4UIMA

Crystal structure of quinine-dependent fab 314.3
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
224
structure length
224
Chain Sequence
EVQLQQSGTVLARPGASVKMSCEASGYTFTSYWMHWLKKRPGQGLEWIGTIYPGNSDSSYNQRFKGKAKLTAVTSTSTAYMELSSLTNEDSAVYYCTRERGLYYGGRSFDYWGQGTTLTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLESDLYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
molecule keywords FAB 314.3
total genus 36
structure length 224
sequence length 224
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimA02
3BVNA 5BV7L 5GSVB 2DTSA 4KRPC 5A2LH 3OB0K 2AW2A 3WIIH 4JFOA 2FHBA 5J06A 4K23L 3ZHLA 4F33B 3B83A 4WI3A 3ZDXE 2YPKB 3MRIB 1P9MA 1QLFB 1TXKA 1DBMH 2AJXL 1MFCL 1ZWIA 2NLJA 2WP3T 4MS8D 5ID1B 4FFYL 3N9GL 2OTWA 3OXSB 1Q1JL 5L2KD 5L88L 5DRWA 3SDDB 2WP3O 5D1ZB 1SVZA 1A6AA 3I6GA 2OXHA 5C0ND 5L2JA 1I8KA 5ICZB 2BOCA 4Y4KD 4TRPH 3ARVA 2V7HB 5JQ6L 1RIUL 5EORH 3CC5B 3DRQA 5JO5B 4E42A 3QDJB 4L4TB 4PGCA 4KJWD 4RAUB 3NFPA 3QUZC 5DD0H 3MJ8B 5T1KD 3RKDC 2R2HA 1NH6A 2BVUA 2P5EE 1LO5A 3DVFA 4LAQH 4Z78B 4MA7L 4OCYL 3TF7C 4KXZI 1YUHA 2E7MA 1NEZB 4NP4L 5T1DL 5I16A 3QXAB 3NN8B 4WNQA 4OD2A 4PBVC 1T7WA 4KJPC 4OZFA 3VFMB 3GHBL 2ESVA 4J6RH 1CTOA 1N4XL 1NDGA 4LDEB 4QOKD 5L6YH 4UU9A 5ISZD 3QDME 2DKMA 3KPLA 4ZFOA 1PEWA 4Y19B 5MP6H 3KJ6L 1YQVL 3DX6B 4IDJL 3HZKA 3JWOC 4TNVF 3I84A 3Q5OA 5E8EA 4F8TA 3T0DA 1FGNH 2ZSVB 3BGMA 4ZUVB 3HI6L 5I8KH 4JPIA 4P46C 4L4TA 5IW6A 3O6FA 3W2DH 2Y7QA 4I0PC 4MZ3A 3D25B 4POZC 1PKQA 2F54B 3ZKSD 1UFUA 1J1OH 1SY6H 3FT3A 2N4IA 4JFFA 3NIFF 4NWTH 2DL2A 2KZ1B 3UJJL 3E2HB 1S7SA 1KPVB 4K94H 5C0AD 2R9HD 2FECI 2FLRT 5DK0A 1FYTD 2OJEB 3VA2C 3MBEC 4JHWL 4NKMB 3A6BH 4WJ5A 1A02N 3FQUB 3B9AA 3CVIH 2P47B 4F3FB 4FFWD 3UTPE 3O2VL 3THMH 1XH3B 8FABB 2Q8BL 3TO2A 4WJ5B 4UDTA 4TVPL 2NY5L 1HE7A 1XR8A 4XBEL 1GVIA 4N8VG 5SV3A 1IM9A 1MFEH 4PJDE 3U4BH 2DQGH 4GRWH 2N56A 4ORGA 1H15B 1QBBA 1BEYH 1P7QD 2NY6D 4XCNB 3OTTA 1IGTB 4V1DB 5ETUB 1AHWC 1FCCA 1G0XA 4XNUL 2NLJB 4G9FD 3TNNA 4G8GD 4GXVH 3V2AR 3NCJH 3CCHA 3AU1A 1XGRB 5AG9A 4Y1AA 1U3HC 1AQDA 4PJ9D 5DJ2B 3CLFL 3O6FB 2Z93A 2VL5B 4JAMB 5DRNA 3ARED 2BVEA 1G1CA 2ZCLL 4BUGA 2N1KA 4P4KD 5FYJD 4M4RA 1U3JA 1FZJB 2YD4A 1WF5A 2FJHB 5E6IC 5IOPA 5DJ6A 1J0YA 4Z7UA 3EFDH 3TIDB 4JFDE 5CGYD 3VE0B 1FG2A 3MJ8A 3FAXA 3CMGA 4P5TD 5K33A 4HPOL 4XNYL 1ULVA 3T0XA 5HGAB 4XPTH 2VZTA 3E8UL 3B3IA 2Q87A 1A4JB 1D5IH 2I26N 3D0LA 1YUHB 4UQ2B 3BH8A 4BSVB 5MENA 1IC5L 2AABH 4Z7WA 2NY5C 5T3XE 2D7QA 2XWBA 4NKQB 3X14B 5CD5C 2R15A 3L5XH 4I18B 2LAAA 2RIKA 3FQRB 1RIVL 4P5MB 3L3HA 4UILH 2E27L 1T03L 1OTSC 4D3CH 1J1XH 4NQVB 3A6BL 3CFCH 1UEMA 2EDQA 2M26A 2D7TL 4BFEA 2OTUB 4RGMB 1CXFA 2VJXA 4WFGE 4X4ME 5TJWK 1RULH 5BRZD 3HMXA 2IMNA 5IVXF 5EUOA 1A7PL 3ECBA 4EJ1C 2D7PA 1U3HB 4NM4L 5FGSA 5DVMA 3PQYA 3U4EB 5C2BH 3VD9A 1M7XA 1UH3A 2DTMH 1IC4H 4NC2B 4BH7A 1EVUA 2DBLH 2FX9L 2LVEA 3H9SE 4K7PH 2IF7A 2DLGA 5GRUH 1H5BA 2MJWA 4KKAD 1MCQA 4R90H 5IFHL 1I7RA 4Y4FB 5M7QA 5AUMB 3PP4H 1F58L 4OCLC 2HJFB 1JHLH 3A6CH 2R39A 2JCCF 3KPSD 4EUPA 2E9JA 4ZUSB 2Q6WA 3O6FC 3L1OL 3PGFL 3R0MA 2PUQT 2G9HA 4WV1A 3SGJC 5C7XH 3TV3H 2DM2A 1NGQL 2V17L 1MJ7L 1QBMH 4PJDF 2G2RB 4UV4H 1FVEA 3LIZH 3GMNB 2QQNH 1RIHH 1OGAE 1GRWA 2MOVA 4RMVA 4RWHA 2DI7A 3IFNH 3DGGA 4V1DA 1R5WB 2D0FA 1QACA 3NCBB 1KTDA 2VABA 4Z7VB 4WUUD 4XP1H 5D71H 1QG3A 4NQDB 1U0QA 4PJ8A 4M3KB 1VFAA 5DJAB 3QYCA 1IL1B 1XGUA 2EXYD 3U0TB 3VI4E 2IALB 1CLYL 3FRUA 3S35L 3LKQA 2HRPH 4RA0C 1I7ZA 5H2BA 1NC2A 4Z7QE 1D6EB 3JXAA 5IB5B 1CI5A 3GMPB 5GJTH 1HHGA 1YEFH 5KANG 4LOUD 3EKCA 1FNSL 3LPGA 3S8WA 1LO2L 4IRJD 1GGBH 4NZUL 1A9EA 2FDBP 2I9LB 3RL1B 1MQKL 5JZ7C 5CIPA 5DQ9A 4NUGL 5BVJA 4P57B 5ALBL 4NKIH 1N3NB 5IM7A 4HZAA 4ZXBD 4NO5B 3VXUD 5AG8A 1EAJA 3U0PB 1T83C 3I6KA 4JFEB 1T22A 2H9GA 4NQCE 2ORBL 5ABDE 3GIZL 4LCCB 3LN4A 2R2HB 4A2LA 1FZKA 2HAZA 3L3DB 4YBLB 5HGHB 1Q9KA 1NMBH 3VFTB 1G7LB 3MYZA 2PYEB 1G7QA 4NKDB 1OAZL 2VOTA 4J4PC 4IRSC 4ZD3H 3F8UB 2FHCA 3RL2A 5FECB 4Y4KA 1UCBH 2VDRL 2C1OA 5IQ7H 3SE9H 2BZDA 3KDMB 4D9QD 4QRPB 3QCVH 1MRFL 3GMMB 4J23A 3VXOA 3ZSTA 4NN5C 4NT6A 4U7SA 3RHWK 4O02H 5BRZB 1AQDB 3SY0A 3TBYA 1OGTB 1FYTA 3MMEB 4IIQC 1ZVSA 1WFOA 1X6NA 5D2NB 5FA3A 3ULUC 4ONGH 4XMLL 2PYFB 2AGJH 1ED3A 3C5ZA 1P7KB 3L3OA 5AYUH 5C9KA 2DL9A 2ADFH 2F19H 4LIQL 3RA7L 4JDTL 4DUWA 1QR1B 2FX8L 4XVTH 5IOPB 4H88H 3SE4C 1ZLSH 3LMJH 1QO3B 1QUNA 3RZCB 5I9QB 1TVBA 3WIIL 4WHCA 4M43L 1R3JB 4ZPVB 5DVOA 2JJVA 1T2JA 3IGAA 1LILA 3IFPB 1GZPA 2X4UA 5E6ZA 4HW6A 4LBEA 5D7SL 3KDMA 1RAMA 1ETZA 2D7OA 4QRQB 5JW4N 1CLCA 3EO9H 4HWZB 5IM7B 3SO3B 5F3BB 4AEHH 2Z4QB 1I8IA 5C71A 1MQ8A 3QA3A 4IRJC 4MQXC 5I1AA 2F54E 3BPLB 1W0YT 2V9RA 2AJXH 5D1ZD 4YBQC 1QLFA 1U8PA 2GTWA 2QSTA 3E6FB 4HT1H 3O4LD 3R06B 4U6TA 2HWZL 1JPGA 4Y5XA 5D1XC 3SO3C 1DANT 1XH3A 1KPVA 3GSXB 3H9HB 4BKLA 4PTUB 4H26B 1IAIM 4EBQH 5F7LB 4R4FH 2OR7A 2C1OB 3FHQA 3MX0A 2IALA 1FRGH 4UAOB 4YHIB 2IH1A 2VLRE 4XPTL 2PO6A 4FG6C 4GMTH 1JZ6A 1E27B 4JN1H 4JRYE 5LGHL 1S9KC 3QDJA 5JR1H 1OAQH 1ORSB 2WV3A 2E3VA 5B3JE 5IW1A 1QLRA 2ZCHL 1I8KB 3FZUD 3OGOE 3Q6GH 3V0AC 3QIBD 3TVMD 3OAZH 4G6ML 4IDJH 5CGMA 3DWTA 1FL6B 3BX7C 4K71B 4RFOL 2A6IA 