4UIMB

Crystal structure of quinine-dependent fab 314.3
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
214
structure length
214
Chain Sequence
DIQMTQTTSSLSASLGDRVTISCRASQDISNYLTWYQQKPDGTVKLLIYYTSKLHSGVPSRFSGSGSGTDYSLTISNLEQEDVANYFCQQGNSLPPTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB 314.3
publication title Structural Basis for Quinine-Dependent Antibody Binding to Platelet Integrin Alphaiib Beta3
pubmed doi rcsb
molecule tags Immune system
total genus 47
structure length 214
sequence length 214
chains with identical sequence D, F, L
ec nomenclature
pdb deposition date 2015-03-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4uimB01
1DQJA 3TWCH 3E6FB 4JM4H 2BSED 2B5IB 1GJIA 3WS6C 1ADQH 1BJ1J 5EBMA 1LK2A 2R23A 3D25A 3P9MA 3GB7B 4O5LL 4Y2DC 3TNNB 5J11B 4FFZH 1HN1A 1A4KA 4ORGA 2VLLA 3M1BA 1KTDB 1OT2A 1YN7A 3MO1A 3L5XH 4LCWA 3LVEA 4FQQB 4YNYA 3C09B 1D5BB 3QQ9D 5EZJB 2DQDH 2VITA 2VNCA 4ZUUB 3O3EA 4OGZA 3HUJE 3QIBA 1BFOB 4JR9H 3MNVA 4TUOA 3QIUC 4LRNH 3MJ7A 4ODBD 5HGAB 4RAUA 3IRZA 4RDQG 3BPLC 3ARBA 4WCYL 1Z0MA 1MHCA 1T0NB 3PJSB 4HUVB 1FNGB 3O0RH 4Z5RA 5IBUG 5IEHB 4R9HA 1FHGA 3THMH 2YK1L 1BAFH 5F1NA 4KPHL 1B3JA 5BRZE 1ITBB 35C8L 4X99A 3P73A 1MCPH 2GKIA 4KJPC 5KG9A 2GFBB 2P1YA 1A1MA 1NCDH 3GJFH 4KY1H 5LGJA 5EU4A 2A38A 1IGFH 3L5WA 1A4JB 2ZUQB 3BP6B 4OGYH 4X80L 5FGCB 4XBGB 5BS0B 5KN5B 2HT4D 3VGAB 1GVIA 2J8UE 2X1QA 5I1CH 3ZDYF 5C3LD 3WV0A 3C2AL 1XFPA 3G6AA 4S0SD 1RQ5A 4I1NB 5I75C 4XCCL 1UADC 3QNXB 4GUPB 5HHVH 1KLGB 4M48L 3V7AG 2LFGA 3S7GA 5BZWA 2F53E 3FB7A 5EZOH 2AJUH 4U6HA 4XNMA 3CFBA 4OCWL 5C0JA 3RWEA 1A7NH 5IW3A 1YUHB 2DICA 2F58L 4HJ0D 4JO1L 4WFGD 3TA3B 5JW5A 4MNQA 1IEAB 4JANB 3WJJC 4QXGL 2PO6D 1GGYA 5DVNA 5D7JC 1N59A 3MJ9L 2HT2D 2FRGP 2BVYA 2F5AH 4KH2A 4XB7A 5E6IB 2BRQA 1WUNT 1G6VK 3FHQA 3IFLH 2F74B 1QKZL 3MCKA 3QNYA 5ALCL 2RB8A 1JK8B 4LSPL 5FV2A 4CVXB 3QI9B 3CXHK 3D3VD 3GSRB 3OMZA 2NZIA 5JXEC 1D5ZB 4Y5YA 1R3KB 2YC1B 4EQ3A 2B0SH 1BM3H 4DW2L 3W9EB 2AVGA 2OS7A 4HWBL 1I7ZA 2LU7A 3EO0B 4Z7WF 4H8WL 3T1FA 4K7FA 3FT3B 5I16B 5I1JH 4IRZL 1KXTB 4WU7A 5I2IB 4XNYH 3SOBH 2P45B 3OJVC 3H3PL 4FTVE 2EDOA 32C2A 4FN0A 3PQYE 4BH8B 2HVKB 1OP3K 4NKOB 1YMMB 1DBAL 1J8HA 3V5KA 3ARDB 2X4RA 2I24N 3TESA 2C3VA 3HRPA 3OKNB 5D7IB 3SDAD 1CDCA 2V2WA 3EO1B 5CUSL 3KPSE 2Q86B 3IF1B 3MLZL 4ZYKB 4WFEE 4X9BA 5B38B 4O51B 4I3SL 4KTDH 4OLYL 5L2JA 1A6VL 2VKWA 1OARH 1YYLH 3FRPG 2ZUSA 4YHLL 3TT1L 3C6LD 1HCFX 2BSRB 2CKBL 3T2NH 5C0RL 5C09E 3ROLB 1H8SA 3STBA 4WV1A 4LHUA 3ULVC 4LAJH 1KCVL 3LHPH 4EQ2A 3RVXD 3ULVD 4U6VH 1AI1L 1WCBB 3RIAK 4HUNB 2AV7A 5HI4C 5J12B 1JNHA 3QIWA 1G6RB 5CJXC 5ITFA 2V17L 5D7IF 4QRPA 1UWXK 4GS7B 1WBXA 5HPOA 2HJKA 3OB0H 4YUEH 4XPHL 3T2OA 1F02I 3SGEI 1A3RL 1DBML 3GSXB 5IJKC 4PJHB 2ID5A 4JZNA 2QSTA 2J2ZA 2CLZB 3WO4B 3MZTA 5I19L 1NEZA 1RZGA 1TQCB 1AQKH 4HSQA 4Y2OA 4IJ3C 4NFCA 1RZKL 4DQOL 3TM6A 5IROA 5IV2B 1TZIA 1IAOB 4Z8FL 2H1PL 4MCZB 3GSUB 1MCLA 5CGMA 3FMGH 5IR1B 3ULUH 5TE7H 5HI5C 1JFQL 4KVNH 4IOIA 1A6PA 1XCTB 2HWZL 2D4DA 1JVKA 5CHNA 5HI5D 3CH1B 3M45A 3SGEH 4UQ2A 2EIZB 5EN2A 5F1OB 2WUBH 4K94C 2HFGH 2RR3A 2X4UB 3SDDD 5C2BH 3UTTA 3VFWA 4YO0A 3WXWL 3U2SA 5DMIH 1UCBH 1WFUA 4NWUH 4QHKJ 1IAKB 1UH2A 1II4E 3P0YL 1AKJB 2XZCL 3OXRA 4XCNB 1PG7L 3TYFA 2V5RA 1HHKB 2NY1B 4XWGH 4YPGB 2VXSL 3W0WB 1IAII 3HC4H 3LKRB 4DK6A 3GJFK 4F7CA 1OGAA 3X13B 1QACA 3BZFA 3HC0A 3EBAA 3M8OH 4P3CL 4B0MM 4OTXL 5E00A 1HXYA 2AGJH 2HLFD 4KHXL 1S7UA 3VD5A 5DR5L 5HVGB 2R1YA 4EIZC 3ZDYE 3EAKA 4CN1A 4YR6B 4MJ2A 1PQZA 3W11C 4PRNA 5HHQA 3BXNA 3FN0L 3OKDA 3W11D 4IMKC 2R0WL 5INDB 1A6TB 1CDYA 4P9MH 3NMEA 1IAIH 4H5SA 3OJDA 3N06B 1KENL 5DUPH 2DJ4A 3SE4A 5BMFL 1NC2D 1V7NL 5B8CC 1I1AB 1TFHA 1ZLWK 3NFNA 3HFMH 4M6NL 2P24B 3NA9H 2DRUA 3DYMA 3PDDA 4MNGA 1N2RB 4ZO6A 2O5YL 4HMEA 1D6VH 5JPMB 1CR9L 3AVEA 3KYOB 3S88H 4XMLL 3AU1B 5JR1H 4YGAB 1OW0C 5BS0E 2APFA 3I2CH 2C1OB 1DSFH 3T65B 1MI5B 3BRGC 4G6JL 5F96H 5F44A 1CGWA 4Y2DB 3A6BH 1B4JL 1I3VA 4HXAH 1CLZH 5GGSY 2ILLA 3V9FA 3BZ4A 1S3KH 4HAFA 2WIIA 1UXSA 2AJZA 4IRSC 4QNPF 3MLRL 1HCVA 3UTSA 1UWGH 4L9LB 3WFHA 1FNLA 4P9HL 2VZVA 3H9SD 4LRIA 5E8EB 3QIUB 1BIIA 2JIXD 3DVGA 5DQ9B 1MUJA 3TO4D 5EG6C 3BPLB 1DFBH 4S2SA 3HAEG 2Y6SC 3F7VA 4Z7WE 3HA0A 5IEKA 1JNNH 2YPKB 3O9WA 4J1UB 1QSED 2WBJA 3RL2B 4F7PA 2F5BH 2QBWA 4M5ZH 4WV1C 4WEUD 1TXKA 2A6DA 4CGTA 4DGYL 4XNUL 4AENB 3T3PF 5CS7A 1V05A 4QXUL 5MHSD 4APQB 2HRPH 4UQ3B 1FFNB 1NAML 5IESH 2ED7A 2D7PA 2QQLL 2ZJSL 4I2XA 1T04A 2EYSA 3WSQH 2J88H 4YDVA 2H26A 2AJYL 3WD5L 43CAA 4ZTPH 4I77H 1GZQB 5FYLE 5BQ7B 2AJ3B 5D2NA 3TN0C 3PP4H 2ARJA 3QJHB 3VFMB 5H94A 2QHRL 3TV3H 2FATH 4JRYB 3V6ZB 4XPTH 2E9WA 1DLFH 3SDYL 3G5XB 3BKML 3HHRB 4TTDC 3WNLA 1ZA3B 2SEBB 2WQRA 1KB9K 3V6OA 4HS6A 1DP0A 1KJ2L 3SO3C 3DXAA 4RWHA 1G6RH 2K7QA 1MRDH 5E8OB 4XI5C 5DQJB 2PXYB 1OQOA 1KPRA 1GC1L 3P0VH 5E03A 2XNAB 3CFJA 1F58L 5CIPB 2DMKA 4X6DB 3O11B 2GY7B 2DD8L 3S4SB 3MODH 4NO0D 2EO1A 4OM1H 2FEDC 3FB6B 3PDOA 5D7IE 3VXRB 5JUEH 5KJRH 4GAYA 5D7JB 4JFOA 2N7BA 2DI7A 3O6FC 4GG6A 2D3VA 3SQBA 4X7CC 3HZYB 2HG5A 1A14L 1JPTH 5T1DH 5EU6E 1JPGB 4OBSA 1KBGH 4JQVA 2C3GA 4L9DA 3WFEL 1MCDA 3MRQB 4RAVA 