DD 3MMEB 1MQKH 4CRPA 4HEME 2CIKA 4JFOB 5C9JB 3QO0A 3O3EA 4TRPL 1DBMH 1DQLL 3HI1A 1VFBA 3MUGA 1H5BA 1UQSA 3UBXI 4RFOL 3KPSA 2BC4B 2DQEL 2M1KA 3HRPA 3O3AA 1F3JA 2BVYA 5CUSL 1DP0A 4XCNA 2QSVA 3WJJA 4XPGL 1AHWC 1D6EA 4GG6B 3BYTA 2CIKB 4GG8B 1UVQA 4OKDA 3M8OL 4LLVA 3HI1B 1VFBB 5ADOH 1N6QL 3BPCA 1H5BB 4WTWA 4X9FA 2D4FA 3NVQA 1M6OA 2EIZA 4GMTH 5H35A 1TVHB 2BK8A 3STLA 3HS0B 3KPSB 1P84K 4PJFA 4QNPE 4HIIB 3O3AB 1F3JB 3N9GH 3TNMB 4XCCH 2BDNH 1A7NL 3GI9L 4WEBH 3JBG7 1I3RB 2I5YL 3QDAA 3RKDC 1YEGH 4KDTC 3U7YL 1UVQB 2BP3A 4M03A 2XRAH 3BP5A 32C2A 4LLVB 4PJHA 4OV5A 3OKNB 1WZMA 3IFOA 3BPCB 2J4WH 1M6OB 2EDLA 4KKLD 1S7UA 1UJ3A 1BM3L 5H35B 1A1NB 1NAKL 1BX2A 2AP2A 1IGJB 3RKDD 2W60B 5EH1A 4PGCA 2AXGA 2E8ZA 4BQBA 2FWOB 5DURD 1G9NL 4OGZA 4F3FA 3HNSL 2YD3A 5C3TA 5DA4A 4PTTB 1T89C 4R4BA 1NEZA 3BP5B 3QUZA 3SE9L 32C2B 4PJHB 4GAGL 5HI3D 5CSZB 5GXBB 3TFKC 4F57H 1N3NA 1T7XA 1BX2B 3AB0B 4DOHB 1VFUA 4PGCB 2A73A 4M4RA 3QIWD 1KIRA 4F9PA 4F3FB 1MH5A 3QAZB 2XT1B 1RK0A 4R4BB 1N5AA 2CKNA 3TFKD 2IH3A 43CAA 1MCDA 3QFJA 4MXWH 4NQUA 1RIHL 3GBMH 1NMBH 1BJ8A 3L5IA 1OTSC 2VR4A 4PRPD 4OIBA 5ITBL 2A73B 1MNUL 1AH1A 4TN9A 3CK0H 4HGMA 1Z2KA 3U9PH 1A1MB 1MH5B 2EXWD 2CLVA 1RK0B 1N5AB 2HT4D 5C86A 1RHFA 43CAB 3QFJB 4NC2B 1X6NA 1S9YA 4MDIA 5IQ9A 4HXAL 5ICXA 5F96L 4NQCA 5DJXA 4JFYA 3VA2C 1BECA 1TZGL 3LV3A 4IDJL 2DD8L 4Z7WE 3DVNA 4LCUA 3ARFD 3O2VL 3EBAA 2CLVB 5I74C 1CN4A 5CFHA 1KEMH 1R3IH 3BKCL 4MDIB 1I7RA 2F58H 5E24E 2C4FT 5ICXB 1G0XA 3BPNB 3CUPA 3NCJH 4NQCB 4MZ2A 1KJ2B 4WV1C 5DJXB 4PRNB 5J06A 3U79A 4JFYB 2KQMA 5B38G 3HC4H 3LV3B 3O6FC 3RY4A 3DVNB 4LCUB 5EU4B 4U6TA 4OLXL 1PSKL 4KY1H 3IJSA 1NLDL 5C6TL 4NM8H 4NO0A 3I3EA 1RFDH 1H3GA 1M7DA 5K93A 1NBYB 4Q2ZA 3S36X 5GS1B 3ULUD 1V7NH 4PJ9A 4CN4A 3QB7C 3B3IB 4NKIL 4O02L 1I7RB 1EO8H 5F93C 3BN9D 1CF8H 1JUFA 4BELD 4UV4H 3RGVA 2Q8AL 2OL3A 1R3LA 3GBNL 3UZEA 2I07B 1MI5A 2NZIA 