4UIVA

Bromodomain of human brd9 with n-(1,1-dioxo-1-thian-4-yl)-5-methyl-4- oxo-7-3-(trifluoromethyl)phenyl-4h,5h-thieno-3,2-c-pyridine-2- carboximidamide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 9
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 35
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uivA00
5H1TA 4LYSA 5BT5A 5F36A 4QSPA 4PCEA 3UVYA 4CUTA 3HMHA 2L84A 5ENFA 4N4FA 4NUDA 3G0LA 5L8TA 5DX4A 4X2IA 4A9MA 4TZ2A 3P5OA 3U5MA 5E9YA 2E3KA 4ZW1A 5C8GA 5KTXA 4TZ8A 2R0YA 5F62A 4PKLA 5TCMA 5HELA 4HBVA 5E74A 4CUPA 4Z6IA 5FE7A 2NXBA 4HBWA 2FSAA 5CGPA 4A9JA 4Y03A 4MR5A 5A5SA 4AKNA 5FFVA 4HXMA 3SVFA 2L5EA 5JWMA 4O7CA 4TT4A 1JM4B 3IU5A 5EU1A 2D82A 4MR6A 4PY6A 4YYNA 3SVHA 4XUAA 5DLXA 2DVSA 3FKMX 5HENA 4QSUA 5FG6A 5FG5A 5AD2A 4BHWA 3U5JA 4TT2A 5CTLA 4IR3A 5EWVA 4PTBA 4ZQLA 5CQ6A 3NXBA 4Z1QA 5F1HA 4NRBA 5A5NA 3O33A 4YATA 5DYCA 2RNWA 3S92A 4QR5A 4Z93A 4C67A 5I40A 5IG6A 4IR6A 4WHUA 4TU6A 5LJ0A 4QY4A 4FLPA 3QZTA 1WUGA 3LQHA 2YEKA 4MR4A 5COIA 5H85A 4BW3A 4LR6A 4NXJA 5ENCA 4CUUA 5I7YA 4YYGA 4BW2A 5D3TA 2DATA 5DKDA 4KCXA 4QYDA 5A5PA 4HBXA 5HFQA 5A7CA 5L99A 5LKUA 3UV4A 5DKHA 4WHWA 3JVMA 5FE6A 4CUQA 5CQ4A 5BT3A 4QC3A 4KV4A 5CQ8A 5A81A 5AMEA 3LJWA 4RVRA 3IU6A 5F63A 5F1LA 5HM0A 3JVLA 5CUEA 3DWYA 4A9IA 5EQ1A 4UYDA 5EGUA 5D26A 5E0RA 5D3PA 4BJXA 4NR4A 5KO4A 4NR9A 4O76A 4Z6HA 4CLBA 3O36A 5D3RA 4BW4A 3QZVA 4F3IA 5F5ZA 5EPRA 3UV2A 3UVDA 5E3DA 3JVKA 4IOOA 3QZSA 5CQAA 3O37A 5FE3A 2KTBB 5L96A 1JSPB 4N4IA 5CUAA 4N4GA 5CQ5A 4UIYA 4ZC9A 4HXNA 5LVRA 5HLSA 4LDFA 4QSVA 5CRZA 4XY9A 5AD3A 4MEPA 4O74A 4UYEA 4UIUA 3U5NA 5DLZA 3RCWA 2YW5A 5EICA 5C89A 3UV5A 5CQ3A 4YC9A 4ALHA 4NR8A 5CP5A 4NR6A 5F61A 5HFRA 4YYDA 4O78A 4UITA 4LC2A 4A9LA 5FG4A 5IGLA 2R0VA 3AQAA 5CUGA 4J3IA 5A85A 5F25A 4NQNA 4TQNA 4Z1SA 5FE4A 5EWDA 4HXKA 5I89A 5KU3A 2DKWA 5II2A 2YDWA 5EPSA 5H1UA 5DKCA 5FH8A 4QR3A 4HBYA 2RNYA 5E9IA 4DONA 5IGMA 1WUMA 5EPBA 1F68A 2YQDA 1E6IA 3I3JA 5A5RA 4QSTA 4YBSA 2F6JA 4HXPA 5E9VA 5CU8A 5D24A 4WIVA 5DBMA 5D3LA 3DAIA 2WP1A 4HXRA 2N9GA 5EV9A 5ENBA 5HQ7A 2I7KA 3U5KA 4LYWA 5HJCA 1N72A 3UW9A 5LJ2A 3LQIA 4NS5A 5CRMA 4PCIA 3MULA 4MEQA 3UVWA 5FH7A 5CZGA 5H1VA 2WP2A 4J0RA 4YH3A 5FFWA 2OO1A 5TB6A 3LXJA 4A9FA 2I8NA 2L85A 5LKZA 5IGNA 4XYAA 5ENIA 4A9NA 5J0DA 4YBMA 4NR5A 3D7CA 4YY6A 5ENJA 4CL9A 4YK0A 4QSSA 4YABA 5C87A 4MENA 4QR4A 4UYFA 4A9EA 4NQMA 5DYAA 5D25A 5II1A 5CQTA 4HXLA 4Q0NA 5CUDA 4QB3A 5EWWA 4XY8A 2RO1A 4O70A 4MR3A 4A9HA 1X0JA 3TLPA 3P1CA 4TS8A 4IOQA 3HMEA 4QNSA 5CY9A 5HCLA 5E3GA 