4UIVA

Bromodomain of human brd9 with n-(1,1-dioxo-1-thian-4-yl)-5-methyl-4- oxo-7-3-(trifluoromethyl)phenyl-4h,5h-thieno-3,2-c-pyridine-2- carboximidamide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
b'STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 9
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uivA00
3MB4A 4QSSA 5EV9A 4HXMA 5FE6A 4Y03A 4UYEA 2DVSA 5ACYA 4HBXA 4QSRA 5FH8A 3UW9A 1JM4B 5DBMA 5HFRA 4QSPA 3JVLA 5ETBA 4XY8A 4KV1A 3JVMA 3UVXA 2WP2A 1N72A 5FFWA 5EISA 5AD2A 5A85A 4XUAA 3O36A 4Q0NA 4A9OA 5IGLA 4YH3A 3ZYUA 4IOOA 5F60A 3NXBA 4ZW1A 5I89A 5FE3A 4NR5A 5ENBA 5IG6A 4YAXA 4TTEA 5LJ1A 5F5ZA 5L8TA 2N9GA 4A9EA 4O7AA 3P1FA 4MR6A 3U5NA 4NR4A 5BT4A 2RNXA 2YEKA 4CFKA 4CFLA 3U5JA 4MEQA 4CUSA 5A82A 3QZTA 3P1EA 4O70A 5HEMA 5CS8A 2L85A 4TT6A 5EQ1A 4NR7A 3U5LA 4WHUA 4Z1SA 5D3TA 5DLZA 5IIDA 4QR3A 4IR4A 2RS9B 5G4SA 4YY6A 5L98A 4KV4A 3O33A 5KU3A 5I86A 5H1TA 5EM3A 5EGUA 5AMFA 4TS8A 3U5MA 4QEUA 3DWYA 5F1HA 5F25A 1ZS5A 5F62A 5IGMA 4UYDA 5CUDA 1WUMA 5C85A 4O76A 4NYWA 2F6JA 5DYUA 4YYNA 4HXOA 4TYLA 4IORA 3P5OA 5CQ8A 5FE8A 4CUPA 4A9HA 5EP7A 5D25A 4XUBA 5AMEA 5F2PA 5D3RA 4PY6A 4TZ8A 4HBYA 4YBTA 5CTLA 4OUFA 5EVAA 5D3PA 3HMHA 5FE7A 4O77A 5HJCA 5EA1A 4Z93A 5EICA 5FFYA 3G0LA 3UVDA 2YELA 5CUBA 5II1A 5C8GA 5HCLA 5HLSA 5TB6A 4UIUA 2OUOA 4NUCA 4MENA 4HXSA 4TU6A 4YYKA 5DFCA 4XY9A 4MEPA 4FLPA 4UYFB 2E3KA 2DVRA 5I1QA 4NRCA 5E9VA 4RVRA 4Z6HA 4IR5A 3TLPA 4UIVA 5ENIA 4BHWA 4BW3A 5H1UA 3S91A 5EU1A 2OSSA 2R10A 5EK9A 3AADA 4A9FA 5I29A 2D9EA 4MR3A 4NRBA 5IBNA 2NXBA 5CPEA 3D7CA 4NQNA 5EWCA 5FE9A 2YEMA 4N3WA 4O75A 3LQHA 2RO1A 5DFDA 3QZVA 2OO1A 4O7BA 4A9JA 4WHWA 1F68A 4LRGA 5CFWA 4O72A 5LKUA 3LXJA 4UYFA 5CQ3A 4BJXA 5CQ4A 3RCWA 5A5QA 3LJWA 5BT5A 4TZ2A 5CUCA 5LVRA 2D82A 5DX4A 5CQAA 5EPRA 3O35A 4TT4A 3UVYA 4BW4A 1WUGA 5FE0A 5JI8A 1E6IA 5G4RA 5EWDA 4A9KA 5FE1A 4HXPA 4NUEA 5EPSA 4QC1A 5LKTA 2F6NA 4QUUA 4YYDA 5CQ7A 5CQ5A 4YH4A 2MJVB 5HQ6A 4QB3A 5HRWA 2L5EA 2YQDA 4YADA 5FG6A 4QUTA 3U5OA 5ENCA 4YYHA 2G4AA 5A5SA 4LYSA 4QSTA 4LYIA 5D3NA 5HENA 4HXRA 2H60A 4MR4A 5CQ6A 4MR5A 3MXFA 3P1DA 4QSQA 4UIYA 5FFVA 5E9KA 2DWWA 4J0SA 4LR6A 3SVFA 5DY7A 5F61A 5FE4A 5D3LA 5D7XA 4N4GA 4C67A 4NR6A 4NR9A 4YBMA 4CURA 4IR6A 5D0CA 4O7EA 4YC9A 3I3JA 5FG5A 5HFQA 3UVWA 3LQIA 3MQMA 5F63A 5HRXA 3S92A 5EWVA 5I80A 3FKMX 5D3HA 5A7CA 5F36A 5E9YA 3GG3A 5E9IA 4CL9A 4YK0A 4LDFA 5C7NA 4NXJA 5ENJA 4A9MA 5A81A 2I7KA 4Z6IA 5C89A 5FH7A 4HXKA 4KCXA 5CGPA 5L96A 4PS5A 5FG4A 3U5KA 4CLBA 3AQAA 4O7CA 4HXLA 5DFBA 3JVKA 4IOQA 4NYVA 5KTUA 5K29A 4O7FA 5E3GA 5KHMA 3U5PA 5CY9A 5H1VA 4O74A 4ALGA 4HBVA 5CZGA 3HMEA 5E74A 4F3IA 5IGNA 5ENGA 4QYDA 5DYAA 2DKWA 5D3JA 4TT2A 2RFJA 4OGIA 2RNWA 5AD3A 4LZRA 5CRZA 1JSPB 5D26A 4HBWA 5FE5A 5ENEA 5E0RA 3ONIA 4Q0OA 2E7NA 4BW2A 5EWWA 4QEVA 3K2JA 4QSXA 4C66A 5ENHA 5C87A 5FBXA 3IU5A 5DKDA 2DATA 5HM0A 5LVQA 2I8NA 4QSWA 5DKHA 4YYGA 4QR5A 5HRVA 4NS5A 4AKNA 5EPBA 5KO4A 2DVVA 5DLXA 5FB0A 4ALHA 4PTBA 5D3SA 4N4FA 4O78A 4YABA 2FSAA 2WP1A 4GPJA 4QSUA 3MULA 4UYGA 4PKLA 4LZ2A 4BW1A 5E73A 4J1PA 5DW2A 4QNSA 4NRAA 4QEWA 5CUAA 3IU6A 5KTWA 2LSPB 5FH6A 4UIZA 2E7OA 2DVQA 4PCIA 4UITA 5L99A 5L97A 3O37A 3Q2FA 5ENFA 3JVJA 1EQFA 3SVGA 4TQNA 2RI7A 4X2IA 5DKCA 3QZSA 5I7XA 4CUUA 4DONA 5HQ7A 4QYLA 4NYXA 5A83A 4MEOA 5BT3A 4NUDA 4N4IA 5KTXA 4CUQA 5A5OA 4J0RA 5I83A 5L8UA 5II2A 4YY4A 4UIXA 3SVHA 3UV2A 5DYXA 5E3DA 5E7DA 5DW1A 5H85A 4QC3A 3P1CA 5HELA 5EWHA 4YBSA 4UYHA 4UIWA 3MUKA 4IR3A 4PCEA 5CU8A 4LC2A 5F3AA 5A5PA 2KTBB 4ZQLA 2R0SA 3UV5A 3DAIA 3G0JA 4OGJA 4J3IA 4YATA 2R0YA 4QR4A 3O34A 4N4HA 4QBMA 5I88A 4YYJA 5ETDA 5LKZA 5CRMA 3MB3A 4TU4A 4A9IA 4A9NA 4XYAA 5D24A 5DYCA 3Q2EA 4NQMA 3UV4A 2YYNA 4LYWA 4HXNA 4YYIA 5CUEA 4O71A 5CQTA 5LJ0A 4WIVA 2YW5A 4QZSA 4LZSA 2R0VA 5HQ5A 5CUGA 5E9LA 5LUUA 4CUTA 1X0JA 2L84A 5JWMA 4QSVA 5A5RA 4ZC9A 5FDZA 5I40A 3LQJA 5F1LA 5COIA 5FB1A 5TCMA 5LJ2A 5C4QA 2RNYA 5FE2A 4QY4A 5I7YA 2GRCA 3HMFA 5E9MA 4Z1QA 5CP5A 5J0DA 4A9LA 2YDWA 5LKXA 4YYMA 5A5NA 5IGKA 5EI4A 4E96A 4NR8A