3JWOH 3WLWD 4NUGH 3UPRB 2XZQL 1H15B 5CJOL 1D5MB 2UZXB 3EDKA 5K9QI 4NHUA 1ZHBB 3WN5B 1IBGH 2F8OA 4PGEB 5CGYC 2CIKA 4OFIA 1KTLA 1CQYA 2Z93A 4M1CD 1MCJA 1T1XA 4X6DF 3TBTB 4MDJA 5BRZD 3GKWH 4ZNEE 2NX5D 3BN3B 1IKFH 2MCG1 5F7DB 4N0CD 4LK4A 3IDMA 5T5NG 3U1SL 1UGNA 4NWTH 5I1DB 4PJHE 4J3VA 1RZJL 2EDXA 1D5XA 1PEZA 3MBEB 4LPXA 4O58H 3GBML 4OCXH 3OBAA 4ODTL 4OIBA 2VERN 3SBWC 1OHQA 1KCRH 2DTML 3L5JA 3QWRD 3RWHB 5D8JL 1I7UA 4HT1L 5DRWA 2X4TB 3HC3H 2CRZA 3SE3C 4NT6B 4DKEH 4YXHH 1V3JA 1YJDL 3MUZ1 2UWEB 3E8UL 2NY0B 1DQJB 4GH7B 4XT1C 1KCSL 1ZANL 1YEDA 1BZ7B 5KOVC 3NAAL 3P9MB 3QDGB 3FQXB 1P1ZA 2G5BB 3M1BB 2YOCA 3BE1L 5HY9A 1FG2B 2FJHB 1R3JA 1X5IA 1YN7B 4H26A 5GGTL 4LCWB 4K3GA 4YNYB 2VITB 2EIDA 5LWYH 5T1LA 5HDQH 4KRPC 2R29H 4LRIC 3QIBB 5DA4A 3MNVB 3GK8H 4KRPD 4TUOB 1CF8H 1FORL 5LJYH 3ZKMC 1ND0A 3EDJA 3VGFA 3S34L 4RAUB 4Y4FC 4NN7B 1U91A 1MF2L 3W0WE 1CN4A 2KQMA 1HI6A 4TNWF 4FQJL 3WLBA 5DT1H 4OLUL 3ARBB 2AK4D 3MZGB 1MHCB 3LS5H 4KUZH 4OZFA 4PJBB 4Z5RB 4R0LC 4NM4H 5JTWA 4GQ9L 4P5TC 1QRNA 1F3DH 2VABA 1O0VA 3DX6A 5HHOA 1IFHL 1FBIL 4Y5VC 2Z8SA 3FFCB 1CICA 3P73B 4PJEA 4IRJC 4UT7H 5LXGL 1A1MB 4IRJD 5LGJB 5EORL 3UJTL 2BSSA 3RJQB 3PQYD 4QNPE 5KSBB 5K9OA 1A6AA 4I0PA 4Z0BL 1S7WA 3U7AA 1C1EH 2CH8A 2X4OA 3U83A 3G6AB 3KPSD 4UU9A 4P2OD 1CT8A 5IW1A 1Y18A 2JJTA 2W9DL 5K9KB 3C8KA 4WFED 4XHQA 1JZ5A 4CUCA 4CRPA 1J1PL 2FIKA 5HI3C 1F4WL 2DYPD 1TVDA 5FEBA 5CEZL 3RWEB 3IU4H 4PRHA 3DSFH 4MNQB 4Z7UB 1LO3L 3RGVD 4KDTC 2EZ0C 4CMMA 5C09D 3JTSA 4UNVA 1U8HB 1MWAA 3WNMA 2B39A 3LS4L 2OQJA 5I15H 3SCMC 4R90H 4YHKL 4DTGL 4OCSL 4M93B 3E0GA 2FECI 3HCVB 3RKDC 5F7FA 1B0RA 5HVHC 3CFKB 2P4AB 4U1SB 3MCKB 3QNYB 3QO1A 3H7BB 5KVEL 3AMLA 3VFVA 2FHCA 4F33B 1YYMH 1XF4A 3TPUB 4ZSOA 5FKPA 1SHMA 1DQDH 2CK0L 4RISL 1EA9C 3C08L 4WHCA 1C16A 5E2VL 4QRSA 5J13C 2X1XR 5IVXA 3WUWG 3O2DA 3T1FB 4K7FB 4GW5A 4KZEL 4XC1H 1DBKL 1QHPA 2E7CA 4Y8DC 3RRQA 1AP2A 1VACA 5IHBA 3OKMA 1C5DA 1MLCB 4PLOB 4JRYE 2FHFA 3V5KB 1J8HB 2X4RB 5TGBA 5ANMA 4LPVA 1K4CA 2C3VB 2X44D 2V5TA 5I8EB 3OZ9L 1R0AL 4WHYG 3GMQA 3PGFL 2V2WB 3QWQB 1RUQL 1OTTC 1Y0LA 4MD5A 1RZ7L 4K9EL 3QXWA 4IRSB 4DAGL 1BJ1H 5CZXC 3S96A 2X4SA 4KUCF 3QEGH 3K4AA 4EZMA 1AHWC 1G7PA 3T8XA 4OUUA 1FH5H 3ET9F 5E6ZA 2FD6L 1M71A 4NQDA 5L2JB 3CX2A 4X6DE 1N5YH 5E7FA 3U0WL 1E4XL 4TVPH 4FFWC 3VXRE 4F37F 2B1AH 1QRKA 4LVNB 3EYUL 2FZ3A 3FQNB 2A83A 2GTZA 2W9EH 3L9RA 4LHUB 4WV1B 4NCDA 1NFIA 5HYJA 4A2LA 3KVQA 4WWKA 3NCBB 4HCRA 4S11A 2DQEL 3LRSB 4NQVA 4YWGL 3T0EA 1JNHB 3QIWB 1UM4L 3G5YB 5ITFB 2DLFH 4D0CB 3BIKA 2HJKB 2HN7A 3NCJL 5BZDB 1NCTA 1QTYT 1YNTA 3AS1A 1H3VA 1EEQA 4JZNB 4LMQI 3TN0B 1D9KA 5LCVH 4QF1A 4FQLH 3AM8A 4K8RC 4LLUA 2EXWD 4NQTA 3VFNB 5L2KB 1NEZB 3FN3A 4OD3H 5JORA 1RUAL 1RZGB 4F8TA 5FOBB 4FQCL 4U3CA 4P4RB 4A6YB 3HI6H 1QLEH 3QB7C 1BF8A 4X6BA 4OIIH 2X4PA 4XP4H 4PTTA 2AJSH 4YC2C 5ENWA 1QQDB 4IOIB 5KSAD 4TVPE 5L88H 4F2MA 4MX7B 1CFVH 4X0KB 4YBQC 1Q0YL 2FX7H 1A6UH 3WIIL 5E9DD 3VFWB 4PRPA 4YO0B 2EE6A 2O5XL 5D7SH 5IVZA 2R56H 4OZGA 4X7DC 1JZ6A 3K3QA 3U2SB 1WIUA 4OKDA 4MLSA 3OAUL 4ZTOL 2CSPA 4TRPH 3E2HB 4NNYA 3TYFB 4D0BB 5SWSA 3AUVA 3TA3D 5DJZA 4EN3A 3B5GA 2UV3A 2E27H 1NLDL 4MS8D 3L7FA 4DJMA 2DBJA 4RMWA 3NN8A 1HOCA 4F7CB 1F8TL 3KYNB 1OGAB 1ZHNA 3HC0B 3P4OA 4Z95L 3BT2H 1HWHB 2PYEA 2DTSA 4LCWE 5CJBA 1HXYB 4K94H 5E00B 2I5YH 3TFKD 3BP7A 1VDGA 3S3JA 3ARUA 1NL0H 1S7UB 1YC7A 2BERA 2R1YB 2E7HA 2Q3AA 2Q76A 1F6AA 4EUPA 1ZE3C 1PQZB 2A9MH 4PRNB 5HHQB 2FDBP 3T04D 5ELIA 3OKDB 5FYLD 2AXJA 2A0LC 2B20A 3CLEL 5JHLH 2A0LD 1EEYA 1G0YR 3QSKB 4H5SB 2XICA 1HWGB 1RURL 5EOTA 4YFLF 4NGHL 2Z4QB 3VRJA 2VXQH 2XN9A 3O6LL 4CADB 1S7XA 5AD0A 2BZDA 3MLTA 1JI1A 4MNGB 1WQVT 5DD0H 1WF5A 3QUXA 1VCAA 2WP3T 5LBSL 5HTSA 3EIFA 4XC3L 4M7LH 2DM3A 4XP9H 3VXSB 2EH7H 3ORJA 5EC1A 4NQCA 1N0LA 2R9HD 1BLNA 4ZUWA 3BZ4B 3PABA 4HWEL 1UXSB 2AJZB 2ENYA 3UTSB 4J2XA 1NGPL 4GJTB 3HE7A 5EU6D 3WFHB 2VISB 2YD9A 5C08D 4R4FL 4XPAL 1RUPH 1I9JH 4QWWD 4ZQKA 4K2UH 3DVGB 1YEGL 5C0CD 3ILPA 3O6KL 2M2DA 4S2SB 3IVKA 4MNQE 3ZTNL 1CTOA 3LSOA 3F7VB 5J7CC 5IEKB 1GYAA 3O9WB 3X12B 2A9NH 1FE8L 2BDNH 4R0LB 5DFVD 2WBJB 4F7PB 2N56A 4FQXD 5GJTH 1TJHH 2A6DB 3B2UC 3JV5A 1QR1A 1UC6A 1FGNH 3IFPA 2ESVA 4O9HH 1YEHL 3MXWH 1DL7H 4I2XB 4RAHA 1T04B 1S78C 4QHKI 43CAB 2H26B 3ZYJA 1D6EB 2NLJA 3MPCA 2EYTA 2JJWA 3VFTA 1D9KC 3F12A 2ARJB 5H94B 3TWCL 4JM4L 4M43H 1OSPH 1ADQL 4LSTL 1ZVSA 5IK3A 3TJHD 1DN0A 1B2WH 1WT5A 1ZT7A 4FFZL 1BD2A 1F3RB 4HS6B 5I1LA 3HMWH 1MCEA 3GMOB 3DXAB 2QKIA 3H2WA 2Q1EA 3L5XL 4R97C 2DQDL 4Z6AT 3ZE2F 4H0IA 4ETQA 3CFJB 1MFDH 4TNWK 4JR9L 1VPOH 5GSVA 1J8HE 1U8IB 4LRNL 5GISL 1DQQB 4XHJC 1CCZA 1IC1A 3DSNA 4N8VG 2APTA 4GG6B 3SGKA 2HG5B 3EYSH 3O0RL 3SCMB 2GJ6D 1WEJH 3MV8A 4A6YH 4H1LG 1BAFL 3OAYH 4MLIA 3BPNC 3ULSA 4RAVB 2KH2B 7FABH 1OTUC 3SGDI 3B83A 1MCPL 1HSAB 4NHUB 1MFEH 1S7VA 1UEYA 1I3UA 2DLIA 1NCCL 4WO4C 4KY1L 3CZFB 4OFPA 1XIWD 3VXOA 1KTLB 2Z93B 3QHZL 5J13B 1T1XB 1FG9C 3SKUD 2XWJA 4MDJB 4OSUH 4KI5F 5I1CL 1IM3A 5J06A 4QRPE 1WLHA 3IDMB 4BUGA 4GG6F 1HK6A 5AYUH 5E4EC 3PXJA 2YPVL 5HHVL 4HUXA 4R8WH 3X11A 4EOWL 3DUUA 3T0VA 1D5XB 5EZOL 5L2KE 4WWID 4PGBA 1IKNC 4C59B 4QRQA 1SQ2N 2NXZB 1F13A 4JRXD 