4MEOA 4QBMA 4PS5A 3P1FA 4ALGA 3HMFA 4QC1A 5DFCA 2LSPB 3K2JA 4YAXA 4YBTA 5EM3A 5FFYA 2RS9B 4NYWA 4XUBA 2DWWA 5C85A 3UVXA 3GG3A 5L98A 5ETDA 4NR7A 5IBNA 5ENGA 5KHMA 4IORA 5LKTA 3LQJA 2OUOA 4NUEA 5E9LA 3U5PA 3MXFA 5E73A 5FE0A 5EISA 2YELA 4UYHA 4TU4A 4NUCA 5I83A 3ZYUA 4QUUA 5FE1A 5FDZA 4BW1A 5LKXA 4YY4A 3G0JA 5LJ1A 5EWHA 4YH4A 4UYFB 2E7NA 2YEMA 4YYMA 5FB1A 3O35A 3MUKA 5EI4A 5C4QA 3JVJA 4O71A 4OGIA 5A5QA 5D3HA 5I80A 4QSQA 3Q2EA 5G4SA 5I29A 5CQ7A 5HRVA 5FE2A 5D3NA 2D9EA 5D0CA 4UIVA 4YYIA 5F60A 2R0SA 4J1PA 4O72A 4QEUA 5EWCA 5AMFA 5IIDA 4LZRA 5DYUA 4O7AA 2GRCA 5A83A 4YYHA 4NYVA 4UYGA 5E9MA 4A9KA 2DVQA 3P1DA 1ZS5A 5CUBA 4E96A 4UIZA 5HQ5A 5EVAA 5I1QA 5DW2A 4QZSA 5E9KA 4CFLA 5A82A 4O7FA 5K29A 4NRCA 3SVGA 5F2PA 5CFWA 2DVVA 3ONIA 3AADA 4TTEA 5L8UA 4QSWA 2DVRA 4QEVA 4O7EA 5L97A 4QYLA 3MB4A 3P1EA 4YYJA 2F6NA 5LUUA 4CURA 4LYIA 4NYXA 2RNXA 4HXSA 2E7OA 5IGKA 4YADA 4Q0OA 3S91A 4TT6A 5DY7A 2H60A 1EQFA 4N4HA 5KTUA 3U5OA 4TYLA 5HRXA 5G4RA 5BT4A 4OUFA 2R10A 2MJVB 3MQMA 3Q2FA 4OGJA 4UIXA 2YYNA 5HRWA 4O7BA 4IR5A 5ACYA 4QUTA 3O34A 4QEWA 5ENEA 5HQ6A 5DYXA 5E7DA 5FE5A 2RI7A 5CS8A 5ENHA 5FH6A 4CUSA 2G4AA 5I86A 5EP7A 4YYKA 4NRAA 5FE9A 3U5LA 4LZSA 5DFDA 4HXOA 5HEMA 4C66A 4LRGA 5CPEA 2RFJA 5KTWA 5FBXA 5D3SA 4N3WA 4O77A 4IR4A 4GPJA 5C7NA 5DW1A 5ETBA 5D7XA 5A5OA 4O75A 5D3JA 5CUCA 4A9OA 5EA1A 4KV1A 5F3AA 5I7XA 4CFKA 4LZ2A 5DFBA 5FB0A 4UIWA 4J0SA 5I88A 5EK9A 5JI8A 4QSRA 4QSXA 5LVQA 5FE8A 3MB3A 2OSSA
chains in the Genus database with same CATH superfamily
5H1TA 4LYSA 5BT5A 3ERRA 5F36A 4QSPA 4PCEA 3UVYA 4CUTA 3HMHA 2L84A 5ENFA 4N4FA 4NUDA 3G0LA 5L8TA 5DX4A 4X2IA 4A9MA 4TZ2A 3P5OA 3U5MA 5E9YA 2E3KA 4ZW1A 5C8GA 5KTXA 4TZ8A 4AKGA 2R0YA 5F62A 3D1DA 4PKLA 5TCMA 5HELA 4HBVA 5E74A 4CUPA 4Z6IA 5FE7A 2NXBA 4HBWA 2FSAA 5CGPA 4A9JA 4Y03A 4MR5A 5A5SA 4AKNA 5FFVA 4HXMA 3SVFA 2L5EA 5JWMA 4O7CA 4TT4A 1JM4B 3IU5A 5EU1A 2D82A 4MR6A 4PY6A 4YYNA 3SVHA 4XUAA 5DLXA 2DVSA 3FKMX 5HENA 4QSUA 5FG6A 5FG5A 5AD2A 4BHWA 3U5JA 4TT2A 5CTLA 4IR3A 5EWVA 4PTBA 4ZQLA 5CQ6A 3NXBA 4Z1QA 5F1HA 4NRBA 5A5NA 3O33A 4YATA 5DYCA 2RNWA 3S92A 4QR5A 4Z93A 4C67A 5I40A 5IG6A 4IR6A 4WHUA 4TU6A 5LJ0A 4QY4A 4FLPA 3QZTA 1WUGA 3LQHA 2YEKA 4MR4A 5COIA 5H85A 4BW3A 4LR6A 4NXJA 5ENCA 4CUUA 3VKHA 5I7YA 4YYGA 4BW2A 5D3TA 2DATA 5DKDA 4KCXA 4QYDA 5A5PA 4HBXA 5HFQA 5A7CA 5L99A 5LKUA 3UV4A 5DKHA 4WHWA 3JVMA 4AI6A 5FE6A 4CUQA 5CQ4A 5BT3A 4AKHA 4QC3A 4KV4A 5CQ8A 5A81A 5AMEA 3LJWA 4RVRA 3IU6A 5F63A 5F1LA 5HM0A 3JVLA 5CUEA 3DWYA 4A9IA 5EQ1A 4UYDA 5EGUA 5D26A 