chains in the Genus database with same CATH superfamily
3MB4A 4QSSA 5EV9A 4HXMA 5FE6A 4Y03A 4UYEA 2DVSA 5ACYA 4HBXA 4QSRA 5FH8A 3UW9A 1JM4B 5DBMA 5HFRA 4QSPA 3JVLA 5ETBA 4XY8A 4KV1A 3JVMA 3UVXA 2WP2A 1N72A 5FFWA 5EISA 5AD2A 5A85A 4XUAA 3O36A 4Q0NA 4A9OA 5IGLA 4YH3A 3ZYUA 4IOOA 5F60A 3NXBA 4ZW1A 5I89A 5FE3A 4NR5A 5ENBA 5IG6A 4YAXA 4TTEA 5LJ1A 5F5ZA 5L8TA 2N9GA 4A9EA 4O7AA 3P1FA 4MR6A 2EJNA 3U5NA 4NR4A 5BT4A 2RNXA 2YEKA 4CFKA 4CFLA 3U5JA 4MEQA 4CUSA 5A82A 3QZTA 3P1EA 4O70A 5HEMA 5CS8A 2L85A 4TT6A 5EQ1A 4NR7A 3U5LA 1PUOA 4WHUA 4Z1SA 5D3TA 5DLZA 5IIDA 4QR3A 4IR4A 2RS9B 5G4SA 4YY6A 5L98A 4KV4A 3O33A 5KU3A 5I86A 5H1TA 5EM3A 5EGUA 5AMFA 4TS8A 3U5MA 4QEUA 3DWYA 5F1HA 5F25A 1ZS5A 5F62A 5IGMA 4UYDA 5CUDA 1WUMA 5C85A 4O76A 4AKHA 4NYWA 2F6JA 5DYUA 4YYNA 4HXOA 4TYLA 4IORA 3P5OA 5CQ8A 5FE8A 4CUPA 4A9HA 5EP7A 5D25A 4XUBA 5AMEA 5F2PA 5D3RA 4PY6A 4TZ8A 4HBYA 4YBTA 5CTLA 4OUFA 3ERRA 5EVAA 5D3PA 3HMHA 5FE7A 4O77A 5HJCA 5EA1A 4Z93A 5EICA 5FFYA 3G0LA 3UVDA 2YELA 5CUBA 5II1A 5C8GA 5HCLA 5HLSA 5TB6A 4UIUA 2OUOA 4NUCA 4MENA 4HXSA 4TU6A 4YYKA 5DFCA 4XY9A 4MEPA 4FLPA 4UYFB 2E3KA 2DVRA 5I1QA 4NRCA 5E9VA 4RVRA 4Z6HA 4IR5A 3TLPA 4UIVA 5ENIA 4BHWA 4BW3A 5H1UA 3S91A 5EU1A 2OSSA 2R10A 3VKGA 5EK9A 3AADA 4A9FA 5I29A 2D9EA 4MR3A 4NRBA 5IBNA 2NXBA 5CPEA 3D7CA 4NQNA 3VKHA 5EWCA 5FE9A 2YEMA 4N3WA 4O75A 3LQHA 2RO1A 5DFDA 3QZVA 2OO1A 4O7BA 4A9JA 4WHWA 1F68A 4LRGA 5CFWA 4O72A 5LKUA 3LXJA 4UYFA 5CQ3A 4BJXA 5CQ4A 3RCWA 5A5QA 3LJWA 5BT5A 4TZ2A 5CUCA 5LVRA 2D82A 5DX4A 3D1BA 5CQAA 5EPRA 3O35A 4TT4A 3UVYA 4BW4A 1WUGA 5FE0A 5JI8A 1E6IA 5G4RA 5EWDA 4A9KA 5FE1A 4HXPA 4NUEA 5EPSA 4QC1A 5LKTA 2F6NA 4QUUA 4YYDA 5CQ7A 5CQ5A 4YH4A 2MJVB 5HQ6A 4QB3A 5HRWA 2L5EA 2YQDA 4YADA 5FG6A 4QUTA 3U5OA 5ENCA 4YYHA 2G4AA 5A5SA 4LYSA 4QSTA 4LYIA 5D3NA 5HENA 4HXRA 2H60A 4MR4A 5CQ6A 4MR5A 3MXFA 3P1DA 4QSQA 4UIYA 5FFVA 5E9KA 2DWWA 4J0SA 4LR6A 3SVFA 5DY7A 5F61A 5FE4A 5D3LA 5D7XA 4N4GA 4C67A 4NR6A 4NR9A 4YBMA 4CURA 4IR6A 5D0CA 4O7EA 4YC9A 3I3JA 5FG5A 5HFQA 3UVWA 4AKGA 3LQIA 3MQMA 5F63A 5HRXA 3S92A 5EWVA 5I80A 4AI6A 3FKMX 5D3HA 5A7CA 5F36A 5E9YA 3GG3A 5E9IA 4CL9A 4YK0A 4LDFA 5C7NA 4NXJA 5ENJA 4A9MA 5A81A 2I7KA 4Z6IA 5C89A 5FH7A 4HXKA 4KCXA 5CGPA 5L96A 4PS5A 5FG4A 3U5KA 4CLBA 3AQAA 4O7CA 4HXLA 5DFBA 3JVKA 4IOQA 4NYVA 5KTUA 5K29A 4O7FA 5E3GA 5KHMA 3U5PA 5CY9A 5H1VA 4O74A 4ALGA 4HBVA 5CZGA 3HMEA 5E74A 4F3IA 5IGNA 5ENGA 4QYDA 5DYAA 2DKWA 5D3JA 4TT2A 2RFJA 4OGIA 2RNWA 5AD3A 4LZRA 5CRZA 1JSPB 5D26A 4HBWA 5FE5A 5ENEA 5E0RA 3ONIA 4Q0OA 2E7NA 4BW2A 5EWWA 4QEVA 3K2JA 4QSXA 4C66A 5ENHA 5C87A 5FBXA 3IU5A 5DKDA 2DATA 5HM0A 5LVQA 2I8NA 4QSWA 5DKHA 4YYGA 4QR5A 5HRVA 4NS5A 4AKNA 5EPBA 5KO4A 2DVVA 5DLXA 5FB0A 4ALHA 4PTBA 5D3SA 4N4FA 4O78A 4YABA 2FSAA 2WP1A 4GPJA 4QSUA 3MULA 4UYGA 4PKLA 4LZ2A 4BW1A 5E73A 4J1PA 5DW2A 4QNSA 4NRAA 4QEWA 5CUAA 3IU6A 5KTWA 2LSPB 5FH6A 4UIZA 2E7OA 2DVQA 4PCIA 4UITA 5L99A 5L97A 3O37A 3Q2FA 5ENFA 3JVJA 1EQFA 3SVGA 4TQNA 2RI7A 4X2IA 5DKCA 3QZSA 5I7XA 4CUUA 4DONA 5HQ7A 4QYLA 4NYXA 5A83A 4MEOA 5BT3A 4NUDA 4N4IA 