5AZEH 4LL9A 1E6JH 5DRWB 2KZWA 5DMJB 4M4RA 3CSPA 5EOQH 2DF3A 2F5AL 1MCQA 3QUXC 1LDPL 4LLVA 4H0HB 4ZNCD 3LPGA 1BREA 4EI6A 3H9YA 3LMJH 3IFLL 4U1JA 3LQAL 2ICEA 4NKQB 5A2FA 2NW2A 3UTTE 1P1ZB 5HY9B 1MVFA 1GGIL 1R3JB 4Z7QF 4H26B 1IQWH 1U41A 5DHXB 4V2CB 1RZIA 5T1LB 3C60C 3HE7C 1GZPA 1MIMH 1BM3L 4TPRL 1WV7T 3UP1A 4WVRA 4U2YA 3BGAA 3O4LB 1ND0B 2AXHA 3UTQB 4F9PA 4PGCA 1U91B 1XCQA 3QISA 2RBLA 3V6FA 1MCWM 2NNAA 3WLBB 1R5IA 4JGJA 4JY6A 3K2UL 4PB0H 2BVPA 3UZQA 2R0ZH 5DQDH 1OGAE 3UBXA 3SOBL 1OSZA 4NC1C 1EMTH 3V5DB 4U1HA 3AXLA 3GHBH 5DJXA 2VABB 1JGEB 3DX6B 5HHOB 5LGKA 4APQD 2DL9A 4ONFH 5DD3H 3I84A 4XPGL 3LPFA 1EK3A 2FYYA 1YNKH 4F7MA 3WXVL 4N9OB 1SMAA 3VH8A 4PJEB 4XCFL 4Y5XC 5D1QD 2K1MA 3IRPX 4YC2B 2BHUA 1S5HA 2D2OA 4UV7H 5HGDA 5DDHB 3OKLA 1WZMA 4QYOA 2CMRH 5IG7A 3BX7C 2BSSB 1AQDB 2A1WH 3CD4A 4RSVA 1RHHA 4JRYD 5K9OB 1ZHKA 3H6JA 1A6AB 5GRVK 5K59F 4F37K 2A74A 1OARL 1YYLL 4I0PB 4BSVA 3VXQA 2X4OB 3ZSTA 2PCPB 5CD5C 4UU9B 5JW4N 5IW1B 4HFWA 4CJ0A 4CVWA 4HMDA 1JIBA 2VIRA 4XCYA 3LPWA 3C8KB 2XKUA 2YHGA 4MNGE 3T2NL 5T3ZE 5IMKB 1PY4A 1MFBH 2PXYD 2FIKB 3LHPL 3RWIA 3LRGA 4U6VL 4UILH 2UYLA 3DETD 1OWWA 1AR2A 4H88H 4MAYD 3FTGA 3VFPA 3VXRD 1I1FA 4K7PX 4YUEL 1T1WA 2IC2A 4G8GD 4KI1A 1B4RA 1JPSH 1G9EA 3JTSB 1A6ZA 4QXWA 1LE9B 4UI2A 4JN1H 1MWAB 4LVHB 1CE6A 2CQVA 1AGCA 3UTSE 5KVMC 3VGDA 2OQJB 3MQIA 4ZD3H 5C0BA 1DBJL 1CFTA 4L4JA 1H0DA 2NR6D 1INEL 3O4OC 1IARB 3KWWB 1AQKL 1S7SA 1B0RB 2A6IB 5HGGS 3QO1B 3RVWC 3BUYA 2BSTA 4OQTA 3UZVB 3GI9H 4M7KH 3VFVB 1XF4B 3FMGL 1HDMB 2IAMC 5FKPB 5TE7L 4KVNL 4KQ4H 3IAPA 2HTLC 5E1AB 2R2EA 5T1MA 3GSVA 1C16B 5F7EH 4MHHG 1G7LB 1U9KA 3ZE2E 5HPMA 3GRWH 5IWLA 3MFGB 3RZCC 1QNZH 2E8YA 4XPBH 2ZG1A 3RZCD 1SYVA 4GW5B 2HFGL 1MOEA 1UJ3C 4P59L 5C2BL 4I2XE 4RX4A 5ICYA 1GPOH 3PWLA 3SKJH 5ADOH 5DMIL 4NWUL 1AP2B 3OAYK 3D6GA 2HJFA 5D2NE 4DFIA 3OKMB 1IQDA 4Q6IA 4WTWA 3TGXA 4MXVE 2GAZA 5ANMB 1K4CB 1IGYA 1SY6H 3V0WH 4XWGL 3QAZC 1FFQA 2VN7A 4FOMA 3BEVB 3HC4L 3FL7A 1MJ7H 3QUZA 4MD5B 1Y0LB 3ZMRA 3S96B 5GPRA 3DROB 3V6OE 4KHTL 4R96A 3DXAE 3T8XB 1D5IH 5F72S 4OUUB 1ED3B 3MRHA 1DBBL 4Y1AB 1M71B 2ZKHH 4NQDB 1A7BA 2AGJL 2OK0L 5IVXF 4D3CH 1INDH 5TH2A 1FYTA 4C56A 2KPNA 5TF0A 2FZ3B 2A83B 4GG6E 3L9RB 4NKIL 5EU7E 3HE6A 4P4KA 1NFIB 5HYJB 5DK3A 5IVOA 1I8KA 1FLRH 1IAIL 1EUTA 3I02B 3QIBD 1M7DA 4NQVB 4G7VH 4ONGH 4ZFOB 3QPQD 5DUPL 3D2UB 3JTTA 2HN7B 2OX5A 4LIQH 3D85A 3ARBD 3HFML 4NUJA 4EJ1C 5FF6A 3K1KC 3NA9L 1YNTB 2CR3A 1D6VL 1D9KB 4BQBA 4LLUB 3S88L 5JR1L 3P9WB 2VDRH 1S8DA 1VFAB 2HA1A 3F5WA 4MJIA 5C6PB 5JORB 3NIFF 2VZ3A 4LAQH 1NGWA 1DSFL 3OWEA 2I27N 3A6BL 2FO1A 4XBEL 4HXAL 4X6BB 3KJ4C 5C6WH 1CLZL 2X4PB 4GSDL 4PP1D 4Y4HC 1S3KL 4PTTB 1KELH 3MRPB 4YGVA 3S5LA 5ENWB 1FL5A 1HSBA 2ICES 1UWGL 1CLCA 1KFAL 4Z7QE 4M9OA 4L4TA 4F2MB 4JCMA 2E7MA 2FLRT 3DGCR 4H25B 1T5WA 4WRLA 3FO0L 4NBYB 4K8RH 3U4AA 4PJ9C 4JDTL 4PRPB 5IVZB 3KPQA 4OZGB 5DJAA 1U95A 1CG9A 2F5BL 4LIQE 4M5ZL 4QCIA 3X14A 3S8WA 3BHBA 3RL1A 3BPNB 3TT3H 4NNYB 2H2SD 2OBGA 4JG0H 4X9FA 5DJ6A 5DJZB 1I9EA 4MNQD 3QQ3A 2HRPL 3KDMB 3L7FB 5IESL 4ZS6D 3NN8B 2CRYA 4WO4B 4ZXBC 3WSQL 1X5AA 1OWRM 3K81A 5B4MC 4ZTPL 1WWCA 4I77L 4ZXBD 1ZHNB 3P4OB 4FS0A 3K80A 4KZDL 3BEWA 4OQ1A 3KR3L 1S9YB 3PP4L 4P3WA 3BP7B 3TV3L 2FATL 2VLRA 3JBG7 4XPTL 4ISVA 3PWJB 4OZHA 1X7QA 1DLFL 5K59E 1S9WB 5FHBL 3V4VH 1UXWA 4LLMA 4OJFH 2Q76B 4HWZA 3SKOA 1F6AB 1UYWH 4EUPB 4OZGF 2C4FU 5D93C 4OCNC 4ZDHA 3K4DA 4KUCD 3BESR 1G6RL 1EVTC 5CZKA 1MRDL 2EDTA 1CYGA 3OR6A 3HKFA 5TE6H 1BVKA 1ACYH 2DWEA 4L8CA 5EOTB 5HHOE 5HYSG 3MODL 3BVNA 2X70A 4PREB 3RDTA 3VRJB 3F6IA 5JUEL 2XN9B 5AD0B 5KJRL 1S7XB 4PJEE 1X5JA 5DI8A 3K74B 4LCCA 1E28A 3PHQA 3QUXB 4JG1H 2JCCB 3I75B 4JN2B 3C5SA 1C5BH 1JPTL 1KT2A 4UDUA 1KBGL 5D9SB 3NFPA 1E6OH 4CMHC 1J8HD 5EC1B 4NQCB 5FYKE 3JWOL 4NUGL 3HR5A 1BLNB 4ZUWB 4HJGA 4JFEA 2E6JA 4DN3H 1NLBH 4KC3B 1NGQL 2P5WD 3PGDA 5E2TH 5C9JA 4KWUA 3C60B 3HE7B 4PP2B 1XZ0B 2ZUXA 1YEJH 4RGOH 4ZQKB 1LQSR 3VFSA 3GKWL 3U0PA 1NC4A 5E95B 1PBYA 3ILPB 1C08A 2XPGA 4NIKB 1IKFL 3AS0A 5D7KE 1ZT1A 1F6FB 4FFYH 2Y07H 2R69H 3LSOB 1UH3A 4NWTL 5F9OH 4OF7A 1FZJA 1IM9B 2AV1A 3RY5A 3TEUA 4LHUD 3ZKQD 2AEWA 4MJ5A 5HGBA 1G7QA 4O58L 4U1MA 2BVQA 3QZWA 1QR1B 4RMTA 4DVBA 3QIWD 4RRPG 4WW2A 2VXUH 4QRPD 1U42A 3C5ZA 4R2GC 3FT4A 4Y5XB 1W2KT 5E99L 1RJZA 2DQCL 3REVB 3B6SB 1A02N 2EYTB 1K2DB 4YXHL 4U7MA 3S97C 4ZSOE 3VFTB 1AC6A 1N3NA 4FXKB 3RPIB 3F12B 2ED8A 5KZCB 3Q6GH 4U1GB 1JHLH 4KMTH 2EDLA 3L3DB 1MY5A 4ZPVA 5IK3B 1ZVSB 2N1KA 4WENB 4PG2A 1TNMA 1DN0B 1ZT7B 4Q74A 4HQQL 4PRID 1BD2B 3BPCA 4GRLC 5I1LB 5F21B 1KJVA 2QKIB 4LVOC 1MQKH 3OJMB 1UKTA 5E94A 5HDQL 3EHBD 4ETQB 2R29L 1OGTA 1BFVH 3GK8L 1CF8L 3NZ8B 4I13B 5ANME 2Y5TA 4XPFH 3T4YB 5H37G 3UTTD 2NYYC 4N8CH 1KLUA 3QEQA 3QQ4A 2PKDA 4HGMA 4HWNA 1HHHA 3LS5L 4KUZL 3BZEA 4NM4L 5GRUL 1FN4A 3O4OB 2FB4H 1PLGH 1J88A 1J86A 3OF6A 3SJVD 4NQDE 1JCKA 3ULSB 5HVWA 2D7NA 3NIFE 4JKPL 3JVGC 3BIAX 3F8UB 1OD7A 4UT7L 5DFWH 1MCHA 1OAQH 2VUYA 4HIXH 1J11A 4OFYA 5HYJE 3EDDA 4G9DA 3B5HA 1C7SA 4MD0B 2XWJB 3EYOA 3L6FA 1XR9A 5GRJL 4JFDB 3ZT7A 4YK4C 5JMRA 5JA9A 5C0ND 1IM3B 1YDPA 2VAJA 5J8OA 2YKLH 1C1EL 5IM7B 3DWTA 2NY4C 2X4QA 5BVJA 5FA4A 