4MHHG 2VLKA 5D2LA 3RWFA 3IJSB 5C08E 3UJIH 4QNPF 3Q1SH 4NO0B 1CQYA 1CE6A 2XFXA 1M7DB 1CFVH 4Q2ZB 1T03L 4KKBC 4DGYH 1EX0A 5JO5B 2CDFA 4AMKL 3CXHJ 4ZFFA 5IGXH 2DKUA 3DMMA 4J6RH 1R3LB 3UXFA 5GQBA 2OI9C 3DO7B 1FPTH 1CE6B 2XFXB 1IAII 1E6JL 4PRHE 3W9EA 2EKSA 2EEAA 3M17A 1KB9J 3DGCR 3PL6A 5DVMA 1ZEAH 5ICYB 4UMGA 1MVFA 2CDFB 1IAIL 4RMVA 3DMMB 4X6DB 5C0RH 1LO2H 3O81A 2XZAL 3LZFH 1IGCH 3G6DL 2VXTH 3K4AA 4U0QB 5KSBA 1EJ6A 1U8KA 2BRQA 3WXWL 3PL6B 3RA7H 1HIML 5J6HA 1AFVL 5T1KA 4RNRB 1Q72H 5HVHC 4P99A 4LARH 4K94C 4Q9RL 2AABH 1G6VK 4RFNB 3T3PF 4TVPE 4Y4FA 1MIEL 2WBJD 5H2BB 1NGWB 5DGQA 4Y19D 3K4DA 1G9MH 1QSFE 2HAZA 1U8KB 5J6HB 5F7WC 2W0LA 4JDZA 4RAVA 3X11A 3JVGA 4EN3A 5DEFA 3I3BA 3EUUA 5JMRA 1HKLH 4JY5L 1ZHBA 3GMRA 2AJUL 1A6ZA 5SWZD 4Y4FB 3SDDD 1DR9A 4YBLB 4OGXH 4QTIL 4WUUA 1XGRA 1YEKL 3U0PB 3GHEL 4TUJB 1A3LH 4KUZL 2IQ9H 1MIML 2CO6B 3BHBA 3UPAA 1XF3A 3KXFE 4JDZB 4RAVB 4NZRH 4P9HC 2L7UA 4JVUA 5IF0B 2NXYD 3PGDA 5DEFB 3TCLB 4KUCD 4IOIA 5F9OL 2MWCA 1E4WH 3GMRB 1A6ZB 3QUMA 4CU8A 4DUXA 4FFVC 3OXSB 3LD8C 4OIIL 5HPMB 2VJXA 1HQ4A 4UTAH 1ZS8A 2DQFB 1MCPL 4PRAA 1NQBA 2WLZA 4NQVA 5E8NA 4FFVD 4C57C 3RWDA 1EHLH 3C5ZC 1HINL 3LSOA 2JJSC 3VFPA 2QR0B 3WFDL 3VWJC 5KJRL 1WT5A 4UQ3B 1GGTA 4HJ0D 1E0OB 2C7UB 2B39A 1HQ4B 4FQCL 1ZS8B 1A0QL 4ORZC 4K8RC 3C5ZD 1VGEH 3FB7A 2NY6B 4PRAB 1ROWA 2EECA 4Z7VA 4NQVB 1MHEB 2H2SD 3HE6D 4LFHG 1JNLH 3V4UH 4PREA 4NP4L 3IFNH 5DJ8A 3VFPB 5B3NA 2BVEA 1QFPA 4PJ8C 1UG9A 4IRJD 2NY7H 1WCQA 3ZDYE 4CVZA 4JO1H 4O58L 1JYNA 1WBYB 1IGIL 1H8OA 2O26U 4HH8A 1A7PL 1J05A 5J57B 3FB7B 1MF2H 2GSIA 1BQHA 2NY2C 3WKNA 4M7ZC 4PJ8D 3QWRA 4OI9A 4Q6IA 2Q76B 4PS4L 3UO1L 4R0LA 1CCZA 3E6HA 1VKXB 2AJZA 3DX7A 4CVZB 3QQ3B 3F7VA 4OZ4A 2R4RH 3QXAB 5JHDB 2P5WA 4J3TA 1FAIL 5IBLD 1JGUH 2GSIB 4J4PA 1HI6B 4UAOC 3UTTD 3D1MC 3WLWC 5AZEH 1KBGH 4NUGH 5D8JL 4Y4KC 1MRFH 3KPRE 4R0LB 1S7RA 2VXUL 1OOAA 2AJZB 3DX7B 