5KTXA 4CUQA 5A5OA 4J0RA 5I83A 5L8UA 5II2A 4YY4A 4UIXA 3SVHA 3UV2A 5DYXA 5E3DA 5E7DA 5DW1A 5H85A 4QC3A 3P1CA 5HELA 5EWHA 4YBSA 4UYHA 4UIWA 3MUKA 4IR3A 4PCEA 5CU8A 4LC2A 5F3AA 5A5PA 2KTBB 4ZQLA 2R0SA 3UV5A 3DAIA 3G0JA 4OGJA 4J3IA 4YATA 2R0YA 4QR4A 3O34A 4N4HA 4QBMA 3D1DA 5I88A 4YYJA 5ETDA 5LKZA 5CRMA 3MB3A 4TU4A 4A9IA 4A9NA 4XYAA 5D24A 5DYCA 3Q2EA 4NQMA 3UV4A 2YYNA 4LYWA 4HXNA 4YYIA 5CUEA 4O71A 5CQTA 5LJ0A 4WIVA 2YW5A 4QZSA 1ZKRA 4LZSA 2R0VA 5HQ5A 5CUGA 5E9LA 5LUUA 4CUTA 1X0JA 2L84A 5JWMA 4QSVA 5A5RA 4AKIA 4ZC9A 5FDZA 5I40A 3LQJA 5F1LA 5COIA 5FB1A 5TCMA 5LJ2A 5C4QA 2RNYA 5FE2A 4QY4A 5I7YA 2GRCA 3HMFA 5E9MA 4Z1QA 5CP5A 5J0DA 4A9LA 2YDWA 5LKXA 4YYMA 5A5NA 5IGKA 5EI4A 4E96A 4NR8A
chains in the Genus database with same CATH topology
3MB4A 4QSSA 5EV9A 4HXMA 5FE6A 4Y03A 4UYEA 2DVSA 5ACYA 4HBXA 4QSRA 5FH8A 3UW9A 1JM4B 5DBMA 5HFRA 4QSPA 3JVLA 5ETBA 4XY8A 4KV1A 3JVMA 3UVXA 2WP2A 1N72A 5FFWA 5EISA 5AD2A 5A85A 4XUAA 3O36A 4Q0NA 4A9OA 5IGLA 4YH3A 3ZYUA 4IOOA 5F60A 3NXBA 4ZW1A 5I89A 5FE3A 4NR5A 5ENBA 5IG6A 4YAXA 4TTEA 5LJ1A 5F5ZA 5L8TA 2N9GA 4A9EA 4O7AA 3P1FA 4MR6A 3U5NA 4NR4A 5BT4A 2RNXA 2YEKA 4CFKA 4CFLA 3U5JA 4MEQA 4CUSA 5A82A 3QZTA 3P1EA 4O70A 5HEMA 5CS8A 2L85A 4TT6A 5EQ1A 4NR7A 3U5LA 4WHUA 4Z1SA 5D3TA 5DLZA 5IIDA 4QR3A 4IR4A 2RS9B 5G4SA 4YY6A 5L98A 4KV4A 3O33A 5KU3A 5I86A 5H1TA 5EM3A 5EGUA 5AMFA 4TS8A 3U5MA 4QEUA 3DWYA 5F1HA 5F25A 1ZS5A 5F62A 5IGMA 4UYDA 5CUDA 1WUMA 5C85A 4O76A 4NYWA 2F6JA 5DYUA 4YYNA 4HXOA 4TYLA 4IORA 3P5OA 5CQ8A 5FE8A 4CUPA 4A9HA 5EP7A 5D25A 4XUBA 5AMEA 5F2PA 5D3RA 4PY6A 4TZ8A 4HBYA 4YBTA 5CTLA 4OUFA 5EVAA 5D3PA 3HMHA 5FE7A 4O77A 5HJCA 5EA1A 4Z93A 5EICA 5FFYA 3G0LA 3UVDA 2YELA 5CUBA 5II1A 5C8GA 5HCLA 5HLSA 5TB6A 4UIUA 2OUOA 4NUCA 4MENA 4HXSA 4TU6A 4YYKA 5DFCA 4XY9A 4MEPA 4FLPA 4UYFB 2E3KA 2DVRA 5I1QA 4NRCA 5E9VA 4RVRA 4Z6HA 4IR5A 3TLPA 4UIVA 5ENIA 4BHWA 4BW3A 5H1UA 3S91A 5EU1A 2OSSA 2R10A 5EK9A 3AADA 4A9FA 5I29A 2D9EA 4MR3A 4NRBA 5IBNA 2NXBA 5CPEA 3D7CA 4NQNA 5EWCA 5FE9A 2YEMA 4N3WA 4O75A 3LQHA 2RO1A 5DFDA 3QZVA 2OO1A 4O7BA 4A9JA 4WHWA 1F68A 4LRGA 5CFWA 4O72A 5LKUA 3LXJA 4UYFA 5CQ3A 4BJXA 5CQ4A 3RCWA 5A5QA 3LJWA 5BT5A 4TZ2A 5CUCA 5LVRA 2D82A 5DX4A 5CQAA 5EPRA 3O35A 4TT4A 3UVYA 4BW4A 1WUGA 5FE0A 5JI8A 1E6IA 5G4RA 5EWDA 4A9KA 5FE1A 4HXPA 4NUEA 5EPSA 4QC1A 5LKTA 2F6NA 4QUUA 4YYDA 5CQ7A 5CQ5A 4YH4A 2MJVB 5HQ6A 4QB3A 5HRWA 2L5EA 2YQDA 4YADA 5FG6A 4QUTA 3U5OA 5ENCA 4YYHA 2G4AA 5A5SA 4LYSA 4QSTA 4LYIA 5D3NA 5HENA 4HXRA 2H60A 4MR4A 5CQ6A 4MR5A 3MXFA 3P1DA 4QSQA 4UIYA 5FFVA 5E9KA 2DWWA 4J0SA 4LR6A 3SVFA 5DY7A 5F61A 5FE4A 5D3LA 5D7XA 4N4GA 4C67A 4NR6A 4NR9A 4YBMA 4CURA 4IR6A 5D0CA 4O7EA 4YC9A 3I3JA 5FG5A 5HFQA 3UVWA 3LQIA 3MQMA 5F63A 5HRXA 3S92A 5EWVA 5I80A 3FKMX 5D3HA 5A7CA 5F36A 5E9YA 3GG3A 5E9IA 4CL9A 4YK0A 4LDFA 5C7NA 4NXJA 5ENJA 4A9MA 5A81A 2I7KA 4Z6IA 5C89A 5FH7A 4HXKA 4KCXA 5CGPA 5L96A 4PS5A 5FG4A 3U5KA 4CLBA 3AQAA 4O7CA 4HXLA 5DFBA 3JVKA 4IOQA 4NYVA 5KTUA 5K29A 4O7FA 5E3GA 5KHMA 3U5PA 5CY9A 5H1VA 4O74A 4ALGA 4HBVA 5CZGA 3HMEA 5E74A 4F3IA 5IGNA 5ENGA 4QYDA 5DYAA 2DKWA 5D3JA 4TT2A 2RFJA 4OGIA 2RNWA 5AD3A 4LZRA 5CRZA 1JSPB 5D26A 4HBWA 5FE5A 5ENEA 5E0RA 3ONIA 4Q0OA 2E7NA 4BW2A 5EWWA 4QEVA 3K2JA 4QSXA 4C66A 5ENHA 5C87A 5FBXA 3IU5A 5DKDA 2DATA 5HM0A 5LVQA 2I8NA 4QSWA 5DKHA 4YYGA 4QR5A 5HRVA 4NS5A 4AKNA 5EPBA 5KO4A 2DVVA 5DLXA 5FB0A 4ALHA 4PTBA 5D3SA 4N4FA 4O78A 4YABA 2FSAA 2WP1A 4GPJA 4QSUA 3MULA 4UYGA 4PKLA 4LZ2A 4BW1A 5E73A 4J1PA 5DW2A 4QNSA 4NRAA 4QEWA 5CUAA 3IU6A 5KTWA 2LSPB 