5GRWA 4HUXB 3X11B 3E3QC 3DUUB 1HXMA 3CZJA 4PB9L 5B39B 3WHXA 5EULV 4LSQL 5CSGA 3CXDH 2ERJC 4PGBB 5D1XA 4KGLA 1NMAH 3QAZB 3IU4L 3RU8H 2ICWJ 1G7MA 3DSFL 5JNYA 3V4UH 1B6DA 1NGYA 1SEBA 3MBXH 3VXUA 5CCKH 5T3ZD 6FABH 2OL3B 3PIQA 3AB0C 4ZOBA 5C8JB 4XXCA 5I15L 2OTPA 2W91A 4LLVB 2WK2A 4R90L 5GS1A 2H41A 1P84K 4EI6B 4D2NA 1I7RB 2CIIA 4AIOA 4U1JB 2Z31D 4GKZA 4MYWB 3MV01 3HZVA 1R5VA 1ORSA 5HYQA 3GMRA 3EZ8A 4HFUH 1XR8A 4PRPE 3VXPB 3UTSD 1U8NB 1YYML 3MGAA 4OZGE 3MRCA 4HS8H 3PGCB 1RZIB 1WVZA 3OTTA 1HYRC 5DZNA 4P5KB 5SWZA 5SWSE 1CWVA 1WSST 3CFEA 4RBPH 4AIZA 3UTOA 1XCQB 4CAGA 2WINA 2NY3C 3O9WD 1KN4H 2NNAB 5LVEA 1R5IB 4JY6B 3IJSB 2BVPB 5IFHH 3K0WA 2WBJD 2FECL 4S10A 8FABA 5DWUH 1OSZB 1Q9KB 4YHNB 4I9WE 3T0WA 4U1HB 5DJXB 2CDGA 3B9KA 4LOUD 2XTJC 3OG6B 1XGYH 3EJYC 3N50A 1CE1H 2WP3O 3LOWA 2XTJD 1CFNA 4JFPB 1S7QB 2FYYB 3KJ4B 4OCRH 1UKSA 4F7MB 1XF3A 5DJ2A 1F4YH 4Y4HB 1W0VA 3VH8B 3D48R 2P8PB 4PJIB 1HYSC 2AEPH 5MI0C 3AMKA 4QYOB 1KXQE 3QEGL 5ILTH 2IF7A 1RHHB 1CVSC 1ZHKB 4JZJA 5FM5M 5C0FA 2A74B 4LCIL 1DEDA 3EYQC 4BSVB 1N5YL 3VXQB 3UYRL 1REIA 1FAIH 4TVPL 4HFWB 2XN9E 4LP4A 2B1AL 2VIRB 4XCYB 3GUTA 4YHIA 5EO0B 3DXAD 4K7PH 5F1KC 5H35A 2JCCE 4OIAA 1MCCA 3MLSH 3RWIB 1ONQA 1CXIA 1X9QA 5IMMB 1AO7A 5BW7A 2FNBA 2UYLB 3RBSA 4J23A 4KI5D 3SO5A 4NQCE 5FA3A 2DLFL 2C26A 5L0QC 5DK2A 3IFNL 5ICZB 1T1WB 5LGHL 4OF0A 1I1CA 1A6ZB 2Q3ZA 3SE8H 2IPKB 1CE6B 5LCVL 1AGCB 4YEFA 4FQLL 5JMOC 3IB4A 2WWKT 2D31A 4WHDA 5C0BB 1CFTB 4Y19D 1H0DB 2XKNA 3E1F1 4OD3L 3ZDZF 1R3IL 1WTGT 5I1EH 1JV5A 3KPOA 5T1KA 1S7SB 3TBVA 1ZKAA 3HI6L 1QLEL 1F90L 2DQGL 2X4NB 2BSTB 4OIIL 4B50A 5D93B 2KDGA 4XP4L 5E5MA 2AJSL 2XA8H 4LEXH 4BJLA 4U0QB 1EBAA 3KHQA 1FO0A 2R2EB 3GSVB 4LDLB 5L88L 1OAUH 1CFVL 4YH6A 4HBCH 1AGEA 1CU4H 3MLXH 4KKLD 2ESVE 2VLJD 1YY9D 1RULH 4O02H 2FX7L 1CZ8H 2YD4A 3P11L 3BFOA 1UENA 2J6EH 5D7SL 2LTQB 4UDTA 5ICYB 2R56L 5SV3A 4TUKH 4UV4H 5KAQG 1FVDB 3IDUA 3U7YH 3ARFA 4YDLC 4CMHB 2HJFB 5IW6A 3MUJA 3N85H 4OZ4A 4EI5A 2ADIA 4TRPL 4C83A 4Q6IB 1YN6A 2O61B 3CDCA 4LU5L 4LLYA 2CRMA 2A2QT 3H9ZA 3ARGA 2VE6A 3QUZB 1N5AA 1BD2E 3EOTH 3KPLA 1A7RL 3TO2A 4R96B 2BXYA 4PJDA 5EU5A 3MRKB 2FLBT 5EO9A 2I5YL 2L0DA 4AT6A 1T89A 2AW2A 3TIEA 1NL0L 1CD1B 4OV5A 1KGCD 5TH2B 1A2YA 3B8YA 5KSVA 2DQTH 5HHNA 3TVMC 1I8LC 2EXYC 5F6HJ 5DHVA 2A9ML 1I85A 1P4BH 5GGSA 3HE6B 4P4KB 1BQHA 1T7WA 2L7JA 5T1LD 1I8KB 3VWKA 2EDDA 1A3QA 3MV8E 3SY0A 5JHLL 4F7EB 2F54A 1DJSA 1M7DB 2Y72A 1JPFA 1DEEA 3TIDA 2OL3H 4YHMH 4HV8A 4UZGA 3JTTB 1U3HA 4FQHA 3U36A 2VXQL 2DM2A 1EVUA 3D85B 1QFUH 5FF6B 5C7XH 3AREA 3QUYA 5DD0L 4X4ZA 2F15A 3B9EA 2R8SL 3AS2A 4P46A 3WNOA 1JYWA 2CO7B 1QRND 3F5WB 4MJIB 1MFAL 4MDIB 3SE9L 5FB8A 1MCKA 1KG0A 4YHOH 5AYQA 2WNGA 1FZKA 2FH8A 4X6EA 1CICD 3QXUA 1A1NA 3D0LA 3PWPD 4GRLB 4N90D 3NFSH 5L9DH 1YZZA 4YGVB 3S5LB 5CILH 3QDJB 3BP5B 4LVOB 1FL5B 3MA7A 3QUMA 5TE4H 1WBYA 2X9WA 4D9QE 1X6NA 1WC7A 4MXWH 3D9AH 4L4TB 4F3FA 1KACB 1RUPL 1I9JL 1X4XA 4NQSB 2I26N 2P8LB 5FYKD 2XQBL 4K2UL 3D0VB 1T5WB 3BN9D 3R0NA 1LO4H 2VTFA 4PJAB 4RMSA 2B2XH 2A9NL 5DJAB 2BDNL 1I9IH 5AWNH 1U95B 4E42A 3X14B 1HILA 5DMGD 4J3WA 5GJTL 3BHBB 4BFEA 4PUBL 1TJHL 4QRTB 5DGRA 2YRLA 4NZUH 1FGNL 1TIUA 2BMKA 5DJ6B 4PRHD 3RHWF 3VWJA 4NZTH 3QQ3B 4MCYA 4CL7A 4O9HL 3O2WH 1DL7L 5F97E 4HUMB 3CSYA 4L3AA 3MRIA 1EGJH 2GK2A 3BEWB 1BHGA 3O3DA 4JKWA 4C58B 4LEOA 1FLTX 4JQIL 4LDEB 1CXHA 4P0DA 3MC0A 2VLRB 1OSPL 2J5LC 3JUYA 5D2LB 5IFJB 4ISVB 1X7QB 2NY4B 4XGZA 1BBJA 1B2WL 4HWZB 3SKOB 3DIFA 4JM2A 2HRLA 3QP3A 3HMWL 4OI7A 4ZDHB 3HNTH 5F89A 1CLOL 5FIEA 2VR4A 4YJZL 5ETUA 2VRAA 3OR6B 2ERJB 1LNUB 2R39A 4YHZH 2DWEB 5EO1A 1RJYA 1VPOL 1QR4A 4NOBA 3KJ6L 1QPXA 3GIZH 4MQ7B 4TN9A 1N26A 3BVNB 2X70B 2G60H 3RDTB 3G6DH 5JOFA 4J4PC 5DI8B 3L95B 1E28B 3PHQB 3AB0B 3VXMA 1NUDA 2VQ1B 5D7LA 3MACH 3CDGA 3EYSL 2VR5A 4HK3J 1WEJL 3ARTA 3WDJA 3ISWA 2CK2A 1KT2B 4A6YL 2EKJA 1U8LA 4UDUB 4OZHF 4E41A 2P5EA 3S9DB 4OQTH 3ZDZE 3DI3B 1NMBH 3HR5B 1WWWX 4PGDA 4HJGB 4JFEB 3DX7B 5GGVY 1MFEL 2YPLB 4KDVA 3LKQA 5AAWA 1DQMH 3QPXH 2JK5B 3FZUC 5HSFA 5L8JB 3IDJA 5EZIH 5SV4A 2HJLA 4NQDD 4KQ3L 4I3RH 4OSUL 4AL8H 1NC4B 5C07B 4NRXA 1C08B 2XPGB 1K8IB 1MHPH 3MOBL 2NY3B 5FUCE 1FL6B 1ZT1B 4RA0C 1EHNA 3FFDB 4N68A 5AYUL 4OD1H 2AV1B 4TYUA 1JZ7A 3HG1D 3C5JA 4R8WL 1NFDA 4UOW1 4D9RE 2AJVH 1ZLVH 3FO2B 4WWKD 2P7TB 1W0WA 1G7QB 4U1MB 3GBLA 5C0BE 5C0DA 3QZWB 3T0ED 5J1AB 4DVBB 1KULA 4YQXH 1KEMH 2GCYA 3C5ZB 3FRUA 2APBA 2VUOA 1E4WH 4PY8J 1RJZB 5AZEL 2GSIA 1E6JL 4UT6H 3UZEA 3VXTA 3I3EA 4FHBD 4HG4J 3ZKXB 5EOQL 1N3NB 3P9LB 2VL4A 3TLRA 4L8BA 1KV3A 5AZ2H 3LMJL 5CMAB 3VI3F 1FFOA 1P2CA 2ADFH 3VCLB 2BNRA 5JHDB 1LO2H 1MEXL 3RPKA 3BPCB 1DQLL 1NSNL 1KJVB 4J3XA 4HUWA 4WW2F 1T7ZA 1F2QA 3DBXA 5F9JA 3EKCA 1CTNA 5CZVL 1OGTB 5L0QB 3IDXH 3CDFA 5T3ZL 2Y06H 1KLUB 3QEQB 3MNWA 4PJCA 3GMMA 2G2RA 1UB5A 1HHHB 2R0ZL 3N1QC 5DQDL 5EFIA 5J56B 3DMMA 3BZEB 4GW1A 2VDOL 1FJ1A 1EMTL 4XVSH 1FCCA 3DUSB 5E4IA 1FN4B 1ZMYA 3NVQA 3GHBL 5D96C 5SWSD 3ZHKA 3MFFB 2RFXA 3BOVA 4EN3D 2DDQH 4M03A 1KYOK 2XWBA 5DD3L 1J5OH 1YNKL 1FYTE 2R1XB 4YZFF 4MXQC 2YD2A 5ESQA 1EXUA 5E8PB 2PYED 5C0AD 5IOPB 4I9WD 2NXYB 4RWYH 1YMHA 3AFLA 2A1WL 3EYOB 2NY2C 1XR9B 1J0HA 