5E0RA 5D3PA 4BJXA 4NR4A 5KO4A 4NR9A 4O76A 4Z6HA 4CLBA 3O36A 5D3RA 4BW4A 3QZVA 4F3IA 5F5ZA 5EPRA 3UV2A 3UVDA 5E3DA 3JVKA 4IOOA 3QZSA 5CQAA 3O37A 5FE3A 2KTBB 5L96A 1JSPB 2EJNA 4N4IA 5CUAA 4N4GA 5CQ5A 4UIYA 4ZC9A 4HXNA 4AKIA 5LVRA 5HLSA 4LDFA 4QSVA 5CRZA 4XY9A 5AD3A 4MEPA 4O74A 4UYEA 4UIUA 3U5NA 5DLZA 3RCWA 2YW5A 5EICA 5C89A 3UV5A 5CQ3A 4YC9A 4ALHA 4NR8A 5CP5A 4NR6A 5F61A 5HFRA 4YYDA 4O78A 4UITA 4LC2A 4A9LA 5FG4A 5IGLA 2R0VA 3AQAA 5CUGA 4J3IA 5A85A 5F25A 4NQNA 4TQNA 4Z1SA 5FE4A 5EWDA 4HXKA 5I89A 5KU3A 2DKWA 5II2A 2YDWA 5EPSA 5H1UA 5DKCA 5FH8A 4QR3A 4HBYA 2RNYA 5E9IA 4DONA 5IGMA 1WUMA 5EPBA 1F68A 2YQDA 1E6IA 3I3JA 5A5RA 4QSTA 4YBSA 2F6JA 4HXPA 5E9VA 5CU8A 5D24A 4WIVA 5DBMA 5D3LA 3DAIA 2WP1A 4HXRA 2N9GA 5EV9A 5ENBA 5HQ7A 2I7KA 3U5KA 4LYWA 5HJCA 1N72A 3UW9A 5LJ2A 3LQIA 4NS5A 5CRMA 4PCIA 3MULA 4MEQA 3UVWA 5FH7A 5CZGA 5H1VA 2WP2A 4J0RA 4YH3A 5FFWA 2OO1A 5TB6A 3LXJA 4A9FA 2I8NA 2L85A 5LKZA 5IGNA 4XYAA 5ENIA 4A9NA 5J0DA 4YBMA 4NR5A 3D7CA 4YY6A 5ENJA 4CL9A 4YK0A 4QSSA 4YABA 5C87A 4MENA 4QR4A 4UYFA 4A9EA 4NQMA 5DYAA 5D25A 5II1A 5CQTA 4HXLA 4Q0NA 5CUDA 4QB3A 5EWWA 4XY8A 2RO1A 4O70A 4MR3A 4A9HA 1X0JA 3TLPA 3P1CA 4TS8A 4IOQA 3HMEA 4QNSA 5CY9A 5HCLA 5E3GA 4MEOA 4QBMA 4PS5A 3P1FA 4ALGA 3HMFA 4QC1A 5DFCA 2LSPB 3K2JA 4YAXA 4YBTA 5EM3A 5FFYA 2RS9B 4NYWA 4XUBA 2DWWA 5C85A 3UVXA 3GG3A 5L98A 5ETDA 4NR7A 5IBNA 5ENGA 5KHMA 4IORA 5LKTA 3LQJA 2OUOA 4NUEA 5E9LA 3U5PA 3MXFA 5E73A 5FE0A 5EISA 2YELA 4UYHA 4TU4A 4NUCA 5I83A 3ZYUA 4QUUA 5FE1A 5FDZA 4BW1A 5LKXA 4YY4A 3G0JA 5LJ1A 5EWHA 4YH4A 4UYFB 2E7NA 2YEMA 4YYMA 5FB1A 3O35A 3VKGA 3MUKA 5EI4A 5C4QA 3JVJA 4O71A 4OGIA 5A5QA 5D3HA 5I80A 4QSQA 3Q2EA 5G4SA 5I29A 5CQ7A 5HRVA 5FE2A 5D3NA 2D9EA 5D0CA 4UIVA 1ZKRA 4YYIA 5F60A 2R0SA 4J1PA 4O72A 4QEUA 5EWCA 5AMFA 5IIDA 4LZRA 5DYUA 4O7AA 2GRCA 5A83A 4YYHA 4NYVA 4UYGA 5E9MA 4A9KA 2DVQA 3P1DA 1ZS5A 5CUBA 4E96A 4UIZA 5HQ5A 5EVAA 5I1QA 5DW2A 4QZSA 5E9KA 4CFLA 5A82A 4O7FA 5K29A 4NRCA 3SVGA 5F2PA 5CFWA 2DVVA 3ONIA 3AADA 4TTEA 5L8UA 4QSWA 2DVRA 1PUOA 4QEVA 4O7EA 5L97A 4QYLA 3MB4A 3P1EA 4YYJA 2F6NA 5LUUA 4CURA 4LYIA 4NYXA 2RNXA 4HXSA 2E7OA 5IGKA 4YADA 4Q0OA 3S91A 4TT6A 5DY7A 2H60A 1EQFA 4N4HA 5KTUA 3U5OA 4TYLA 5HRXA 5G4RA 5BT4A 4OUFA 2R10A 2MJVB 3MQMA 3Q2FA 4OGJA 4UIXA 2YYNA 5HRWA 4O7BA 4IR5A 5ACYA 4QUTA 3O34A 3D1BA 4QEWA 5ENEA 5HQ6A 5DYXA 5E7DA 5FE5A 2RI7A 5CS8A 5ENHA 5FH6A 4CUSA 2G4AA 5I86A 5EP7A 4YYKA 4NRAA 5FE9A 3U5LA 4LZSA 5DFDA 4HXOA 5HEMA 4C66A 4LRGA 5CPEA 2RFJA 5KTWA 5FBXA 5D3SA 4N3WA 4O77A 4IR4A 4GPJA 5C7NA 5DW1A 5ETBA 5D7XA 5A5OA 4O75A 5D3JA 5CUCA 4A9OA 5EA1A 4KV1A 5F3AA 5I7XA 4CFKA 4LZ2A 5DFBA 5FB0A 4UIWA 4J0SA 5I88A 5EK9A 5JI8A 4QSRA 4QSXA 5LVQA 5FE8A 3MB3A 2OSSA
