4UIMA

Crystal structure of quinine-dependent fab 314.3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
224
Chain Sequence
b'EVQLQQSGTVLARPGASVKMSCEASGYTFTSYWMHWLKKRPGQGLEWIGTIYPGNSDSSYNQRFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCTRERGLYYGGRSFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 314.3
molecule tags Immune system
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
total genus 36
structure length 224
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimA02
4HMEA 3D0VB 3FHQA 5I8OH 3D48R 3IFPB 1MJJB 3BP4B 5FM4A 3AROA 4MMZC 2VDQH 3OR6B 4ODHH 1IKNC 4WU5B 1Z3GL 4H26B 1IMHC 2DM2A 3EJZD 4LLVB 5ALBH 1X5YA 3CVIL 5DLMH 1CXEA 1FRGL 1I7UA 1BF2A 4WO4A 1FL5B 1CL7I 2AP2A 4KKAC 4UOW1 1HQ4B 5F6HI 5I1LA 1KGCD 2FL5B 3CFJA 3MUJA 2EH7L 3KLAA 3PXHA 4M48L 1P9MA 4DCQA 1EEZB 1U8JB 1E6JL 1Q9LA 2BSSA 2J7LA 1N6QH 3W2DL 2ENSA 3ROOB 1VGKA 5JPNB 4FQPA 3C09C 1VHPA 2NY5L 4MJIB 4POZD 3BPNC 2F53A 1UXSB 4XC3H 3WFDH 3IFOA 4ZQKA 2NY1C 4CGTA 3T65B 2N7BA 4BK5A 5FKAA 1R3KB 1JUFA 4JFQA 4JFDB 3V6OC 4ETQB 5CIPH 3QEHA 5LAXA 4Q6IC 5IR1B 4RQQB 3CFEB 2SEBA 3HHRB 2X1WL 1NFDE 1OAUL 3KXFE 3DLQR 3ZT7A 5JXAH 2IFFH 3DMMD 1BM3L 1E4XI 2C7UB 3H9SB 5I1KH 3FO1B 4HWBL 3S7GA 4AMKH 3VG0L 4O9HH 2X4TA 3OAZK 2D7OA 4TYUA 5T1MB 4Y5VA 4OQTA 1NC2D 4PJEB 1J0JA 1MAJA 1QSEB 5I19H 5F7FA 5DUML 1G9MC 1SJEA 3P4OA 4MZ3A 1WUNT 5SWQB 3MCLH 1FFPB 5KVEL 3AAZB 25C8L 3AS0A 2C3WA 4WW2B 1A14L 2DL2A 4XMLH 3HZVB 4LFHD 4LP5A 3HTLX 2HAZA 1RZKL 4WHYG 2AJYL 5JW5A 1DBKL 2EYRA 1JN6A 2Q3ZA 4PJGF 2AJUL 1N6QL 4OD2B 4DUWA 5C2BL 1HYSC 1FLTX 4JREC 2ESVB 2IAMC 2VDQL 4HKZB 3JTSA 4OUUB 3PABB 5KSVB 1RURL 1A22B 5I8CB 1MJ8L 5I71B 3STZB 1UZ8A 3HNSL 3TO2A 5FDYA 3PWLB 3CVIH 5DLML 3MRMA 1L7TH 1XGYH 5C09A 5EU6E 1C1EL 4ZS7H 1UYWH 3RI5F 2J8OA 4JKWA 3RTQD 5GS0H 2WWKO 4N1HB 3U7YL 1JFQL 4YLQT 2D7NA 1I1CA 5B38B 2UUDK 2VJXA 4XI5D 3HZYA 2AK4D 5CJOH 1NCWL 2YUXA 3PQYD 1MF2L 2XY2A 2AGJH 3ARVA 4PJ8A 3VG9C 3SJVB 1ZLWH 4DZBA 1YECH 2X4OB 3S88L 4HUXB 5FYLE 2AQ1A 2A6KB 3BKYL 2GSGA 1FNSL 2H2SD 4LLMB 3W39B 4JFZH 2PYFA 4KUZL 5CMAA 1RPQA 3W11C 3MXVL 1IFHH 3TVMD 3M1BB 3L3OB 3VFUB 3IU4L 1FAKT 4OFPA 1KIPB 1ZOXA 1A9EA 4PGCA 4LAQH 4N5EC 5B3JF 4Z5RB 5IHZB 4LVEA 1F00I 1UZ6E 1DBAH 3MLZL 4Y19B 3BGAA 3U7WL 4EDWL 1XGUA 1XCQA 5TQ0H 5J3HD 1ZAGA 4XCCL 3JWOL 5JW4N 1U8IA 1NMBH 4I0PD 3E8UH 4KY1H 4WI6A 4P2RB 3LQAH 2Q87A 2VXTH 5H35A 2WBJD 1U8PB 3O3UN 5GIRA 1RU9L 4GT7A 5CGYD 3HZVA 4MXWL 4J6RH 3B9VA 1V3LA 2IPUG 4KROB 4E42B 4NPYA 5C8JB 4G8EB 5IWLA 2EIEA 1N3NB 5I15H 2XA8H 2E7HA 4Z7UB 3RQ3A 2PTTB 5E6ZA 1JFQH 5I73B 3STLB 4WJ5A 1F6AA 4I0CC 2CXKA 4U1GC 4MNGB 3QYCA 5ISZA 1KENL 3NOIA 2H26B 4JPKH 5IBLC 3GRWL 3VXME 3RVUD 1OTSC 3HI1A 2R4SL 5FA4B 2A0LC 3BEVB 4NSKB 2XZZA 2AJSL 1DVFD 1YEDA 1OAQL 4FQXA 2YR3A 3O9WC 5HYSB 1D9KC 3MLYH 3SKUD 3NH7L 2B1AH 3X17A 2C7UA 2EYTA 7FABH 4XP6H 3U0TB 4PJAF 2DN7A 4UT7L 3WHE0 3MJ8A 4QHNA 2VYRE 4R6UA 2BVYA 2LV4A 4XB8A 4DVBA 3ROLB 1C12A 4J1UB 3F7YB 4K3EH 3QWRD 3VXUA 5FYJH 4LSRL 3MJ9H 4ELKA 3WEXA 1EXUA 4X6CF 4R2GD 1JZ6A 2A9NH 2P1YA 2IWGA 5FKAB 3FT2B 1PSKL 3HUJB 4P2CG 5BRZE 3IFOB 4LVNC 1QEWA 4N0RA 5CBEA 1NMBL 4NQSB 1HDMB 2VN4A 4Z7QE 4NRXB 2NY0D 5F3BB 1IEAB 4MQXD 2DQCL 2X6MA 2A9NL 3MMEA 4E41D 5ACZB 5FUOH 4I9WE 1J86A 4KJPC 5C92A 3MLVH 3A67H 4S1DC 3F8UB 3UX9B 1R6VA 4YHZH 4ZUWA 2EC9T 1NAML 5L0QB 2IANA 5FYLD 1U3HA 3REWB 1S8DB 4P5TD 1T21A 2LQRA 1C5BH 1CDBA 4K23L 3O41B 4BH8B 3LKNA 5F1SA 4OT1L 4WWKB 15C8L 3ZDZE 4NN5B 5T33H 2BK8A 3AS2A 4LNVA 4G6JH 3LEXA 3VFRA 3PQYB 4LCYA 5D6CA 1XAUA 3I02B 3HB3C 1KIQA 1LE5A 5IQ7H 4JRXA 4HEME 3EFDH 3TZVA 3VD5A 3EYQD 1OW0A 4KK8D 4ZOAA 4TTGA 3MCKA 5IB3A 3T08A 3NIDF 2YZ8A 4J3VA 2P43B 1IGJA 2HP4A 2Q7YB 4K9EC 1PZ5B 3BJLA 3MA7A 1OGAD 4WEUD 4UDUB 4E0RB 3FQNB 3WDHA 4MNHB 2PYFB 2DWDB 3W5NA 2FSEB 4OLXH 5D2LA 2NW3A 2O26U 5JIIA 3RNKB 4QRPB 4WVRA 4P2RD 4NWTH 4L4JA 2XQYG 4E9LA 4PGBA 5DMKA 4XBGA 1NDGB 1QFUH 4PPTA 5C0NC 3PWPD 2VDNH 5D6CB 5H8DA 7CGTA 3Q5TA 3BZEA 4LRNH 2AXFA 1T1YB 4UV7L 3L7EB 3BUYA 5C08B 2NCMA 4UAOB 2YPLB 2YUZA 1KXTB 4MDIA 2Y07H 1I9IH 1UVQA 5GSVB 5IB4A 1CFVL 4MYWB 1CK0H 4AEIL 5DT1L 1NKOA 5CP3H 3L3IB 3MRHB 4MD4B 2B5IC 3L1OL 2Y4SA 4UB0L 4HKZA 3BO8B 3WBDA 4XXCA 4HDIB 2CO6B 2I9LB 1MIEL 3KPSB 4MXQD 3T0XA 4O4YL 1Q9OB 1UB6A 3DVIA 2EH8L 1QFWM 4TTDC 3RGVB 1UJ3C 3QEQD 1IBGL 3HPJB 1H3PL 1KG0A 3AU1A 1FG9C 3ARED 3FN0H 3QEGH 1M7DB 1N59A 1DQMH 3K4AA 3VFMB 3VA6A 5DD0L 1A2YA 1NSNL 4OCSL 4POZC 5KTEL 5ANMB 1CF8L 1DP0A 3VI3F 2VN7A 4HK0A 5GGTH 1NCBH 1KXVC 5HDOA 1WSST 1XIWA 3MV7E 1XR9A 4FQ1L 4IS6B 1KCUH 4ZFFB 5CGMA 4H5SA 2MNUA 3QDME 1OWWA 3OKMA 1UADC 2YPVH 2YD9A 3V0AC 3QQ9D 2F54D 4M7LL 1MCJA 5IK3B 1IAIL 3BAEH 3L3JB 5F7DB 1BAFL 4GG6F 2AKRA 4GXUN 2A6IA 4FNLH 3SJVE 4JFXA 1SJHA 2MCPH 1JHTB 3QAZB 1DBML 2R1WA 5EWIL 1LE9B 1ERNA 1Y6NR 1MCPH 4LLMA 4HZLB 5HYSA 3BN3B 5I71C 1OAYH 2XFXB 5KSBA 5L2JA 1W0VB 3MV8B 4MNHA 3VGFA 1U8QB 4NO0A 1EO5A 3T09A 4CVZB 2Z93A 2WINA 2VLJE 1PX3A 3IJHB 4UMGA 5E5MB 2VDRH 5CEZD 1QLEH 3T8XB 5KW9L 3ES6A 1BD2D 4NWUL 3HUJF 4A2MA 1T0MA 5GRUH 1VPOL 2W38A 1L7IH 5KANG 2I27N 2VABB 3EHBD 1JJUA 2VDLH 4E42A 5JW3H 2YK1L 