3SPVA 1YDPB 3O3UN 2PETA 3O8XA 4CU8A 3T2PA 2X4QB 4K3DH 5B38G 4L3CA 1WITA 4OFDA 5FA4B 1CL7L 4YDLB 4B41A 1OL0A 4HF5H 1HXMB 1MFBL 1VFUA 1ZLSH 4JGMA 3IJHA 4UILL 5LAXA 4MJIE 4P57A 1DCLA 2A6JA 5D1XB 1AGFA 1I4FA 4ZUSB 5J0BA 3CVHH 4H88L 1MJ8H 1G7MB 3QFDA 4MAUH 3TP4A 3AAZB 5CJ5A 1SEBB 3VXUB 3MROA 3Q3GA 1JPSL 2H2PC 7CGTA 3FT2A 3PIQB 1WZKA 2H2PD 3DOSA 1TVBA 5TFSH 4ZD3L 3SDXA 3A0OA 3RI5F 4L4TE 5GS1B 5JW3H 4NQCD 3R8QA 2CIIB 3PUCA 5FO8A 2MKLC 4TVSa 4GKZB 3TVMB 1XH3A 1DN2A 3PHSA 2RCSH 4R3SA 3HZVB 1R5VB 1ORSB 2D7OA 1HHJA 4HIHA 3GI9L 5IFAH 3GMRB 3UROR 4LF3A 1XR8B 3T4AB 1T0MA 1NGZB 3MRCB 3O6MH 5IGXH 3E6FA 1VFBA 4KK5C 1T2JA 4I18A 1K6QH 5F7EL 3Q1SH 3ZDXF 3P77A 5SWZB 4F57L 4X98B 4RFOH 3GB7A 1QNZL 3CFEB 4XPBL 4AIZB 1G9MH 1A21A 1MPAL 3EJZD 4HEME 5I8CB 1A7PH 5TDNA 1KTDA 1WFTA 2JELH 4V1DD 3HI1A 3SDCC 3DJ9A 4Z78A 4K7PY 1JGVH 5ADOL 1KSRA 4OD2A 1TDQA 2CDGB 2ESVD 2PW1B 3B9KB 3NCYS 2VLRE 4OZHE 1VEPA 1CFNB 4OF8A 5HGAA 3V0WL 5KBNC 1XF3B 5DJ2B 2AI0L 3W5MA 4PJFB 1W0VB 1MJ7L 3WE6A 4M5YH 3PJSA 1T0NA 4ZUVA 5GHWH 4P2YA 1IGTA 1DVFC 1FNGA 1CVRA 4TTGA 5KZCD 1D5IL 1LEGA 4JDZA 1L0QA 3OPZH 2QADD 2ZKHL 1IGIH 4Q9CA 4D3CL 3B2VH 4IBLT 1U8KB 5C0EB 1INDL 4M00A 1A9EB 1BVLA 4WGVB 2GFBA 4I3GA 3GUTB 4WFFD 4YHIB 3NABL 1ZLVK 4KROC 5H35B 4NN6B 3GGWB 1VB9A 5I1HH 5KN5A 5IF0A 2YMXL 1ONQB 4M8QA 1FLRL 1KB5B 4G7VL 4ONGL 5IB4A 1PJ9A 5FA3B 5I6XC 5DSCA 2BNUA 3QNXA 4KJQD 4LIQL 4JFEE 3JWDC 4F15B 3ES6A 1KLGA 3KLHD 4BK4A 1CK0H 2QTEA 3MXVH 3MV8D 2YXFA 5D70H 2BOBA 5I30L 4X83A 3CIQA 4BZYA 2VDRL 1SJEA 2XKNB 4RGNC 2ICWI 3IU3B 4LASH 4BZ1H 1YUHA 3KPOB 5T1KB 3TBVB 4XWOD 4PJ8C 3VI3E 2W07A 4G3YH 4HEPG 3NGBB 1TLKA 5E5MB 4IOFC 3VGGA 3ZZ1A 1LGVA 5E6IA 1FO0B 3GIVA 5HHMD 1JWUA 3W2DL 4FQ2H 2AEQH 1AGEB 4JFFA 5TF1H 5DEZA 1YC8A 2YS4A 2ZUVA 1N6VA 1Z3GL 3BRFA 1JK8A 1ZSDB 1N0XH 4ZOEA 1JHKL 4LQFL 4B5EA 4UDTB 1RV6X 4PTUB 4D9QD 3QG6A 1D5ZA 1R3KA 3RHWK 3ARFB 1Q94A 4OZ4B 4RQQA 2IH3B 4EI5B 2ADIB 3TT3L 4FZ8H 4C83B 3W9EA 2UZYB 1YN6B 4DGIL 2X40A 4GBXC 3PWVB 4LGRB 1PW3A 4KV5F 4GBXD 4LLYB 2EECA 3FT3A 4KKBC 3V95A 2VE6B 4WUKH 1FFRA 4X5LA 5JHDE 2GQHA 2WAHA 3TO2B 3KPLB 4CNIA 4YZFE 1IAMA 1UFUA 2XKSA 5EDXA 4D9LH 5EO9B 4BH8A 2J8HA 2HVKA 4AT6B 4OCYH 1YMMA 5SX4H 2OYPA 4YAQA 4AEHH 1U6AH 4OV5B 5KSVB 3V4VL 5HHNB 4OJFL 5HJ3B 3ZE0E 2DIBA 3IF1A 1UYWL 4ZYKA 4ENEC 3MMEA 3QEQE 1FNEA 4NBZB 3LN4A 5I9QC 4O51A 5GGSB 4OI8A 4RGMB 1BQHB 3VWKB 1D3CA 4ODHL 2VLKA 3SY0B 3VMOA 2F54B 4G7YH 2EE3A 5TE6L 3A67H 1ACYL 4LQ1A 1JPFB 2D0FA 1DEEB 1Q9OB 4HV8B 1N7MH 1H3GA 1MWAL 3BO8B 4FQHB 5B22A 3U36B 2X1PA 1MNUH 1TCRA 3MOAH 4GMTH 1MLBB 3AREB 1KTRL 4PJDF 3NCMA 4JG1L 1XGRA 4XP6H 1C5BL 2HT3C 2VZTA 1WCBA 1T1ZB 4FQIL 1E6OL 1YA5A 1JTTA 5FB8B 2MWCA 1KG0B 4G43B 1FZKB 4X6EB 4RMRA 5EBGA 3C8HA 3D0LB 4Z77B 5FGBA 2VJXA 4BK5A 1DDHB 4DN3L 5DC4B 5E2TL 5EBWA 4ODVH 2EE9A 2ZSVB 3FQRA 3QUMB 1WBYB 4PY7A 3WFCH 3BPOC 2DIAA 1WC7B 1AC0A 1YEJL 3P2TA 4P23C 2NY6B 4RGOL 4F3FB 1OAZH 1T83C 1DLHB 4QOKA 3ZDXE 2UUDH 1CQKA 1J10A 4G6AC 2JJVA 4OLWH 3KPRA 3GSUA 3L3OB 4FFYL 2Y07L 4HK3N 2R69L 4LKCA 4TQEH 5F9OL 3VXUE 1T66D 5D1ZA 4ZODA 2C9AA 2QSCH 5A3ID 4E42B 3ZE1E 1HILB 2FSEA 2RGSA 5FECA 1SVCP 4UAOB 2EIZA 3LH2H 3VWJB 4MCYB 3LY6A 3RTQA 1INQA 3OKYA 1VA9A 5HHPA 1CBVH 4HIJB 3FCTB 4JY5L 2DQHL 4JDVB 3CSYB 3WUZA 4OAWA 1IAKA 3O3DB 5C0BD 3FB5B 1EO7A 4LEOB 5FK9B 2NY2B 3EW3B 4OFKA 4XCNA 3Q6GL 1ULVA 2J7LA 4DN4H 4KMTL 3KYMA 1BBDH 4JE4B 5SWZE 1BPVA 4YPGA 1SMOA 2JLLA 3W0WA 1IEHA 4XGZB 3LKRA 1BBJB 5CP3H 5M7QA 4YDJA 2DKSA 3DIFB 1AE6H 1FL3A 3X13A 4QY8A 1KB5H 4LBEB 4HLZG 3QFJA 5DVMA 2IGFH 5F89B 5CBAA 4L8SC 4ZFOL 4DKFH 2X10A 4RIRB 2ZUWA 3ARVA 1VESA 1QFWL 4PLJD 4W4OC 1B88A 4U31A 4KK9D 5EO1B 1BFVL 3QDHA 1H3PH 2GHWB 5F6HI 1RZKC 3RX8A 4XPFL 1T03H 3L1OH 3BISA 1GGBH 3QDMA 4N8CL 1Y6KR 3LN5B 4RX4D 3L3KA 4M1GH 3VXMB 1HKFA 5D7LB 1GHFH 4MVBD 1U8LB 1PLGL 2FB4L 4MA1B 1G9NC 4E41B 4EXPX 1EAPA 2AABL 4J8RA 5I0DA 1F4XH 4TULH 1ZXQA 3KPPA 4AY0A 1E27A 1I1AA 2Y36H 3CFCH 4WUUB 2E7BA 3MGOB 2WWKO 4JM2F 2P24A 4D0DA 4PGDB 5FAAA 4Y4KC 1OAQL 4HIXL 3UAJD 3HPJA 3KYOA 4YHYC 3RY6C 3AU1A 1G7IB 3IDJB 3WS6A 4RMUA 2HJLB 4OLVL 1NMCC 1MI5A 2FR4A 3BQUC 4LLAA 5IVNA 2WWMD 1FYTD 1L0XA 4NRXB 4Y2DA 1Q9LB 4C56D 1OT1A 1J87A 5FYJH 1OAKL 4EVNA 2HLAA 3HE6D 4M7JH 4P4KD 3RNKA 1FDLH 5DGQA 4Q9QL 1NFDB 3Q5YA 4MZ3A 5CKGA 5E8EA 3EJJX 1W0WB 5DVOA 3EO9H 5C0DB 3KLAA 2J4WH 1DUZA 3CXDL 3JUZA 2GCYB 3FRUB 3RU8L 3CMOH 3V4UL 3LN9A 1AIFB 3D85D 3QUKA 4KV5E 2JB5H 1EIBA 1EX0A 3PDGA 2GSIB 2YPKA 3MBXL 1FNAA 2VMFA 1DVFB 5CCKL 3RI5K 1BQLH 6FABL 1HHGB 4PJXA 3HB3C 1SM3H 1NUFA 4HZLA 3GBNH 1JZ3A 2JJSC 1M1SA 2EC9T 4MJID 5IT2H 3W39A 5K9JL 4AENA 3B9DA 4G8IA 5DUBA 4PJ7A 4NKDB 5E08H 3ZYOA 2W38A 2BNRB 1H3WM 3Q0HA 4HPOH 3L7EA 2R4RH 4FZEH 4HFUL 3LEXA 5BQ7A 2AJ3A 4HS8L 4L4TD 4I5BA 4LPYA 1RUKH 4Z7NF 5CEYB 4HUWB 3U6RB 5KW9H 5F9JB 3Q48A 3GSOA 4KVCH 1FSKB 5FCUH 4X6CB 3HR6A 3NBNA 3V52H 1KN4L 4OF6A 1QA9A 3IXTB 5IFHL 4PJCB 3GMMB 3H42H 1UB5B 5EFIB 3DMMB 1F2XK 4GW1B 5DFTA 5DWUL 1Q0XH 3JZ7A 5E1HB 3RWFA 2XNAA 4P9HC 3GMPB 2ORBH 2E9BA 4Q0XH 5GS2D 1UQSA 1XGYL 3B9VA 1CE1L 4PJ8B 3S4SA 3WJJA 3V4PH 3FB6A 4OCRL 2XXCB 1F11A 3QUMH 1F4YL 5D7JA 5MEND 