2X9YA 4DTGL 1WQVT 3LRHA 2EO1A 4N1EA 1OP3K 5HYSB 1DCLA 4YK4C 1DZBA 2A1WL 2ZOKA 3QRGH 3EO1A 3EYUH 5GRJH 5T5FL 4L4JA 3ZTJG 2IFFH 4L5FH 3P0VH 2LU3A 1TFHA 2FWOA 2VXVH 2CPCA 1K9TA 3EDKA 3OKEA 5BW7A 3B9KA 1UQSB 2IG2L 3RUGF 3SOBH 3UJIL 4P2RA 2AK4A 5C09B 4L3EB 1F2XK 4FP8H 1Q38A 1HHJA 3P4LA 4JFDB 2CDGB 3MV8D 2H2SC 4Z8FL 3WO4B 4GS7B 1EO7A 1F4AA 4PRDB 4HUVB 2FZ3A 1KPRB 3GGWA 4YO0B 4NQXA 5EIIB 4PP1C 3RJQB 2CJUH 2NMSA 2YPLD 1CN4A 4MXQC 4R26L 2A83B 3GNMH 4QGTA 3U36A 4G9DB 1UZ8B 2NX5B 1OOAA 4K3DL 5AD0A 3MV8E 5TE6H 3RX5A 4PJCF 2AAVA 3QI9C 5IHUL 1RZKH 1EBAA 3LV3B 4MQSB 3RIFF 4Q0XH 1LEKB 4M61A 3CXDL 3ES6A 3M8OH 3W5NA 1CIUA 2I24N 1I1FB 5L2KE 1A7RL 4XBPB 3VWJD 4B5EA 5L0QC 4P57A 3FQXA 4KKLC 1IGFH 2WLYA 4J1UA 2FYYA 3SJVB 4ZD3L 4LKXA 1N6QL 2ZCKL 5EA0L 2PW1A 2BDNH 4AENB 3WIHA 4YUEH 4RAVA 3W9EA 5IVNA 4O4YH 1XFPA 1S9YA 5DJDB 1PAMA 4F9PC 2MCG1 1FV1A 4PJEF 4CW1A 3OAYK 3QUXA 1PG7H 3N50A 3VGAC 2ZUWA 4FQ2H 3S88H 2R0KL 1KJ3L 4YWGL 4KK5D 4P3CH 4DN3H 3O3AA 5SWSE 3FONB 3QJHB 1JZ2A 5CJ8A 1W72A 4HGKC 4R4NC 1CDYA 5F7EL 2ZCLH 1GGBL 2WBWB 4BH7B 5HBBA 5I1HH 2Q8AL 3FB5A 1G7IA 4U1NA 5AWNH 4D0DB 5F21B 3CCHB 4HBCL 4PP2B 4ZDHA 3CD4A 2HN7A 3IYLW 2BFVL 4XP6H 2YZ8A 4YHOL 5F1NB 3OX8A 2FL5B 2KDGA 1DQDH 3TIDA 1YJDC 5D7SH 5MI0B 2DIBA 5GJSH 1IEBB 4M6NL 3D9AH 1F3DJ 2IADA 3IXAA 25C8L 4DUXA 4MQTB 2CDEA 1XIWC 3ZZ1A 1EZVX 4Z18A 3CLEH 5CFHA 5B38A 2R1XA 4JQVA 2KQNA 5HGBB 3PHSA 1BFOA 4WEMB 2UVEA 1HH9B 3JTSB 3TH4T 1DVFB 1BGXH 3SDYL 3ZTNL 1B4RA 1F4YL 3QXVA 2AXGA 4MX7B 4PG2C 5FO8B 1X5KA 3BSZL 3GSQB 1MRCL 2FATL 1XF2A 3MJGX 4JY4B 3MRHB 4QF1B 2ESVD 4HH9A 4O02L 3IDXH 4U1SB 2ZSWA 3ET9F 4PJHA 1RZJH 2B20A 4C55A 1T7ZA 3CFEA 4JZJA 1NC2D 4NQTA 1JYWA 4P5KB 1RJYB 3D2UB 2NY3C 3RFZC 4BSWB 3IDJA 4L3EA 1OGAA 2VDQH 2AK4D 3OJDA 1U8KA 3UAJD 1U6AH 3P4MB 5GRWA 2EDBA 3RNKA 3HMXL 2ESVE 4PTUA 5J1AB 1JNNL 3MXWH 4OM1L 3RWJA 4Z0BL 4NZDA 3P0GB 1HKLL 2WUCH 4NFCA 4Y2DC 3WIFB 4ZO7A 4XCFH 3K2UL 3IDIB 3BZFA 1VHPA 1XF1A 1EGJL 4N8PA 2PYED 4GOSA 2B0SL 1RJZA 1IRAY 4XC1L 1NGZB 3NZHH 5CHNA 3FO1A 4FTVE 4G9FE 1IEAA 2OX5A 2A6JB 1BZ7A 4ODTL 1XGTB 3I50L 5EFIA 3LQZA 1C16A 1KJ2B 3KS0H 2PYEE 3GI8L 2XKSA 1OWRM 3MZTA 4WUUA 4PV9A 4HT1L 3V4VH 2VUOA 1JN6A 2YUZA 4HJ0C 3S37L 2NXYD 2B1AH 3RWEA 4GQ9L 4U1JB 5E6IA 1JK8A 4UDUA 2ICWJ 1S9WA 5SWSB 4GAJL 1A1MA 1UGNA 4MDIB 2VE6A 4IJ3B 2AERT 3UDWA 4OZHF 4YNYB 4YHNB 3TESA 3WNOA 4HBCH 5KZCD 1G9MH 1J10A 2QKIA 4WDIB 2FBJH 1AP2A 5KAQG 3L5JA 3MRGA 3HS0B 3FFCA 3CFKA 3MBEA 4KGJA 1OGTA 2VZSA 4JY5H 5DK2B 2AS5M 4M9OA 4XP4H 5I8CA 1IEAB 3MLSH 3QXAA 4F58L 5ICZA 5DJ8B 3HMWL 5EU7E 4MA1B 4Y5YA 3LS5L 2F58H 5DJ0B 5JLZB 5BS0D 3HB3C 4C56E 4E42B 1IAII 1XCTA 5IR1A 3RZCA 1JGDA 4M7LH 4RAHA 5GS3A 4GRWB 3KYAA 4OZIE 1ITBB 3EDEA 3SE3A 1EO8H 2VZVA 1HQRB 1F42A 2KH2B 1NCNA 1WTGT 4WUKH 4JPVH 5LCVH 4KVCH 4QXTA 5C86A 5E94A 3UO1L 1CL7H 3IFPA 5DUML 1JNLL 4E41A 4MA7H 4OCYH 3LB6C 4G8GE 1J88A 2Y7QB 2DDQL 2WANA 5F89B 4OZ4A 3RIFK 3S97C 4Z7QF 5CJBA 1EA9C 3QXDB 5E7FA 4Y4KB 3WE6B 1U6AL 4W6YB 3QG6A 3ETBF 4IMLB 2IAMA 5J57B 4OF5A 2D7NA 5D6CA 2PR4H 3PNWA 4M6OL 2P45B 3TYGL 5HPMA 4AG4H 4Y8AA 1FBIH 2ESVB 3CFJB 1CD0A 1I8LA 3AVEA 5SX5H 5TDOB 2H9GB 5GRXG 4EI5B 4LLUA 5GSVA 5HTSA 4UINL 3SCMA 3D87B 1JRHL 1UXWA 2FB4L 4NO3B 1WJ3A 4JEGB 3MLRH 1R3IL 4DKEL 1QHPA 3BOVA 5IHZB 4PJ8B 2VXQL 4WU7A 5HVWA 1SYVA 2XPGA 1FH5H 3O41A 5FYLE 3ZL4H 2MPAL 2YKLL 3HZMA 2HFEA 2HLFD 3RUGB 1HHKA 1KBGL 2KUTA 5EIQA 1NMCB 5CMAA 5F7YC 3U7YL 4EN3D 1JNHA 1ZANH 1JYXA 3GRWL 1KTLB 3L3GA 3GMPA 4ODBD 1QSFB 3MRLB 5DRWB 4D8PB 3DXAA 4PJ8D 1A3LH 3IU4H 2XWTA 2DS4A 5HGGS 4O51A 5GGQH 3OPZH 1A9EB 1VERA 5LG1A 3ALPA 3HR6A 5K9QI 2VDPL 3K4ZA 1QBAA 1NLBL 1KPUB 4MNHB 5E9DA 4WW2A 4KH2A 1JWMB 3S36H 2XZAH 3EBAA 3RWCB 5J56B 1X6LA 2DI8A 4JGJA 1QRNA 2H32B 1MY7A 1G9NH 3SE3C 2AXFB 4DVRL 2GYSA 1BM3L 2YD5A 4QXUH 2HFFB 1J5OH 3LKSB 1EEQA 3DXAD 4JE4B 3S3PA 2EDXA 5IJVB 5DI8A 4OD1L 5FFLA 4G5ZL 3RY6C 4AJ0A 2C3XA 4ELKB 3VWJB 3EDDA 5JR1L 1PBYA 3QNZB 3S96B 4LVHC 1OSPH 2Z93B 3DUUB 3P9LB 2X5PA 2UZYB 1P84J 3RX8A 5KVMC 2WUBH 2XQBL 5IJVA 5FYKH 2OTWB 4NWUH 5ANME 1QRND 1PFCA 4ODUA 3CFBA 1M4KA 3F7PC 4KZEH 2CKBL 3VMPA 5GGRA 3F62A 1J9CT 4S1RH 4OIIH 1S7UA 1GOHA 4LVHB 4OZIF 2QLVB 5CD3A 1GZQB 5JIKA 1WITA 1YEKH 3D3VD 4BSJA 4HPYH 3R8BB 1EFQA 2R8SH 1RFDL 2MQCA 2F53D 2NYYD 1FBIL 5HPOA 3H2WA 3RWGA 3T0EE 3C08H 2YMXL 1A1NB 1C1EL 3BKYH 3FONA 5DJCA 4LCWE 3HG1D 1JYVA 2XY2A 3GB7A 4MJID 1ODAA 1B0GA 2DLIA 5HSFA 3DXAB 5EO1A 2VWEC 4KFZC 1QP1A 2J2ZA 1MCPL 5H37G 3VW3H 1HNFA 2BK8A 4P46A 1YQ2A 3AS1A 3UEZA 4ZAKC 5B3JF 3LHPH 1QSEE 3HNTH 1OLZA 4P5MA 3L3HB 1UVQB 2CLRA 1T3FB 1S9WB 1P4LA 3VFSB 4P59H 5MHSD 3PABB 4OB5L 5C07E 3UX9B 5KG9B 2VO5A 2PETA 5L9DH 1DBBL 3X14A 1UM5H 2JKXA 1PW3A 4FP8L 4X8XA 2VLKD 1PZUB 4P2QA 2VZOA 3QIWD 3EYSH 4AM0B 4POZD 5FDWB 1OP5H 3P11L 1I75A 5GHWH 4FHBD 4KK5C 1MRFH 1KELL 3KYOB 5GS2D 2W60A 2HTKD 5DRZB 4GRLA 1G1YA 1G7JB 5GISH 2EZ0C 4NGHH 4YXKH 3RWHA 1AD9B 3GNML 5JLZA 4Z7WE 2NTFB 3VXTB 2GSIB 1ZAGA 4TOYL 2W9EH 2IH1B 1AGDB 4YQXH 1KF9B 2IJ0C 2FJHA 4HS3A 3V4VL 2FX9H 5E8OB 3ZE0F 2LU4A 3DVIA 1IMHC 3DMMD 4RGOL 1XIWA 2PTUA 1WBYB 4DKAA 4DGIL 2VN4A 1NAMA 