5FH6A 4UIZA 2E7OA 2DVQA 4PCIA 4UITA 5L99A 5L97A 3O37A 3Q2FA 5ENFA 3JVJA 1EQFA 3SVGA 4TQNA 2RI7A 4X2IA 5DKCA 3QZSA 5I7XA 4CUUA 4DONA 5HQ7A 4QYLA 4NYXA 5A83A 4MEOA 5BT3A 4NUDA 4N4IA 5KTXA 4CUQA 5A5OA 4J0RA 5I83A 5L8UA 5II2A 4YY4A 4UIXA 3SVHA 3UV2A 5DYXA 5E3DA 5E7DA 5DW1A 5H85A 4QC3A 3P1CA 5HELA 5EWHA 4YBSA 4UYHA 4UIWA 3MUKA 4IR3A 4PCEA 5CU8A 4LC2A 5F3AA 5A5PA 2KTBB 4ZQLA 2R0SA 3UV5A 3DAIA 3G0JA 4OGJA 4J3IA 4YATA 2R0YA 4QR4A 3O34A 4N4HA 4QBMA 5I88A 4YYJA 5ETDA 5LKZA 5CRMA 3MB3A 4TU4A 4A9IA 4A9NA 4XYAA 5D24A 5DYCA 3Q2EA 4NQMA 3UV4A 2YYNA 4LYWA 4HXNA 4YYIA 5CUEA 4O71A 5CQTA 5LJ0A 4WIVA 2YW5A 4QZSA 4LZSA 2R0VA 5HQ5A 5CUGA 5E9LA 5LUUA 4CUTA 1X0JA 2L84A 5JWMA 4QSVA 5A5RA 4ZC9A 5FDZA 5I40A 3LQJA 5F1LA 5COIA 5FB1A 5TCMA 5LJ2A 5C4QA 2RNYA 5FE2A 4QY4A 5I7YA 2GRCA 3HMFA 5E9MA 4Z1QA 5CP5A 5J0DA 4A9LA 2YDWA 5LKXA 4YYMA 5A5NA 5IGKA 5EI4A 4E96A 4NR8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MB4 A;  4QSS A;  5EV9 A;  4HXM A;  5FE6 A;  4Y03 A;  4UYE A;  2DVS A;  5ACY A;  4HBX A;  4QSR A;  5FH8 A;  3UW9 A;  1JM4 B;  5DBM A;  5HFR A;  4QSP A;  3JVL A;  5ETB A;  4XY8 A;  4KV1 A;  3JVM A;  3UVX A;  2WP2 A;  1N72 A;  5FFW A;  5EIS A;  5AD2 A;  5A85 A;  4XUA A;  3O36 A;  4Q0N A;  4A9O A;  5IGL A;  4YH3 A;  3ZYU A;  4IOO A;  5F60 A;  3NXB A;  4ZW1 A;  5I89 A;  5FE3 A;  4NR5 A;  5ENB A;  5IG6 A;  4YAX A;  4TTE A;  5LJ1 A;  5F5Z A;  5L8T A;  2N9G A;  4A9E A;  4O7A A;  3P1F A;  4MR6 A;  3U5N A;  4NR4 A;  5BT4 A;  2RNX A;  2YEK A;  4CFK A;  4CFL A;  3U5J A;  4MEQ A;  4CUS A;  5A82 A;  3QZT A;  3P1E A;  4O70 A;  5HEM A;  5CS8 A;  2L85 A;  4TT6 A;  5EQ1 A;  4NR7 A;  3U5L A;  4WHU A;  4Z1S A;  5D3T A;  5DLZ A;  5IID A;  4QR3 A;  4IR4 A;  2RS9 B;  5G4S A;  4YY6 A;  5L98 A;  4KV4 A;  3O33 A;  5KU3 A;  5I86 A;  5H1T A;  5EM3 A;  5EGU A;  5AMF A;  4TS8 A;  3U5M A;  4QEU A;  3DWY A;  5F1H A;  5F25 A;  1ZS5 A;  5F62 A;  5IGM A;  4UYD A;  5CUD A;  1WUM A;  5C85 A;  4O76 A;  4NYW A;  2F6J A;  5DYU A;  4YYN A;  4HXO A;  4TYL A;  4IOR A;  3P5O A;  5CQ8 A;  5FE8 A;  4CUP A;  4A9H A;  5EP7 A;  5D25 A;  4XUB A;  5AME A;  5F2P A;  5D3R A;  4PY6 A;  4TZ8 A;  4HBY A;  4YBT A;  5CTL A;  4OUF A;  5EVA A;  5D3P A;  3HMH A;  5FE7 A;  4O77 A;  5HJC A;  5EA1 A;  4Z93 A;  5EIC A;  5FFY A;  3G0L A;  3UVD A;  2YEL A;  5CUB A;  5II1 A;  5C8G A;  5HCL A;  5HLS A;  5TB6 A;  4UIU A;  2OUO A;  4NUC A;  4MEN A;  4HXS A;  4TU6 A;  4YYK A;  5DFC A;  4XY9 A;  4MEP A;  4FLP A;  4UYF B;  2E3K A;  2DVR A;  5I1Q A;  4NRC A;  5E9V A;  4RVR A;  4Z6H A;  4IR5 A;  3TLP A;  4UIV A;  5ENI A;  4BHW A;  4BW3 A;  5H1U A;  3S91 A;  5EU1 A;  2OSS A;  2R10 A;  5EK9 A;  3AAD A;  4A9F A;  5I29 A;  2D9E A;  4MR3 A;  4NRB A;  5IBN A;  2NXB A;  5CPE A;  3D7C A;  4NQN A;  5EWC A;  5FE9 A;  2YEM A;  4N3W A;  4O75 A;  3LQH A;  2RO1 A;  5DFD A;  3QZV A;  2OO1 A;  4O7B A;  4A9J A;  4WHW A;  1F68 A;  4LRG A;  5CFW A;  4O72 A;  5LKU A;  3LXJ A;  4UYF A;  5CQ3 A;  4BJX A;  5CQ4 A;  3RCW A;  5A5Q A;  3LJW A;  5BT5 A;  4TZ2 A;  5CUC A;  5LVR A;  2D82 A;  5DX4 A;  5CQA A;  5EPR A;  3O35 A;  4TT4 A;  3UVY A;  4BW4 A;  1WUG A;  5FE0 A;  5JI8 A;  1E6I A;  5G4R A;  5EWD A;  4A9K A;  5FE1 A;  4HXP A;  4NUE A;  5EPS A;  4QC1 A;  5LKT A;  2F6N A;  4QUU A;  4YYD A;  5CQ7 A;  5CQ5 A;  4YH4 A;  2MJV B;  5HQ6 A;  4QB3 A;  5HRW A;  2L5E A;  2YQD A;  4YAD A;  5FG6 A;  4QUT A;  3U5O A;  5ENC A;  4YYH A;  2G4A A;  5A5S A;  4LYS A;  4QST A;  4LYI A;  5D3N A;  5HEN A;  4HXR A;  2H60 