4HJJH 4KJYA 3OSKA 1GSMA 2AEPL 1EXUB 3DX8A 3INUH 3K8MA 1E4KC 4O2CB 4U1KA 1YMHB 1JPGA 5ILTL 1ZLUH 2VLRD 3WHE1 2F54E 3MRQA 5IB3A 1KC5H 4YBLB 3UPRA 1MCSA 15C8H 4LSUH 5DS8B 1D5MA 2VDPH 3BD3A 3WFBL 3NACH 4DEPC 4PJCF 1XF5A 4PGEA 5I1IH 2F8VA 5JXEA 3MLYH 12E8L 3IYLW 2VOTA 2DWDB 5H2BA 3MLSL 5I8KH 3FONB 4P2RD 4J6RH 5LAXB 4P57B 4I4WA 5F7YC 2A6JB 3R1GH 1AGFB 1I4FB 2HTKD 2X89D 3RDTD 3M17A 3QFDB 4LHUG 2AS5M 5JW4Q 2A73A 3ZT6A 3FT2B 3EDFA 5B3NA 3VXNB 1TVBB 1A3LH 5MEPA 3SDXB 2MPAH 4S1SH 1GC1C 4PLKC 1WWAX 1AR1C 4NQUA 4PLKD 5I1EL 3PL6C 1UH4A 2FEEL 3IETB 3WFZA 4R3SB 1NCAH 2X4TA 4LLQA 2AK1H 5I9QB 3SGJC 1L7TH 4HIHB 1B9ZA 5C6TH 3ZYZA 2XA8L 4LEXL 5E2WH 1KJ3H 1T0MB 1NEZG 2UWEA 1LMKA 3P3YA 2GK0A 1VFBB 1FVEA 4I18B 1K5NA 1OAUL 3P77B 4HBCL 1W72H 1BZ7A 3MV11 1CGSH 4O02L 2WZPD 3QDGA 1CZ8L 2YXMA 3FQXA 2G5BA 5TDNB 4GFTB 1FG2A 2FJHA 2J6EL 3QQ9C 3HI1B 4Z78B 4TUKL 4UV4L 2Z35A 1DUYA 3SDXF 3U7YL 4OD2B 3NZHL 3N85L 5CJXA 4WU5A 2BP3A 1CDHA 1JBJA 4RA3A 2QQNH 3BW9B 3WIFA 1A47A 2EIEA 3UC0H 5IJKA 1XGPA 2H3NA 3WE6B 4OB5H 1H5BC 4ZUVB 1CS6A 4X9HA 5JO5A 3EOTL 1IGTB 2DL2A 4PJBA 2PTTA 3QRGH 2IG2H 1PAMA 1RZJC 3DI2B 3KLSA 1UM5H 1LEGB 4JDZB 3HMXH 4N1HB 5CFHA 1T2QH 3FFCA 5JLZA 3QHFH 2RIKA 4TSAH 4G9FA 1BVLB 2GY5A 4PD4J 3G5ZA 1UZ6F 2MKWA 4GW4B 1WGOA 4UBDD 4WTZA 4U4BA 2HT4C 1P4BL 3VXME 5I71C 1YJDC 5D7LE 1HNFA 4JKKA 4LLWA 3ULUF 4WHYH 5IF0B 5KSBA 3FQTA 2X6MA 4M8QB 4YPJA 4UUJB 1QSVA 4E41E 2P5EE 2VXTH 5IB4B 4NJ9L 1DE4B 5JPNA 2OL3L 4FABH 5DSCB 4YHML 2BNUB 2WM0A 4PGZA 1MREH 1OAXH 5K9KA 3QYCA 4Q2ZA 3ES6B 4Z76A 4NN5C 3N1GC 1OCWH 1OTSD 2BOBB 2OJZL 1HEZA 4IIQC 2R0KL 1SJEB 4HJ0C 4GRWB 4JREC 2BXZA 4YHOL 4WI3A 3S98A 4Z7UA 2FGZA 2PO6C 3D39B 4OGAD 2HT2C 3DV4A 4XAKE 4AH2B 1U8HA 5L9DL 5A40E 1X5ZA 2ICCA 2NXYD 4OFYD 4AIXA 2JB6B 5TE4L 1XF1A 5F3HB 1NFDE 3GIVB 4MXWL 1JWUB 3D9AL 4DVRL 5GIRB 3HCVA 4Z7NE 3JWDH 3SHSA 4JFFB 3VG9C 5DURB 3CFKA 1MHHA 4XRCA 1LO4L 3CNKA 4U1SA 3H7BA 5SWQA 2B2XL 2C3HA 2EDJA 4IMKA 4MQXD 3WFDL 4F33A 1S9XA 3TPUA 3HPLA 4JFYB 4NOFA 3QG6B 1I9IL 5AWNL 1K3ZA 3KAAA 3IDNA 1Q94B 4UOW0 4RQQB 1P4IL 5D1XD 3P4MB 5B8CA 4WCYH 4J12A 4F8QA 1Y6NR 5EA0H 2HFTA 1YEKL 4KMLB 4BQ9A 4IM8A 3VXUD 3O2WL 2EKSB 1TJGH 2BNRE 5DD1L 2VWEC 2BX5A 4DCQA 4HW6A 3EFFA 4PYGA 4CNIB 1OW0A 3LKNB 3PV6A 1EGJL 1MLCA 1NMCB 4N5ED 2BRRH 4YAQB 3SDAC 4AEFA 5I8EA 3G6JA 5CEZD 3H7LA 3T0XA 4HKZA 3WL9A 1I1RA 1KF9B 2WSKA 4X80H 5FXCH 4IRSA 2BVTA 4NZRL 3MMEB 4Q58C 3D87B 1FNEB 3QNZB 1HKLH 3LN4B 4MB4A 3O2VL 4PJCE 1FNSH 2ZCKH 1CLYH 3BDYH 4ZUTB 2VLKB 2YD1A 3VA2C 3ZKND 4AYFA 4NO2A 3FOLB 4OGXH 4YHZL 3C6LC 2B4CL 4F80A 2J8OA 3GIZL 3DECA 2G60L 5BOZG 3DNKA 3PP3K 1TCRB 3FQNA 1TTFA 3OAZK 2ZP0T 1MCNA 1LK3H 2QEJA 3RVXC 1XGRB 5DMYA 2F58H 3MACL 4HKJB 5FGRA 4LFHD 3LRSA 3G5YA 4OQTL 3MJ9H 4D0CA 4D94A 3BGFB 4G42A 1E4JA 5GRZA 1NMBL 4GAJH 2NW3A 4MJ6A 2YUVA 3UDWC 1NFKA 5BZDA 4WEMB 5LQBL 2H32H 2OSLA 5KS9B 3C9NA 3QCVL 2YWYA 3TN0A 4ACPA 5EBWB 4PY7B 3FQRB 3QPXL 3VFNA 4BQ8A 3WNKA 5L2KA 5EZIL 2LU4A 1OY3B 3ARSA 2Q6WA 3VI4F 3CK0H 3JV0A 3MV7A 4QOKB 5FOBA 1BVZA 4P4RA 4A6YA 4X7FC 4AL8L 1RZFL 5T3XH 3U48A 1RAMA 1MHPL 4LSVH 2YN5A 3KPRB 5K93A 5EU3A 4LKCB 4JY4A 3RBGA 5D1ZB 4OD1L 1QQDA 3BI9X 3ARRA 4HWBH 3MRMA 2AJVL 1AO7D 1FRGH 2FSEB 3O3AA 4MX7A 3SDXE 4X0KA 3CXHJ 5FECB 1WAAA 2DM4A 3DRTB 3UPAA 1KEML 4YQXL 2E7LA 5GS0D 3SDDC 1V7MH 3RTQB 2FJGA 1INQB 2GIYA 3O6FA 5HHPB 4PJHF 3GI8L 3D69B 3ZTJG 3AY4C 3BGMB 2MQ3A 4OAWB 1MVUA 4WI6A 4U1LA 5TQ0H 1QD0A 5J9PA 4QRRA 2IBBA 5JIIA 3LZFH 1S9VA 5CUSH 4D0BA 4U0RC 1PDKA 5T1KD 3KYMB 2IANB 1TCMA 4DEPB 4I3SH 2ADFL 4YDJB 4ZMAT 4G6KH 3BIBX 1LO2L 1FL3B 3KYNA 4OLYH 4QY8B 1A6VH 2X42A 4XZUA 3LEVH 3QFJB 5EOCL 3V7MA 4KU1A 1UZ6E 5CBAB 2NX5A 2HLFC 2UZIH 3IS1X 3WNPA 3RNQA 2MOVA 3ULUE 3HI5H 4HD9A 3KXFA 2CKBH 3IDXL 2ADGA 4OZIA 3QDMB 1RIUH 2VDKH 2R2BA 2IPTH 3L3KB 4FFVD 2NQCA 1X3DA 1HINH 2GEEA 4GRWH 1RIHL 2PUQT 2W65A 1LE5B 3SBWA 4KAQL 4XPHH 3UEZA 3QXAB 1AD9A 1EAPB 1A3RH 1QBML 3N1PC 4MQTB 4BELD 4J8RB 1EEZA 3KPPB 4CBPA 1E27B 2CKNA 2Z4QA 3ARGD 1J5OL 4OZFG 3SE3A 4D0DB 3EYVB 4CADA 4X5WB 1BQSA 4Z7OF 1QPPA 5I19H 3REWA 5C1MB 3UXFA 1FYHB 5HD8D 3HPJB 2QR0B 4W81A 5FGCE 1RZKH 4LKXA 4DQOH 4RWYL 4NRYB 2CGRH 2W9LA 3U9UA 1MJJA 3VXSA 1Q72H 1CXKA 4F58H 3QH3B 5IIEB 1JYVA 3DLQR 2FR4B 4LHJB 3O41A 2O93L 1T20A 1NAKH 4H1LH 1G9NH 2QQKL 4EVNB 2HLAB 1IGMH 1RFDL 1VENA 3RNKB 1NBYB 3WIHA 2VISA 4XTRD 2EDRA 1EDQA 2E9IA 2GTWB 2DQUH 5BXFA 1ZLSL 3TO4C 5GJSH 3KLAB 3BMVA 1DUZB 4Y4FA 5F71A 2GI7A 2EDKA 2AK4A 4KTYA 2JTDA 1U3HD 1BZQK 1MJ8L 5A2JH 2BJMH 3QUKB 3ARED 1EFXD 1UCTA 1GRWA 3QUYD 3X12A 1ZVHA 4R0LA 4PJXB 2VQUA 4P46D 4P5TA 5TFSL 4HZLB 2P48B 4Y5VA 3W39B 2CRIA 3HNSH 1H8NA 3TYGH 3LEYH 4JFFE 4G8IB 5DUBB 2IWGA 2X7LB 4IRJA 4U3HA 4PJ7B 1PX4A 1WBZA 2RCSL 2D0HA 2YD5A 4XBPA 1OLZA 1D6EA 5DLMH 1OM3H 5IFAL 5I71B 1IAIM 3L7EB 5D5MA 3LEXB 4OF3A 4WW1B 5A2KH 5DR5H 3O6ML 4I5BB 5IGXL 2NY6D 1NH6A 2YUWA 3Q1SL 1TETH 3GSOB 5I75B 4RFOL 3OX8A 3TCLA 4RMQA 1G9ML 4KK8D 1A7PL 1QA9B 4PJXF 5FUOH 2JELL 3GMOA 3W5NA 4IIQB 5BMFH 4C4KT 3RWFB 1NKOA 3RVUD 4G8EA 3Q2CA 3FAXA 1YMME 4L1HA 3BWAA 1UQSB 3VWJD 3OB0K 1U8IA 4PJ7F 4LPCA 1DQQA 4AM0A 4KDTA 2E7LC 1F11B 1O7SA 