2GI7A 3WFHA 1IKNA 2OJZH 2QJDA 4JG0L 4QHNA 3ARFB 4HIHA 5SWQA 2R0KH 4P9HC 2OS7A 4N0YH 3VFUB 3GRWA 4HF5L 4AQOA 1J8HD 3TCLB 5LAXA 5C0BD 4LHQB 5DR5H 1P5UA 4QRRE 4K9EL 5ILTL 5C8JB 5LJYH 3CVIL 3ULVF 4GMSH 1XIWD 3QZWB 5F9WC 4HLZH 4I4WA 3RI5F 2C5DC 1VFAB 2H2SD 2LU7A 1AE6L 3EYFB 4N0UB 1TZGL 5DJAA 3MXVH 1DE4A 4XH2A 3GFUA 3RPIA 1A21A 1JTTA 3LSOA 3T8XB 1N8ZA 2QR0A 2DQGL 1BBJA 1DLHA 4LLWA 3F7VB 3B5GA 5MHSE 4JFEA 1T5XB 4DJMA 3GI9H 2VE6B 4PJEE 1UEYA 2A9NH 3ILPA 3QQ9C 4PP2A 2ED7A 3MYJA 4X4XB 4PD4K 4BFBD 3HNTL 1YMHB 3IKCA 3MRGB 4NOBA 1H3PL 5LGJA 1JI2A 4XHQA 3RAJL 4JANB 1LEGA 1SM3H 3BIBX 1FIEA 4YPGA 3MCKA 1F4HA 3BP6A 4HS3B 1MELA 1NMAL 3DOSA 3CFDB 2HVJB 3QPXH 3DTXB 2VISB 4QT5A 2EH7H 3H8NA 3ZE2E 4WHYH 3P11H 1V7MH 1A8JH 1FSKC 4JZJB 5KSUB 1DANU 3EFFB 1RJZB 4MSWB 4DQOH 4HIXL 1CFBA 4PTTA 3MOAH 3KHQA 1F2QA 1BBJB 4L3CB 4OF6A 4B41A 4HFWA 5HYQB 1YJDH 3EYUL 3VXSE 3TT3H 2VXQH 3JVGC 2C3VB 3GMNA 2DM7A 1BFVH 4IIQB 4CNIA 2X4PB 3LEYL 5IQ7L 3FMGH 3IDJB 4KQ3L 1IGIH 2P44B 3QNZA 4L8SA 2ADIB 5D1XD 3NZ8B 1NC4B 2A74B 3VCLA 2N7BA 5KS9B 5A3ID 1HSBB 3UTTD 1G9MC 2QEJA 1ZOXA 3QDMA 4KQ4L 3WKML 3VXNA 1KCSH 2GITB 4FQJL 4I3SL 1KTRL 4GKNA 1U58B 2JB6A 4UILL 3OZ9L 1WFUA 1YYMH 2XTJB 3VFNA 1ZLVH 2Z8WC 4N68A 1OT1A 5JHLH 3S7GA 1II4E 4PJ9B 1RZJC 2DQFA 5FIEA 4TPRL 4M8QB 1BECA 2ZG2A 1K3IA 4DK6A 5JUEL 2UVFA 4BZ1L 1NLDH 1A6VH 2DBLL 4QRPD 2P49B 1FC1A 1UWGH 3TZVB 4JDVA 2C7UA 1JHTA 2EEBA 5J3HD 2DQFB 2DQUL 2AEQL 3PL6B 4KDTA 5C2BL 2UY7A 2WWMD 4WHTB 4XGZA 3I75A 3PWVA 2Y25A 4QO1A 1JWSA 4HCRA 2WQ8A 3OHXA 5E1HB 3DMMA 4UOW0 4I3GA 3MODL 3A67H 3V4PH 4XT1C 2D3VA 3QEQA 2UV3A 3HPLA 2X4NB 2XA8L 1G7MA 4FFVC 3IDMA 1B3JA 4NQCB 1CFVL 2G5BA 3CDFA 4NO5A 3ULVE 1RZFL 3MR9A 1JZ4A 1A4KA 3PXHA 3QHZL 4B53A 1U36A 4R7NA 5C0RH 2CIIB 4NUJA 4ZQKA 5E5MA 2J6EA 4TN9A 3V6ZB 1Q0XL 1J86A 3LAFA 1INEL 3FOLA 1ZWIB 4MNGB 5DD6B 1FNGA 2BNRB 1U95B 5HHOE 3VMOA 3LD8B 2X89D 4MD5A 3P4OB 2YHGA 43C9B 4RDQG 3MCLL 3BP4A 5ACMA 3CU1A 5ID0A 5EOQL 1U8OB 3QXWA 3B2UD 1BOGB 1S5HA 2BFVH 4Y19E 3RVWD 4G43A 4PLKD 3BDYH 3C8KB 1U92B 3VGDA 4WO4B 1GAFH 3V9FA 3QULA 1OAYL 2AJ3B 1W8NA 3IDMB 4KRMB 4NQCA 1I3UA 2DQJH 2VDNL 2YK1L 4HKZB 2MHAB 1T7YA 1SJEB 1MQKH 3IFLH 4AEEA 1FYHB 1JGUL 1EUUA 1G0YR 4MGXA 4H25B 4YJZL 5C3LD 4EDXA 1CLOL 1TLKA 3IU3A 5F7DA 1QEWA 4ZAKD 1KIPB 1A6WL 2NY6C 2EXWC 2CRZA 1TIUA 1AJ7H 5D4QA 4A2MA 1JPST 4LVOB 4NN6B 4M62H 1DSFL 1L0QA 2OZ4A 4NGHL 3PDOB 4YXKL 3V6FA 1RZJL 3PV6B 4NQSB 3W11C 3DI2B 1KB9J 3RI5K 3DLQR 5EUKB 4YFLF 5T3ZD 4M1CC 5C6TH 5H8DA 3UJTH 2ERJB 1H15A 2UZXB 4GJTB 3HS0A 2Z92B 4OIAA 1FH5L 3GKWH 3MA7B 3CPLB 5DFTA 3IF1B 4IRSA 4D8PA 4KTDH 1JWUA 4BA8A 3T4AA 3HE6A 2OI9B 3W9DB 5TGBB 3EUUA 1KCRL 1WZKA 3QPXL 1SJXA 5FGCE 4KUZH 3TFKC 2VLKB 1YNKL 3ROLA 1F13A 1MFAH 4JDTH 1KB5B 2HLAA 3RHWF 5IHLB 2ICWI 4WCYL 4QXTB 5ITBH 4K7FA 2AK4E 3JZ7A 1KTLA 1FLRH 2GJ6E 1MCOH 1PKQE 4NO0B 1S3KH 5IVZB 5IKCB 1Z0MA 4LDOB 1G9EA 1JWMA 3L7FB 2EO9A 3BGAA 4Y2DA 1LP9A 4U2YA 4MQ7A 1ZSDB 2GCYB 5L8JB 4PYGA 2GUOA 4M5ZL 4YDLC 2CKBH 1RURH 4OUUB 4MWFA 4S1RL 3UTQB 4YIQB 4LLYA 4LLMB 4OLZL 5IVOA 4PB0L 3ZE1F 4DN3L 2BY1A 5BO1H 2WBJB 4NKOB 1T1YB 1BWMA 1UB5A 1F3JB 4H1LG 1FVCB 4L3EE 3MREB 1FAKT 2XFXA 3HE6C 1YY8A 3IFLL 1P84K 3QISA 1U9KA 5EN2A 5F8RC 4PUBL 4QTHA 4ALAH 4ZSOB 3O3BA 1QPXA 1BMGA 3OR6B 1PQZB 4NN6C 4JN1L 1CICC 3EYFA 1NAKH 3VGEA 4S10A 3ESUF 4LCUB 2AJVH 1E4WH 3BUTA 4Y4HA 3TYFB 4WHDA 3MV11 4EI5C 4ELMA 2B4CC 4APQB 4ODSL 4N5ED 3QUZB 3ZHKA 2PW2A 2G5RA 1QEWB 2V5MA 5IBTH 1Q0XH 1BD2B 3QNXA 1IM9B 5F3HB 3DX7B 4U1KA 4GAFB 2H26A 2DQTH 3BP7A 3AREC 4BSWA 3C09B 5C0GB 5E8DL 4BQ8A 5CKGA 1EFXD 4PJEB 5DFWH 2VXVL 4OCSH 4PJAA 5GPRA 1UVQA 2CLRB 3KS0J 3LQZB 1QBLH 3HN3A 3FFCD 3NBNA 1F8TH 1VFUA 4L29A 1UG9A 2I9TB 3QRGL 4LLVB 3STZA 4YFLI 4ZFGH 2AJSH 4Q2ZB 2EDDA 1OW0C 4XPHH 3WN5C 3O11B 4M7JL 4P4KB 4BH8B 1R24B 4QNPE 3ULVC 1XF5A 1NMBL 1X7QB 3RWHB 1C5DA 3HB3D 4GG6A 4TSAL 1L7IH 1L0XA 3QWQB 5FM8A 2X4OA 5CP7A 5I15H 1T2QL 1G7HB 3P3YA 3S4SG 4PS4H 3L3JB 3NZHL 1FE8H 4L8DB 1KEMH 5DR5L 5ALCH 1G6VK 2OLDA 2VXUH 4IOSD 5I76A 3MQIA 4IJ3C 1BAFL 4EN3C 2NR6D 1QFWI 1NGXA 4NHUA 1HKFA 1MOEA 2ILLA 3KPQA 4KHXL 2P5WA 4FABL 2COQA 1T7VA 2J12B 1CG9B 4O2CB 2YD1A 3I6LE 5EPMA 1MUJA 2A9ML 1CDHA 4UUJA 4HDIA 4QRUA 5IWLA 1BLNB 3MRMB 2YXFA 4X5LA 2AXGB 4MX7A 5KS9E 3BAEL 4OLXL 5D96B 4I48A 4JHZA 2W59A 5T3XH 1MCFA 4JDZA 1M7IB 3HC0A 2HJKB 3T2OA 5I74C 3ZE1E 3L7EB 2VABB 5CS7A 2AK1H 2WBJD 3MZGB 5KSVA 3K81A 1XF4A 1PSKL 2NW3B 4XPBL 4ZS6C 3C5JA 3OGCB 1IGYB 3QEGH 1F3DH 1JP5A 1T0PB 1KCUL 1GXEA 2XG4A 4G3YL 3L5IA 4IMLA 5J1AA 3VFWA 4KMQA 5EU7C 1FAIH 5DJ6B 5F6HI 1W0VB 3IFOB 4PGBB 1IQWH 4Z5RA 1UYWH 3OJDB 4O00A 5F7UA 1OAUL 2AXHA 5IMOB 3MR9B 1CU4H 4X80L 2Z9TA 1RUKL 1GGCL 4Q6IA 1TQCB 1YECH 4RMUA 1EEZB 4EQ2A 3TFKD 4MA8H 1W0VA 3IFOA 2GTZA 2YEZB 4FTVA 3OHXB 4O2FB 5CILH 5EZOL 4GRLC 1WLHA 1S7QA 5FCUL 2DAVA 4JQIH 3TN0D 3GM0A 3FL7A 1NFIA 4HG4K 5I1CH 2E9IA 1S9YB 1EHLH 2AJSL 4UQ3A 3S9DB 1Y18A 3VW3L 3BE1H 5KZCB 1T1XB 1I7UB 4LPTA 4WGWB 5C7XL 1LO2H 3LY6A 3O3AB 3VI3F 1IEBA 5JHDE 4PRPE 3ZE2F 2AXJA 2X4PA 3GJEA 1ND0A 2J8UE 4WDIA 1UM6H 4G6AC 5EU6B 5HD8C 4KDVA 4P23A 3JSSA 1JCKA 2GJJA 