4G42B 4QLRA 3MRQA 1WIUA 5GS0C 5TQ2H 1RJYA 3U6RB 2BVOA 4PJ9B 4PJXF 1WBZA 1R3IH 2XZQL 5HYFA 2QLVB 4HXBH 3NCJL 3CZJA 1T2QL 5E8PB 4XNUL 4CNIB 1MWAB 3C5ZC 4M61A 1F4XL 1JIBA 4Y0GA 1RURH 2I07B 5GZND 5BS0B 5GHWL 3ZDYE 3QDJB 2IAMA 5DFVC 4N1EA 4R7NA 1X3DA 5B3NA 1KSRA 4FQLL 4DWHA 5D6DC 1EO8L 4Y5XB 2C3GA 4I3SH 4RZCB 4ZFOA 1F4XH 3OKDA 1JGDA 2G9HB 3LKPA 1AI1L 1D5ZB 4P57A 4MJID 3QH3A 3ZKND 1ZHLB 4X9FA 2E6JA 1DQML 1A6VL 4MCYB 2QL1A 1A7NL 1MLCA 3ESVF 4I13B 2DYPA 1OAKH 4WFGE 1QR1A 5D1ZB 3HE7A 4TULH 4OLVH 4NP4H 4Z7WB 4XVUC 1K3ZA 2XZAL 4JZJC 4NZJA 1OWRM 2IADB 3SE3C 3D69B 3EO9L 1YJDC 4YC2C 4NQXA 3F7YA 1NGXB 3VXUB 2XNAB 3VG0H 5EOCL 3H9SD 4MMXC 2GTWA 4FHBD 1IC7L 5IVXE 3PDDA 4WV1A 5GGRA 1ZVHA 5FXCH 1T1WA 5JA9A 3FONA 2EO1A 3V6ZB 3BMVA 5DHYA 4W4OA 3NCFB 4APQB 2LABA 3L5XL 1YEDB 5K59E 2IMNA 2YN5A 3OKOB 4JY5L 3LH2L 3QH3B 4HUKB 2YA2A 3G08A 2EDEA 1IAKA 3CU7A 1MREH 4N68A 1AO7A 4NRZB 1MLBA 5C7XH 2ED9A 3MFFB 2YEZB 3RUGF 4G7VH 4FFVD 4TUJB 1MFEL 1KTLB 2OK0L 4Y5XA 4OCYL 5DC0A 4X4YA 1HOCB 3AAZA 4RISH 3X11A 4I3SL 5JW3L 4NCDA 2CPCA 5DD6A 3C60B 1M05A 5IQ9A 3FAWA 4K94C 1LD9B 2JB5H 1QSEA 2P5EB 1FG2B 1HHJA 5BV7H 1MCRA 4ELMA 4M61B 1Z0NA 3WIFB 2VXSL 2FH8A 2Y23A 3MLPA 5KVEH 3Q5OA 4MDIB 1DVFC 1UJTA 1KACB 1U8IB 5I2IA 3FB7B 3PWVB 1YY8A 4P59H 2WV3A 4OCLC 1G7JB 2AV7A 2I9TB 4NP4L 5HD8D 1SY6L 3ZKQD 2E9IA 1M7IA 3H42L 3DO7A 1WZ1L 2Z91A 1A7BA 3KLHD 2VSCA 4FTVE 1PW3A 1BIHA 1RZ8A 2ORBL 5DS8B 5SWSA 3S35X 1FO0H 4D9LL 4HUVA 3AGVA 3CFEA 1AGCA 3BZ4B 4K8RH 4YE4L 3T8XA 3OB8A 4M1CD 4HFWA 3E6HB 3O9WB 2VH5H 3DV4B 2XKNB 4NQTA 4QYOB 3BP5A 3HE6A 3MV8A 4QGTA 4WEMB 1U8HB 2AJVH 1DUZA 1P5UA 4TULL 3IDMB 2WIIA 1T89C 3RJQB 5TDOB 4I18B 1TMCB 1VA9A 2PUQT 4G8FA 4JVPA 1DANT 1JHTA 3K1KC 2BSSB 3HZYB 4QHMA 3PQYA 3RDTB 2A6IB 1U92B 1RIUH 3EHBC 4UBDD 4OCRL 2M8XA 5FGCB 3MCLL 4HGKC 5CZXC 3EDJA 1NGQH 1SBBA 2IALA 5CKAA 4ENED 4L1DA 1QSFB 4FQIL 1W72B 2VZ1A 2E6QA 1P7KA 3OBAA 2UWEA 2W9DH 4YNYB 2HYMA 2N7AA 4AM0A 3S3PA 1ZHNA 5ICXA 4P4KA 3JUYA 1T4KA 5KSAA 1UXWA 5GZNC 2IEPA 4HG4K 2IH3B 1MFAL 2AK4A 4P59L 3VFMA 2RFXB 3LQMA 2HT4D 4S1SL 3C8DA 2HKHL 3EOTH 2EC8A 3K2UL 5LJYH 3UAJC 1AXSA 3X3FH 3GUTA 5J6HA 3NA4A 3PHQA 3F65A 1OF2B 3B5GA 3MV7B 2F5AL 1ADQH 1NFDF 5C0CA 1EHXA 1CLCA 3RHWF 1P9MC 4M7LT 5DK0B 5EU6D 1MI5D 4S1RL 2EXWD 3WS6A 4OI8A 1RD6A 4QRUA 4AM0B 3CIQA 3MRCA 4LKCB 5BV7L 2CIIB 1UM5L 4ZUVA 3HAEA 3WEXB 5FHAH 4L3EA 3GSVB 1BJ1H 4N0YL 3VD3A 4GQ9H 1TZHB 1RZFL 4JQIL 4I3RH 1QFWH 4OD3H 2FGWL 3MXVH 3ARSA 3IDXL 1F58H 1NGWA 4LPVA 2DAVA 2HVJB 2EYTB 3ARRA 3NPSC 4PGBB 1QOKA 2Y06H 4N0FB 4JFOB 2DQJH 3VGAC 3VGEA 3GJFK 1PGRB 2BVPB 4PTUB 3K8KA 3VGBA 5D2LB 5IR1A 3SGKA 4OKVB 3MV8D 4WO4C 5C0FA 1EVUA 1WIOA 4PRDB 3QWOA 3V0VB 2MPAL 4KJYA 4U6HB 5FF6B 1MCKA 3GO1H 1OP5H 2HTLD 4DZ8A 1NBYB 4XWGH 5J8OA 4DOHB 1X5AA 4RFNC 2MWCA 2H1PH 5HGDB 4NQDD 3T0BA 1RMFL 2BY3A 4ZTOH 4LPTA 4WFFD 5KJRH 2CK0L 4OAWB 2D0GA 1OF2A 1X4YA 4Z7UF 4G8GD 1M7IB 5E5UB 4WGVB 1NBZA 4CN6A 1PSKH 3ZHKA 4J6RL 3GIZL 4G43A 1EK3A 4L8SC 2DQFA 3PWVA 4Q0XL 4KUCF 5IEKA 2C3XA 3R8QA 3KPMB 4XP5L 4APQC 3BYYA 1T4KB 4PJCE 4G43B 4D9QD 2EIBA 4AEHH 4YIQB 4QWWD 3ZKXB 1S9KC 1F2QA 4KRPC 4JFHE 5C0AD 3CC5A 2X1PA 5LBSH 4JFDE 5IG7A 1YYLH 4KVNH 5DVOA 2XI9A 4GW1A 4JKKA 3TN0C 4RWYH 4Y19A 3PJSB 2O5YL 5MP6H 1I85A 5J7CC 1KTLA 4I4WA 3KLHC 3BIKA 3MLYL 4Z7VB 3ARFD 1AGBA 2H45A 2AI0H 5D7KD 1P4IL 3EDKA 3O4LB 1NMCB 2OTWB 3OKOA 1BWWA 1G0XA 5C2BH 4CAGA 3IDMA 4GBXA 3WFBL 5MP6L 1ED3B 3FQRB 3LKQA 4Y1AB 4ONGH 43CAA 5DMIL 3IDYB 1MVFA 4RWHA 4HIXH 1E4WL 1U95B 2FJGA 5FECA 4EKXA 2UVEA 4DAGH 1RZJH 4RBPK 5CEXA 2R4SH 1DTUA 2D31B 3HNVL 3MOAH 2CRZA 4XRCA 4ZS7L 2ARJA 4WUUD 1AGCB 1FGVL 3GSUB 4LMQE 1KJVB 5HGAA 4LGRB 1SYSA 3CD4A 1CGSL 1D6VL 3FFCD 2J6EA 4IRJD 2HMID 3L1OH 5TGBB 3EGSB 3PABA 4Y1AD 1P6FA 1MSPA 1BJMA 1ODAA 1FNEA 5D1QC 2HA1A 4MJ5A 4K07A 4NRYB 4XTRD 4I0KA 2BRRL 2W91A 2ESVE 2X42A 3VFVA 1TZGH 1J9CT 1IFHL 1ZHLA 3RWEA 3VDAA 3WUZA 1I1RA 1FZKB 2E8YA 2FX8H 4P23C 1R5IA 3C60A 3MRKB 1B90A 1ZGLP 3O81A 2OSLA 3UAJD 3QDAA 4Y2DB 4F15C 3FO0H 1YN7B 4FMKA 1JHLH 1QLFB 3MX0A 1C5DA 5DA4A 1KELL 1K9TA 3QDGA 1NBQA 1HNGA 2OP4H 1JP5A 2VTFA 2LVCA 1FLRL 2UWEB 2AW2A 4P5MA 5I6XB 3HG1B 2X10A 3R06B 3ZSTA 1MCLA 3WNLA 2C9AA 1NAKL 5DK2A 2R2HA 3C5SB 1MWAL 4GBXD 5EZJB 4L8SB 1Q72H 4J8RA 5E7BA 1MCCA 5L7XH 4GRWE 1PEWA 4J12A 3R8BB 5ENWB 4EDXB 5IHLB 3DUUB 3GMNB 1KGCE 2VXUL 1A6WL 4RWYL 1QRND 3STBA 1A7PH 4G8GE 2MSPA 4P23A 3X12A 3SDDD 5HYJA 3ES6B 4M5YH 1A7QH 4NQED 3U4EA 2ICCA 3HE6B 3UYOD 5L7XL 3MLWL 1HILA 1DQQA 5ID1A 2QJDA 4L5FH 5C08E 1Q0YL 2VQUA 4ZNEA 2MMXA 5DRNA 5LGJB 1JGVH 5HYIA 4PJHF 4PJXA 1N2RB 1WQVT 4DFIA 1JNHA 4GKNB 2FATL 3LB6D 1OGAE 1NLBH 3B83A 4JDTH 1ZTXH 4JFEB 4YZFF 1VGKB 1G6RB 5FO8B 3H2WA 4LHUA 4M43L 2Z91B 5H94B 3TYFB 4BZ2L 4ELME 5E95B 1V8HA 4U2YA 5CGTA 5D7JD 4H0GA 4LLQA 4WHCA 1CG9B 4N90D 3MGTA 4FFVC 4ZO6A 5DQ9A 2AEQL 1S5IL 3WHE1 1EERB 4K55A 5JOFA 4N8VA 4EI6B 5D2LE 3PGFL 4GW1B 4PRAA 4Z7NE 5J1AA 1U8NA 3WSQH 4ODHL 3ARDC 4XCYA 2FJFB 2FYYB 1F02I 5C70A 4YDVB 4K7PY 4ZXBC 1XIWB 1TETH 3QHFL 4ERSL 5EBLA 4HBCH 1DBJL 2VQ1B 3QIBD 4JM2F 4KVCL 2AJ3B 1XGPB 1KPUA 3GJEB 2FX9H 4CBPA 