chains in the Genus database with same CATH topology
5H1TA 4LYSA 5BT5A 5F36A 4QSPA 4PCEA 3UVYA 4CUTA 3HMHA 2L84A 5ENFA 4N4FA 4NUDA 3G0LA 5L8TA 5DX4A 4X2IA 4A9MA 4TZ2A 3P5OA 3U5MA 5E9YA 2E3KA 4ZW1A 5C8GA 5KTXA 4TZ8A 2R0YA 5F62A 4PKLA 5TCMA 5HELA 4HBVA 5E74A 4CUPA 4Z6IA 5FE7A 2NXBA 4HBWA 2FSAA 5CGPA 4A9JA 4Y03A 4MR5A 5A5SA 4AKNA 5FFVA 4HXMA 3SVFA 2L5EA 5JWMA 4O7CA 4TT4A 1JM4B 3IU5A 5EU1A 2D82A 4MR6A 4PY6A 4YYNA 3SVHA 4XUAA 5DLXA 2DVSA 3FKMX 5HENA 4QSUA 5FG6A 5FG5A 5AD2A 4BHWA 3U5JA 4TT2A 5CTLA 4IR3A 5EWVA 4PTBA 4ZQLA 5CQ6A 3NXBA 4Z1QA 5F1HA 4NRBA 5A5NA 3O33A 4YATA 5DYCA 2RNWA 3S92A 4QR5A 4Z93A 4C67A 5I40A 5IG6A 4IR6A 4WHUA 4TU6A 5LJ0A 4QY4A 4FLPA 3QZTA 1WUGA 3LQHA 2YEKA 4MR4A 5COIA 5H85A 4BW3A 4LR6A 4NXJA 5ENCA 4CUUA 5I7YA 4YYGA 4BW2A 5D3TA 2DATA 5DKDA 4KCXA 4QYDA 5A5PA 4HBXA 5HFQA 5A7CA 5L99A 5LKUA 3UV4A 5DKHA 4WHWA 3JVMA 5FE6A 4CUQA 5CQ4A 5BT3A 4QC3A 4KV4A 5CQ8A 5A81A 5AMEA 3LJWA 4RVRA 3IU6A 5F63A 5F1LA 5HM0A 3JVLA 5CUEA 3DWYA 4A9IA 5EQ1A 4UYDA 5EGUA 5D26A 5E0RA 5D3PA 4BJXA 4NR4A 5KO4A 4NR9A 4O76A 4Z6HA 4CLBA 3O36A 5D3RA 4BW4A 3QZVA 4F3IA 5F5ZA 5EPRA 3UV2A 3UVDA 5E3DA 3JVKA 4IOOA 3QZSA 5CQAA 3O37A 5FE3A 2KTBB 5L96A 1JSPB 4N4IA 5CUAA 4N4GA 5CQ5A 4UIYA 4ZC9A 4HXNA 5LVRA 5HLSA 4LDFA 4QSVA 5CRZA 4XY9A 5AD3A 4MEPA 4O74A 4UYEA 4UIUA 3U5NA 5DLZA 3RCWA 2YW5A 5EICA 5C89A 3UV5A 5CQ3A 4YC9A 4ALHA 4NR8A 5CP5A 4NR6A 5F61A 5HFRA 4YYDA 4O78A 4UITA 4LC2A 4A9LA 5FG4A 5IGLA 2R0VA 3AQAA 5CUGA 4J3IA 5A85A 5F25A 4NQNA 4TQNA 4Z1SA 5FE4A 5EWDA 4HXKA 5I89A 5KU3A 2DKWA 5II2A 2YDWA 5EPSA 5H1UA 5DKCA 5FH8A 4QR3A 4HBYA 2RNYA 5E9IA 4DONA 5IGMA 1WUMA 5EPBA 1F68A 2YQDA 1E6IA 3I3JA 5A5RA 4QSTA 4YBSA 2F6JA 4HXPA 5E9VA 5CU8A 5D24A 4WIVA 5DBMA 5D3LA 3DAIA 2WP1A 4HXRA 2N9GA 5EV9A 5ENBA 5HQ7A 2I7KA 3U5KA 4LYWA 5HJCA 1N72A 3UW9A 5LJ2A 3LQIA 4NS5A 5CRMA 4PCIA 3MULA 4MEQA 3UVWA 5FH7A 5CZGA 5H1VA 2WP2A 4J0RA 4YH3A 5FFWA 2OO1A 5TB6A 3LXJA 4A9FA 2I8NA 2L85A 5LKZA 5IGNA 4XYAA 5ENIA 4A9NA 5J0DA 4YBMA 4NR5A 3D7CA 4YY6A 5ENJA 4CL9A 4YK0A 4QSSA 4YABA 5C87A 4MENA 4QR4A 4UYFA 4A9EA 4NQMA 5DYAA 5D25A 5II1A 5CQTA 4HXLA 4Q0NA 5CUDA 4QB3A 5EWWA 4XY8A 2RO1A 4O70A 4MR3A 4A9HA 1X0JA 3TLPA 3P1CA 4TS8A 4IOQA 3HMEA 4QNSA 5CY9A 5HCLA 5E3GA 4MEOA 4QBMA 4PS5A 3P1FA 4ALGA 3HMFA 4QC1A 5DFCA 2LSPB 3K2JA 4YAXA 4YBTA 5EM3A 5FFYA 2RS9B 4NYWA 4XUBA 