2EH8L 2IPTH 3MACH 4JFHE 32C2B 2ARJB 1K4DA 1ZHNA 3TIEB 1CIDA 5K9JL 1MJJA 3D18B 4KTYA 3FT2B 4IRJA 1Z5LB 5DMIH 4DWHA 5KSBF 3TBSA 5GSRB 4QRPE 4EUPH 2ENYA 2BNQA 2E7BA 1LE5B 2IAMD 2BVYA 2AP2A 2X4RB 4WHYG 4DAGL 2GSGA 4S0SD 3FT3B 4D9RE 4ODHH 1XR9B 1J0KA 4RFEB 1T1ZA 4V1DD 2LFGA 4PG9A 3WUZA 3T0EA 4Y2DD 5HYJA 4XGZB 4R4BA 4NKIL 5T1LB 4XMLH 2EC8A 4ZUTA 2BVQA 4AMKL 3UPRA 1VACA 1ADQL 4D9RD 1SEQL 3GMLB 4TVPE 5F9WB 2FO4B 1OPGH 1EEUA 2C1PA 2HTLC 2CGRH 1LDPH 1QSEB 5IF0B 4F57L 1AD0A 2X4NA 3HPLB 2EDJA 1FHGA 1NDGB 3BP7B 5C0BA 2QQQA 4M43H 2HT2D 5C07B 1UJTA 1RZGA 3ZTJH 5DEFB 1MWAL 3NH7H 4F2MA 1TQBC 3BPCB 3W5MA 3TC9A 3VJ6B 3OKKA 3NIDE 5I15L 3C5ZD 4GG6F 5IMLA 4PJBF 1N7MH 4GQ9H 4U1GC 3QA3B 4JKKA 4NWUL 1E6OL 1OM3L 1ZS8B 4OZGA 3QCTH 3T09A 4RZCA 3IVKB 3CZFB 4HIEB 2A6KA 4Y88A 3SQOL 3BQUB 3U0WH 1L6XA 1X7QA 3L3KB 2Z31D 1KN2L 3KVQA 4PP1D 3VJ6A 3WJLA 5SWZA 3ULUF 1AIFA 1PKQB 3ABZA 5I1CL 5E8PB 1HHJB 1BZ7B 2FBOJ 1P6AB 3QDMD 3HNSL 2VQ1A 3KLDA 5CEZH 1RFDH 2XICA 4HIEA 2C4XA 1JPTH 1IKNC 4XBEH 5KVDH 4OCRH 4P2QB 3PGDB 3JV4A 4HG4J 3MV7B 1N3NA 3LS5H 3SDAC 4JHAH 3KYNB 1MNUL 4NNYA 4NQEE 4JRYB 3BEWB 2ZUTA 3ARGC 4NKMA 4BFGA 1E27A 5C92A 1A1MB 4OSUH 1PZ5A 3RWIA 5C0JB 1WZ1L 4JKMA 1FYTB 1FFPA 1OF2A 4OZFB 2ZG3A 1CXHA 3VG9B 2RCSL 5GQBA 4P2QD 2RQ8A 1PY9A 4XPGL 1WWBX 5T3ZE 3WFZA 5EBWA 5MEPA 4AM0A 1VKXA 1S78C 1IC4L 2EIZB 1CQKA 3OKDA 2APTA 1AGFA 4OLUH 4NJAL 1E28B 1ORSA 4KUZL 2IANB 4R9HA 4DZ8B 3MJ9L 3ZTNH 4ZPVA 4PRNB 5E70A 3QUXD 4JPIB 3B2VH 1MRDH 1YEJH 5F1OB 4GAYA 1V3MA 1P4IH 1X5XA 3MRFA 2YBRA 2EKJA 2Z35A 4UT9L 1TQCC 4EIGB 3QIBA 3TVMA 2A77L 2F53A 1EMTL 2MMXA 1UACL 4UU9B 2B1HL 3DO7B 4NKOA 3C5SB 3TO4C 2GJ6D 4OKVA 5ESAB 3E6FA 4XNXH 1KNOA 4ZUUA 4LHUB 2NTSP 4Z0BH 4JPKL 1UWXK 2XI9A 2HT3D 4YHPB 4WW1A 3GMQA 4AT6A 3VFVB 5GXBB 1EO5A 1GIGL 3V7MA 3K2UH 1PDKA 1GZQA 2R2CA 3U9PL 3RDTB 5F97E 2YD8A 4LCYA 3JV4B 3UTTE 5D71L 5J3HC 3NCYP 3GUTA 5T1KB 5IJKC 1R3KB 4HWBH 5EC2A 3D0VB 1KGCE 1KB9K 5TQ2L 4PJ7E 3MROA 3CSYA 4X4YA 5DFVC 3MV8A 1D5BA 3BMVA 3D39E 3F65A 3Q6FA 2P48B 2IQ9L 3FQWA 5TF0A 4YHMH 4OD1H 5IVXA 1YN7B 3O3EB 3VFOB 3VFSA 2IPKA 4KU1A 4Y89A 4U49A 1E4KA 3SKMB 3RZCC 1YPZB 3PIQB 1G9NL 4DVRH 5KTEH 3TIEA 1CDJA 3KYOA 4HK0B 3PWPD 4Z8FH 2NX5D 2N7AA 1M7DA 4HSQA 4Z7VF 1MI5A 3ULUE 3KPMB 2ED9A 1S5IL 3VXMA 3F5WB 4A6YL 3QWOB 4Z7WB 4OCNC 1X5GA 1HOCB 2O5XL 5C70A 4GS7C 4ODWA 4YAQB 1YMMB 1OPGL 3LDBB 3BT2H 3WN5B 4PB9H 2FGWL 4G8EB 3S5LB 1BLNA 1JF1B 4P2OA 1FLTX 1HXMB 1T1ZB 4UIKH 1WT5A 3VXUE 3FO2B 5J4MA 3SDCC 2P8LA 1I9IL 3U1SH 5GGRB 1A6TB 5D7LA 2BVOA 3V0VA 3X11B 1YN7A 4LKXB 3PG2A 4N9GA 1KEGL 3V6BR 1MHPL 5IUSA 4HS8L 1AO7D 4JZJC 4JKPL 4OT1L 3T3PF 3U7WH 4JFYB 2CK2A 4IRZL 2QSCL 4PJCA 2R56L 3L3IB 1IC7H 2DBJA 3Q1SL 2F19L 1DFBL 2BVPB 1A1OB 2EYSA 2E9WA 4HAFA 2ATKA 4FQXA 4GG8A 4Z6AT 3P9MB 4AG4L 3UZQA 4P4KA 3QXTA 3QIWB 4O9HL 1VGEL 4X9FA 3SKJH 4TVPH 1IQDB 5F7EH 5CEZE 5I8OL 2E6QA 3VRLE 1HXYA 4WFHD 3MGOB 1KCRH 1U8LB 1BVLB 3PQYB 1H5BC 2EIBA 3UTSE 5DEGB 3QDGA 4X6BA 3KPOB 3MRDA 3U46B 4F7MA 4KRPB 1E0OB 3H9SB 4JR9H 4LHUG 5M95B 1PQZA 1S7QB 4WRLA 1A3QA 1HSAB 1X5JA 1A5FH 4XVUD 3RU8H 3O4OC 5EZLB 4QYOB 4PGJA 4MCYA 4XCYB 4YX2L 1A1OA 2EYSB 4TOYH 4NJ9H 3QHFH 4HIJB 3WS6C 2UZIL 4UIMA 1H8NA 4TNWK 3VXUA 5J9PA 3HAEA 2P42B 1A7QH 4GKOA 1LK2B 3FO9A 3CUPB 4KZDL 1CGSL 4HS6A 2R1WB 3D85D 5HYFA 1A2YB 4MXWL 1KCUH 1UZ6E 1JPSL 1CVSC 1OTUC 3GEWB 4Y4HC 5F9OH 1INQA 4AQ1B 2LE9A 5CBAB 1IQWL 5C0RL 5F8QC 4OZGF 4LU5L 3UYOD 2X1PA 4U1IA 3E6HB 4N0FB 3CSBA 2ADFL 4KKCC 4LIQH 3TA3D 3AY4C 5E9DE 3RY4A 4M1DH 1CE1H 3CGTA 2QADC 1Q9OB 2W0FA 4TQEH 5F96L 2OMBA 1W0WB 3HLAB 4F7EA 5DTFB 4MD0B 3UDWC 1CD8A 5KW9H 3MOQA 4OZHA 3SCMB 3KLAB 4HJGB 5FB8B 5H35A 5MP6L 4MNQE 4JQIL 4LAJH 4NQCD 1NCDH 1OSPL 5GRVL 1IILE 2YA1A 4PJ8C 5MEND 4URTB 3QDJD 3M07A 2GAZB 3NAAH 2P5ED 4LEOB 1LHZA 3FKUS 3ARUA 5I1JL 5EIVA 3TH3T 2DD8H 2MKWA 3FB6B 3T2QA 1JGUH 1QQDB 4L3ED 5MENE 1NBZB 3BI9X 3GSQA 5BMFH 5JPMA 4ENEC 5CD5D 1A7PH 2EDKA 4W6XB 4PJGE 2VLLB 5J13C 4S2SB 15C8L 4ZYKB 3ARDB 5IBTL 2ERJC 2VQ1B 1K2DB 1GZPB 3ZKNC 5DC9B 5FK9A 3ROLB 1VCAA 3HCVB 1CL7I 2Y4SA 1WAAF 4OI7A 2DQHH 3DUSB 4R3SB 4NO0A 1SJHA 1OW0A 2NY1B 1DUYB 1MCCA 5ICXA 5IMMA 3C6SB 2DLFL 1KXVC 1J0HA 3KHOA 1MAMH 3BPOC 5HHOA 3VI3E 3QHFL 5F70A 2M8XA 5BVPL 1AGBA 1O5DT 3VRLF 4OGAD 1AR1C 1BVLA 3LB6D 4NZRL 3TNNB 3P30H 3UPRB 2UWEF 5HVFB 5B39B 3BIKB 3LVEA 4P48A 3BPOB 4BM7A 1G7QB 2VYRE 3TNMB 1TETL 3U7AA 3NFPB 3CFIC 5HHME 2XN9E 4N5EC 4G8FA 1ZT1A 2XRAH 4I3RL 2HN7B 1HCVA 3E3QE 1N64L 4PJFB 4BFIB 5ICYB 3ARBD 3A6OA 1VENA 1RUAL 3BIKA 4JVUA 12E8H 4GXUM 1Y6MR 1OTTC 1VKXB 4KKLD 1BQUA 1JGEA 1S7XB 3QWRD 1RU9H 4IDLA 2OJZL 3F6LA 2R2EA 3K2MC 4NQUA 3CDGA 1P7QB 5D2NE 1PZ5B 4UB0H 3GJFK 5FYKD 5SX4H 1K6QH 3WO3B 1UB5B 5K93A 5BO1L 2OXGA 2H3NB 4Q7DA 2FX7H 3BZ4B 5KN5A 1IBGH 2G9HB 2NY2D 1GGUA 1BBDL 1BX2A 1U8QB 4I9WD 4P23B 4R3SA 1JWSB 5DYOA 4EVNB 4MQXD 1CGXA 3IF1A 4X6DB 4FZ8L 1LO3L 3MLTA 4UMGA 1P53A 3S98A 1OHQA 4OJFL 5GS0C 3TCXA 2ZJSH 5E8PA 1J1PL 3UTTB 3OKYA 2DKUA 4OFPA 1U8LA 5HDQH 4EIZC 5D1XA 1RUMH 3ESVF 5C0DB 3ZT7A 5KJRL 3KPRA 4PJGB 1DN2A 4LAQL 1EZVY 3OSKA 1FO0A 1S7RB 3LKPA 1ZT4B 4Q9BA 3SKMA 1U95A 