4M48H 1Q72L 1I4FB 5HGBA 4JHZA 3BYTA 5EOQH 4XCFH 3SE8L 2KKQA 3IS0X 1IAOA 1NCTA 5I1EH 4HWUA 3FCTB 2X09A 3QNZA 2AXGA 4JO1L 4M6AA 4G9FE 5DJZA 3MRQB 1T1XB 4WW2A 3ZE2E 5LQBL 2IPKB 2Q3AA 3BHBA 5MENB 3D85B 5BOPA 2YPLE 3BO8A 4KUCD 2CKBA 3V4UL 1FQ9C 1RHHA 5T1LB 2KBGA 4MD4A 2DLTA 3ZKMC 4BFBD 1SMOA 3SKMA 1QQDA 5MI0C 5JW4R 1JGVL 5J13C 1OW0C 3O4OB 1S7WB 2GT9A 5JORB 1W2KT 1NKRA 1JPTL 3DRQB 3BZEB 3A0OA 4JFOA 1B0RA 2DICA 4ZXBB 2NY2B 4BFGA 2F19H 5I1IH 4YHLH 1I75A 4HHAA 3ZO0A 1D5MA 3DIFB 1JRHL 5IK3A 3VD7A 2FSEA 3RY6C 1DCLA 1NCUA 3ZTJH 5D7LB 3HKFA 5MERA 2CIIA 2EDNA 1BOYA 4H5SB 2FCBA 2R0KL 2EZ0D 2ZCKH 4PGDA 3OWEA 2V7NA 1CGVA 4HKBB 1QKZH 2HKFH 2OI9B 3U2SB 3WNPA 2NY2D 3NCJH 4P23D 4L8BA 1ZTXL 1K4CA 4M6OL 1M7DA 1N59B 4KK9D 1T0NA 5E00B 3V7AG 4NZUL 4U0RB 2VLKE 1CD9B 1LO4L 1W0WB 1MRCL 1JGLH 5CZVL 4W4NA 4AH2A 5SWZA 3Q48A 4B0MM 1FRGH 1HSAA 2RFXA 4NO3A 5M94B 4HSQA 3JXAA 4GG6E 3U9PH 2D7TL 1U93B 4OBRA 2XWTB 4RX4A 1RUPL 4A2LA 4FQJH 1B2WH 5JHDB 3EYVB 2ZSWB 3NZ8B 5FO9A 3SDCC 3UTPD 1I9EA 2DI8A 2IANB 2FB4H 1MCFA 4XNQA 1E4XL 3ARGC 2IG2L 2QQLH 1DSFL 2A83B 5E5RB 1Q9KB 2JJWA 3VWJD 4LK4A 3QCTH 4U1KB 5C08A 1SHMA 3L7EA 4X99A 4ORGA 4IIQC 3MNZB 1C5CH 5GHWH 5F6IC 5F88A 2V5RA 3T1FB 5EU7E 1YPZE 3SCMA 1AQKL 1CCZA 2OI9C 4F8QA 2OYPA 1PQZB 2DQDL 3CVHL 3LMJL 1A1MB 1GGCL 5JPMA 1KEMH 4XPHH 3MSPA 1EGJL 4OZFG 2ED7A 2EE6A 1CXFA 4RAUA 1R0AL 1MHPL 2PNDA 3DXAA 3F58H 1KT2B 4YK4C 3UTSD 4K3HA 4EJ1C 3QDJE 3QIBB 4I48B 2L0DA 3T1WA 5JHLL 3I6KB 5C09E 2D03L 1FSKB 5JXEA 1NANI 3MBXL 1YEFH 1DBAL 3MLZH 3VH8B 5DS8A 5SWSB 3RIFF 1QG3A 2ITCA 3T2QA 5KJRL 3T4YB 3HC4L 3DV6B 1UZ8B 3QRGL 4OM0L 5GJTL 3OJDB 2O93L 4IS6A 3QUMB 4PYHA 3ZHLA 1IM9A 1B6UA 1FCCA 3CLFH 3VXRB 5IKCA 1JWMA 4Z78A 1FVDA 5AUMB 3O41A 3B5HA 1Y0LB 4BH8A 4OZFH 2LAGB 1B3JA 1JPFA 3JV4B 3VFOB 4JLRA 3R0NA 3B2VL 1KXQE 4QWWC 1QR4A 3IDNB 3TVMB 2NW2B 3VFGL 2IQAB 1WWBX 5D71L 2FB4L 5EU7C 4Y16D 1AGDA 4L9LC 5JMOC 3OKEA 1C5DB 3OF6D 1YN7A 5GISL 5JDJA 3OPZL 4D8PB 4XPTH 2NPLX 4PY7B 4DGIH 2F8OA 2IH1B 2VUOA 5ACZA 3CSYB 5HXMA 1YEEH 1KENH 3LPWA 1IC4L 1CBVL 4GW4B 5KANI 3IJSA 1NGPL 2NY1D 4YHOH 1T20A 4GRWF 4PJ8C 3WO4C 4OM1L 1K5NB 4XXDB 4Y4HD 3O3DB 3OPZH 5J11C 3U0PA 3BP7A 3JWNC 3SQOL 1KYOJ 3EGSA 4LIQH 4MJ6B 2G60H 3ULSA 2EIZA 1XCQB 1NCWH 3FQTA 3NCYS 2DQJL 3GNML 4FXGA 4RA3A 5E2WH 4JANA 3EO1B 2NW3B 3QCTL 4UILL 1Z9LA 4ZUSA 4XB7A 3BSZH 5DJCB 3IDJA 4AIZA 3P4MA 5BW7C 1X5GA 5CEXB 2Z4QB 2IADA 1A6ZA 4GMSL 3U46B 2FHFA 5IF0A 4IRJC 5F7YC 4H0IA 4R96B 2XN9D 5IB3B 4X6FA 1WT5C 4XP1H 4UILH 3IKCB 2OL3B 5ESVB 2FBOJ 5TH2A 1CFQA 2AXHA 1A1MA 4FP8H 1L0YA 3MACH 1TZGL 1U42A 5CJXC 2Y6SC 2NY2C 3MV9D 5D71H 1UJ3B 5EUKA 4QOKB 3GFUA 4X9BA 2E5EA 4L4TE 5EOCH 4U33A 3BKYH 1YEFL 4PJAB 3E8UL 1FZOA 5F1NA 2A83A 1AC0A 3PWPE 3B5TA 3GMQA 1AC6A 3S3SA 1UA6L 4PUBL 3TO2B 1QNZH 1A5FL 4OFKA 4PJ5D 3VWKB 5KSVA 4EIGB 3KJ6L 3QNXA 4XXCC 3FO2A 3AY4C 3DX6B 2XA8L 5A16B 3JV6A 2RGSA 4XBPA 3DSFL 2ZUQB 3W9EB 4U1LA 3SQBA 3KWWA 2X70B 3HNSH 1NBZB 2RJMA 4NRXA 5SV4A 3IDUA 1C7TA 4XMPL 5EOTA 2J88H 1OAQH 3NGBC 1T22A 1CDJA 1QEWB 3V5DA 3FZUC 1IAII 3FRPA 3MROA 1A7QL 5DRXA 1OP3K 1XIWC 2YPKB 2R39A 5E5MA 4A6YH 3OR7A 4ZTPH 1DBKH 4NO5A 2PYEA 2R4RH 3E6FB 4ODTL 2XQYK 3IFLL 3M1BA 4OQ1A 1P7HL 4PRID 3L95B 1F11B 1UFUA 1FV1B 1HQRB 2QV2A 1GPOL 4ZMAT 3IVKB 1T6WA 1P84K 1QYGL 4RA0C 4BFIB 5D1XB 3GSOA 3I6GB 2OTPA 4HHAB 3VWKC 1SY6H 3FB6A 1YEJL 3L3HB 5E9DE 4Z7VE 3HE6C 4QGYA 1DUYA 3O9WD 4OLUL 5EIIB 1OHQA 2GKIA 2P42B 1OLLA 2VIRB 3P0VH 3IETB 1IGML 4LU5L 4YUEL 4OZHB 2KPNA 4QHLA 3SKNA 2IFGA 1QRKA 3SE9H 3LKRB 3QEHB 3C09B 2JELH 4U1NB 4UNUA 3CX2A 4H25A 5BO1L 5DT1H 3Q3GA 1FDLH 3QQ3A 3VWJB 1H5BB 1MPAL 1UWXH 5IMOB 5GXBB 3C6SB 4YUEH 1DEEA 3KPLB 5EFIB 4OLZH 5E1HB 1FNSH 3D2UD 3LD8C 4G8EA 1FC1A 3U9UA 4PBVC 5CEZE 5IFAL 1JNLH 3PWPA 1F4WL 1FDLL 2J12B 3AU1B 1T5WB 4NN6B 1RQ5A 1LEGA 5HGBB 3TNNB 4LHJB 4P2RA 4O2CB 4PRBA 2J3SA 1G6RL 5IW3A 1I3RB 3U0WL 5DURD 4DGVH 2FO4B 4WUKL 1K4DA 3GBLA 2R0LL 4KJPD 3I6LE 1A5FH 1JV5A 1BBJA 4LRIA 4MCZA 4S1DD 3BGMB 2HFEB 1X7QB 3GIZH 3O8XD 4LASL 5F8RC 1NGYA 3V6FA 3UDWA 1UVQB 5GSVA 5K9JL 2HFFA 4JM2C 5IEHA 3EYOA 1M6OB 1BZ7B 4U0RC 4GAGH 4XCNB 5E94A 4YGAB 4YXKL 2A9MH 5T3XE 3UP1A 1EZVY 1T1YA 3CLEH 5C07A 2DWEA 3RDTA 5H2BA 5FCUH 2EDDA 5T3XH 3NAAL 3W0WD 1FVCA 3VFUA 4PGEB 1G6RA 2ICEB 5FO8A 1C7SA 3GBNL 1XGTA 4M93B 4CMMB 4XPGL 4UIMA 5GRJH 1R3LA 1UENA 5IW6B 4PLNC 3CDCA 2E7MA 2PXYA 5LWYL 2B2XH 2OR9L 3IDGB 4M5ZL 4Y16B 3FT4A 5GZOD 1B4JL 5IBUB 1G84A 5FK9B 3HS0B 4PJCB 2OXHA 3RWFB 1PDKA 3T0WA 2F5BH 3O9WA 2QKIB 1U58A 3CFDA 5E70A 5KW9H 2P8PA 3VMOA 1P1ZA 1AO7D 3BPLB 2P8PB 2GK2A 2RBLA 2NY1B 4WV1C 4OZIE 4N0UA 4XP6L 4Z8FL 2GCYB 4WUUE 1JGLL 5CZVH 3CK0L 4KZEH 3GB7B 1CDCA 2NX5A 3KPQA 4HS8H 4BZ1H 1Z9SA 2UWEF 4LGSB 2YKLL 3LCYA 2GJ6D 2D7TH 1F3RB 3FO0L 3QFDB 1RUQH 4NM4L 3G6JB 5DC4B 5KSBE 3WIFA 4ISVB 1WEJH 2Q7NA 4YK4B 4O5LH 3WIIL 2HMIC 5HPMA 4OD2A 1IBGH 2EYRB 4O2FB 3EZJB 3LEVL 3BRDA 4ZD3H 4N0CD 3DMMA 4LASH 5E94B 3IAQA 1HXYA 2K3TA 5DD0H 4WW2F 4Y5XC 2X41A 3X13B 4WTZA 3VWJC 3KG5A 1GIGH 4D9RD 4X7FC 5BJTB 5GGQL 1XCTB 4BZYA 1REIA 5I1GH 4GRLD 3QIUD 4G6JL 1MLBB 4XNZC 3UC0H 4X4XA 4BM7A 2XWJB 