2DWWA 5C85A 3UVXA 3GG3A 5L98A 5ETDA 4NR7A 5IBNA 5ENGA 5KHMA 4IORA 5LKTA 3LQJA 2OUOA 4NUEA 5E9LA 3U5PA 3MXFA 5E73A 5FE0A 5EISA 2YELA 4UYHA 4TU4A 4NUCA 5I83A 3ZYUA 4QUUA 5FE1A 5FDZA 4BW1A 5LKXA 4YY4A 3G0JA 5LJ1A 5EWHA 4YH4A 4UYFB 2E7NA 2YEMA 4YYMA 5FB1A 3O35A 3MUKA 5EI4A 5C4QA 3JVJA 4O71A 4OGIA 5A5QA 5D3HA 5I80A 4QSQA 3Q2EA 5G4SA 5I29A 5CQ7A 5HRVA 5FE2A 5D3NA 2D9EA 5D0CA 4UIVA 4YYIA 5F60A 2R0SA 4J1PA 4O72A 4QEUA 5EWCA 5AMFA 5IIDA 4LZRA 5DYUA 4O7AA 2GRCA 5A83A 4YYHA 4NYVA 4UYGA 5E9MA 4A9KA 2DVQA 3P1DA 1ZS5A 5CUBA 4E96A 4UIZA 5HQ5A 5EVAA 5I1QA 5DW2A 4QZSA 5E9KA 4CFLA 5A82A 4O7FA 5K29A 4NRCA 3SVGA 5F2PA 5CFWA 2DVVA 3ONIA 3AADA 4TTEA 5L8UA 4QSWA 2DVRA 4QEVA 4O7EA 5L97A 4QYLA 3MB4A 3P1EA 4YYJA 2F6NA 5LUUA 4CURA 4LYIA 4NYXA 2RNXA 4HXSA 2E7OA 5IGKA 4YADA 4Q0OA 3S91A 4TT6A 5DY7A 2H60A 1EQFA 4N4HA 5KTUA 3U5OA 4TYLA 5HRXA 5G4RA 5BT4A 4OUFA 2R10A 2MJVB 3MQMA 3Q2FA 4OGJA 4UIXA 2YYNA 5HRWA 4O7BA 4IR5A 5ACYA 4QUTA 3O34A 4QEWA 5ENEA 5HQ6A 5DYXA 5E7DA 5FE5A 2RI7A 5CS8A 5ENHA 5FH6A 4CUSA 2G4AA 5I86A 5EP7A 4YYKA 4NRAA 5FE9A 3U5LA 4LZSA 5DFDA 4HXOA 5HEMA 4C66A 4LRGA 5CPEA 2RFJA 5KTWA 5FBXA 5D3SA 4N3WA 4O77A 4IR4A 4GPJA 5C7NA 5DW1A 5ETBA 5D7XA 5A5OA 4O75A 5D3JA 5CUCA 4A9OA 5EA1A 4KV1A 5F3AA 5I7XA 4CFKA 4LZ2A 5DFBA 5FB0A 4UIWA 4J0SA 5I88A 5EK9A 5JI8A 4QSRA 4QSXA 5LVQA 5FE8A 3MB3A 2OSSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H1T A;  4LYS A;  5BT5 A;  5F36 A;  4QSP A;  4PCE A;  3UVY A;  4CUT A;  3HMH A;  2L84 A;  5ENF A;  4N4F A;  4NUD A;  3G0L A;  5L8T A;  5DX4 A;  4X2I A;  4A9M A;  4TZ2 A;  3P5O A;  3U5M A;  5E9Y A;  2E3K A;  4ZW1 A;  5C8G A;  5KTX A;  4TZ8 A;  2R0Y A;  5F62 A;  4PKL A;  5TCM A;  5HEL A;  4HBV A;  5E74 A;  4CUP A;  4Z6I A;  5FE7 A;  2NXB A;  4HBW A;  2FSA A;  5CGP A;  4A9J A;  4Y03 A;  4MR5 A;  5A5S A;  4AKN A;  5FFV A;  4HXM A;  3SVF A;  2L5E A;  5JWM A;  4O7C A;  4TT4 A;  1JM4 B;  3IU5 A;  5EU1 A;  2D82 A;  4MR6 A;  4PY6 A;  4YYN A;  3SVH A;  4XUA A;  5DLX A;  2DVS A;  3FKM X;  5HEN A;  4QSU A;  5FG6 A;  5FG5 A;  5AD2 A;  4BHW A;  3U5J A;  4TT2 A;  5CTL A;  4IR3 A;  5EWV A;  4PTB A;  4ZQL A;  5CQ6 A;  3NXB A;  4Z1Q A;  5F1H A;  4NRB A;  5A5N A;  3O33 A;  4YAT A;  5DYC A;  2RNW A;  3S92 A;  4QR5 A;  4Z93 A;  4C67 A;  5I40 A;  5IG6 A;  4IR6 A;  4WHU A;  4TU6 A;  5LJ0 A;  4QY4 A;  4FLP A;  3QZT A;  1WUG A;  3LQH A;  2YEK A;  4MR4 A;  5COI A;  5H85 A;  4BW3 A;  4LR6 A;  4NXJ A;  5ENC A;  4CUU A;  5I7Y A;  4YYG A;  4BW2 A;  5D3T A;  2DAT A;  5DKD A;  