3HA0A 4UNUA 2QSCH 3IRPX 4FQLH 5FUZH 3RWDB 3K74B 1CFSA 1JF5A 2FNBA 5ANMA 3MCLH 4FQIH 2AI0L 4JQXC 3SKNA 4WI6A 2E5EA 3KPRB 1DEEB 2C4FU 2DLFH 3RY5A 5I73B 2HT2C 1F45A 1OAKH 2XA3A 4PJGF 5HYSA 1LNUA 3S4SA 3SQBA 3TN0A 3JUYA 3GO1L 2JK5A 1PX3A 3BDXA 1IJ9A 2AJZA 3GB7B 4AYFA 5BVPH 4CDHA 2HTLD 2E27H 2F8OA 1T1WB 3STLA 2A83A 1MFNA 3B9KB 4IHOA 1CGWA 1HH9A 4YZFE 1CDCA 2CIKA 1P6FA 4KJWC 1JFQH 4J3VA 4TUOB 1PKOA 4B7IA 2YS4A 2Q20A 3PGFH 2CDFB 2DICA 1N5YH 1J7VR 3STLB 2ADGA 3PP3H 4ZTOL 3HC3L 1TVHB 4JM2C 1HOCA 3AFLA 5I66B 2MKLC 5EUOE 3JWOL 1B6UA 4YHLL 5DQJB 5DURB 3MLUH 4N90E 3FQXB 2X42A 5J89A 2HH0L 3ZLQC 2V9QA 5I30H 5CZKA 1LGVA 1RU9L 3RDTC 4YGAB 4ELKA 4LVEA 4NZJA 3DIFA 5I1LA 3VXME 5ESVA 4HH8A 2Z31A 5ADPH 1RUPL 4GQPH 2I07B 3WV0A 3O4LA 4P4RB 4JFYA 3KJ4C 1IGCL 4MVBD 2A6DB 5DHVH 5F1IB 1I85C 3MLSL 5EO9A 2RJMA 3CU7A 4RNRB 2Y5EA 4YEFA 5FO9B 4YPGB 3CX2A 5T3XD 3MRNA 4PLKC 2CDFA 3VH8A 4H0GA 5LGHH 1Q1JH 3GK8H 4HXBL 3I9GL 5F1SA 1QFWL 2VL4A 1P2CB 3OAUH 2H26B 5AD0B 1MIEL 1F6AB 1S5IH 1RURL 3UCRA 3NH7L 1MWAH 1FG2B 4Y5XC 1WFNA 3DSNA 2NX5E 5ECJE 1Z9SA 4M1GL 2DN7A 3FN9A 3TCLA 1BJ1H 1I8IB 4PJ7F 1SYSA 3G9AB 1KIRB 4FN0A 4LSSL 1CFTA 3T8XA 4WFGD 2CR6A 3V7AE 1FAIL 5DRNB 3WHE1 3S37X 3IDXL 3O8XC 3RVVC 1FDLL 3QFDA 4N8VB 5GZOD 2V6HA 3N85L 3LQAC 1YPZA 5CBEB 1FNAA 3WHXA 4GBXC 4KI5E 1TZGH 4MAYB 4IRSD 4QRPA 1LDSA 1IC1A 5FO7B 4I18C 2JJTA 5D8JL 5FHBH 4D94A 4ZSOA 4G6JH 4PJGA 4EDWL 1UWEL 1MJUL 5FGBC 5IV2A 4GG6B 5IR1B 2JJSA 4MA3A 5BCAA 2AJVL 3PHQB 4MYWB 4XVSH 3BHBA 5MEQA 3I3DA 1ED3B 3WJJC 1G7JA 1CD9B 2AKRA 3LQAH 3VXPB 3MFGB 3RDTA 2Y06L 4HKJB 1CLZH 3EO0B 2WBKA 4HUUA 4N0YL 5B8CB 4GW4B 1ERNA 1JF6A 4QHLB 1TVBB 1CFTB 1ZXQA 3WIHL 2D03H 4S1SL 2IH3A 3DX9A 5C0FA 3MV9E 4HGWB 4MJIA 5BW7C 4JN2A 5F3HA 3NCFB 4OJFH 1GGIL 4GAGH 2NXYB 1EFXB 2DWEB 2ZNXA 3QCVL 4GUPA 4LCIL 5EOCL 4NRZB 4HGWA 4MJIB 2Z4QA 5IK3B 4DCQB 3TPKA 4LEXH 2APBA 1U3YA 4KROC 2VKWA 3AS3A 1C16B 3VRJB 4H8WH 4I2XE 3WHE0 2DQEL 2X4RA 2BX5A 4EI5A 2QSVA 1G6RL 3S36L 5DJ8A 3BPNB 4YUEL 1IFHL 4Y4HB 5JW3H 1BFVL 3WNNA 3GKWL 1Q72H 3IJHB 2VTFA 4HV8A 5DHVB 4QXUL 3BWAA 3QUKB 3KPPA 2ZOLA 3H7LA 2XTJE 4G7YL 2I9TA 4XNMB 1DJSA 2BNUB 3OKNB 5T1MA 2UYLA 5CGYC 4QY8B 4ISVB 3BEVB 2UZIH 3VFUA 4H0IA 5DDHB 1MJ7H 4WO4C 2HMIC 1CF8L 1AY1H 4PRBA 3BPLC 1X5YA 2GY7B 4AMKH 5IBLD 4YC2B 1U3ZA 2F5AH 3U0TA 5BS0E 5AWNL 5FYKU 2EYRA 4YE4H 1FCGA 4FQ1H 3MYJB 2BOBB 4KI1A 1FN4B 2CLVB 3PDGA 4XPFH 4HIJA 4XWGH 1X5HA 1NLDL 1A6VL 1DUYA 4ZOBA 5ENWB 2E8ZA 3CLFH 1ACYL 5KVGL 3BQUC 2CLZA 4XP1L 5ISZA 2NXZC 4J3TA 2WBJC 1Q94B 2AEPH 4EI6B 3IJHA 3VGGA 2XQYK 1O7VA 3CZFA 2IQAA 1MVUB 3SE8H 3CC5A 5JO5A 2CXGA 5C08D 2BJMH 1I9RH 4XVSL 5BZDA 3VXOB 4J3OC 1I8MB 3JV6B 4RMTA 4XMKH 3RTQB 4WI5A 1IQDA 5IBUG 1SEBA 4MNGE 1UA6H 1J8HB 2W65A 1QQDA 4DOHB 2F53E 5C0EA 3UXFA 4LSTH 2D31B 3MC0A 4YGVB 2ZCHH 4AIOA 3F12B 3X13A 3MJ7B 4MHHI 4HHAA 2VLJB 1HI6A 1XF4B 1T5WA 1HNGA 1FO0L 1U2HA 4G6MH 5FCSH 3VWKD 4GBXD 1FZOB 4HAGA 3BH9A 3BD5A 3MRBA 1T21A 3GMMA 2IGFH 2Y72A 5GHWL 3TWCL 2DQIL 4OM1H 2QHRL 3FOLB 5DD6A 5D5MB 5FYLD 4NO3A 3QQ3B 4GXVL 2Y6SD 4YDIH 3MRCA 2H8PB 3HI1B 1KFAL 1ZEAL 4D9LH 3IXAB 1OQOA 3IETB 5ADOH 3GHEL 3VWKB 2VLKE 3VFGH 3CFJA 3BYTA 4WU5A 2AQ3A 4I2XB 3E3QC 4OLWL 5CMAB 4X0KB 3D39A 4ZODA 5EOTA 4KKCD 4U6VL 3TA3C 3T0VA 4Y5VB 4P4KC 1FG9C 4M03A 1OB1A 4OQTH 4QCIA 1FQ9C 4MJ5B 1V7NH 4XVJH 5DLML 3V5KB 4GRMB 1AY1L 3CFEB 5DEZA 4G6KH 4GLRH 4U6HB 1R5WA 3RTQC 4Z7VA 4JFQB 5IG7B 4QTIH 4YEEA 5D1ZC 3MO1A 4MB3A 2EYTB 4PRAA 1CFSB 1J18A 1BVZA 3AS2A 1IC5H 5I8EA 1Q9LA 5BS0B 5IQ9B 1N5AA 3RKDD 5DF0A 5FUOH 5MEOA 3BIAX 1KOAA 3LRSA 7FABL 5KVEH 5DJ0A 5E8NA 4KWUA 5D1XB 5C0BE 3SPVA 3R1GL 2DM3A 1NCBL 4ONHB 2X89A 3L95B 2ZCKH 3LH2H 3W11D 5E24E 1TZIA 1A14L 4OD3H 1OD9A 3NFSH 3QDGE 4APQC 5HVHB 3QDJE 1A22B 4X6CB 2I60H 4R6UA 1MLCB 4P5TB 4PJXF 5ELIA 1Y0LB 2FH6A 1ES0A 3QEQE 1FNLA 3NCCB 2BMKB 4XTRD 5K9KA 2P8MA 1FLRL 1IT9H 1NQBA 1RMFL 3LKNB 5IG7A 4JJ5A 3KR3L 3PWUA 3UC0L 1YEEL 5TH2B 4XNZB 4HXAL 2K7PA 3V4UH 5GJTL 4N0CD 4FMFA 4L9LC 3NABH 1OVZA 4WU7B 2Y36H 4XMPH 1AQKL 2RGSA 4R7DB 4X98B 3ROOA 3TO2B 5GGSY 1NANH 2DWDA 3T65B 1R3HA 5JXEA 2B4CL 3QIBB 3TVMB 1FFNB 1GGTA 1QSZA 1U8HB 2FCBA 1K85A 1DBML 1AGBB 1K8DB 3RQ3A 2P8PB 4Y16A 5C0AE 4UTBL 3SDCD 3UTSA 4LCWB 3P0YH 2UUDK 3BKCL 3GHEH 2VRAA 5KSAC 3WJJA 3GSNL 1NGWB 4Z7UB 5I1EL 2P43B 4RQQA 3BXNA 5IVXE 1TITA 4U6XA 3RGHA 2NY3B 5GRJL 5T5FH 1BF2A 4KUCF 1T0NA 3QPQD 3MNWB 1KNOB 2BVTA 2XZZA 1TJIH 1ACZA 1FZMA 1LVEA 5HXMA 1QFUH 2R0ZL 5DZNA 1MWAA 2J4WH 1KBGH 4ZS7L 1YEGH 3BUYB 4YDKL 5KVDL 1AKJD 5ANMB 1N59B 1T20B 1ZKAA 1YYML 1S7XA 3Q3GA 3NFNB 1U42A 1T4KA 2OQJB 5DK0B 3G6DL 3J8F7 1WCBB 3ZDYF 4PJHE 3AC0A 2X44D 4LRNL 4I2XA 2F5BL 2V7NA 4GLRI 4L1DA 5JQHC 1YNTA 5E1AB 2HH0H 3STBA 1F4WL 4HLZG 4JVWA 5DZOA 4ZAKA 3I02A 4QXGH 5EWIL 5HHVH 3DURA 3NFNA 4XI5C 4PY7A 4U0RB 4HUUB 4N0UA 5LBSL 4K3DH 1NAMB 4G80B 1AHWA 4Q9RL 4FQQB 1LK2A 3DVGB 3FO9B 4NBXB 5ILTH 4LPCA 1C12B 1XF5B 1IKFL 4ZAKB 1ZTXH 3SDDA 3X3FL 4NYLA 4F9LA 1R0AH 2FWOB 4MNQB 4XHJC 3BEWA 4Y5XB 3FB8B 4E9LA 4PR5B 2YPVH 3QDAA 4PGDA 4XC3L 5I6XB 5IMKB 2DKSA 1U8JA 2VL5A 5SWZD 1T1YA 4GW4A 4Y16B 4P0DA 1WIPA 3TT3L 