4PRPE 4F7MB 1G0DA 1IAKB 4PJ7F 4MXQC 1K4DB 4CU7A 3CXHK 4IRSD 5FYJD 3QUYC 3MLVL 1AXTL 2LE9A 4TTDD 3DXAD 4Q2ZB 4IMLB 1X5FA 3VXTA 1NCAH 3GJFB 3KAAA 2BMKB 3DVGA 1KB5H 4HWEL 2FNBA 1ITBB 2V2XB 4LSTH 4OKDA 1Q0YH 3LN4A 3ZTJG 4IIQB 2EECA 1EXUB 3BPOB 3S4SB 1NH6A 3DURA 3NIGE 4GBXC 4GRMA 5J9PA 4YR6B 1HCVA 2D03H 1FIGL 3PWUA 3BXNB 4KI1A 4I3GA 4DK6A 5C6TH 4KROC 4JJ5B 4LHUD 4FTVD 3VWJA 1WBYA 2J8HA 1N5AA 1QRNB 1KTDA 5IMMB 4LVHC 1VENA 3D3VE 3HI6H 4Q6IA 3GBNH 1LO3L 4NO2B 4M03A 1ROWA 1BQLL 2WBJB 3IB4A 4H20H 3MXWH 1JGUL 1ZA3A 2DBJA 3QQNA 1KJ2L 3FAXA 5DMIH 3O3AB 4RX4D 4TRPH 4B50A 3HI1B 1B4JH 3GMRB 1I8MB 3P4LA 4WI8A 4OI7A 1M1SA 4PREB 2A2QT 2VDPL 5E99H 5C0DA 3WNNA 1JGDB 2G9HA 4IOIB 4XNMA 1LO3H 4Y16C 5E24E 1MCPL 3BIKB 3C2SA 3DBXB 5EUOA 3QI9A 3H3PL 1J1OH 1YPZB 1HEZA 4LLVA 1IEBA 1F6FB 5GIRB 2HWZL 2EO9A 4GFTB 2FLBT 4EBQH 4V2CB 4C56D 3ZT5A 3QFJE 3I2CH 1H8OA 3PGFH 4FABL 3I85A 3KPOA 3WUWB 4G7YL 3O8XC 3QIUA 2QEJA 3MA9H 2VQTA 3EJZC 3LKSA 1C5CL 2FX8L 2VLRA 1JMXA 4JRXE 1GXEA 2WBJC 4JFPA 1CGWA 2HLAA 4YDIL 2K1MA 1A6VH 5SV3A 1U8MB 2ATKA 5IHZA 3KLSA 3RWGA 4G7YH 1J12A 5MI0B 3MRGB 4LL9A 2P24B 5I1GL 2IF7A 1NCCH 2X9WA 2Y1VA 4KJYB 3TCXA 1X5JA 4LEXL 5GGUB 2PF6A 4G6AD 5F1NB 4Q9QH 1FZOB 3HB3D 1J0ZA 4O51A 5KVGH 3IXTA 2D0HA 3GSWB 3HR5A 2E27H 4GUPB 1YUHB 5SX5H 3HC4H 3KDMB 1I8LC 4EOWL 5AD0A 4YBQC 1KCVL 4PRNB 4K3DL 4P9MH 1II4E 4NHUA 3G5ZA 4NCC1 1I9JL 5TH2B 4R8WH 1AR1C 1QKZL 4P46C 1PX4A 3QIWA 4Q6IB 3QUZA 2DLFH 3EYFA 5FA3A 1NCDH 4QHUA 1WVZA 1CICD 3QULB 1LO4H 3KPNA 4J3XA 3N0PB 4FZEL 3MOBH 4JJ5A 3KR3H 3TESA 4R4BA 4K7PX 3UTSB 2ZUVA 4OLXL 2E6PA 2VITA 3UPCA 4L4VA 2JE8A 3B3IA 1MAML 1NUFA 5CKGA 4LEOA 3SPVB 3LQZA 5ISZD 4P4RB 1JF1B 4RRPA 4ZFGH 1OARH 1Z3GH 1J8HB 5J6HB 1VFAB 4MNQD 1CDHA 4M9PA 3RNQB 1WC7B 4O00A 4MAUH 2C4FT 2GUOB 1T1ZA 3GSNA 4YC2B 3ULVD 2Q8BL 5I8EA 4RGOL 2CH8A 1MUJA 2NLJB 3QFJA 5KOVC 3EBAA 4HS3A 3MRFB 4AEIH 4LIQL 2XYCA 5DD1L 3FB8A 4M8QA 4P46A 2IH1A 2YC1A 2V2TB 4KKLD 1CT8B 4PJ7B 1XR8B 2OZ4A 5SWZE 3LMJH 1BEYH 3OX8B 1R3HA 1YNLL 2Z31B 1PZUB 3CU1A 3OKEB 2A38A 1EUTA 3QXDA 3RP1A 1CE6B 3RA7L 4JREB 2IQAA 4XCFL 5DJYB 5DZLA 1OGTA 3O6LL 2NR6C 1KCLA 2L7UA 1QACA 2BVUA 2NYYC 4QRTA 2SEBB 2A77H 4NNXB 1U8HA 3F7VA 5HDBF 4MDJA 3KPQB 1IM9B 4CADA 3IU4H 2VISB 4FZEH 3DVFA 1A3RH 2CLRA 3CDYA 5B3JE 4ZNCD 2FEEL 3QEQE 3UTQB 4O9HL 3N50A 4OCXL 5EU5B 4ZAKC 1R5VB 3TZVB 3LRHA 2WUCH 4K8RL 5F7EH 4KPHL 1HHIA 2KL6A 5IGXL 4JPIA 2F19L 4IRJB 4X4ZA 1TNMA 3ME0A 3QCUL 3SDYH 3X3GH 3V79C 3QUXD 4UOW0 4Y4FA 1YY8B 4FFYH 4K7FB 4QY8A 4PJFF 4QRQB 1L0XA 2BNUA 3NACL 3QUXA 1I7UB 4L9LB 3BVNA 4JZNB 1J05A 1KCSH 4UBDC 1FNGA 2NNAA 1MJUH 4HIJA 2OXGA 3P77B 1RIUL 1QLEL 5DI8B 4IHOA 4ZUWB 5D1ZC 1YMHA 1OTTD 5EDXA 2J8UF 3BOVA 1DN0A 3HPLA 3IFPA 3HZKA 3NN8A 3V6FB 4BSJA 1QFWI 4YXKH 1I3GL 2Q76B 4PBWD 3WE6B 4MCZB 3THML 1G7HA 4KK6C 3LDBC 1NMCC 1F8TL 1G9NH 1MJUL 4GRLB 5DC9B 1S7SA 4HIIA 3OXRB 3MRFA 4G7VL 4HS3B 2NMSA 1F13A 2CDEA 3GNMH 3QQ4B 5L2KB 3VI4F 2UVFA 3RDTC 1R5WA 4JM4L 5I8EB 4PJGE 4HIHA 4NZTL 1FHGA 1D5BA 1QHPA 5EN2A 1ZT1A 3SGKC 5AZEL 3NH7H 5D7SH 4ZPTB 2I60H 1PG7X 4YBHA 4GAYA 1BOGB 4HWNA 3K80A 2FLRT 5CEYA 5DJ2A 2AGJL 4EN3A 3REVA 4LPXA 3P0GB 4M6ML 3MV9A 4I2XB 4QXGH 5I66A 1GZPB 4C54A 5DQDL 1SYVA 5IMOA 1MNUH 3WNOA 2BJMH 4X4ME 3L7FB 4WFHD 3F7PC 4XVUD 1J88A 4P46D 3VXNB 2G5BA 3OKLA 5F7KC 5BZWA 4MAYC 4PRIB 3QISA 4W68A 1KJ3L 2V5MA 1TDQA 4M7JH 1NGZA 2EDBA 4OLVL 3I9GL 4LLDB 5BZWB 3F12A 2CDGA 4LBEA 5AD0B 2ZKHL 1NEUA 5HI5D 4P57B 5C07D 2HTKC 4XPBL 1FORL 1E6OH 3GSOB 1RJLB 4HWZB 5C6PB 5CWSB 4OZIB 3IVKA 5I1DB 4M7JL 3Q1SL 5GGVH 1MFAH 2BOBB 4WDIA 5FUZH 1JYNA 1OCWH 4NPYB 5C8JA 4YHNA 2A6DB 1DL7L 4N90E 1H5BC 1BOGA 4K71C 4XGZA 2R2EA 1G9EA 1JZ2A 3WHXB 5DRXB 1QBAA 2PYEE 4I77L 2BCKA 4NQCE 3V5KA 2YSSB 1FBIH 1E0OB 3RWCA 2HLAB 5F1IA 1B6DA 1JNNL 4NOFA 1D6EB 5I18L 4K8RC 1DE4A 1JTTA 2Q76A 3TJHC 3KPRA 2W0KA 1J87A 5HVGB 4XP9L 3S6CA 3DX6A 2HT3D 4OSUL 4R90L 1OSPL 3LQAL 4ZO9A 4X9GA 3KPPB 3GHEL 3IDXH 3IRZA 2DD8H 2GSIA 5IB1A 5EO9A 5T5FL 3PIQA 2Y5TA 3TA3D 5KN5A 3TBYB 3VXRE 2O5YH 2GSGB 2MHAA 3P2TA 2JCCF 5IB5A 4GO6B 5JIKA 2HRPH 2AQ3A 3MRLA 2X4OA 4GOSA 2BRQA 5HVHB 5DGRA 2IBZY 2N4IA 3VXSE 3CH1B 4KU1A 4ZAKD 2ZCLL 3IFLH 3GMLB 5A3IC 4KZEL 3KPRD 2XTJB 5I75B 3GKWL 1RFDL 1KJMB 4QTHB 4GKNA 1YNKH 5JTWA 1HINH 1JNJA 1TQBC 1CWVA 1HI6B 3ZL4L 4K2UL 2EE9A 2PR4H 5T5NG 3ULUF 4MA7L 5I1AA 2AK1H 5I8CA 2HWZH 4X5WA 5L8JB 4MXVF 5FM5O 1YNKL 3K2MC 2DTSA 4O4YH 3TZVC 3FQTB 4JJHA 4QT5B 3RUGB 4BK4A 3OZ9L 1G9NC 5B8CA 1L6XA 3FN0L 2IG2H 4D3CL 3M07A 3VXTB 4AMKL 2C1OA 5FHBL 1Q9OA 4ONOA 1D5BB 4YXLH 4TOYH 5DK2B 5L88L 2Q6WA 4PJIA 4KRLB 5LCVL 5CIPA 1T89A 3FO9A 1KEGL 3OXRA 1KNOB 2C1PA 2LVEA 6CGTA 1KB5A 4PB9H 5FUOL 4UNVA 1KNOA 2C1PB 1RULL 4JR9L 1S9XB 3P0YH 5I1CH 1MFBL 4MVBD 4PV8A 3X13A 4YWGL 1FN4A 2W9EH 2YA1A 4X8JA 4B7IA 4F2MA 2XA3A 4YHZL 5FDWB 4F58L 1CLZH 3BKMH 2WWKT 1JWSA 3CSPA 4LQFH 5GGRY 3X3FL 3HN3A 4YO0B 3DX8A 3SCMC 1S7XB 5T3XD 5KSAC 4HJGA 1FVDB 1QSEE 3BWAA 3RNKA 2DQIH 1UWGH 1JGUH 1AQDB 2NTFB 3GHBL 3VXRA 4Y4KA 5EZLB 1FNEB 2NXYB 4MAYD 5ANME 3VJ6B 4MQ7B 5IHUH 3KHQA 4M43H 1FVEA 2GCYA 1S9VA 3AY4A 1B88A 3T3PF 3TO4C 1PKQE 