A;  4MR4 A;  5CQ6 A;  4MR5 A;  3MXF A;  3P1D A;  4QSQ A;  4UIY A;  5FFV A;  5E9K A;  2DWW A;  4J0S A;  4LR6 A;  3SVF A;  5DY7 A;  5F61 A;  5FE4 A;  5D3L A;  5D7X A;  4N4G A;  4C67 A;  4NR6 A;  4NR9 A;  4YBM A;  4CUR A;  4IR6 A;  5D0C A;  4O7E A;  4YC9 A;  3I3J A;  5FG5 A;  5HFQ A;  3UVW A;  3LQI A;  3MQM A;  5F63 A;  5HRX A;  3S92 A;  5EWV A;  5I80 A;  3FKM X;  5D3H A;  5A7C A;  5F36 A;  5E9Y A;  3GG3 A;  5E9I A;  4CL9 A;  4YK0 A;  4LDF A;  5C7N A;  4NXJ A;  5ENJ A;  4A9M A;  5A81 A;  2I7K A;  4Z6I A;  5C89 A;  5FH7 A;  4HXK A;  4KCX A;  5CGP A;  5L96 A;  4PS5 A;  5FG4 A;  3U5K A;  4CLB A;  3AQA A;  4O7C A;  4HXL A;  5DFB A;  3JVK A;  4IOQ A;  4NYV A;  5KTU A;  5K29 A;  4O7F A;  5E3G A;  5KHM A;  3U5P A;  5CY9 A;  5H1V A;  4O74 A;  4ALG A;  4HBV A;  5CZG A;  3HME A;  5E74 A;  4F3I A;  5IGN A;  5ENG A;  4QYD A;  5DYA A;  2DKW A;  5D3J A;  4TT2 A;  2RFJ A;  4OGI A;  2RNW A;  5AD3 A;  4LZR A;  5CRZ A;  1JSP B;  5D26 A;  4HBW A;  5FE5 A;  5ENE A;  5E0R A;  3ONI A;  4Q0O A;  2E7N A;  4BW2 A;  5EWW A;  4QEV A;  3K2J A;  4QSX A;  4C66 A;  5ENH A;  5C87 A;  5FBX A;  3IU5 A;  5DKD A;  2DAT A;  5HM0 A;  5LVQ A;  2I8N A;  4QSW A;  5DKH A;  4YYG A;  4QR5 A;  5HRV A;  4NS5 A;  4AKN A;  5EPB A;  5KO4 A;  2DVV A;  5DLX A;  5FB0 A;  4ALH A;  4PTB A;  5D3S A;  4N4F A;  4O78 A;  4YAB A;  2FSA A;  2WP1 A;  4GPJ A;  4QSU A;  3MUL A;  4UYG A;  4PKL A;  4LZ2 A;  4BW1 A;  5E73 A;  4J1P A;  5DW2 A;  4QNS A;  4NRA A;  4QEW A;  5CUA A;  3IU6 A;  5KTW A;  2LSP B;  5FH6 A;  4UIZ A;  2E7O A;  2DVQ A;  4PCI A;  4UIT A;  5L99 A;  5L97 A;  3O37 A;  3Q2F A;  5ENF A;  3JVJ A;  1EQF A;  3SVG A;  4TQN A;  2RI7 A;  4X2I A;  5DKC A;  3QZS A;  5I7X A;  4CUU A;  4DON A;  5HQ7 A;  4QYL A;  4NYX A;  5A83 A;  4MEO A;  5BT3 A;  4NUD A;  4N4I A;  5KTX A;  4CUQ A;  5A5O A;  4J0R A;  5I83 A;  5L8U A;  5II2 A;  4YY4 A;  4UIX A;  3SVH A;  3UV2 A;  5DYX A;  5E3D A;  5E7D A;  5DW1 A;  5H85 A;  4QC3 A;  3P1C A;  5HEL A;  5EWH A;  4YBS A;  4UYH A;  4UIW A;  3MUK A;  4IR3 A;  4PCE A;  5CU8 A;  4LC2 A;  5F3A A;  5A5P A;  2KTB B;  4ZQL A;  2R0S A;  3UV5 A;  3DAI A;  3G0J A;  4OGJ A;  4J3I A;  4YAT A;  2R0Y A;  4QR4 A;  3O34 A;  4N4H A;  4QBM A;  5I88 A;  4YYJ A;  5ETD A;  5LKZ A;  5CRM A;  3MB3 A;  4TU4 A;  4A9I A;  4A9N A;  4XYA A;  5D24 A;  5DYC A;  3Q2E A;  4NQM A;  3UV4 A;  2YYN A;  4LYW A;  4HXN A;  4YYI A;  5CUE A;  4O71 A;  5CQT A;  5LJ0 A;  4WIV A;  2YW5 A;  4QZS A;  4LZS A;  2R0V A;  5HQ5 A;  5CUG A;  5E9L A;  5LUU A;  4CUT A;  1X0J A;  2L84 A;  5JWM A;  4QSV A;  5A5R A;  4ZC9 A;  5FDZ A;  5I40 A;  3LQJ A;  5F1L A;  5COI A;  5FB1 A;  5TCM A;  5LJ2 A;  5C4Q A;  2RNY A;  5FE2 A;  4QY4 A;  5I7Y A;  2GRC A;  3HMF A;  5E9M A;  4Z1Q A;  5CP5 A;  5J0D A;  4A9L A;  2YDW A;  5LKX A;  4YYM A;  5A5N A;  5IGK A;  5EI4 A;  4E96 A;  4NR8 A; 
#chains in the Genus database with same CATH topology
 3MB4 A;  4QSS A;  5EV9 A;  4HXM A;  5FE6 A;  4Y03 A;  4UYE A;  2DVS A;  5ACY A;  4HBX A;  4QSR A;  5FH8 A;  3UW9 A;  1JM4 B;  5DBM A;  5HFR A;  4QSP A;  3JVL A;  5ETB A;  4XY8 A;  4KV1 A;  3JVM A;  3UVX A;  2WP2 A;  1N72 A;  5FFW A;  5EIS A;  5AD2 A;  5A85 A;  4XUA A;  3O36 A;  4Q0N A;  4A9O A;  5IGL A;  4YH3 A;  3ZYU A;  4IOO A;  5F60 A;  3NXB A;  4ZW1 A;  5I89 A;  5FE3 A;  4NR5 A;  5ENB A;  5IG6 A;  4YAX A;  4TTE A;  5LJ1 A;  5F5Z A;  5L8T A;  2N9G A;  4A9E A;  4O7A A;  3P1F A;  4MR6 A;  2EJN A;  3U5N A;  4NR4 A;  5BT4 A;  2RNX A;  2YEK A;  