2XIDA 3GRWA 4FA8A 4KJYB 4K55A 4M5YL 3RVTD 5GHWL 3DX8B 4LARH 5JIPA 2OP4H 4Y16C 5FUZH 3SCMA 5J6GA 4U1KB 4Y16D 4QTIL 1B4JH 2VLKE 3OPZL 3WBDA 4YX2H 3IT8D 4NZJA 2VO5A 3UTZB 3WLWC 3VG9B 1IGIL 5IB3B 1B6UA 4H20H 1ETZA 3VI4E 1T4KB 3LB6C 3D3VB 1GGCH 2HH0H 1HSAA 3LB6D 4I48B 4JM2D 4P9HH 1XF5B 1SY6A 1L0YA 4IEFB 3CZFA 1ZV5A 4M1CC 4NQEA 4N0UB 1BOGA 5H2BB 5I1HL 4AG4H 4BH7B 4QLRA 5FYJU 2CLRA 4XX1E 4I4WB 4N0CC 2EDEA 1FZOA 2I9TB 5DHYA 3CCHA 3LD8C 3NA4A 5T33H 3U30C 3M17B 2DKUA 3TZVC 5EB9A 2I60H 5J3HD 4ZFFA 1KEGL 2FWOA 3TZVD 2A73B 2Q7YA 1I3GH 4UTBH 3VXMD 3VGBA 3B8SA 3MXVL 4XNZC 1ZK9A 5CAYB 1NAMH 5D70L 5MEPB 4L3EA 4DUWA 2QQLH 4QGYA 2P5ED 2BFVH 3SDAB 3VDBA 4RMVA 4QOKE 4BZ1L 4LASL 2IJ0C 2AJYH 1AGBA 1CDBA 4LLQB 4G3YL 3KPRE 3GKZA 1GOGA 1AHWA 2F53D 2C4XA 2Q8BH 3OG4B 2GK0B 1X5YA 4MHHI 1FVEB 4MZ2A 1VADA 1K5NB 4FQ2L 3C6LB 2IMNA 1LP9A 3F58H 2AEQL 3BKCH 2GITA 1S7RA 1ACZA 4XAKD 1T7VA 1N0XL 2CLVA 2EDYA 3R0MA 1GC1H 4M61A 2CO6B 1I8MA 2Z35B 1DUYB 1FNHA 2DD8H 3I50H 1KB9J 1J8KA 4FZ8L 4WU5B 3K46A 3IDYC 3O4LA 4DZ8B 2IANE 3WIFB 4XP1L 3UTQA 2FJFB 1FC1A 3Q5TA 5IHZA 1U58A 1DQTA 1XGPB 2H3NB 4WUKL 4UIMA 2VDMH 2UWEF 5JO5B 1RPQA 4LNRB 4Z7OE 2PTTB 3QFJE 4N8PA 2P47B 3V5DA 4D9LL 5JQ6H 3QWOA 5CJOH 1JGEA 4MGXA 3A6OA 5I1AA 4IJ3B 4OCYL 5ACLA 1U6AL 1EJOH 4TOYH 5JLZB 1AFVH 4G9FB 5FO7B 2BNRD 1ZGLM 3ULVF 1DANU 3G5ZB 3QDME 2AXGA 5I1GL 5DDHA 3KNBB 4FTVD 2V7HA 1ZGLP 2I9LA 1AQDA 1U93A 4LLWB 3L5HA 5E8NA 3FQTB 4HH9A 4OCMC 4G7YL 3SDDB 5EZLA 3A67L 3I6LE 3I6KB 5E9DA 3STLB 4EUPG 4P2OC 4G80B 2PCPA 3JV6B 4XXDA 5JPNB 3LQAC 1RZJH 1N7ML 2W1NA 2EEAA 3MOAL 4PJBF 4GMTL 4ODTH 4Q2ZB 4LGSB 3ZHDA 4Z76B 5IMKA 4X4YB 2X1OA 5DZOA 1HEZB 1LO0H 4U0RB 5D8JH 1MI5E 3RGVC 4JVPA 1YJDH 5ABDE 1FIGL 1TPXC 4XNXL 1L4IA 4ZO7A 1EBPA 3DV4B 1LE9A 1H8OA 2IQ9H 1KCSH 4QHNA 2XOTA 4HK0A 4KDWA 5KSBF 3ILQC 3WFCL 4JLRA 4ZAKC 3ILQD 3NPSC 4ZAKD 1OAZL 3KWWA 5FO9A 3BE1H 3O8XD 1MHHB 2A6IA 4XRCB 5SWQB 1BIHA 4OLWL 2HP4A 3T3MF 4TQEL 1S9XB 3F65A 1HDMA 3HPLB 2QSCL 3GJEA 2RHEA 5J6HA 5EWIH 4PJXE 1EV2E 1FORH 1MIEH 5E1AA 3IDNB 4M7ZC 4X6FA 1G7LA 4ZFGH 1MRFH 5B8CB 5F7MC 1N64H 2FGWL 3HRZA 3OGOE 4Z7UF 2OTUB 2P44B 3LH2L 1EO5A 4ORZC 3CX5K 2FX9H 1TZHA 2XG4A 5FKAA 4MJ4A 4PJ7E 4CDHA 4QGTA 2D0GA 1CBVL 1JZ4A 4DCQB 3EFFB 2IH1B 4JB9L 4JHAH 3VRLF 2XRAH 3PV6B 3DVNA 1A5FL 4HC1H 3RKPA 3OXSB 4LGPB 4GG8A 1J05A 4DN4L 3VFRA 3NIGF 2BC4A 1BBDL 1U8JB 3LAFA 1OP5H 5I1KH 3G6JB 4HKZB 3BEVA 3JV4A 4JQXC 3WL9B 1PZ5A 3G9AB 3TF7C 4NNPH 4DFHA 3DROA 1AE6L 4XP5L 5HYEA 3PV7A 1KB5L 4B53A 2B5IC 3QRFM 1OB1A 1ED3A 5C0CA 5EC2B 4XMKL 3TO4B 4DKFL 5AG8A 2DAVA 4Y1AA 3FAWA 1FNFA 4NFBA 5GS0L 4WFGE 4NO2B 1OPGL 1YEFH 1JYXA 2APVA 25C8H 1H3PL 4N0YH 1T03L 3L1OL 1QSEB 1GGBL 3C09C 1CDUA 1O5DT 4K23H 4M1GL 4LPTA 3ULUD 3DX9A 1LO3H 1GHFL 4UMGA 3I02A 3C2SA 1V3KA 1QYGL 4ZFOA 4R7DA 3G5VA 2IPUK 1BF2A 3D2UA 4MSWA 4U6YA 1F4XL 4G42B 3GMLA 2NW3B 3TH4T 1P6AB 3CFCL 4MJ6B 2GJZB 4LDOB 3WMSA 4JPVH 4GKSB 2OSLB 1FO0L 4YHKH 3C9NB 2EXWC 2O5ZH 5KANG 1VFAA 2Q6WB 1U36A 1GCFA 3MV7B 1AXSA 3VDAA 3Q6FA 2Y25A 3WHE0 2NY5L 2ZZUT 2D4FA 3ULVH 2EIBA 1JL8A 4AQ1B 3VFOB 4FNLH 3SO3B 5EU3B 2VWEE 4MA8H 5FYJL 3MRPA 4JY4B 5KSAC 3SKNB 4M7JL 1FDLL 2F19H 5BS0D 5LG1A 3MRMB 3O3AB 1RVFH 3EO9L 1ODAA 4F9LC 1RMFH 4H25A 5DYOA 4UINH 3ROOB 1XF2A 1E4XI 3CMOL 1RD6A 2FJGB 3O6FB 2GJ6A 2JB5L 2ITCA 4ZOAA 2AAVA 1SJHA 3HUJB 5B39G 1I7TB 4LP5A 4NP4H 2WUCH 1MVUB 1SM3L 4U1LB 2UWEE 5J9PB 4E5XA 4QRRB 3GBNL 3TA3C 1RUQH 5IT2L 1S9VB 4MS8C 3U4BL 4JKMA 3KDMA 2YD3A 1TTGA 3QDGE 5E08L 4WO4A 2D03H 3MRJA 4HPOL 4K3JL 4XZUB 4J3UA 4B7IA 4QTHA 4FZEL 2R4RL 5E6ID 3ULVE 4WJ5A 3TFKC 3MLWH 5BRZB 2NX5B 1S9YA 3RZWA 2ATPB 3KS0J 5INCA 1WAAF 1RUKL 2HAZA 1EFQA 4M6OL 3RNQB 3BAEL 4JFFD 3PWJA 2HYMA 3KXFB 1Q8MA 3LD8B 1S9WA 4OF5A 3QI9C 2ADGB 4OZIB 4H0GA 2BNQA 2R2BB 1J12A 2NZ9D 3QI9D 4AEIH 4LMQE 4YWGH 4XNZB 4R4ND 1RIVH 2D9CA 4PJBE 2HMID 1Q0XL 2W65B 2N7AA 3I3BA 3MLVL 4JO2H 1IKNA 3NCJH 1IC7H 2VYRE 1AD9B 4HUUA 4Q0XL 4LSSL 3FFCE 4PREA 1VKXB 1EEZB 3V4PL 4G9FE 3QUML 3UBXG 1YEEH 4HJJL 5K33A 3REWB 3X3GL 4JPIB 3GEWB 2JCCA 4X8XA 3I75A 4IDJH 4JN2A 4LKXB 3ARDC 1FCGA 5H37H 3U9UB 1MJJB 1L6XA 3D18B 5D9SA 3VJ6A 5KSBE 1YMMD 1ZT4A 1SBBA 5KSUA 3ARDD 3I9GL 2R9HC 2PTUA 3VH8G 1JE6A 4UTAH 3O41B 4K3EL 15C8L 1JF1A 2ZPKH 3MTRA 4LSUL 5KVFL 5IMOA 1CFQA 4OZIF 1T20B 3NACL 2FBJL 3BJ91 5I1IL 4JFXA 1BEYH 1GGTA 3T3ME 1Q0YH 3C60A 4PP2A 4QWWC 1XZ0A 4KRPB 1F4HA 4GMSH 3S36X 5I8KL 2ZG3A 1HH9B 5BXFB 1R6VA 4J6RL 3IDYB 2O5XH 1JGUH 4Y4FB 4Q6YA 2AK4B 4RFNC 1ZHLA 4Z7UE 2ZWLT 5GQBA 4WI9A 1EERB 3BDBA 5DFVC 1IM9A 5HGHA 4FQXC 1BJ8A 3FHAA 4JFZH 2E6PA 4P5TB 1TENA 1ZEAH 4TSBH 1A3LL 4Y5VB 3VRLE 4S1SL 4GS7C 1OP5K 1QLFB 2B1HH 4M1DH 2X41A 4IRJB 4Z95H 4Y5XA 1JJUA 3NIGE 1RZ8A 1WBZB 4XBPB 2J3SA 3REVA 2AK1L 3B6SA 2H6PA 1L7TL 3WO4C 1K2DA 5KOMC 5D5MB 4E0RA 1M7IA 5CJQH 4FXKA 3RPIA 4POUB 1EHXA 4JO4H 4QT5A 1Y6MR 5CEXB 2GW5A 2CUMA 3L3DA 2P42B 4P2OB 3TJHC 5BVPH 4NJAH 1CGSL 3OX8B 3TCLB 4ZO8A 3VD7A 1LD9A 1QG3A 4XVJH 5D1ZD 2DYPB 2G75A 3DYOA 3DYPA 3J8F7 4MAYA 1JGLH 5D6DC 2Y5EA 5ID1A 4G8EB 4G8GA 3BWAB 3NZ8A 1IEBB 2QQNL 5E0QA 5J1SC 1TPXB 3T4YA 4AM0B 2LVCA 3G6JE 3Q5OA 5LBSH 3NH7H 5I66A 