1CFNA 1T5XB 3RRQA 2BC4B 4WEBL 3G6DL 4C55A 5SX5K 1AGFA 4NKOA 1R5VA 4JAMB 3WFBH 2X4RB 3N85H 4F7EA 1FIGH 4LCCC 2X1XR 3TV3L 3D25B 1TQCB 2HT4C 5IHUL 3LD8B 1DR9A 1OP9A 3LIZL 1NUNB 3AFLA 2C3HA 1XGQB 1AHWC 2DLGA 4DEPB 1J1XL 4FQ2H 2F54A 4LF3A 5DQJB 4JPWL 3F7VB 4NBXB 1IQDA 1MIEH 1T83A 5E2TL 5J06A 1VDGA 2AJXL 3B6SA 5HYEA 4OB5H 4R97C 1FVCB 5D7LD 2ICWB 4QKXB 1G9ML 2GFBA 3REWA 4ENEC 1T7XA 2F15A 3S97C 3C6LB 1BFSA 4XWGL 1AR2A 5GRWA 5F7UA 3W82A 1YNLH 4UI2A 4WTWA 1V3MA 2JJUA 2X4SB 3PNWB 4ONHA 3DOSA 4S0SD 3WUWG 4LCCA 5IVXA 5AAMA 1LO2H 4GKZA 2QTEA 3P9WB 1QSFE 4ZPVA 3BH8B 4Y4FB 1YY9D 5TDPB 1LK3L 1ONQB 4JDVB 4PRHD 4PP2A 4M9OA 4GG6A 3FT2A 1UM6L 3SKJL 3U83A 1JK8A 3MRIB 2NXZD 2YA0A 1FJ1B 3T2OA 1W0WA 4LDOB 3CZFA 2DIJA 3IU3B 3CNKA 1YN6A 4NQDE 1T7YA 1U8LA 3WN5C 3U9UB 1K4CB 2EXWC 5FKPA 2ICWI 1EFXD 3PL6D 4RAVA 2GJZB 2VAAB 2EEDA 4NZRH 3UTSA 3MJ8B 1E4JA 5C3TA 3V0VA 4LSSH 3U0TA 4EI5C 4KHXL 4LBEB 4XH2B 4JRYA 4S2SB 1XF5B 4MA3B 3VRLF 4LLDA 3TJEH 1KN2L 5JLZA 1AQDA 2NTFA 4Z6AT 1OGAB 1CDGA 1XF5A 3ARGB 1RZIB 3KDMA 1UM4L 4Z7WE 3DPBA 1NJ9B 3WXVL 3L3KA 2DI9A 4U1JB 3HMXA 3LZFH 1GZPA 3STLA 3IXTB 3A6BL 1CXLA 5D7KE 1CQKA 1KULA 4L3EB 2UZIL 2LU7A 4HD9A 1A8JH 4X6CA 3B9KC 1CGYA 5F9WB 2OZ4H 3MV9E 4IIQA 5CEYB 3TIEB 3CZFB 5HDBE 2FJHA 3ZT6A 4QRUB 1ZLVK 4I8DA 2AABH 2Z8RA 5CEZH 4ZUUA 4FQ2L 3NIDE 4YPJA 4E41B 3ULUD 1MAMH 5KTEH 3GSNB 2RHEA 3WCYA 2EC9U 4JRYD 2X1QA 4FFZL 1T03H 3WL9A 5E8NB 1I4FA 5D1XC 3PNWA 4DOHE 3T0ED 4ODUA 5D1QA 3JV6B 1JI2A 1PAMA 2XIDA 4LEOB 3SPVA 3I2CL 4K71B 3MGOA 2X4PA 3PWJA 3C6LA 2FX9L 2VZVA 4HF5L 3EZ8A 1OL0A 1VFBB 4KTYA 4Z76B 1IEBB 5C86A 5HJ3A 4GS7C 4YNYA 3IAGC 5HPMB 2P44B 4ISVA 3EYFB 3S36H 3IXAB 2HT2D 5CBAA 1MQ8A 4JFEE 1MOEA 4WI5A 4U6VL 3SJVA 4HT1L 3RA7H 4F57L 4XHJC 2KUTA 3VXUD 3T2NL 2J4WL 3ARBC 5H94A 3B8SA 4Y8AA 3P73A 1WK0A 3BPCB 4OIIH 2RB8A 1F42A 1G7MB 4C4KT 4J4PA 5IVNA 1I1FA 3UTQA 1BZ9B 3RZWA 1MCBA 3LN5A 3ULVF 2Z8SA 5J1TC 3PWLA 2BSTA 3IFNH 5KOMC 1SEBB 4MQ7A 2YBRB 3IDJB 1GGIH 4JRWA 4JHAH 3I3BA 3MYZA 3VXQA 2X4PB 4PJ9C 3RPKA 4IJ3B 4JANB 5K9QI 5D1QD 1EV2E 3S4SA 4JPVH 3WFEL 4GLRH 1BD2E 2VLRB 1WAAE 1H3WM 4PJXE 3WXVH 3PDOB 4WY7L 5ALBL 3QXDB 1G7JA 1S7VB 2AEQH 2I9TA 3J7HA 3NGBB 3CUPA 3M17A 4XT1C 5E8DL 3T0EA 3FB7A 1R3HB 2Z31A 3EYOB 5DHVB 3S4SG 5DA0B 1BJ1J 3TBVA 4XNZB 4HJJL 5CFHA 1PD6A 1FFPA 1CT8A 4HK3N 4PJ7A 5J56B 3IYLW 3CCHB 3Q6FB 5D96C 5EIQA 3CSYA 4P5TA 1MCNA 1P4BL 1XH3A 3DYPA 1MFEH 2FO4A 5D5ME 5C9JA 4YFEA 1KPVA 5EU6B 1FO0L 3BW9A 1CFBA 2X4QB 3BFOA 5E56A 3EJJX 2K7QA 4YPGA 1WC7A 4HLZH 5C0DB 2FGWH 5AEAA 3RY4A 3GSNH 4IEFB 5DEZA 1GOHA 3QI9C 5IMKB 4PY8I 3JV4A 2JJSA 3O6FC 4L1HA 1U91B 1YMMA 3HNTH 3QAZC 1BEYL 2BXZA 1OM3H 5IKCB 4CN1A 4NM8L 2EH7H 2GK0A 4U6YA 4QCIB 2J8UE 1KJ2B 5D7SL 3ZL4H 1KN4L 3OAYH 4KRPD 4F3FA 4JFQB 3H7BB 3HG1E 4UT9L 2B4CL 4PV9B 2X4UB 3H0TB 3VH8A 3GO1L 3NIGF 4J3UA 4JGUA 4QHKI 4ZQKB 2VAAA 5CINL 4U6VH 5ADPH 4YAQB 2XG4A 1U6AL 2GYSA 1G7MA 3QUZC 2FX7L 3AMKA 4JY5H 4P2OC 5HGGS 2B4CH 5FK9A 4JVUA 3L9RB 5F9JA 1K8DB 1X5IA 4D3CH 2YOCA 4GMTH 1QR1B 4MJ4A 5L6YL 2DYPB 4G6FB 5ADPL 1S9YB 2X7LB 1FL5A 3IS1X 3UYPA 4Y4HB 5LXGL 1JYXA 2XZCH 5EPMB 3O4LA 5BRZD 4GRLA 4X4XB 1FZJA 4LCCB 3MNZA 3OHXB 1FORH 4ONHB 4S10A 4KHTL 3DMMC 2WAHA 3DSNA 3FT3A 2Y5EA 1V05A 1DDHA 2ADIB 4F58H 3S8WA 2KZWA 3X14B 4EQ2A 3MGAA 5E8OB 3KS0H 5IFHH 5I19L 2VDKL 4YDJB 2BNQD 3QJHA 4I77H 3QUXB 3G6JA 4M8VA 4X7SL 4LLYA 4XBPB 4AQ1B 3MBEB 4QRQA 2BCKB 2UY6A 1IQDB 1FBIL 3F6IA 5CS7A 3UXFA 3TNNA 2AEIT 2DS4A 2ERJB 3K2UH 2A1WH 2R2EB 2PN5A 5DR5H 4ZS6C 4YQXH 3S37X 4XHQA 1NC2A 5HHOE 4N0UB 3TT3L 1FFOA 4PTTB 4W81A 2NTSP 2VABA 4LSPH 2J6EL 4YAQA 3HR6A 1CS6A 4JAMA 1I8KA 5FYKD 5L9DL 4Y2OA 3BPCA 3BT2L 4NNPL 5TF1L 4DQOL 3G04A 4JFFD 4DKAA 4MJ2A 4HUWA 3ARGA 1OGAA 1SBSL 4DUXA 1A7NH 4CRPA 3MNVB 1TLKA 4QHKJ 5IVZA 4OZHA 2B5IB 5ELIA 5F1OB 3VWKD 3WFDL 1TCRA 2WW8A 2BVQA 5DRZA 5F3HB 3FRPG 1QRNA 3D3VD 3ULUH 2FECI 3MCG1 1I85C 5CJOL 5ICYB 2CO7B 1B0RB 1UH2A 1P4LB 2Y06L 1CVSC 2F53D 3DYMA 1SYVB 1CZ8L 4PJ7E 1TZHA 3MV9B 5L8KB 5I1HH 1VKXA 3L95A 1CIDA 1JHLL 4HJ0D 1GAFL 3GEWB 2HKHH 3EOTL 2BNRB 3PP3K 4NO5B 5IFHL 4B53A 3D5OF 1U9KA 2BP3A 1GGBL 5HY9A 1S78C 3WL9B 5DRWA 4L4VE 3QPQC 5EN2B 3O6ML 4KV5F 1OLZA 1X9QA 3NFSH 4OLZL 2N1KA 3OL2A 4JY6A 5CUSH 4R3SB 1K5NA 2W9EL 3QQ4A 5L2KA 3GRWA 1OSPH 2HN7B 3UTOA 5C0AB 2AXGB 1KB5L 4HWEH 4ZG1A 3RNQA 4WWKD 1QNZL 5FB8B 3RUGA 3VU2A 3GSQB 1G7HB 1A9BA 5EBMB 2X4SA 4MXVE 4D8PA 2ILLA 5EO1B 1A4JA 3MPCA 2HRPL 4ONGL 4YHMH 3DMMB 1JZ3A 3L3KB 4NQVB 3U1SH 4DQOH 1YEEL 1YEJH 3MRHA 3TVMA 1MCIA 4L8DB 2CJUH 5EU3B 1J05B 4AENB 1RULH 4W6WB 4H25B 4L9LA 5DO2D 2IALB 2ZUUA 4G6FD 2J88L 3MZGB 1JWUB 5C0BA 5KS9E 4R90H 3QHZL 5E6IA 4LF3B 5DQJA 3VGAB 5EIIA 5GS2D 4RIRA 4JRYB 5F9OH 3P73B 5BO1H 1UB5A 3FB6B 3LS4L 1EUUA 3UJJH 4OGYL 4U31A 3BQUC 4NC1E 5ERWA 3RY5A 3DGGB 2DWDA 1CIUA 4I5BB 3FMGL 3PIQB 5FYJE 5GGUA 4G8IB 1TPXC 7FABL 1I1YA 5K93A 5TQ0L 2NY3D 2XKNA 5B39B 3O6MH 1YNTB 4ZSOE 2ZWLT 3TBTA 1A4KA 4M4PA 4M1DL 4ODVH 1XEDA 5F89A 1INEH 5L88H 5JPMB 1DFBL 1N7MH 4K3GA 5EOTB 4LLYB 4O58L 5BW7A 2FBJH 1GL4B 3I02A 3CPLA 4W4OC 1D5IL 2P5WB 3RL2A 4PB9L 4HC1L 2JB6B 3CVHB 2CIKB 