1NGPL 4EEEA 1IM9D 3AU1B 4HWNA 5EZJB 4I77L 4NSKB 1S7SB 2OL3A 2BNQE 3A0OA 4L8DA 1N2RB 1T2QH 3F7QA 4U1MA 4JQVC 1AFVL 1AGCB 5FO9A 4WVRA 3GJFA 4NRYB 4U6VH 3T2NH 2B1AL 4XNXL 2RBLA 5IB1B 1K5NB 4MXWH 3DYPA 4JHWH 2B4CH 4Y5VC 4ACPA 5FO8A 4UV7L 1P4BL 4JFPA 1T66C 3HE7B 4PJXE 5E2WH 4CW1B 1T2XA 4H25A 4EI5D 3WXVH 2DLTA 1ZHKA 1SEQH 5HHMD 4HIIA 4HFUH 2Q8BH 4PJCB 2VDNH 3KPSB 2MSPA 1SYSB 3ARFA 4HIHB 1VDGA 2D9QB 4QTHB 2Q8AH 1YEFL 4F7CA 3QEUA 3PJSB 5KAQF 3WDHA 1IEHA 2I9LA 5BQ7B 3EYOA 7FABH 5KVEL 2JB5L 3ILPB 1A6ZA 4RGNC 4WY7L 3GMOB 3UTPD 1B90A 3B9VA 3O45B 2P8PA 4PGZA 5B4MC 2VR5A 5DRXA 3ARGD 3HE6B 3SDAB 4Z77B 4F80A 3V5DA 2HJLB 1Q9LB 4L4TD 1YEIH 2R0WH 5FUCC 4OGYH 1XGTA 4KAQH 1ONQA 3GIZH 1KYOK 2AKRB 1ZT7B 5F9JB 3VG9C 1RHHB 4Q6IB 4GW5A 5J9PB 4I0PD 4UQ3B 5IK3A 3MCG1 3G5XA 4N9GB 2YPLA 1GGIH 3VFOA 1Y0LA 5GS1A 5CEXA 4OLYL 1DDHB 4JG1H 5F7WC 3HZVA 4CN4A 3DX8A 3HKFA 1F02I 4KK9D 3IB4A 3C2SA 5JMOC 3QFJB 1EHLL 2RB8A 1AD0B 3OXRB 2V2XA 4RSVA 4MB5A 4PJ5E 5IW3A 5D7IA 4I0KA 2BHUA 2J7LA 3QP3A 1YC8A 4LSDA 3QIUD 3L9RB 5EU4B 1X5IA 5EU6E 1MY5A 1BFTA 5FUOL 4NZRH 2ZPKH 3MGAA 1ZGLB 1G7PA 1URLA 1Z3GH 4U1HA 3QUML 3WNKA 4LVNB 4D3CL 3D3VB 1NUFA 2E9BA 3P77B 5E4IA 4X80H 3EFDL 3GMRB 3I50H 3CFCL 4YBHA 5JQ6H 2VZ1A 3DGGB 2W91A 1FNEA 3K46A 2A77H 3U30B 2CLVA 4LK4A 3KPNB 4CU6A 4U3HA 4ZXBA 3VRIB 3SDXE 1RUPH 1YN6A 1RY7B 2HG5A 4DEPB 4RMQA 4WI9A 2CUIA 2FL5A 3OX8B 1CGVA 3KPNA 3BEVA 1MJJB 5DMGC 4QXGL 1MJ8L 4MS8C 1MCNA 5GGTL 5HHXL 3EHBC 5GGUA 2JLLA 3B6SA 3RIAK 4F7TA 5D7JA 1ZA6A 3RTQD 4G5ZH 5ID0B 4I5BA 1ZT4A 3TT1L 3TPUB 5I1AB 4BQ6A 3G5XB 3I2CH 3C5JB 5FYLL 4QT5B 4CADA 3QQ3A 1WC7A 3INUH 1HEZB 4X6DF 1C5CL 2E8YA 1J05B 2QHLA 4PJBA 1RK1A 2P24A 3WFEH 2V17H 1VPOH 1PX4A 4PJEA 1HWGB 5DD3L 4M7LL 4Q0XL 4CADB 1FIGL 3T3MF 1L9MA 3LPFA 1CFQA 3IDGB 1UH4A 4OZFH 3IU3B 5F7DB 3O11A 1FSKB 4QLRA 3BO8B 3F7YB 4OBRA 6FABH 1X3DA 1CR9L 2XIDA 4LASH 3ARGA 3VDBA 4ODHL 4AH2A 1B0WA 3QIUC 5F89A 1NDMA 2AV7B 2AJ3A 4C83B 3MNZB 2OYPA 1ONQB 1JUFA 1OGAD 3HG1A 2XN9B 5D1QD 2G75A 1CCZA 1A7OH 4HFUL 5TQ0H 2IG2H 4FQPA 3IVKA 5FV1L 5JPMB 3T1WA 1OSZA 5TDPB 2FB4H 1MVFA 4M8QA 5IW1B 3EOAB 1MNUH 4WGVB 2MWCA 3V7AG 2RFXB 3O2WH 2FECL 3PWJA 3GSVA 3MRCB 1FVDB 4ZUWA 2GJZA 4X99B 3QG7H 5D2LF 1MFDL 3BRDA 2FH8A 3LD8C 4X83A 2NY4C 3KPSA 4UZGA 4TUKH 4DW2L 3IDNA 3C6SA 4FFZH 4JRWA 4JFXA 4J3UA 3GMLA 3KXFE 5GIRB 3QQ4A 1BZQK 4R0LA 4CN6A 3BZ4A 5KN5B 4YFDB 4PJIB 3FFDB 4MCZA 5JW3L 4YQXL 1HYSD 3IJYA 4JLRB 3M8OL 5GGTH 1IAKB 4PG9B 2LQRA 2FSEB 3C5SA 3DPBA 2VNCA 3T2NL 4E5XA 4XAWH 1WUNT 1JGLH 3OG6B 3VXRD 2BSRB 4OUUA 4UT9H 1V3LA 2QTEA 2JTDA 4FQQA 2NYYC 1NCAL 1U91B 3QIBC 4HKBB 3TVMC 4X8JB 3AB0C 3V6OA 4PJFA 4BFIA 3QFDB 2X1OA 1YZZA 4QHKI 4FS0A 1O0VA 4E41E 1F3JA 4LSQL 1C8PA 4D0BB 5EOQH 5E1AA 2W07A 4NM8L 4RRPG 3QUXC 3CFDA 5EN2B 4R0LB 3SDCA 3MXWL 2BMKA 2XQBH 4BZYA 1VGKA 4JZNB 3UTQA 2OJEA 4X6CA 4WTZA 3U79A 5HYSG 2AEPL 1P69B 4PGEA 5AAMA 1IM3B 4E41D 4KROD 1MFBL 5DURD 1RHFA 3ULVL 3VXPA 3IXTA 5CIPH 1JJUA 3O4LE 3KLHD 4G9FA 1S7TB 2X70A 5GGVH 5GZND 3QAZC 3G04A 4MVBC 2VAJA 3L7FA 2DQTL 4JFEE 1EAPB 5CEYB 1FPTH 4R2GB 4RQQB 5E8DH 1YNTB 5I18H 2VXTH 3GBNL 2H2PC 2Z91A 2R69L 2P7TA 1HYRC 2GSIA 1J8KA 1QSED 2XKNB 3W2DL 5JDSA 4LBEB 5HDQL 3HR5A 4X9HA 1E28A 2L0DA 3CLEL 3C9NA 4FZ8H 2PXYA 3IS0X 2PCPB 4YXLH 4DN4L 4PRIB 3IDUA 3LRSB 5E08H 2JJUA 3VFPA 2PKDA 3JTTB 2GK0B 3TT1H 2QHRH 3NAAL 4ONHA 1F58H 3V0VB 3X11A 1NEZA 1Z6JT 2Z31B 4YDIL 3H0TB 4QRSA 3MSPA 2VXSL 1N59A 1T20A 3T0EB 1R3LB 3C5ZC 3CK0L 4YDJA 1BJ8A 1WCQA 3SGEI 1NEUA 2WINA 3VDAA 4C59B 3THML 5L2KA 2R23B 4ZSOE 3HMXH 4KTEL 2C3HA 1BZ9A 3V95A 1BHGA 4OF3A 1S7VA 1B0GB 1M7IA 2CKBA 4L8SC 4XNUH 4P3DB 4JRYD 3D1MC 1HINL 3FTGB 2VB5A 5B38B 2C4FT 1LO4L 3C87A 1XCQA 3DRTA 4KQ4H 3WKMH 1X4YA 1JVKA 4Y2DB 4R4FL 1LNUB 3X3GL 3AREA 2G5BB 1A3RL 2P4AB 5I19L 5SV4A 4CKVX 4QTIL 1DDHA 3JWDH 4JG0H 4MNGA 4H5SA 4P3WA 4DFHA 3FQRA 3IDYB 5I30L 4K3HA 3QFJD 4LCCC 3TJHC 3MRIA 1INEH 1FP5A 1ZHBA 1S9VB 1K3ZA 3SDDC 3WFHB 3KLSA 4K71C 3MOBH 1NDMB 4R97C 2WSKA 3E8UH 5HHPB 1KIQB 4J3WA 5CGTA 5TDNB 4LPUA 1TNNA 1UZ8A 2NX5A 1D6EA 3MXVL 5FM4A 4HX1A 3FB7B 4I13B 3TA3A 1CWVA 3KWWB 3Q5YA 2GITA 1TPXC 5CZVL 3GGWB 2R29H 4U05A 4YO0A 1AH1A 1H3GA 3QDGB 4X6BB 3W0WA 3WN5A 4XRCA 2HJKA 5HVGB 2YPLE 1Y6KR 2FYYB 4DAGH 4OF0A 3UZVB 4HPYL 3BP5B 2IBZY 4P2RB 3RBSA 1XT5A 1CD1B 1SEBB 5DWUH 5E94B 3AGVA 5CEXB 2GT9A 5SWSD 1I1AA 3DJ9A 3TBVA 3MRMA 2XQYG 1TJHL 4KXZH 5EG6C 1DSFH 1C5BL 3DIFB 3DBXA 1BBDH 1QKZL 3ZO0A 2H2PD 5EZIL 1EJ6A 4XZUA 1LO0H 5A2FA 1DEDA 1A6UH 2FIKB 3OL2A 2XWBB 4LLVA 3STZB 2HVJA 4OV5B 2C26A 3SKOA 1MJUH 5J12C 4PRIA 5HYJD 3OMZA 1GOFA 1DBKL 4X6EA 3QUXB 1F11A 1E6JH 4F7PA 1IGYA 1UM5L 3V5DB 1P4IL 1HIML 3N1PC 4J12A 5JMRA 2J88L 4PTTB 4XB7A 4E0RB 1KYOJ 3VXNB 3QHTC 3D2UD 4AIXA 3GMQB 4I48B 3UBXG 3X12B 4ZFFA 2FR4A 2LAGB 1M6OA 5J6HB 2EDTA 3ULVH 5C0AA 5FYKL 2AI0H 2BERA 2VLRA 5EC1B 3B9KC 4U0RC 3JWDL 2W38A 4JZNA 4Q9CA 2P5WB 3HUJA 4KJPD 2ZWLT 4OZ4B 2NY3D 4YHZH 4OM0H 4F3FA 4X5XA 3SCMD 4HIIB 5HYQA 1JNJA 5BZWA 1LP9E 5EC1A 1CT8A 1CFNA 3EJYC 5DTFA 3Q5TA 4JHAL 1PGRB 1UXWB 1Z3GL 2NY2C 1RUQL 3UBXI 1IZKA 1HHHB 2X4SA 5JHLL 4NPYB 3RZCD 3QEUB 