4KCX A;  4QYD A;  5A5P A;  4HBX A;  5HFQ A;  5A7C A;  5L99 A;  5LKU A;  3UV4 A;  5DKH A;  4WHW A;  3JVM A;  5FE6 A;  4CUQ A;  5CQ4 A;  5BT3 A;  4QC3 A;  4KV4 A;  5CQ8 A;  5A81 A;  5AME A;  3LJW A;  4RVR A;  3IU6 A;  5F63 A;  5F1L A;  5HM0 A;  3JVL A;  5CUE A;  3DWY A;  4A9I A;  5EQ1 A;  4UYD A;  5EGU A;  5D26 A;  5E0R A;  5D3P A;  4BJX A;  4NR4 A;  5KO4 A;  4NR9 A;  4O76 A;  4Z6H A;  4CLB A;  3O36 A;  5D3R A;  4BW4 A;  3QZV A;  4F3I A;  5F5Z A;  5EPR A;  3UV2 A;  3UVD A;  5E3D A;  3JVK A;  4IOO A;  3QZS A;  5CQA A;  3O37 A;  5FE3 A;  2KTB B;  5L96 A;  1JSP B;  4N4I A;  5CUA A;  4N4G A;  5CQ5 A;  4UIY A;  4ZC9 A;  4HXN A;  5LVR A;  5HLS A;  4LDF A;  4QSV A;  5CRZ A;  4XY9 A;  5AD3 A;  4MEP A;  4O74 A;  4UYE A;  4UIU A;  3U5N A;  5DLZ A;  3RCW A;  2YW5 A;  5EIC A;  5C89 A;  3UV5 A;  5CQ3 A;  4YC9 A;  4ALH A;  4NR8 A;  5CP5 A;  4NR6 A;  5F61 A;  5HFR A;  4YYD A;  4O78 A;  4UIT A;  4LC2 A;  4A9L A;  5FG4 A;  5IGL A;  2R0V A;  3AQA A;  5CUG A;  4J3I A;  5A85 A;  5F25 A;  4NQN A;  4TQN A;  4Z1S A;  5FE4 A;  5EWD A;  4HXK A;  5I89 A;  5KU3 A;  2DKW A;  5II2 A;  2YDW A;  5EPS A;  5H1U A;  5DKC A;  5FH8 A;  4QR3 A;  4HBY A;  2RNY A;  5E9I A;  4DON A;  5IGM A;  1WUM A;  5EPB A;  1F68 A;  2YQD A;  1E6I A;  3I3J A;  5A5R A;  4QST A;  4YBS A;  2F6J A;  4HXP A;  5E9V A;  5CU8 A;  5D24 A;  4WIV A;  5DBM A;  5D3L A;  3DAI A;  2WP1 A;  4HXR A;  2N9G A;  5EV9 A;  5ENB A;  5HQ7 A;  2I7K A;  3U5K A;  4LYW A;  5HJC A;  1N72 A;  3UW9 A;  5LJ2 A;  3LQI A;  4NS5 A;  5CRM A;  4PCI A;  3MUL A;  4MEQ A;  3UVW A;  5FH7 A;  5CZG A;  5H1V A;  2WP2 A;  4J0R A;  4YH3 A;  5FFW A;  2OO1 A;  5TB6 A;  3LXJ A;  4A9F A;  2I8N A;  2L85 A;  5LKZ A;  5IGN A;  4XYA A;  5ENI A;  4A9N A;  5J0D A;  4YBM A;  4NR5 A;  3D7C A;  4YY6 A;  5ENJ A;  4CL9 A;  4YK0 A;  4QSS A;  4YAB A;  5C87 A;  4MEN A;  4QR4 A;  4UYF A;  4A9E A;  4NQM A;  5DYA A;  5D25 A;  5II1 A;  5CQT A;  4HXL A;  4Q0N A;  5CUD A;  4QB3 A;  5EWW A;  4XY8 A;  2RO1 A;  4O70 A;  4MR3 A;  4A9H A;  1X0J A;  3TLP A;  3P1C A;  4TS8 A;  4IOQ A;  3HME A;  4QNS A;  5CY9 A;  5HCL A;  5E3G A;  4MEO A;  4QBM A;  4PS5 A;  3P1F A;  4ALG A;  3HMF A;  4QC1 A;  5DFC A;  2LSP B;  3K2J A;  4YAX A;  4YBT A;  5EM3 A;  5FFY A;  2RS9 B;  4NYW A;  4XUB A;  2DWW A;  5C85 A;  3UVX A;  3GG3 A;  5L98 A;  5ETD A;  4NR7 A;  5IBN A;  5ENG A;  5KHM A;  4IOR A;  5LKT A;  3LQJ A;  2OUO A;  4NUE A;  5E9L A;  3U5P A;  3MXF A;  5E73 A;  5FE0 A;  5EIS A;  2YEL A;  4UYH A;  