4LKXA 3UZQA 5KAQF 3BP7B 1YA5A 4XPAL 5ABDE 3OX8A 1BFVL 2BRRH 3K46A 1FIEA 5FYJU 1S9XA 1D7FA 4XVJH 5JA8B 3BQUA 1V5JA 4N0CC 4CMHC 4DKEL 5INCA 4Y4KD 3FRUB 4NQEB 2X2YA 3C6LC 2VOTA 2W9LA 3RGVC 4DW2L 1YPZA 3HE7D 4Q9QL 1J0IA 4TVPH 3VRJA 3NFSL 3ZYIA 1I3RA 2HT2C 3WJJC 4D0BB 5ITBH 2RCSH 4TVPE 4XC1L 2VXVH 5E9DB 4OF3A 4U1JA 4DKEH 5B8CB 3GM8A 5JMRA 2B1AL 1AO7B 4X6BB 4WNQB 4KZDH 1IAIM 2XN9E 4OZHE 4KV5E 5BVPL 5F3BA 3UJJL 1QFHA 3ILQD 4WI4A 1CFQB 3MLTA 4G9FB 2OR8A 4X6FB 5EC2A 5E1AA 1HXMA 2IQ9H 4Z0BL 3DO3A 1BQHG 2DLFL 3H0TA 3MJ9L 3RBGA 1N8ZA 2ZSVA 2Z92B 4MLSA 1SYSB 2HH0H 5GGRB 3M8OL 3V52H 3NPZB 4R2GC 3TPKA 3TPUA 1UYWL 3GSUA 4OFYA 1AD9B 4I3RL 3VFWA 2VDMH 2VIRA 5JZ7D 4O58H 4L29A 4Y7MA 1LP9F 1TNNA 4QOKE 4LSVL 4K94H 4JB9L 3SHSA 4X6BA 1YJDH 2NY0C 2NZ9D 1HE7A 2QR0A 5FV2A 3OGCA 3V52L 3HI6L 1F3DH 1OAXL 4P5KA 4GBXB 5C0BD 3BKCL 3VFTB 3O11A 4ZSOA 5EO9B 1NAMH 4NKMA 1EHLL 2HLFC 1KB5B 1FNLA 1RIVL 4KTEL 3Q6FA 3UO1L 5EZIL 1RK0A 2Q6WB 2R69H 4P5TC 1N3NA 4OV5B 4F9LC 1EAJA 1ZEAH 3M17B 3T0EB 3SDXE 1FH5L 4RNRB 2FBJL 3CC5B 3QDJA 4P2QD 4CU8A 1G7PB 5T3ZL 3RY6A 4PJHA 1W8OA 4BYHA 4LEXH 3BVNB 2GTZB 4NKDA 4WFED 5TPWH 2Q8AL 2VERN 5GRXG 4KVCH 1KPUB 1ZE3C 1AY1L 4QTIH 3VH8G 2NXYD 3BZFA 4XVJL 4OD1L 1GC1L 3RFZC 5C0CE 5ICZA 4OBSA 3RVXC 4C56B 4KXZH 4NUJA 4JPIB 1TJGL 3E1F1 5FO7A 3L5IA 4WDIB 3H9YA 4UTBL 1MFBH 3QI9B 1ZT7A 5EU5A 4WW1A 4F37K 3HMXL 1CTNA 3UEZA 3P9LB 2BVEA 5E6YA 5DJ0A 3UTZB 3KXFA 2XN9A 2XT1B 1CFNB 1T5XA 1FO0B 1IQWL 1ND0B 3QCUH 4I0PB 2VDPH 3KR3L 4JZJB 4NNYB 3W39A 5GRYA 5FEBA 1BIIB 3GHBH 1HCFX 1P5VA 2B2XL 3SDAC 4NZDA 5DJDA 1RZJC 5LXGH 3KPSD 1N5AB 1AKJB 5H2BB 4ODSH 3OQ3B 1MAKA 5E4IA 4NQUA 1AFVH 1JWSB 5EZIH 1R3IL 4YBLB 1YC7A 1JHKH 4U6XB 4GKSB 5EO0A 4JZOA 2B1HH 3LRGA 4OCWH 1WBXB 2X4NA 4TRPL 2WZPD 5C09B 3DTXA 2XRAL 3SGJC 5ENWA 4LKCA 3BGMA 4XNQB 1HHHA 4ODSL 3MOBL 1A64A 3UTTD 1XR9B 2P5EE 3JTSB 4OUUA 4WI3A 5DK0A 2V9TA 4JHAL 3N9GL 1B0WA 4UUJB 3AREC 4N1CA 4BJLA 1A2YB 1R5WB 1K2DB 2NY5C 2ENYA 5HHNB 1CK0L 2IAND 1KBGL 3QNZB 1Y18A 3H8NA 3WHXA 5DEGA 1MJ7L 5GZOC 2EKJA 1QO3B 3PHOB 3NTCL 2FH6A 2VE6A 5HYQB 3HNTL 2NY6B 5E2WL 4PD4K 4G5ZH 4CW1A 1QRNE 5L9DH 5IVXF 1MHPH 5J11B 2WANA 2DQTL 2FJFA 5I1IL 2CRYA 3T3ME 4JY4A 3TA3B 3RX7A 5E08L 4QHUB 4K3DH 5DJDB 5F21B 5KS9B 3H9HB 3VFVB 3HZMB 2D0FA 5KVDH 4LPCA 4ZUTB 4RMUA 5DFVD 1AY1H 1KB9K 4QTIL 3MNVA 5ITFA 5T33L 3OJDA 1I9RH 3H9SA 1WAAF 5TE4L 4HKXA 1NDGA 1HN1A 3K0WA 1EHNA 5K9OB 5DMKB 4PJDF 5IBTL 5CD3A 1GGIL 4BH7B 3MRRA 4LAJH 3EYQC 3GSWA 3HR5B 5F6HJ 5HHQA 3UBXA 3CFKB 2HKFL 4LOUC 3UZEA 3MLRH 3O3EA 1I8LA 2ARJB 2FGZA 2FEDD 3VXSD 4ETQA 4HJ0C 1FPTL 5D72H 4JPVL 4GXVL 4CUCA 3GSRA 5D6DA 2NY6C 3EO9H 5T1LA 1HZHH 4RAUB 1NBVL 1Z9MA 4KRMB 1ONQA 3MROB 3MV8E 4CMMA 4IRZL 3I50H 4RGOH 1AD0A 2AXJA 4XPFL 3B9KA 3UJIL 2FX7H 2NX5D 1KIQB 1LE5B 4DGIL 4EDXA 1T66C 3OXSB 3C5ZD 2VLKA 2JIXB 1Z5LB 1VERA 4X99B 1QUNA 4UV7H 1CE1L 4F7CA 4GJTB 1YEKL 5D2NE 4UQ2B 1DN0B 1UWEL 2YSSA 3RZCB 4Z7OF 3FB5A 3LKNB 3QG6A 4NZTH 4E5XA 1F4AA 5KSUB 2VDLL 1T21B 1BBJB 2P5EA 1U3HB 1EMTL 3KS0J 3RL1B 1Q9WA 2B7DT 1BQUA 1YMMD 3QFJB 1HOCA 2DF3A 4K3JH 5HYSG 3G6JE 4M1GH 4N0YH 1AKJD 3DBXA 1I3VA 4MA8H 2Y72A 4GLRI 4HZAA 3QHZH 1MQKH 5SWSD 1T03L 4OV6F 5TJWK 5EIVA 3WLWC 5E0QA 4PJBB 2EKSA 4LSQL 5BCAA 1XZ0B 1BJ8A 5CBEB 4OCXH 4AEEA 2W0LA 2AJVL 3KPLA 5EFIA 4FRWA 4EI5B 5IB2B 1YEGH 2P5ED 3O8XA 4QF1B 3LSOB 1IKNA 2CLRB 2VUYA 3MNWB 2IFFL 1H5BA 5J4MA 5HGHA 2PCPA 2UY7A 4CKVX 1DQQB 4HPOL 1S7RA 3TO4A 5ID1B 4OQTL 3CVHH 4JM2D 3B9EA 3QEQB 4P23B 3E2HC 4IRZH 5I76B 3L5XH 4PB0L 5J9PB 4NYLB 5ECJE 5AWNL 3D69A 2O5XL 5EORL 3MODL 3GMOB 1KC5L 1LDPL 1DBMH 1I7TA 2CKBH 4MJ6A 2R1XB 3I6GA 3G6JF 3FFDB 2VLKD 3RWDB 3VRLE 5BQ7B 1U41A 1F90L 1UWEH 4MQTB 3MLUH 2NY4D 4XVTH 2IPUK 3RVWD 4U1IB 3HG1A 3R06A 3VD9A 4H1LA 2H26A 2Q20A 4Y4FC 2VC2L 3VW3H 4P48A 3CCHA 2ZNWA 5BJTA 2PTTA 1K8IA 1GH7A 1YQ2A 1ADQL 4CN4A 1T0PB 1HKLL 1YMHB 2A9ML 3OKYA 5DI8A 4Y5YC 3WFEH 3B2VH 2XTJC 3BIBX 2AS5M 4XBEL 2AI0L 3PHQB 2YRLA 4Z7QF 2I60L 3GIVB 1ACYH 1GGBH 3N1QC 3TT3H 3C08H 3QO1B 4HGMA 2CUMA 2WWMD 5BVJA 4R4NC 5I8OL 2AK4B 2DBLH 3UBXG 2AJ3A 4NRYA 2X89D 1YQVH 3P4NA 4GQ9L 4L4VB 4RISL 4HK3J 2VO5A 4YXHL 3BSZL 5JQ6H 4DN4L 2YBRA 3QUMA 2FYYA 1F8TH 1I7RA 3FQWA 1C16A 2BVOB 4PJ9A 4RFNB 2GY7B 1ADQA 4G8IA 4JN2B 4D94A 1UEMA 3IDIB 2XTJE 1KJ3H 5EUOB 5EU4B 5HI5C 4RGNB 4K3EL 2WLZA 3MGTB 3VCLA 4AK1A 2QKIA 4Q74A 3DX9B 5EORH 5BV7C 3O6LH 2ZKHH 1JZ5A 1WZ1H 4CVZA 1UC6A 4OGAC 2CUIA 2R1YA 4JFEA 3V7AE 2IC2A 1W0VA 1GGCH 2CQVA 4FQCH 3IKCA 1R3LB 3ABZA 1DQJA 3D6GA 4MNQE 3TC9A 4QYOA 5EU3A 4AENA 2HLFD 4Q7DA 5KZCB 4PJHE 2E8ZA 3QDGE 4OLUH 3KXFD 4NDMA 3BZ4A 2DI7A 4U1KA 2NY0B 4JKMA 3VFPA 1U6AH 4FP8L 1NGYB 3PL6A 4M7KH 4ODUB 1Q94B 1A14H 5D1QB 4WCYH 3WLBB 1NUDA 3B9DA 4MXWH 4NFCA 1MHEB 3C8KA 3MBED 4EVNA 5A2LH 3KPMA 5B4MC 1OB1B 3C5SA 4ODVL 5I2IB 3VG9B 3BJ91 5BXFB 3QIUC 5F97E 3T77B 1VEPA 4XZUB 1CI5A 1JN6B 4YDKH 5TE6L 4G6MH 2J5LB 2CJUL 1XCTA 1QVOB 4K9EL 1XGYL 4X83A 4PD4J 1LEKA 1NEZB 4PP1C 3LQZB 1A6WH 4YXLL 4JRYE 4JGJA 3BEWB 3BUTA 4W6XB 4HV8B 5JW4M 4HQQL 2VXTL 2YEZA 3U36A 1P4LA 1CXHA 4PRHA 3QWOB 5FGSA 1F58L 1GSMA 1G1YA 3F12B 1IGYA 1NGPH 