3W9DB 3OJVC 4UOW0 4XPTL 2X1QA 1G1CA 4PGBA 5GIRA 5C07D 3WLWD 4Y4KD 3NABH 1JTTA 5K9QI 1PQZA 2X42A 3X12A 3UJJH 4R8WH 4XPBL 1F97A 5K9QG 1RZJL 1OPGH 1KPVA 4NHUA 3EYFB 1A4KA 2F5BH 2OTUA 4P2YA 4WI7A 1S7RB 4LGRB 4XVSL 1MLBA 1CE1H 4PGBB 1X5ZA 4ONGL 1UACH 5CJXA 2EDOA 3L5WB 4FFWC 4JPWL 1OD7A 3TN0B 1S9VA 1IC1A 3X12B 2CDEA 1KPVB 3ARED 4NHUB 3IDXH 3MUZ1 1E4XI 1A4KB 4PJ7E 5BS0A 1FDLL 4WY7L 5IP4A 5HVFB 3LHPH 4NN5C 4DKEL 3IFLH 2W91A 1I9JL 1MLBB 4YHKL 4ZS6D 4HMEA 3R0MA 4RRPA 4N8VA 1IE5A 2AJSH 4S1QL 2CDEB 1U8PB 3VFWB 4CVUA 5HHOE 1FNHA 4ONFH 1U8LA 4QTHB 4UDUB 3IU3B 1YJDC 2AEQL 3REWA 3ZTNH 3ARGA 3SCMB 1FL5A 2GSGB 2BNQB 2HLFC 5I15H 4N8VB 4P23A 2XTJB 2PTUA 1LO0L 3HC3H 1UB6B 1ZT1A 3EYQC 3A67H 5E8PA 3SE3A 1JWUB 1BVLA 3REWB 4Z78A 2UY6A 1CVSC 1WAAF 3ARGB 1FFPA 1FL5B 5DD5L 3S5LG 3EYQD 5JIKA 1K3ZA 4KJPC 3FO1B 2GKIA 1AQKL 4YGVB 2HVJA 4K71B 3ZDYF 1ZT1B 5DA0B 5EU6A 5HI4C 3NAAL 4NQDE 5E56A 5K9OB 1ZLSL 3VXSA 1CICC 4DTGL 4UILL 2NW3A 4L8CA 3QPXH 5FECB 1FFPB 3AY4C 1H3WM 1AO7A 1I3UA 2PKDA 1K3IA 5HI4D 3P3YA 2DB8A 1X4YA 5C08D 4S11A 5DVOA 1YC7A 4DN4H 3W0WE 2N4IA 3H9YA 5T1LD 5E1AA 1ND0A 3T1WA 3SE4A 5BZWA 5HYFA 4FG6C 1NJ9A 4TRPH 3VXSB 5FB8A 5IEHA 5GJTH 5GGTA 2NW3B 5FOJA 4L8CB 4MA7L 2A74A 1RUAL 2C3VA 3EJZC 2W0FA 3SGEI 2DQEH 4PRHD 5CUSH 3OSKA 3TVMA 4HPYH 4WO4C 1TQCC 4XPGH 1N0XH 2JB6A 2EDWA 4Y16A 1KTDA 5JPMA 2R56L 5GGUB 2DYPA 3I50L 1P6AB 3HNVL 5IEHB 4CN6A 3FN3A 3HLAA 2H1PL 3Q48A 4JLRB 4Z95L 1K2DB 2C3VB 4OZGA 5EPMB 1I1YA 2P8LA 3FRPA 2JB6B 1A7NH 2Q8BL 4Y16B 2P48B 3OHXA 2CK2A 4PJGA 1KTDB 2Z4QA 2DYPB 3MZGB 3HLAB 5IROC 2EEBA 4BQCA 5FM5O 3H9ZA 4XWGH 3QBTB 3ULSB 1BM3H 4KJWC 1L0YA 2NTFA 4LHUA 1NAKH 5EFIA 4OZGB 3KPSE 1QFWL 2IPUG 1UGNA 2P8LB 2VKXA 3E8UL 1G9NH 3WLBA 5AAWA 3OHXB 3P9MA 3PGFL 4PJGB 4QXUL 1OP5H 3NMEA 1MCWM 1J87A 4XPHH 1KB5L 2DQHL 5DMGD 4GAGH 3O8XD 5T5NF 1I4FA 2NTFB 1S8DA 4LHUB 5EFIB 4MD4A 4PJFE </