3EW3B 3MLWL 5CJXA 1A3LL 1J8HA 5LQBL 1W2KT 5L7XH 1U8NA 2B2XL 2WWMC 2PN5A 4Y19D 5HHNA 1I8MA 5DA0B 4TSCH 4Y5YB 3P4MA 3KPRD 1KJMB 4XXCC 5I1JH 1GJIA 2XV6B 4OFDA 1KB5H 1LE9B 3O3BB 3QQNA 3QXUA 3FFDA 3F6IA 4M3JA 3X17A 3IKCB 4Y4FD 2BVQB 5FKPB 1JPTL 5C0JA 5ADPL 1G7LA 2R4SL 3H0TA 2EE6A 4KDTC 1QNZL 4NHUB 5KOMC 3SDXF 5SX4I 2VC2L 2E7HA 4KRPD 4MLIA 3QIUB 4WFFD 3QUZA 4OLZH 3IGAB 3L5HA 3I3EA 1OY3B 1KJ2A 4XRCB 3TO4D 3OJMB 4R96B 4O5LL 1NFDE 4NQED 3BVNB 4X4ZA 4XNZC 4L4VD 3MROB 4OF8A 3RWFB 2BNQD 5DK3A 3FOMB 5GSRA 4GAYB 4ZYKA 1MREL 4HV8B 5DHVA 2AV7A 3U9PH 4G7VH 4PRPA 3WDIA 1EHXA 3DBXB 4WY7H 4X6DE 2JJSC 4RMSA 4LGSB 2EKSA 4W4OC 4DQOL 3ZT5A 4HZLB 5AZEH 4UDUB 1ZMYA 2ICEA 4MAUL 4OGZA 4XP6L 2ATPB 1ZHBB 1KB5A 5C08A 4Y7MA 3G5ZB 4BZ2L 1AJ7L 5KG9A 4ONGL 5MI0C 3RWGB 4ODSH 4IRJB 4LLYB 3PWJB 4TUJB 4JY6A 1EO8L 4JPWL 1CXKA 1I4FA 1NEZG 1QTYT 4KQ3H 1X44A 5HHOD 5CD3B 2NNAB 4QYOA 4G8EA 3S5LA 5IT2L 3ZE0E 1OARL 3O4LB 2JJWA 3MNWA 4QHKJ 1LP9B 2J6EL 4O2FA 3KPRE 1ZEAH 4D9LL 1KLUB 2ZUQC 3QPQC 4X8JA 1T04B 5DJCB 4C56D 4O4YL 2FBJL 4JO1L 3EGSB 2NCMA 3CXHK 1JZ8A 4LLQB 5F72S 3SDDD 5EU3A 5JNYA 4PJ7A 5E5RB 4FMKA 4RZCB 1U93B 1NUNB 1KJ3H 4YWGH 2BRRL 3GDBA 4NJ9L 3Q0HA 3T0AA 4LRIA 2ITDB 4PD4J 3MREA 1QBML 2ADGB 1P4LB 1L7IL 1ND0B 2AQ1A 1JNNH 1QLEH 1MFAL 1IGMH 4NRXB 1V7ML 4XCCH 1MCOL 4WU5B 2Z8SA 1DVFC 2NY5H 3P9LA 1NBVH 3O8XB 3REVB 1D7FA 4K9EC 3WXWL 2Q3ZA 3U9UA 4CBPA 3V52H 3SJVD 4RISH 4OV5A 4HEPG 5C09A 4HWBA 4M5ZH 4K23H 4DVBB 3S3JA 1DFBH 4RGNB 4UOW1 2GFBA 5D5MF 1FFOB 5IEKA 4HLJA 3CFBB 4ORZC 4XVUC 3T77B 3PHQA 3QR2A 5IB3B 4MJ4A 2JK5B 1S7UB 3U4EA 5HHXH 3EJJX 4G9FB 2HFGL 4LNVA 3S37H 3VD7A 2FGWH 4HKZA 2FJFB 3MRKB 1F90L 5E2TH 3OBAA 4HKXB 5F1IA 5TFSH 3OR7B 2YSSB 5JA9A 4P9ML 3FQWB 4YE4L 3SGKA 4AIZB 1IT9L 4LPXA 3S6CA 4S1DC 3RL1A 4OCWL 5BV7B 3BH8B 3U9UB 1QSFA 3MRLA 3ES6B 4XWGL 2QBWA 1EVTC 1DEEA 4BELD 2H32A 2KBGA 4BZ1H 5JUEH 1T6WA 2NW2B 2EIEA 3L5XL 2VXTL 3GBNH 4J6RL 4JM2F 3RY6A 1PG7X 3O41B 5FEBA 1E4XI 2HJLA 2NXZB 3VE0A 2AABL 3OKDB 3FTGA 3WNPA 2VAAB 3RVTC 1MEXH 3O9WB 4ONOA 1I9JH 5HHPA 3L3JA 1EGJH 3AREB 3SE9L 2EXYC 3EDJA 2PCPA 1CXEA 4P9HL 1PVHA 2V2XB 4JAMA 1NBYA 3O8XA 2C3GA 4JDZB 4M62L 4R97B 1HXMA 4YDVA 1EPFA 3LEVH 3HR5B 3BZEB 2GEEA 4HQQH 4KC3B 2YUWA 3PIQA 5D70H 3SDXA 5C2UB 2ZZUT 4TUJA 3QCUH 1R24A 1FGNL 4GG8B 4C54A 3RUGE 1HINH 1F6FB 4I18A 5AYUL 2UYLB 2X9XA 2X05A 3VFRB 3OB8A 5D8JH 2NW2A 3WSQH 4HC1H 4NM4H 4KTEH 1IGIL 4LHUA 4X7CC 1A7RH 3P30L 4N0RA 5DZLA 4JPKH 3VWJC 3D0LB 4C4KO 3AXLA 4MZ2A 5F88A 3WXWH 3DTXA 1K2DA 1YN6B 1CLZL 2BCKA 4ZS7H 4PJ9A 3S34H 3QI9D 5T1KA 4WTZG 1MPAL 2WWKO 2P8LB 3D5OF 1FV1B 4D2NA 4FFZL 3AM8C 2Z8RA 3G6DH 3FQUA 4ZTPL 2H3NA 3K4AA 3QUMH 4NO0D 1HSBA 2D4FA 3MV8B 1S3KL 3CJJA 3P9WB 4MDIA 3GSRA 5D7LD 2L7JA 3DRTB 2MPAH 2YKLH 3KNBA 4Q2ZA 5C0GA 5DJ2A 3CH8A 5I73C 2OTUA 3AY4A 1CE1L 1YYLH 4ZO9A 3SBWA 1IVLA 2BNRD 4G6JL 3C08L 1B2WL 4FABH 2ADIA 5DD1L 5JXAL 5CSZB 1Z9OA 1TQBB 2R29L 2X6MA 1VEPA 2OK0L 3OKNA 1SQ2N 1EFXA 4X4XA 5C9JA 1CGTA 4Y16D 5K9OB 3D48R 3AS0A 4K2UL 3B9DA 2OR9L 4LL9A 1B4JH 1CFQB 3ARFC 4OLVL 1HILB 4WHTA 1NBZA 3FB8A 5EBLA 3NCJL 1BFSA 1UXSB 3KYNA 2W60B 1BD2E 1MAML 5F44A 2PO6D 3B4NA 3DX9B 3S35H 5C0FB 5D96C 4BSVA 3TYFA 2LABA 5FOBA 4W68A 4CN1A 5GZOC 4BYHA 5JHDD 1I1AC 5LGJB 1H0DA 3VXSD 3BW9A 4L9LB 1QR4A 3RZWA 5EBLB 1OF2B 3DUHA 3NGBC 3HFMH 3DETD 2VMFA 4P9HH 4LEOA 5DUPL 3H9YA 2Q7NA 3V8CA 1T66D 4P5TC 1BQHB 4PJ5B 5GS1C 1J0ZA 4YNYA 5FGRA 5HDBF 3QJFA 3IAPA 3QCUL 1RUKH 2IH3B 4HK3J 4XBGA 5CUSH 2XXCB 3IS1X 1YECL 1JK8B 2DQJL 5BQ7A 4J7RA 5EBMA 1ZE3C 2EECA 3ZT6A 3B2VL 1U8PB 2GTWB 3RVTD 2QR0B 1U3HD 4IMKA 2F53B 3BPNC 4OFVA 4IS6B 5EB9A 1KJVB 5FKPA 1T5XA 4QRRD 5B8CA 4FRWA 4AK1A 3C6LD 5IBUB 2PTTA 4QGYA 4AL8L 1P1ZA 1D9KB 3K3QA 1Z0NA 4F7EB 3CUPA 5TFSL 4H1LB 4KPHH 5E99H 3W39B 2RCSH 3X12A 4ZFFB 5AEAA 2Y5TA 4XTRC 5B38G 2YEZA 2R1XB 2XN9A 3BMWA 1TETH 1FGVL 2GQHA 4F33A 1FVDA 4I0PB 1JRHI 3LHPL 3MV9A 3O2WL 1RULL 4M93C 4Q6YA 3L3KA 2W9DL 2Y9RT 1B6DA 2Q7YB 3GBLA 5LWYH 3V8OA 2J3SA 5HHQA 3L6FB 1RUML 5E03A 1BJMA 3GSOA 3NCEB 4YX2H 2VLRB 2HA1A 3DHJA 4JRXE 2CH8A 3Q48A 3VXQA 1QYGH 4EDXB 3V52L 1IGJA 4XPAL 5CINL 3HZYA 1IZJA 1BAFH 4JRYA 4ZUTB 2V7HA 4X5XB 2NXYC 4UB0L 3ZDXF 1NKRA 4Y5YC 3T4AB 3CXHJ 1JPSH 1INQB 1MHEA 4YPJA 4RAUA 4NQDD 4XCEA 1IBGL 4PRHD 1KLGA 3FQTB 2BSTB 1R3HB 5HI4C 2CRMA 5HI3C 2WIIB 3PWPA 1MIEH 1AI1H 1D5MA 3MA9H 1N6UA 2Q86B 3H7BB 3WBDA 4EXPX 1HH6B 1M7DB 1I3RB 2AJUH 2IEPA 1FO0H 2NNAA 4OZHE 4FQHA 3LN4B 2ADJB 1C08A 4HWEH 5DA4A 4MD5B 1RK0A 2IGFL 4PRHE 3TWCH 1SBSH 4JFOB 1ZLUK 2R4SH 4NQEA 1YMMA 2DI9A 3RVUD 3VXQB 4WENB 4FNLH 1I3VA 1MLBB 1KSRA 4Y4HD 1MJ8H 1CDGA 5IGXH 5C0BB 4LIQE 4QHUB 4P4RA 4JCMA 3Q2CA 2MHAA 1E6OH 3RVXC 2XNAA 1FZMB 3SPVB 4FXGB 1C7TA 5CJQL 4TVSa 1VEMA 4TSAH 5HI4D 25C8H 4I0PA 4Z7UE 1I9IH 5L9DL 1CU4L 3MJ9A 4KV5F 3W0WD 2A0LC 4X6CF 3SHSA 3VFTA 5H94B 3EZJB 3HPJA 4HPOH 2KPNA 5DYOB 4EVNA 2Z91B 5DD0L 3SJVA 3GMRA 5DLMH 4MDJB 5IESL 4U1IB 4V2CB 3GJFH 3IETA 4A6YH 3VU2A 4EUPG 4JY6B 4L9DA 4NBYB 4OCRL 1UC6A 1SY6A 4XNQB 5L2KB 1P7QA 1FVEB 3QO1A 2F8XC 1FZOA 2AJZB 2FEDD 4HK3N 2ZUVA 4QRTA 3V0WL 1Z5LA 3QUYA 1TDQA 3TLRA 3MBED 5ESVB 5C1MB 