4TU4 A;  4NUC A;  5I83 A;  3ZYU A;  4QUU A;  5FE1 A;  5FDZ A;  4BW1 A;  5LKX A;  4YY4 A;  3G0J A;  5LJ1 A;  5EWH A;  4YH4 A;  4UYF B;  2E7N A;  2YEM A;  4YYM A;  5FB1 A;  3O35 A;  3MUK A;  5EI4 A;  5C4Q A;  3JVJ A;  4O71 A;  4OGI A;  5A5Q A;  5D3H A;  5I80 A;  4QSQ A;  3Q2E A;  5G4S A;  5I29 A;  5CQ7 A;  5HRV A;  5FE2 A;  5D3N A;  2D9E A;  5D0C A;  4UIV A;  4YYI A;  5F60 A;  2R0S A;  4J1P A;  4O72 A;  4QEU A;  5EWC A;  5AMF A;  5IID A;  4LZR A;  5DYU A;  4O7A A;  2GRC A;  5A83 A;  4YYH A;  4NYV A;  4UYG A;  5E9M A;  4A9K A;  2DVQ A;  3P1D A;  1ZS5 A;  5CUB A;  4E96 A;  4UIZ A;  5HQ5 A;  5EVA A;  5I1Q A;  5DW2 A;  4QZS A;  5E9K A;  4CFL A;  5A82 A;  4O7F A;  5K29 A;  4NRC A;  3SVG A;  5F2P A;  5CFW A;  2DVV A;  3ONI A;  3AAD A;  4TTE A;  5L8U A;  4QSW A;  2DVR A;  4QEV A;  4O7E A;  5L97 A;  4QYL A;  3MB4 A;  3P1E A;  4YYJ A;  2F6N A;  5LUU A;  4CUR A;  4LYI A;  4NYX A;  2RNX A;  4HXS A;  2E7O A;  5IGK A;  4YAD A;  4Q0O A;  3S91 A;  4TT6 A;  5DY7 A;  2H60 A;  1EQF A;  4N4H A;  5KTU A;  3U5O A;  4TYL A;  5HRX A;  5G4R A;  5BT4 A;  4OUF A;  2R10 A;  2MJV B;  3MQM A;  3Q2F A;  4OGJ A;  4UIX A;  2YYN A;  5HRW A;  4O7B A;  4IR5 A;  5ACY A;  4QUT A;  3O34 A;  4QEW A;  5ENE A;  5HQ6 A;  5DYX A;  5E7D A;  5FE5 A;  2RI7 A;  5CS8 A;  5ENH A;  5FH6 A;  4CUS A;  2G4A A;  5I86 A;  5EP7 A;  4YYK A;  4NRA A;  5FE9 A;  3U5L A;  4LZS A;  5DFD A;  4HXO A;  5HEM A;  4C66 A;  4LRG A;  5CPE A;  2RFJ A;  5KTW A;  5FBX A;  5D3S A;  4N3W A;  4O77 A;  4IR4 A;  4GPJ A;  5C7N A;  5DW1 A;  5ETB A;  5D7X A;  5A5O A;  4O75 A;  5D3J A;  5CUC A;  4A9O A;  5EA1 A;  4KV1 A;  5F3A A;  5I7X A;  4CFK A;  4LZ2 A;  5DFB A;  5FB0 A;  4UIW A;  4J0S A;  5I88 A;  5EK9 A;  5JI8 A;  4QSR A;  4QSX A;  5LVQ A;  5FE8 A;  3MB3 A;  2OSS A; 
#chains in the Genus database with same CATH topology
 5H1T A;  4LYS A;  5BT5 A;  3ERR A;  5F36 A;  4QSP A;  4PCE A;  3UVY A;  4CUT A;  3HMH A;  2L84 A;  5ENF A;  4N4F A;  4NUD A;  3G0L A;  5L8T A;  5DX4 A;  4X2I A;  4A9M A;  4TZ2 A;  3P5O A;  3U5M A;  5E9Y A;  2E3K A;  4ZW1 A;  5C8G A;  5KTX A;  4TZ8 A;  4AKG A;  2R0Y A;  5F62 A;  3D1D A;  4PKL A;  5TCM A;  5HEL A;  4HBV A;  5E74 A;  4CUP A;  4Z6I A;  5FE7 A;  2NXB A;  4HBW A;  2FSA A;  5CGP A;  4A9J A;  4Y03 A;  4MR5 A;  5A5S A;  4AKN A;  5FFV A;  4HXM A;  3SVF A;  2L5E A;  5JWM A;  4O7C A;  4TT4 A;  1JM4 B;  3IU5 A;  5EU1 A;  2D82 A;  4MR6 A;  4PY6 A;  4YYN A;  3SVH A;  4XUA A;  5DLX A;  2DVS A;  3FKM X;  5HEN A;  