5ETUA 3UTTB 5D7LA 5MERB 5AUMA 3TJEL 1MCWW 1V7ML 4DN3L 3OJ2C 5ITBL 3DIFA 5DXWA 1JRHI 1T83C 5HI4C 1IKFH 35C8H 3IETA 3SQOH 3HC3L 3SN6N 1DUYB 1I7TB 3GMOA 2VXQL 2H9GB 4UOJA 1T1WB 2NXZB 3EKCA 1MPAH 1L7TL 2ADJA 4FN0A 4MJIE 5C2UB 3PG2A 2GTWB 4HUUA 5I66B 1RUMH 5DUBB 2YKLH 4XRCB 4XWOC 3U7AA 3KYMA 4M1CC 4OFIA 1U8LB 3GI8H 1HH6B 5BZDA 2F58H 4TSCH 2PYEB 2YD6A 1NC4A 4LDEB 4Z7WF 3ELAT 3T65A 1RFDH 3I84A 3HE7B 4NC2B 4ZODA 5DD5L 3BKJL 5IW6A 4NHCH 2EEBA 4X6DF 3I75B 1GIGL 3S37H 1ORQB 2GI7A 3BD3A 2CLZA 1WFUA 2QADB 5TDNB 5B21A 2QHRL 1RU9H 4OZHF 3FN3A 2G2RA 3AXLB 4JPWH 4U2ZA 4F80A 3P0YL 3F7QA 2FL5A 1NAMB 3PUCA 2IH3A 1ZLSH 3PJSA 1DFBH 2P5WD 5DF0A 1C08A 3O6FB 2QSCH 4P4KD 4X98B 3U7WH 3P3YA 2HFEA 4LHQB 4LQFL 3OHXA 4KDVA 3TWCH 4FQHB 3SE3A 2CR6A 2EE3A 1QSFA 4JQVC 2BNUB 3D9AL 4JO3L 2OTUA 3FTGB 1I7ZB 1LP9A 4YJZL 2XV6B 5SWZB 1F4HA 2VLKB 1CG9A 2APVA 4AH2B 1I9RL 5CD5C 3G08B 3PWPB 3MR9B 3QUYB 1IEAA 3B2UD 1H0DA 3AS1A 1X5XA 1PLGH 2AK4E 4XVSL 1MEXL 32C2A 1OSZA 2FHCA 4Z7VF 5ALCH 5DYOB 3TA3C 3MV01 4EEEA 4JCMA 1YEIH 3IF1A 4QXTB 4R26L 3JVGC 3VDCA 2O61B 3QBTB 1VADA 4JDTL 3BKML 2DJ4A 4AYFA 5J13B 2R8SH 4R2GB 1FPTH 1U58B 2VISA 1D5XB 3HMWH 3BGFC 3BP5B 3EJYC 4FMFA 4OJFH 4YX2H 3GRWH 2VDNL 1AGEB 2A6JA 2DMCA 1AR1D 2XPGB 1C12B 5JR1H 4CDGC 5HYJB 3AMLA 4QCIA 4NGHH 3C87A 3PWUB 1GGTA 3BMWA 5HHQB 2HRLA 1EZVX 1K6QL 5DJXA 3V6BR 4NJ9H 1QPXA 1X5ZA 4XTRC 3U30C 4HKXB 1RK1B 5DMGC 2BDNL 4JDZA 1TJHH 4JEGB 2W07A 1NMAL 1FE8L 4I2XE 1ORSA 3TF7C 4LLWB 1UKQA 3N9GH 4QOKD 3GSVA 2M1KA 4GAJH 5EU6A 1T20B 2BY1A 2Y25A 3E6FA 3TA3A 2Z35B 4Z8FH 3BN9C 4JB9H 4P5TB 1D5ZA 5HTSA 5DVKA 3LRSB 3U36B 1TJHL 4OIBA 4AT6B 1T7WA 3PXJA 4HK0B 4NUGL 3TBVB 1IE5A 4OT1H 1HXYB 2EXYC 4HXAH 2GW5A 4PLJD 1TITA 4TUJA 5F7NC 1PY9A 1EHLH 1BGXH 4HAFA 4NRZA 4JHWL 5DEGB 3KWWB 5CEZL 1SM3L 3LHPH 2R69L 5E8PA 4R4FL 3U0WH 3VXMD 3FO2B 1CGXA 4M5YL 4IOFD 2BNQE 3NFNB 4AG4H 1X44A 2KQMA 4MD0A 3FONB 5F9WC 1A0QL 1SM3H 2ZOKA 4NQDB 5FA3B 3ZKSD 1YYLL 4KVNL 4EN3C 3ARFA 1CICB 2GAZA 3QIWB 1BQLH 4CVXA 3GKZA 2PKDA 4V1DD 1F97A 4BA8A 2R56L 3WD5L 1UJ3A 1A9EB 4PGCB 5ESAB 5K59F 1NCDL 1VEMA 1KCUL 3GMPA 4KDTC 5T3XL 3LB6C 1LO5B 3BX7C 2HJFB 1R3JB 2WIIB 5IROA 3X3GL 2GJ6B 3HC0B 5D96B 4DTGH 4NC1C 4GSDH 3HFMH 4FZ8L 5BS0D 3KYKH 2MCPL 1AJ7L 3DWTA 3F5WB 4KK9C 2P7TB 4WY7H 5B38A 2QSTA 4ALAL 5LGKA 3MGOB 3D2UA 3EO1A 3SDAD 2FO1A 4Y5VC 1QBLH 1A6UL 1I3GH 5D72L 4LSVH 1JPGA 2FECL 3DO7B 4QXUH 1JF5A 2IAMB 1PEZA 2IGFH 4RMRA 2I07A 1IC4H 5BS0A 1CBVH 1CL7H 2E7LA 3DVNB 5IIEB 1MCOL 2YD2A 3WUWA 3ARGD 3BISA 4GAJL 5KS9F 2MKLC 2UZIH 4KK6D 3N1MC 1NPUA 4JO2H 5E2UL 1OARL 4ZUUB 3BP6B 4FQ1H 2YD8A 4HWBA 4ZAKA 4R7DA 1AQKH 4KAQL 3GMQB 2I26N 2VZTA 2VL5B 5GGSB 4HXBL 3AM8A 3MUY1 5AZ2L 2V2WA 2V5YA 3Q0HA 1TFHA 1T0MB 4HJJH 2G5RA 3WD5H 4LRIC 3B2UC 1UKTA 1RK0B 3MRKA 2ED8A 4LHUG 3CFIC 1NJ9A 2EE2A 3IJHA 3D39A 3O2DA 3T2PA 1F2XK 3O11B 4OKVA 1JPFB 4J7RA 3G6AA 1A3RL 5T3ZE 1H15B 4Y5VB 4P5KB 4OCSH 1UEYA 3O2WH 4NBYB 2YPLA 1XGRA 3SKNB 4YEFA 4QRRA 1ORSB 1OAUH 3RWDA 2W92A 2Q1EA 3FFDA 4N0FA 4JDZB 1HIML 5JDSA 1NGWB 3W2DH 2FZ3B 4PIRF 3ZDZF 1E6OL 2AKRB 2VRAA 4XI5C 1K85A 1S7WA 4YR6A 3QEQA 3SDCA 5LAXB 4LCWB 5IBUG 3EIFA 3L6FB 3NFPB 4FQIH 5C6WH 1DL7H 4YGVB 3AM8C 1QQDB 4FNLL 2VZ3A 3ALWA 3QHTC 1UA6H 4PUBH 2EEAA 4YHLL 1EO7A 3MLSH 1TJIH 5I30H 2D7QA 1HSBB 1UH4A 4RMWA 5MEPA 1MLCB 3SGEI 4XPTL 4NSKA 1PQZA 4KPHH 5AWNH 1YY9C 5HHVL 1VSCA 3S3JA 3D39B 1BD2B 1INDL 3MREA 1AJ7H 5FFLA 3HA0A 3VFRB 5D7JC 3UMTA 5IVXB 2UYLA 2EXYD 1AGBB 3S98A 1Q8MA 1JHKL 3P40A 2VXSH 3G9AB 4WWKA 5AZ2H 5A16A 4U49A 5EC1A 2CRMA 2FRGP 3VXSB 5IMLA 2XY1A 2ZCHH 4C59B 4JVWA 5MENE 3OSKA 4LVOB 3PP4L 3ULVE 4WU5A 4EUPB 2OMBA 1HH9B 2ICWA 4H8WL 5EUOF 5F96H 2LTQB 5IMLB 3V6OA 1WITA 4LSQH 2A73A 2YRPA 5J1AB 3FN9A 1BECA 4DGYL 3RZCA 3D0VA 2CIKA 4PJDE 5EUKB 1I1AD 2JB6A 3CVHA 3MA9L 5F9OL 2QADD 5SWZD 3WJLC 1BD2A 3MREB 3O2DL 4HX1B 4LCUA 5FUCE 3SO3C 2I24N 4QRPA 3HCVA 5DJ6B 2XXMB 3Q5YA 1UQSA 1WCQA 1HINL 3V4PL 4L4VD 4LP4A 2Z9TA 5DUPH 5LGJA 4PRDA 4LCIH 3ULUL 3OGOE 2MPAH 1KPRA 2O5ZH 1QA9A 3WN5B 4KMLB 1RAMA 4KK5C 5ERWB 1EGJH 4ZOEA 4TNWF 4UIMB 1CFTA 2HFTA 1MNUL 3TYGH 4WHYH 3MC0A 2ICEA 3TM6A 5LGHL 4S11A 3QG7H 1MHCB 2AQ2A 3EUUA 5EBWA 4F15B 5J12C 2GY5A 5CJ5A 1YEHL 3QNYB 1WFOA 5DJYA 4YHYB 4KRNA 4J8RB 4R8WL 4XCCH 3SY0B 4P2OA 4AJ0A 3OV6A 25C8H 3MBXH 2AJZB 3I9GH 3H9HA 1S5HA 5IGXH 5EZOL 1MELA 4YFLI 3U4BL 4EUPA 2VR4A 1BM3H 3QIWD 4ZFFA 3TWCL 4Z7OE 4JR9H 1QFOA 3LS5H 3HRPA 2ZPKL 4J4PC 4TSAL 2LU4A 3K8MA 4TVPL 2MKWA 2VLME 1VB9A 1RVFL 5I15L 3BHBB 2IMMA 4GRLC 3VFSA 4XPFH 1HWGB 3NACH 4OSUH 4M3JA 4TUKL 1UWXK 5AYUL 3FCTA 2ITDA 4B41A 5I17B 2XZCL 3BI9X 1IAOB 2LFGA 2G60L 4YQXL 1J8HA 3Q6GL 3QZWA 2ITDB 4S1QL 5I17A 4JG0H 5H35B 4LCWD 3D0LA 2YMXH 1OP3H 1CD8A 1LHZA 1HDMA 1MRDL 2BHUA 2R15A 3U2SA 1HKLH 3FL7A 1B0GB 2Z8WC 4FQXD 1PBYA 3SCMD 4OJFL 4YX2L 1WLHA 1JZ4A 2DLEA 1P7KB 3C08L 1JPSH 4N0UE 1RZJL 4UU9A 4LCWA 5T1MA 2FEEI 3T0DA 1KJVA 3SDCB 4N8VB 1N4XH 2JKXA 4JN1L 5E03A 1RUML 2HJKB 5BV7B 1GJIA 4QRPE 2I5YH 2Q86A 1RJCA 3F6LA 4NDMB 3IJYA 4RMSA 2V17L 4ZTPL 1BFOB 3IAPA 2X5PA 5T5FH 3HI5L 5KSBF 5CILH 1WGOA 4Z7WA 3FQUA 1DUZB 5GS0L 5IB5B 