4CFK A;  4CFL A;  3U5J A;  4MEQ A;  4CUS A;  5A82 A;  3QZT A;  3P1E A;  4O70 A;  5HEM A;  5CS8 A;  2L85 A;  4TT6 A;  5EQ1 A;  4NR7 A;  3U5L A;  1PUO A;  4WHU A;  4Z1S A;  5D3T A;  5DLZ A;  5IID A;  4QR3 A;  4IR4 A;  2RS9 B;  5G4S A;  4YY6 A;  5L98 A;  4KV4 A;  3O33 A;  5KU3 A;  5I86 A;  5H1T A;  5EM3 A;  5EGU A;  5AMF A;  4TS8 A;  3U5M A;  4QEU A;  3DWY A;  5F1H A;  5F25 A;  1ZS5 A;  5F62 A;  5IGM A;  4UYD A;  5CUD A;  1WUM A;  5C85 A;  4O76 A;  4AKH A;  4NYW A;  2F6J A;  5DYU A;  4YYN A;  4HXO A;  4TYL A;  4IOR A;  3P5O A;  5CQ8 A;  5FE8 A;  4CUP A;  4A9H A;  5EP7 A;  5D25 A;  4XUB A;  5AME A;  5F2P A;  5D3R A;  4PY6 A;  4TZ8 A;  4HBY A;  4YBT A;  5CTL A;  4OUF A;  3ERR A;  5EVA A;  5D3P A;  3HMH A;  5FE7 A;  4O77 A;  5HJC A;  5EA1 A;  4Z93 A;  5EIC A;  5FFY A;  3G0L A;  3UVD A;  2YEL A;  5CUB A;  5II1 A;  5C8G A;  5HCL A;  5HLS A;  5TB6 A;  4UIU A;  2OUO A;  4NUC A;  4MEN A;  4HXS A;  4TU6 A;  4YYK A;  5DFC A;  4XY9 A;  4MEP A;  4FLP A;  4UYF B;  2E3K A;  2DVR A;  5I1Q A;  4NRC A;  5E9V A;  4RVR A;  4Z6H A;  4IR5 A;  3TLP A;  4UIV A;  5ENI A;  4BHW A;  4BW3 A;  5H1U A;  3S91 A;  5EU1 A;  2OSS A;  2R10 A;  3VKG A;  5EK9 A;  3AAD A;  4A9F A;  5I29 A;  2D9E A;  4MR3 A;  4NRB A;  5IBN A;  2NXB A;  5CPE A;  3D7C A;  4NQN A;  3VKH A;  5EWC A;  5FE9 A;  2YEM A;  4N3W A;  4O75 A;  3LQH A;  2RO1 A;  5DFD A;  3QZV A;  2OO1 A;  4O7B A;  4A9J A;  4WHW A;  1F68 A;  4LRG A;  5CFW A;  4O72 A;  5LKU A;  3LXJ A;  4UYF A;  5CQ3 A;  4BJX A;  5CQ4 A;  3RCW A;  5A5Q A;  3LJW A;  5BT5 A;  4TZ2 A;  5CUC A;  5LVR A;  2D82 A;  5DX4 A;  3D1B A;  5CQA A;  5EPR A;  3O35 A;  4TT4 A;  3UVY A;  4BW4 A;  1WUG A;  5FE0 A;  5JI8 A;  1E6I A;  5G4R A;  5EWD A;  4A9K A;  5FE1 A;  4HXP A;  4NUE A;  5EPS A;  4QC1 A;  5LKT A;  2F6N A;  4QUU A;  4YYD A;  5CQ7 A;  5CQ5 A;  4YH4 A;  2MJV B;  5HQ6 A;  4QB3 A;  5HRW A;  2L5E A;  2YQD A;  4YAD A;  5FG6 A;  4QUT A;  3U5O A;  5ENC A;  4YYH A;  2G4A A;  5A5S A;  4LYS A;  4QST A;  4LYI A;  5D3N A;  5HEN A;  4HXR A;  2H60 A;  4MR4 A;  5CQ6 A;  4MR5 A;  3MXF A;  3P1D A;  4QSQ A;  4UIY A;  5FFV A;  5E9K A;  2DWW A;  4J0S A;  4LR6 A;  3SVF A;  5DY7 A;  5F61 A;  5FE4 A;  5D3L A;  5D7X A;  4N4G A;  4C67 A;  4NR6 A;  4NR9 A;  4YBM A;  4CUR A;  4IR6 A;  5D0C A;  4O7E A;  4YC9 A;  3I3J A;  5FG5 A;  5HFQ A;  3UVW A;  4AKG A;  3LQI A;  3MQM A;  5F63 A;  5HRX A;  3S92 A;  5EWV A;  5I80 A;  4AI6 A;  3FKM X;  5D3H A;  5A7C A;  5F36 A;  5E9Y A;  3GG3 A;  5E9I A;  4CL9 A;  4YK0 A;  4LDF A;  5C7N A;  4NXJ A;  5ENJ A;  4A9M A;  5A81 A;  2I7K A;  4Z6I A;  5C89 A;  5FH7 A;  4HXK A;  4KCX A;  5CGP A;  5L96 A;  4PS5 A;  5FG4 A;  3U5K A;  4CLB A;  3AQA A;  4O7C A;  4HXL A;  5DFB A;  3JVK A;  4IOQ A;  4NYV A;  5KTU A;  5K29 A;  4O7F A;  5E3G A;  5KHM A;  3U5P A;  5CY9 A;  5H1V A;  4O74 A;  4ALG A;  4HBV A;  5CZG A;  3HME A;  5E74 A;  4F3I A;  5IGN A;  5ENG A;  4QYD A;  5DYA A;  2DKW A;  5D3J A;  4TT2 A;  2RFJ A;  4OGI A;  2RNW A;  5AD3 A;  4LZR A;  5CRZ A;  1JSP B;  5D26 A;  4HBW A;  5FE5 A;  5ENE A;  5E0R A;  3ONI A;  4Q0O A;  2E7N A;  4BW2 A;  5EWW A;  4QEV A;  3K2J A;  4QSX A;  4C66 A;  5ENH A;  5C87 A;  5FBX A;  3IU5 A;  5DKD A;  2DAT A;  5HM0 A;  5LVQ A;  2I8N A;  4QSW A;  5DKH A;  4YYG A;  4QR5 A;  5HRV A;  4NS5 A;  4AKN A;  5EPB A;  5KO4 A;  2DVV A;  5DLX A;  5FB0 A;  4ALH A;  4PTB A;  5D3S A;  4N4F A;  4O78 A;  4YAB A;  2FSA A;  2WP1 A;  4GPJ A;  4QSU A;  3MUL A;  4UYG A;  4PKL A;  4LZ2 A;  