2IMMA 1X4YA 4OB5L 3G08B 4DZBA 2L7UA 4K07A 3WJLC 5J6GB 1X5XA 3QRGL 2IG2L 1AKJD 2J6EA 3THML 4MXVF 1DZBA 2W0KA 4R7NA 3HMXL 3GM0A 2NY1D 5HVHB 1ETZB 1T2QL 3W0WD 3BH8A 3QHFL 4TSAL 3MJ6A 2IAMA 1NCDL 1XIWC 4HLJA 3QFJD 2PR4H 4JJ5A 1IGFL 4M7ZB 4NQEB 4OGYL 2OMNA 4V2BA 1BOGB 1GGUA 4PBVC 5DO2D 3ZTNH 4MD0A 2CLRB 1D7FA 3RZCA 4DOHB 4JFDA 2VXTL 2AERT 2MTPA 1FZOB 1FE8H 5DHYB 3CCHB 1UJ3A 5IM7A 4FABL 4WI8A 5DJYA 1IGCH 4ZFFB 2FWOB 1MREL 1OAXL 2Q7YB 3V0VB 1S7TB 5L6YH 1TITA 1OCWL 3SGDH 5B39A 5TDPB 2AJUL 4L3EB 1YEHH 3I6LD 3TBWB 3MV7E 1A7NL 2VR9A 2IQAB 1I1AD 3GSQB 1AGBB 2QSVA 1BFTA 3MRBB 2OL3A 1EO8H 5BO1H 1AHWB 5DUMH 4LSTH 5C8JA 3MV9A 2E3VA 2J1KA 3RA7H 3NCFB 3OKEB 1VADB 1MI5D 3TBYA 1LP9B 1NCNA 1I7RA 4Z0XB 1WAAE 1NQBA 3ARQA 3JWDL 4Y2DD 1IGJB 2GITB 1S7RB 1JPST 4EEEA 4W4NA 2C3WA 2KL6A 1WFOA 2FH6A 2VSCA 3S5LG 1L6ZA 4X7TB 2HVJB 4L9LC 4YLQT 4XVTH 2CLVB 4M61B 3DTXA 3VXPA 1U8NA 3O3BB 2DQIH 1I8MB 4O2FA 2Q87A 3PGCA 2VH5H 2FIRT 5GISH 4GXUM 4QRRE 4O2EB 2B0SL 3QIUD 3BSZH 4P5KA 1QO3A 3DHMA 1P7KB 3K7UA 4POYA 5EA0L 5IHZB 3VD3A 1U58B 4JHZA 3MRNB 5I1JL 4UIMB 2ZNWA 3IJSA 1TJGL 2MCPH 4YIQB 4M8VA 4XNYL 3LRHA 1Q9KA 4YHNA 5HHXH 2NX5E 3WNNA 4CN6A 3QWOB 1LP9F 5GGRY 4APQC 5E8DH 5I1AB 2BRRL 3UJIH 3KXFE 4JFPA 1S7QA 1NCCH 3T1WA 4KJPD 2HFEA 1NBZB 5D1QC 1WICA 1BWWA 4Y4HA 2P8PA 5KSAB 3WIHH 4PJIA 4OZIE 3QHZH 2AXGB 2OZ4A 1G1YA 4X4XB 1HKLL 2V7HB 5I0ZA 4X4ME 2I9LB 1HQ4B 1FNSL 4JKLA 1U93B 2ZCKL 4KTDL 1ZWIA 1CLYL 3BDYL 5E8NB 1P9MA 2GT9B 4HH9B 4QRUA 1MCRA 3T09A 4OGXL 1EGJA 3QA3B 5EZLB 5E9DB 4PJ9A 2YPVH 4XXDB 4EOWH 2WMPA 3V6BR 2Q8AH 1ITCA 5EO0A 2NTFB 2PXYC 1LK3L 2FHBA 3W82A 1CFBA 2YZ8A 3WS3B 3F7PC 1NUNB 2YD8A 5IMMA 3DETC 1X5GA 1FFPB 4BUHA 3VXSE 4MAYC 3CJJA 4PIRF 4JAMA 4FQPA 4Z7WB 3HNVH 4Q7DA 1WISA 4WI7A 1ZLWH 2AQ2A 4PJEF 4ZXBA 5D7JD 5ICZA 4GAJL 1LDPH 4KKCC 5EIIB 3L3GA 3UPCA 3UTPE 4KKCD 3RJDA 2IPKA 2OI9C 4QHNB 4HK0B 2NR6C 3LQAH 4JLRB 3QXTA 1U0QA 3G04A 3CK0L 3I6GA 2BCKA 5BOPA 4HWUA 5IMLA 3PF2A 5FO9B 3WN5C 1GGIH 3FQWA 2AK4E 5T3XL 3V8OA 2X4NA 4LSVL 5FFLA 1F6LL 3OR7B 3EUUA 5JXED 3ULUL 4TPRH 3GJEB 3PXHA 1YNLH 4IS6A 5J6HB 4BQ6A 4C57C 2IFFH 4X6FB 3BYYA 4ELKA 1FRGL 1XAUA 3K2UH 3HRZB 3GFUA 4PS4H 1X5FA 4NC2B 1WIPA 4I0KA 4C4KO 1TZHB 2WUBL 1V7ML 5FKAB 1NCWH 4PYHA 5CLTA 5DJCA 3QCTH 3MBEC 4TVPD 1FVDA 1UCBL 1U2HA 3QZWG 2ZSWB 3MBED 1H9VA 5D5ME 2YEZB 4XPGH 5TQ0L 3GSNB 3DVNB 5CSBA 3WXVH 3VGHA 3LZFL 4URTB 4XCFH 2O61A 4GG8B 1J05B 4JFQA 3VFRB 1IC4H 2BC4B 1R3HA 3NOIA 3X3FH 4R26H 4U3XA 2P5WA 3JV4B 1PZ5B 2C7UA 1JZ2A 2F9BT 5AAMA 3RUGA 5EU6B 4HAGA 4G6KL 5C08B 3ESVF 2H8PB 2NY0C 1H3UA 4OCLC 1BOYA 5IBTH 3R06B 3LEVL 3M8OL 2NY0D 2DOCA 3MRKA 4QHLA 1OB1B 5C0CB 1XMWA 2UZIL 1HH6A 3HI5L 3VU2A 1CD1A 4RFNB 2OXGA 1FV1B 1T22A 2XTLA 3QDGD 4CU6A 2NTSP 1RIUL 2VDKL 1YY8A 4IOSD 2IPTL 4L5FH 5SX5H 4FQXB 4LCWD 5TQ2H 1JI2A 4YXKH 1HINL 5ITBH 1CDIA 4PRDA 3QIBC 5HI4D 3DX9B 3QPQC 3BKJH 4P9ML 4F7EA 2PW2A 4NN7C 4R7DB 4NO5A 3G5VB 1VGKB 4HGKC 4MSWB 4U6YB 3ARBC 1KXVC 3GMLB 3DV6A 1TQBC 1DBJH 1U2CA 4BKLA 5EIVA 4HXBH 1INEH 1NBQA 4DK3A 3HTLX 1PY9A 2WBWB 3VDCA 1KIUA 4NQEE 4Q97A 4Q9RH 3LCYA 2CGRL 2EO9A 1HZHH 1Q72L 3PHOA 3QHTC 4MDIA 4F58L 3I2CL 1AXSB 3Q6FB 3FFCD 4BA8A 4DOHE 4GRMA 4PRIA 5F96L 4G9FD 3DVIA 1Z0NA 4EDXB 1K9TA 4PP1C 1PKQA 4PRAA 5DMKA 4GRLA 1KPUA 1NAKL 1G9NL 2EH8H 2LU3A 1K4DA 3QDJA 3BP5A 1IGML 3MR9A 3P4NB 4R97B 3CVIH 5HDOA 2XWTA 4NQSA 1W0YT 2DQUL 2P8LA 4L3EE 4P59H 1EEUA 5GJSL 1P9MC 2V7NB 5DYOB 3D0VA 5J1TC 4PJAA 1XF2B 5MEQA 1DFBL 5HYIA 1IL1A 5CKAA 4Q9BA 4S1DC 2BJML 2GJ6B 2ITCB 1JNNL 2BOCA 4S1DD 1SJHB 1LDSA 1LEIA 4XH2A 1AXTH 1ZGLB 4FXGB 4Y8AA 1MCWW 3SJVA 2H2SC 4E5XB 2V6HA 4QRTA 4N1EA 1Q1JH 5IP4A 1LP9E 4ZS6C 3HNSL 3TYGL 3LEYL 1JNJA 3JVGA 4KHTH 1XGUA 1T21A 4FRWA 5KVGH 1XIWB 3CVHA 2J88L 1DBBH 2W92A 5DLML 1OM3L 3MRJB 2GYSA 3DO7A 2OK0H 4QTHB 3EGSA 1T6VN 3GZKA 4WJ5B 1KIRB 4M93C 3VRIB 1QUNA 1IC5H 4PGJA 5INCB 5GRYA 1FZMA 5D2LA 5J57B 5IFJA 1IJ9A 5F93C 1BZ9A 3IKCB 2VQTA 1TETL 2GSGA 3O4LE 5DJ0A 4NKIH 4OV6F 1VGEH 5E7BA 5CBEA 2RAMA 5E4EB 2BNQB 4XCEB 3QEHA 3RWJB 4Y5YC 5B21A 5FUOL 4YE4H 2WLZA 3U9PH 4U49A 2XT1B 3P0VL 1LNUA 4JRXB 3DURA 3CFDA 4HUUB 4GAFB 3W81A 1Z2KA 1PSKH 2APXA 4MQ7A 3G9VA 3V8CA 3JXAA 4OM1L 1UVQA 3L95A 4M62H 1MFNA 3TCXA 2VQ1A 4LARL 3RWGA 4HKXA 2OP4L 5FUZL 4LFHG 5T1DL 4U1IA 2Z31A 3VJ6B 4XBEH 5FYLH 1ZT4B 1GOHA 5KSUB 4YX2L 4GSDH 2V2XA 4ZFZA 1LWRA 2D7TH 3HZKA 4H20L 3S36H 5E9DE 3FB8A 1JF1B 4ONOA 5IMOB 1CFQB 1RK0B 4IRSD 3IAGC 1GGCL 1KFAH 2HH0L 3DX7A 2YPLA 1IBGL 4JFXB 1TMCB 2JK5A 2FX8H 3FO0H 4AG4L 5ERWA 5CINH 4JDTH 5C07A 1K8IA 2Y6SD 4LVNC 5T33L 4FG6C 3IFOA 1ZHLB 1FL6A 4HULB 3FFDA 2I60L 4FG6D 2JCCF 4KFZC 1J0ZA 3GSNH 5HGHB 4XAWH 1I3GL 4UTBL 3FO2A 3QIWC 2P7TA 4UNUA 1NEUA 4OCXL 5J1AA 2VXVH 2P49B 2BFVL 5ALBH 3DRQA 1KCRL 3D1MC 2ATKA 2DQJH 4L4VA 5D1QB 5C9KA 5BCAA 1FQ9C 2AQ3A 1PX3A 1RZ8B 2YSSA 4KZDH 5GGVH 3HC3L 3KR3H 5IB5A 3ARXA 3DUHA 5IJVA 2H6PB 3TN0D 4DKEL 1OQXA 3A6CH 4EDWH 3QJFA 4QO1A 4E0RB 1M7IB 2Q8BL 2PYFA 5JW4M 3P9LA 5L2KD 5FHBH 4QT5B 4LHQB 3MV7D 2UVFA 3FRPA 3N1MC 4TTDD 5CMAA 5IROC 4YDIH 3F58L 3OV6A 2OCFD 3CPLB 3BKCL 4G6MH 1JRHI 5SX5K 3VCLA 5JHDA 1NANI 1LD9B 3VD9A 5A1AA