4TPRL 1JNHB 4FQXB 4O51B 4HUXA 3LKOA 4OD3L 2P46B 1ZA6A 4Q9RH 1WFNA 2ZUSA 3BT2H 4I0PA 4NNPH 5TF1H 2NXZC 4O5LL 3DETC 3SKMB 1FO0A 1JUFB 3CDFA 3KPPA 2CKBB 2APXA 4TNVF 3ZYZA 1IGMH 1BQSA 5EU4A 1WF5A 2F53B 1ZLSL 4HIEB 4JO4L 2WUCL 5F7EL 2VL5A 2XACC 1M71A 5GGQH 2ZOKB 4NQDA 5AYUH 5F9AC 3MR9A 2IBZX 4XPBH 2ZSWA 5FO9B 2DDQH 3P30H 4IBLT 1NFIA 5IOPB 4OCRH 1LP9B 3QIUB 4Y19D 1RV6X 2D3VA 2XWTA 5L6YH 2X9XA 3QJFA 2DM7A 1XGPA 4R4FH 1X4ZA 1RMFH 5BVJB 4XCEB 5HHPA 1HHJB 1S8DA 2DQCH 1CR9L 5DGQA 4WTXA 4FG6C 3OR6A 3LQAC 1XMWA 2ZUXA 3JWOH 4YHKL 5HDLA 4PLKC 4KTDH 2DQIL 2JJVA 5I1DA 1V7NL 1QFWL 3B9KD 2XG5A 3GJFH 4F8TA 4G8GA 2V17H 1RZKH 4MQSB 5C0FB 5EPMA 4PJFB 4H1LB 1HYRC 3HRZB 5C09D 1IL1B 5GSRB 4LHUB 4L3EE 1RZGB 2YMXL 5CMAB 5FYKU 3GM0A 4APQA 5DTFB 4YXHH 4LMQI 4R96A 2VXVL 4NO2A 3FMGH 4PJ8B 3U48A 3WO4B 3WYRA 1R3JA 3GGWA 3GZKA 3GMPB 5K9KA 3L7FA 4YGVA 4RGMB 3DRQA 2J6EH 5HGAB 4HS8L 5HI4D 3T3MF 4ZUSB 4KDWA 4HKJB 3X12B 2HJKA 1VESA 3SJVD 2MTPA 5DQDH 1CFVH 3TO4B 4GH7B 2Y36H 2H9GA 3W0WB 3STZA 3ULSB 2ZCLH 4MS8C 4PJAE 4I1NB 3LEYH 5TFSL 1LK2A 2BMKA 3DVGB 3FOLB 3P0VL 4IMLA 4Q2ZA 1UXSA 3TNMB 1GZQA 2DQHL 2VLJD 2PYED 3MRNB 4MCYA 5KBNC 3C6LD 3HLAA 4KMTH 1BQHA 4LLUA 4PJFA 1Q9LB 3O3BB 5I1EL 4WUUA 4CU6A 5K33A 4PY7A 2NX5E 5CP7A 2GEEA 3BEWA 2EIDA 4JO3H 1MWAH 4TUOA 3TH2T 1MRFL 3ZDXF 5IUSA 3RAJL 1LEKB 1L9NA 1V7NH 4ONFH 4HDIA 5SWQA 1H3TA 4BSVA 5DSCB 4WI9A 1FL6A 1FNGB 2F8VA 4H26A 3WXWL 3BP6A 4OLYL 3BQUB 1MCSA 5E08H 2QQKH 1UH3A 3ESUF 4TN9A 1Y0LA 5ALCL 2V7HA 3SDDA 5INDB 2W65A 1VFUA 3D87B 3QDMD 3S35L 2WK2A 4Z0XB 4OF8A 4F7CB 2E27L 1TENA 2EDQA 4WENB 3AXLA 3V4VH 3SDAA 1B9ZA 1RUAL 1W72L 5JIPA 1XGUB 1P69B 3EO0B 4OAWA 3V0WL 1RJYB 1TXKA 1Q94A 2ITCB 2NXYC 1HHIB 2BOCA 3MUGB 4XMPH 3WFHA 5AAWA 2DJUA 5F89B 1J18A 2YD5A 1FGVH 1NBYA 2EDHA 1N2RA 4GQPH 3ALPA 2VDML 4NC0B 4UQ3A 3CLEL 3QUYD 4F7TA 1EBPA 1QLRA 5FOBA 5DRNB 1SEBA 4NJ9L 1NUGA 1NC4B 1M7XA 3RWJA 2J8UB 4TQEL 1LNUB 1QLRB 5FOBB 3GSXA 2YPVL 4X4MA 1EAPA 2XFXA 5B22A 5KSBB 4MD5B 1OTUD 1UWGL 5F71A 1KFAL 1LE9A 1J1OL 2IQ9L 4Z0BH 4J23A 1RZ8B 4DZBB 5B39G 4GAFB 4PGEA 1I1AB 5J1SC 3QUYA 1BFOA 5FGBC 8FABB 4NOBA 4LVNB 4KROD 5E6IB 3ORJA 3ZTNH 4I4WB 3N85L 3BPOC 3CH8A 4NGHL 3CFJB 4ZUTA 1Q9KA 4P3WA 1KFAH 3FFCB 5DZNA 2JELL 5KS9A 1FH5H 1SQ2N 1LDSA 1IGYB 4RFEB 4TSCL 1BGXL 4OF6A 5EOQL 5T1LD 5HI3C 1UACL 3V8CA 1E27B 5C0JA 2VL4A 5IESL 3LEYL 4O02H 3L3GB 1QLFA 3VXSA 3A6BH 5JOEA 1BZQK 3DECA 3BP4A 3CXDL 5D7IB 4UINL 1HK6A 4NM4H 4X5LA 1JPST 4M3KB 5IFAH 1N0XL 5EBMA 4BKLB 1G9MH 3S96B 1JYVA 1NFKA 3O3BA 3EFFB 1KF9B 3L5HA 3MRBB 1HKFA 4X6DE 4BKLA 1BQHB 4LLUB 4KJQC 3O2DH 5CP3A 5IJKC 3WJLA 4NQSA 1QBML 2R9HD 3CAFA 4MJ5B 3V4PH 5C6TL 4R4BB 4AT6A 3DUSB 5DWUH 5HY9B 1F6LL 5TGBA 3RPIB 3W0WA 3MRJA 5I0DA 2JCCA 4OCMC 1W72A 2O5ZL 3L6FA 3NFPA 4PRHE 2AJZA 3U79A 3RUGE 1SY6A 4PTUA 3ZKXC 4KRPB 4PG9B 2C5DC 4XC1H 1RHFA 4C83B 2DOCA 4LQ1A 4OZFB 4MZ2A 4FZ8H 5GPRA 2UZXB 4R0LC 3L3HA 4XBGB 3V0WH 2DTMH 2V5SA 4I18A 1T2JA 5IQ7L 3VI3E 5F3HA 5I30L 4F7PB 3ET9F 3WJJA 3GMMB 1RY7B 4Y1AE 3PV6A 3PWNB 5GGVY 1H15A 3ARZA 4ZS6D 4JFDA 3PGCA 4P9HH 3RWJB 3H3BC 3DX9A 2ADGA 3D3VB 2DYPD 4UIKL 3QXUA 2P24A 3LS5L 4QF1A 2NY3C 5CZKA 3RVTC 5IB2A 3R4DA 4RZCA 2YS4A 4M6NH 4NIKB 5CHNA 1WJ3A 3MCKB 4Z7UA 5FV1L 1T22B 1XZ0A 4QRSA 2CGRL 2NY6D 1ZGLB 1NFDA 1YN6B 5E2UH 4JQXC 1LEIB 4LDLB 4JFFB 1KLGA 5HHPB 1CGTA 3GJEA 5I8KL 3WFCL 4OTXH 4K3JL 5F1KC 3I50L 3L5WB 3MOQA 2IAMD 3MUHL 3L3GA 1Y6MR 1NL0L 4NZUH 3L5JA 3RKPA 3VWKA 1Q9WB 1UACH 1E27A 4OZGE 3RL1A 5C0JB 3ULUE 1GVIA 1EGJA 3U6RA 3UO1H 4UB0H 5DD6B 4EBQL 4RFEA 1CD1A 3A6OA 1A6AB 2ZUWA 3PL6B 2WIMA 5IFJB 2NR6D 4TUOB 1X6NA 2A77L 3ARUA 4LPWA 1FYTB 1RI8A 1S3KL 2NYYD 1TVHB 4FQJL 1WZLA 4IJ3C 1BBDL 3D3VA 1KIPA 1OOAA 1S78D 1VFMA 5C0BE 2CLZB 1I1AA 4WTZG 2NZ9C 2EICA 3VMPA 1DSFH 1U8QA 1MY7A 3I75A 3PV6B 3KVQA 5ESVA 3DHMA 3CJJA 1NCBL 3SO5A 3FOLA 2H2PC 3ISWA 5I6XC 1LO5A 3SBWA 4URTB 3MODH 1G7IB 4V1DB 4HFWB 4OZFA 3MUZ1 3U4EB 2ZG3A 5IHBA 2EDRA 5I76A 1TIUA 2JIXD 5D5MF 3U30B 3MRRB 4WRLA 1CDYA 4HT1H 1GRWA 1R0AH 4I9WD 3MRMB 3MRCB 5TE4H 1S9VB 5GGTA 1VGEL 3NA9H 1BHGA 1RJZB 5DO2C 2Z8VC 3GJFA 5JPNA 1YEKH 1XGRB 43C9A 4HUMB 3EOAB 2R2HB 1KJ2H 1AHWA 5I0ZA 3D0LB 2WMPA 1IL1A 5GSRA 2WUBH 4ELMB 5LKNA 2YZ1A 4GW4A 4YDKL 3MRBA 3MO1B 4NKQB 1G9NL 1KG0B 1WIPA 5DSCA 4BSVB 3HPJA 1JI1A 1IGIH 4H8WH 4WJ5B 4RGNC 5MEND 4PLKD 4M1GL 1L7IL 5IV2A 1UXWB 1DANU 2QQQA 5KSAB 4R7NB 1MIMH 4MHHI 1MREL 3GHEH 2IJ0C 4APQD 3NZHL 4KHTH 3RWEB 2IPTH 1DN2A 5IB4B 3QFDA 1K2DA 2OR7A 3FB5B 2Q8BH 3BDXA 4Y88A 5CSGA 5BQ7A 4XMLL 2AXFB 2ZOLA 5DFWH 3TN0D 4D2NA 1HNFA 4KI5F 4QHMB 1X6LA 3DV6A 1OT1A 3FQXA 4KKAD 4KAQH 1WZKA 4WV1B 5KVFL 1FP5A 4HIEA 2PTVA 3MYJB 1D3CA 2W60A 1A4KB 3BDBA 1EO8H 3SE9L 3QB7C 1QA9B 4XX1G 3WN5A 3DXAE 3MACL 1KT2A 4JG1H 3B4NA 2O5XH 5F7LB 1QSED 3O2VL 1PZ5A 3UJTH 3MNWA 3HE7C 3DRTA 1A47A 3BQUD 3ULVH 5IM7A 2MCG1 4HWBH 4M7ZC 1YC8A 2O61A 3EDFA 4EI5A 4MNQA 4JRXD 3BH9A 1H0DB 2HJFA 2BFVH 5K9OA 2CK0H 4MQXC 4PFEA 5I1JL 4R0LB 3DROB 5DJ0B 3UTZA 4MA1B 2DQUH 4OIIL 3IJYB 5DUMH 4N9OB 4FQCL 4G8GB 1RZ7H 3TVMC 1M6OA 1CICA 5IFJA 2Y5TB 2R2CA 2BFVL 4P2RE 4XBEH 4L3AA 3VRIB 1T3FA <