4BW1 A;  5E73 A;  4J1P A;  5DW2 A;  4QNS A;  4NRA A;  4QEW A;  5CUA A;  3IU6 A;  5KTW A;  2LSP B;  5FH6 A;  4UIZ A;  2E7O A;  2DVQ A;  4PCI A;  4UIT A;  5L99 A;  5L97 A;  3O37 A;  3Q2F A;  5ENF A;  3JVJ A;  1EQF A;  3SVG A;  4TQN A;  2RI7 A;  4X2I A;  5DKC A;  3QZS A;  5I7X A;  4CUU A;  4DON A;  5HQ7 A;  4QYL A;  4NYX A;  5A83 A;  4MEO A;  5BT3 A;  4NUD A;  4N4I A;  5KTX A;  4CUQ A;  5A5O A;  4J0R A;  5I83 A;  5L8U A;  5II2 A;  4YY4 A;  4UIX A;  3SVH A;  3UV2 A;  5DYX A;  5E3D A;  5E7D A;  5DW1 A;  5H85 A;  4QC3 A;  3P1C A;  5HEL A;  5EWH A;  4YBS A;  4UYH A;  4UIW A;  3MUK A;  4IR3 A;  4PCE A;  5CU8 A;  4LC2 A;  5F3A A;  5A5P A;  2KTB B;  4ZQL A;  2R0S A;  3UV5 A;  3DAI A;  3G0J A;  4OGJ A;  4J3I A;  4YAT A;  2R0Y A;  4QR4 A;  3O34 A;  4N4H A;  4QBM A;  3D1D A;  5I88 A;  4YYJ A;  5ETD A;  5LKZ A;  5CRM A;  3MB3 A;  4TU4 A;  4A9I A;  4A9N A;  4XYA A;  5D24 A;  5DYC A;  3Q2E A;  4NQM A;  3UV4 A;  2YYN A;  4LYW A;  4HXN A;  4YYI A;  5CUE A;  4O71 A;  5CQT A;  5LJ0 A;  4WIV A;  2YW5 A;  4QZS A;  1ZKR A;  4LZS A;  2R0V A;  5HQ5 A;  5CUG A;  5E9L A;  5LUU A;  4CUT A;  1X0J A;  2L84 A;  5JWM A;  4QSV A;  5A5R A;  4AKI A;  4ZC9 A;  5FDZ A;  5I40 A;  3LQJ A;  5F1L A;  5COI A;  5FB1 A;  5TCM A;  5LJ2 A;  5C4Q A;  2RNY A;  5FE2 A;  4QY4 A;  5I7Y A;  2GRC A;  3HMF A;  5E9M A;  4Z1Q A;  5CP5 A;  5J0D A;  4A9L A;  2YDW A;  5LKX A;  4YYM A;  5A5N A;  5IGK A;  5EI4 A;  4E96 A;  4NR8 A; 
#chains in the Genus database with same CATH homology
 3MB4 A;  4QSS A;  5EV9 A;  4HXM A;  5FE6 A;  4Y03 A;  4UYE A;  2DVS A;  5ACY A;  4HBX A;  4QSR A;  5FH8 A;  3UW9 A;  1JM4 B;  5DBM A;  5HFR A;  4QSP A;  3JVL A;  5ETB A;  4XY8 A;  4KV1 A;  3JVM A;  3UVX A;  2WP2 A;  1N72 A;  5FFW A;  5EIS A;  5AD2 A;  5A85 A;  4XUA A;  3O36 A;  4Q0N A;  4A9O A;  5IGL A;  4YH3 A;  3ZYU A;  4IOO A;  5F60 A;  3NXB A;  4ZW1 A;  5I89 A;  5FE3 A;  4NR5 A;  5ENB A;  5IG6 A;  4YAX A;  4TTE A;  5LJ1 A;  5F5Z A;  5L8T A;  2N9G A;  4A9E A;  4O7A A;  3P1F A;  4MR6 A;  3U5N A;  4NR4 A;  5BT4 A;  2RNX A;  2YEK A;  4CFK A;  4CFL A;  3U5J A;  4MEQ A;  4CUS A;  5A82 A;  3QZT A;  3P1E A;  4O70 A;  5HEM A;  5CS8 A;  2L85 A;  4TT6 A;  5EQ1 A;  4NR7 A;  3U5L A;  4WHU A;  4Z1S A;  5D3T A;  5DLZ A;  5IID A;  4QR3 A;  4IR4 A;  2RS9 B;  5G4S A;  4YY6 A;  5L98 A;  4KV4 A;  3O33 A;  5KU3 A;  5I86 A;  5H1T A;  5EM3 A;  5EGU A;  5AMF A;  4TS8 A;  3U5M A;  4QEU A;  3DWY A;  5F1H A;  5F25 A;  1ZS5 A;  5F62 A;  5IGM A;  4UYD A;  5CUD A;  1WUM A;  5C85 A;  4O76 A;  4NYW A;  2F6J A;  5DYU A;  4YYN A;  4HXO A;  4TYL A;  4IOR A;  3P5O A;  5CQ8 A;  5FE8 A;  4CUP A;  4A9H A;  5EP7 A;  5D25 A;  4XUB A;  5AME A;  5F2P A;  5D3R A;  4PY6 A;  4TZ8 A;  4HBY A;  4YBT A;  5CTL A;  4OUF A;  5EVA A;  5D3P A;  3HMH A;  5FE7 A;  4O77 A;  5HJC A;  5EA1 A;  4Z93 A;  5EIC A;  5FFY A;  3G0L A;  3UVD A;  2YEL A;  5CUB A;  5II1 A;  5C8G A;  5HCL A;  5HLS A;  5TB6 A;  4UIU A;  2OUO A;  4NUC A;  4MEN A;  4HXS A;  4TU6 A;  4YYK A;  5DFC A;  4XY9 A;  4MEP A;  4FLP A;  4UYF B;  2E3K A;  2DVR A;  5I1Q A;  4NRC A;  5E9V A;  4RVR A;  4Z6H A;  4IR5 A;  3TLP A;  4UIV A;  5ENI A;  4BHW A;  4BW3 A;  5H1U A;  3S91 A;  5EU1 A;  2OSS A;  2R10 A;  5EK9 A;  3AAD A;  4A9F A;  5I29 A;  2D9E A;  4MR3 A;  4NRB A;  5IBN A;  2NXB A;  5CPE A;  3D7C A;  4NQN A;  5EWC A;  5FE9 A;  2YEM A;  4N3W A;  4O75 A;  3LQH A;  2RO1 A;  5DFD A;  3QZV A;  2OO1 A;  4O7B A;  4A9J A;  4WHW A;  1F68 A;  4LRG A;  5CFW