4TTGA 4F37F 3AUVA 4OF7A 3SKNB 2ZOLB 3WCYA 5J0BA 4I8DA 4ELMB 4XPGH 5EOCJ 1AGEA 2EDFA 2R9HC 4QRTB 1A47A 4LNRB 4N90D 4OD3L 5F6IC 4Z76B 2B0SH 3UTTA 3O3DA 1NCWH 5D1QB 3QULB 2GK0A 3ARBB 5HDLA 2VERN 1D6VH 1QRKA 4BK4A 1AR1D 1BF8A 1AGCA 1KCKA 1Q72L 2Q7YA 1DQLH 4M7JH 1KT2B 1JZ7A 5JTWA 1FO0B 2BOBA 2YD2A 4IOIB 4YDLB 2E7LA 2AGJL 3HI6H 1PLGL 3GSWB 5I8KL 4R2GD 3GI8H 3ARXA 3VFVA 1A6WH 3EO1B 4HUXB 1EJOH 1NL0L 3ULUH 4A6YA 1AGFB 4HWEL 4XCCL 5C09D 2KZWA 2EDWA 5F9OL 3RNQB 2CXKA 4Y0GA 4WV1B 1Z9LA 2IANE 1JHLL 3A6CL 3DUUA 1BQSA 2XTJD 3CH1A 2VWEE 4X4YB 4DKDC 1K6QL 1LEKA 1GHFH 5BZDB 4TSBH 5JW4M 4AEIH 5D7IE 1YEDA 4S1SH 3C8KA 1K8IA 4XP4L 4Z0XA 3VWKC 4PFEA 2VUYA 4PGDB 1MCWW 4NNPL 5E56A 3NPSB 4UQ2A 5A2KH 1DN0B 43CAB 4MMXC 3E0GA 3FO2A 2WAHA 1EHAA 3HZKB 4YHKH 4PRIE 5E00A 5B39A 2DQUH 4FZEL 4XCNA 4G8IA 3K7UA 3FHAA 8CGTA 1I4FB 1KUMA 2R0ZH 2DB8A 4U1MB 3CSYB 4WCYH 5C0NC 1L6ZA 3SCMC 1KC5L 5D2NA 2YPVL 3RGVD 2IQ9H 4HUWB 4G42B 4E5XB 5I75B 5I74B 5FM5M 1G6RA 4CAGA 3QWOA 1PSKH 2EEDA 1JZ3A 2M1KA 3DGCR 3SEPA 3PHOA 1MFCH 4JFPB 1LEGB 5FYJU 1BZ9B 4NDMA 4NQVA 3WFBH 2F74A 4G3YH 1PYWA 4JN2B 2QQLL 4BQBA 3VH8G 2OL3L 4KV5E 4YDJB 1MFBH 4K07A 4KTDL 3KNBB 3RGVB 5SWQB 3CPLA 3HCVA 2X4UB 5GGVL 3T08A 3KYKL 2J8OA 1D9KC 5DO2D 2K1MA 4QEGA 4G7VL 4PG2A 1E4XH 2DQCL 4HWZA 5IB1A 4PBXA 4LLMA 4PJ9C 3WYRA 3HNVL 3LZFH 5A2JH 1D5IL 2E6JA 4ORGB 5HY9B 1SBSL 4QHLA 3RPIB 1V5JA 2ICCA 4U6XB 1XZ0A 3G08B 4HC1L 3ZMRA 4HUWA 4XPFL 5JXED 2PYEA 4NKDA 3BWAB 4XZUB 4XB8A 4KKBD 4BZ2H 1CDIA 5ESQB 4LSUL 4OQ1A 5KSBE 1FFQA 1AHWB 4G80A 4POUB 3SN6N 1Q9WB 4N0FA 2EC9T 5F88B 3G08A 2AEWA 1BQLL 2IMMA 4LQFL 4ZFZB 1HDMA 3MPCA 2ARWA 4M6ML 2UWEA 3H42L 5CEZD 3WHXB 2H41A 1F6AA 3PWNB 2AQ2A 3V6OE 4F15C 2J6EH 4Z7OE 4G6FD 3E2HC 4P2RD 3A67L 1KN2H 3FAWA 4NBZB 3UTSD 4FFWC 3R4DA 4PY7B 3OPZL 5HDOA 5DMIL 2FJGB 4PV8B 1JPFB 2GJ6B 2W0PA 3FT4A 4FOMA 5E4EC 4TTDC 4DGVL 1TTGA 4FQ1L 5EO9B 4C56A 1HYSC 4ZTPH 2PTVA 2F74B 3UPCA 4NYLB 5MERA 3MRNB 4GMSL 4P2RE 3DVNB 2BCKB 3X3GH 2ATKB 5EU4A 4GRLB 1KXQE 1CFNB 4JG1L 4F7MB 1SHMA 2R1WA 3B5HA 2IFGA 5GRYA 3QDHA 3MCKB 4ZNEE 2BHYA 3PP4L 1FORH 1NBVL 1KC5H 3SGKC 3WUWG 3WFCL 5B39G 4CRPA 2V5RA 2CMRH 5D7IF 1UXSA 2XN9D 2ARJA 5CCKL 3VI4F 5DQJA 1G9ML 5ADOL 2VDLH 5DC0A 2WUBL 4PPTA 3VMNA 4FQCL 3FQNA 1TNMA 4ZXBB 1M71B 3VXUB 2EYTA 4PRAB 4UT7H 1RIHL 3UTSB 5CLTA 1AQKH 4NN5B 2QADB 1JIBA 3HI5L 4R8WL 4UNVA 5I1HL 43C9A 5JOPD 5TF1L 1EXUA 1LMKA 3U4BL 1LD9B 3BJLA 1KJ2L 2WNGA 1AXSA 4OZFG 3O8XD 4NN7C 1D5MB 1EJOL 1NL0H 1YQVH 1NCAH 4J3XA 4WO4A 1JZ5A 1RZ8B 5FECA 3L95A 4HX1B 3SJVE 1XF2B 1DVFD 4TQEL 4KK9C 1REIA 3OXRA 4KI5C 1SBBA 4LFHG 4U4BA 1HI6B 1LO3H 2FJGA 2WIMA 4OI8A 4JFHD 5F1KC 4LRIC 4U1LA 2WWKT 4EUPB 1NGXB 1TJIL 1I3GH 3GJEB 4LFHD 3ZDZE 1RQ5A 3L6FA 3OV6A 2W65B 1KG0A 4KPHL 5CIPB 3LKSA 4HGMA 3L7EA 2QV2A 1RVFH 4FZEH 4ISVA 3EGSA 3P2TA 4ZNEA 1RK0B 1OWWA 1ZT7A 5BV7H 3G6AA 2GIYA 5HDBE 5E4EB 2FLBT 5IQ9A 4R0LC 2BNRA 2EE9A 7CGTA 2HKHH 2CUHA 1TCMA 1T83A 4HXAH 2ITCB 2X1WL 3FRUB 2VZ3A 4BQ9A 1LO0L 3P4OA 4HUVA 1XR9A 4XNQA 1HH6A 4HEME 4OLXH 1L7TL 4U3XA 1YEJL 4L8CA 3DV6A 3CVHH 3NVQA 3CMOL 3HE7C 3EOBB 1F97A 4MNQD 1DBAL 2ITCA 2B5IB 1JPGB 1JV5A 2IQAB 3K8LA 3MJ7A 4P49A 3I2CL 5FYLH 2ICES 5D2LA 2O61A 2IAMB 4JR9L 4M61B 2CO6B 3U2SB 3G6AB 1QPPA 5IWLC 4KHTH 4YH6A 4M5YL 3H6JA 1WBXA 3I9GH 3NZ8A 1I3RA 4M7ZC 4UNTA 4GFTB 5IEHA 1RMFH 2DTML 3PL6A 2F8VA 3C6LB 3RWFA 4NC0B 5LKNA 5C0IA 2BSTA 1FL5A 3QG7L 4HCRL 4WFEE 2B2XH 4NNXA 4IEFB 2HKFH 2XZQL 2BSSA 2HYMA 4XNYH 4KK8D 1DQJA 3ULSA 3ILQC 4Q9QL 3WXVL 3QQ9D 1NJ9A 1RJLA 4YHNA 3Q1SH 2J1KA 4YHPA 4LRNH 1CXLA 1FDLH 2OCFD 3GI9L 4WI7A 1P1ZB 4UDTB 2GAZA 4FXKA 3PL6D 2NY4D 3DO7A 3EZ8A 2R2BB 2QQKL 2CK0H 2Q76B 3MOBL 1IARB 3G5VA 2OTPA 2VDKL 4LHUD 5HJ3B 4P2QE 5IESH 4WTWA 3VWJA 3ZKND 5AAWA 5KW9L 4CJ1A 2OM5A 4CDGC 1KJMA 2Z31C 2EDEA 3UJJH 1I9EA 1NCDL 1MHCA 3TP4A 1LE9A 1M1SA 1J1PH 5INDA 2VLLA 1QFUL 4M4PA 3WLBB 4LCWA 1Q0YH 3IT8D 2IBBA 4P23C 2R2EB 4DZBA 3IDYC 5B21A 3ARWA 4LQ1A 3UTZA 3JV0A 4U1GB 5D1QC 2W0KA 5J8OA 1ETZB 4KY1H 3G04B 4M6OH 3MLZL 3TYGH 3GSXA 4LSPL 4WV1C 1L0YA 4HWUA 2A6DA 3ISWA 1ZSDA 2GCYA 4CVUA 3VD4A 1YNLH 1QFPA 4PRPB 5EWIH 5HHVL 1AXTL 3MLTB 4X6CE 3NA9H 1AGEB 9CGTA 1NCWL 5GRUL 4YIQA 2IANA 4DZ8A 5TH2A 4OKDA 5E8EB 1U8QA 2FEEI 4HQQL 3D69A 1M05A 4ZFOL 1UH2A 1DL7L 3CH1B 4H26A 1QSFD 4ZOCA 3PQYD 1RJCA 4R2GC 1KN4H 3RNKB 4PJIA 4I9WE 2E7LC 2DIJA 4YDVB 1MWAB 4NQDE 5BRZA 3ZKXC 4LSQH 3DSFH 1JE6A 2G60H 3BQUA 5T5NG 1UENA 4IOIA 1INDH 1NGWA 4JO1H 4PLNC 3JWOH 2NY1C 4MCZB 3D85B 2HLAB 1MH5B 3C60A 5CP3H 5CAYB 1AO7B 4ODXB 3O0RH 5L2JB 1C7SA 3KXFA 1P4BH 5DJXB 5E2WL 3S4SB 3BHBB 4WUUE 3QFJA 2JE8A 3NTCH 5C0CE 4JFDD 3LKNA 2CK0L 3IAGC 1UYWL 1IGFL 5F7MC 5I71B 5F6HJ 1TVHA 4G7YH 4PJDB 2WM0A 4MAYA 4H5SB 2QL1A 2X1QA 1EERB 4OUOA 2AXFA 3HRZA 5K9OA 4QHNB 3IDGA 4NUGH 2PW2B 1RJLB 4PUBH 1TCRA 3FRPG 4ALAL 3BN9D 2Y07H 4P2OD 2J8UA 4PLOB 1AGDA 2D2OA 2BOCB 4X9BA 4HJ0D 1FFNA 5GGSA 1KIRA 4DVBA 1PG7L 1QFWM 5DD5H 1QFWH 1AC0A 4FXKB 5TDNA 2NY4B 4PJXB 1FIGH 3H9SD 3VXMB 1U8OA 2W0FB 3FRPA 3ZHDA 1WZMA 1RZIB 5L0QB 4X7TB 3L3GB 2EDRA 1KTDB 2X4TB 3OWEA 1E4JA 3K1KC 2X41A 3VH8B 1T80A 5CBAA 2OMNA