A;  4O72 A;  5LKU A;  3LXJ A;  4UYF A;  5CQ3 A;  4BJX A;  5CQ4 A;  3RCW A;  5A5Q A;  3LJW A;  5BT5 A;  4TZ2 A;  5CUC A;  5LVR A;  2D82 A;  5DX4 A;  5CQA A;  5EPR A;  3O35 A;  4TT4 A;  3UVY A;  4BW4 A;  1WUG A;  5FE0 A;  5JI8 A;  1E6I A;  5G4R A;  5EWD A;  4A9K A;  5FE1 A;  4HXP A;  4NUE A;  5EPS A;  4QC1 A;  5LKT A;  2F6N A;  4QUU A;  4YYD A;  5CQ7 A;  5CQ5 A;  4YH4 A;  2MJV B;  5HQ6 A;  4QB3 A;  5HRW A;  2L5E A;  2YQD A;  4YAD A;  5FG6 A;  4QUT A;  3U5O A;  5ENC A;  4YYH A;  2G4A A;  5A5S A;  4LYS A;  4QST A;  4LYI A;  5D3N A;  5HEN A;  4HXR A;  2H60 A;  4MR4 A;  5CQ6 A;  4MR5 A;  3MXF A;  3P1D A;  4QSQ A;  4UIY A;  5FFV A;  5E9K A;  2DWW A;  4J0S A;  4LR6 A;  3SVF A;  5DY7 A;  5F61 A;  5FE4 A;  5D3L A;  5D7X A;  4N4G A;  4C67 A;  4NR6 A;  4NR9 A;  4YBM A;  4CUR A;  4IR6 A;  5D0C A;  4O7E A;  4YC9 A;  3I3J A;  5FG5 A;  5HFQ A;  3UVW A;  3LQI A;  3MQM A;  5F63 A;  5HRX A;  3S92 A;  5EWV A;  5I80 A;  3FKM X;  5D3H A;  5A7C A;  5F36 A;  5E9Y A;  3GG3 A;  5E9I A;  4CL9 A;  4YK0 A;  4LDF A;  5C7N A;  4NXJ A;  5ENJ A;  4A9M A;  5A81 A;  2I7K A;  4Z6I A;  5C89 A;  5FH7 A;  4HXK A;  4KCX A;  5CGP A;  5L96 A;  4PS5 A;  5FG4 A;  3U5K A;  4CLB A;  3AQA A;  4O7C A;  4HXL A;  5DFB A;  3JVK A;  4IOQ A;  4NYV A;  5KTU A;  5K29 A;  4O7F A;  5E3G A;  5KHM A;  3U5P A;  5CY9 A;  5H1V A;  4O74 A;  4ALG A;  4HBV A;  5CZG A;  3HME A;  5E74 A;  4F3I A;  5IGN A;  5ENG A;  4QYD A;  5DYA A;  2DKW A;  5D3J A;  4TT2 A;  2RFJ A;  4OGI A;  2RNW A;  5AD3 A;  4LZR A;  5CRZ A;  1JSP B;  5D26 A;  4HBW A;  5FE5 A;  5ENE A;  5E0R A;  3ONI A;  4Q0O A;  2E7N A;  4BW2 A;  5EWW A;  4QEV A;  3K2J A;  4QSX A;  4C66 A;  5ENH A;  5C87 A;  5FBX A;  3IU5 A;  5DKD A;  2DAT A;  5HM0 A;  5LVQ A;  2I8N A;  4QSW A;  5DKH A;  4YYG A;  4QR5 A;  5HRV A;  4NS5 A;  4AKN A;  5EPB A;  5KO4 A;  2DVV A;  5DLX A;  5FB0 A;  4ALH A;  4PTB A;  5D3S A;  4N4F A;  4O78 A;  4YAB A;  2FSA A;  2WP1 A;  4GPJ A;  4QSU A;  3MUL A;  4UYG A;  4PKL A;  4LZ2 A;  4BW1 A;  5E73 A;  4J1P A;  5DW2 A;  4QNS A;  4NRA A;  4QEW A;  5CUA A;  3IU6 A;  5KTW A;  2LSP B;  5FH6 A;  4UIZ A;  2E7O A;  2DVQ A;  4PCI A;  4UIT A;  5L99 A;  5L97 A;  3O37 A;  3Q2F A;  5ENF A;  3JVJ A;  1EQF A;  3SVG A;  4TQN A;  2RI7 A;  4X2I A;  5DKC A;  3QZS A;  5I7X A;  4CUU A;  4DON A;  5HQ7 A;  4QYL A;  4NYX A;  5A83 A;  4MEO A;  5BT3 A;  4NUD A;  4N4I A;  5KTX A;  4CUQ A;  5A5O A;  4J0R A;  5I83 A;  5L8U A;  5II2 A;  4YY4 A;  4UIX A;  3SVH A;  3UV2 A;  5DYX A;  5E3D A;  5E7D A;  5DW1 A;  5H85 A;  4QC3 A;  3P1C A;  5HEL A;  5EWH A;  4YBS A;  4UYH A;  4UIW A;  3MUK A;  4IR3 A;  4PCE A;  5CU8 A;  4LC2 A;  5F3A A;  5A5P A;  2KTB B;  4ZQL A;  2R0S A;  3UV5 A;  3DAI A;  3G0J A;  4OGJ A;  4J3I A;  4YAT A;  2R0Y A;  4QR4 A;  3O34 A;  4N4H A;  4QBM A;  5I88 A;  4YYJ A;  5ETD A;  5LKZ A;  5CRM A;  3MB3 A;  4TU4 A;  4A9I A;  4A9N A;  4XYA A;  5D24 A;  5DYC A;  3Q2E A;  4NQM A;  3UV4 A;  2YYN A;  4LYW A;  4HXN A;  4YYI A;  5CUE A;  4O71 A;  5CQT A;  5LJ0 A;  4WIV A;  2YW5 A;  4QZS A;  4LZS A;  2R0V A;  5HQ5 A;  5CUG A;  5E9L A;  5LUU A;  4CUT A;  1X0J A;  2L84 A;  5JWM A;  4QSV A;  5A5R A;  4ZC9 A;  5FDZ A;  5I40 A;  3LQJ A;  5F1L A;  5COI A;  5FB1 A;  5TCM A;  5LJ2 A;  5C4Q A;  2RNY A;  5FE2 A;  4QY4 A;  5I7Y A;  2GRC A;  3HMF A;  5E9M A;  4Z1Q A;  5CP5 A;  5J0D A;  4A9L A;  2YDW A;  5LKX A;  4YYM A;  5A5N A;  5IGK A;  5EI4 A;  4E96 A;  4NR8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...