4QSU A;  5FG6 A;  5FG5 A;  5AD2 A;  4BHW A;  3U5J A;  4TT2 A;  5CTL A;  4IR3 A;  5EWV A;  4PTB A;  4ZQL A;  5CQ6 A;  3NXB A;  4Z1Q A;  5F1H A;  4NRB A;  5A5N A;  3O33 A;  4YAT A;  5DYC A;  2RNW A;  3S92 A;  4QR5 A;  4Z93 A;  4C67 A;  5I40 A;  5IG6 A;  4IR6 A;  4WHU A;  4TU6 A;  5LJ0 A;  4QY4 A;  4FLP A;  3QZT A;  1WUG A;  3LQH A;  2YEK A;  4MR4 A;  5COI A;  5H85 A;  4BW3 A;  4LR6 A;  4NXJ A;  5ENC A;  4CUU A;  3VKH A;  5I7Y A;  4YYG A;  4BW2 A;  5D3T A;  2DAT A;  5DKD A;  4KCX A;  4QYD A;  5A5P A;  4HBX A;  5HFQ A;  5A7C A;  5L99 A;  5LKU A;  3UV4 A;  5DKH A;  4WHW A;  3JVM A;  4AI6 A;  5FE6 A;  4CUQ A;  5CQ4 A;  5BT3 A;  4AKH A;  4QC3 A;  4KV4 A;  5CQ8 A;  5A81 A;  5AME A;  3LJW A;  4RVR A;  3IU6 A;  5F63 A;  5F1L A;  5HM0 A;  3JVL A;  5CUE A;  3DWY A;  4A9I A;  5EQ1 A;  4UYD A;  5EGU A;  5D26 A;  5E0R A;  5D3P A;  4BJX A;  4NR4 A;  5KO4 A;  4NR9 A;  4O76 A;  4Z6H A;  4CLB A;  3O36 A;  5D3R A;  4BW4 A;  3QZV A;  4F3I A;  5F5Z A;  5EPR A;  3UV2 A;  3UVD A;  5E3D A;  3JVK A;  4IOO A;  3QZS A;  5CQA A;  3O37 A;  5FE3 A;  2KTB B;  5L96 A;  1JSP B;  2EJN A;  4N4I A;  5CUA A;  4N4G A;  5CQ5 A;  4UIY A;  4ZC9 A;  4HXN A;  4AKI A;  5LVR A;  5HLS A;  4LDF A;  4QSV A;  5CRZ A;  4XY9 A;  5AD3 A;  4MEP A;  4O74 A;  4UYE A;  4UIU A;  3U5N A;  5DLZ A;  3RCW A;  2YW5 A;  5EIC A;  5C89 A;  3UV5 A;  5CQ3 A;  4YC9 A;  4ALH A;  4NR8 A;  5CP5 A;  4NR6 A;  5F61 A;  5HFR A;  4YYD A;  4O78 A;  4UIT A;  4LC2 A;  4A9L A;  5FG4 A;  5IGL A;  2R0V A;  3AQA A;  5CUG A;  4J3I A;  5A85 A;  5F25 A;  4NQN A;  4TQN A;  4Z1S A;  5FE4 A;  5EWD A;  4HXK A;  5I89 A;  5KU3 A;  2DKW A;  5II2 A;  2YDW A;  5EPS A;  5H1U A;  5DKC A;  5FH8 A;  4QR3 A;  4HBY A;  2RNY A;  5E9I A;  4DON A;  5IGM A;  1WUM A;  5EPB A;  1F68 A;  2YQD A;  1E6I A;  3I3J A;  5A5R A;  4QST A;  4YBS A;  2F6J A;  4HXP A;  5E9V A;  5CU8 A;  5D24 A;  4WIV A;  5DBM A;  5D3L A;  3DAI A;  2WP1 A;  4HXR A;  2N9G A;  5EV9 A;  5ENB A;  5HQ7 A;  2I7K A;  3U5K A;  4LYW A;  5HJC A;  1N72 A;  3UW9 A;  5LJ2 A;  3LQI A;  4NS5 A;  5CRM A;  4PCI A;  3MUL A;  4MEQ A;  3UVW A;  5FH7 A;  5CZG A;  5H1V A;  2WP2 A;  4J0R A;  4YH3 A;  5FFW A;  2OO1 A;  5TB6 A;  3LXJ A;  4A9F A;  2I8N A;  2L85 A;  5LKZ A;  5IGN A;  4XYA A;  5ENI A;  4A9N A;  5J0D A;  4YBM A;  4NR5 A;  3D7C A;  4YY6 A;  5ENJ A;  4CL9 A;  4YK0 A;  4QSS A;  4YAB A;  5C87 A;  4MEN A;  4QR4 A;  4UYF A;  4A9E A;  4NQM A;  5DYA A;  5D25 A;  5II1 A;  5CQT A;  4HXL A;  4Q0N A;  5CUD A;  4QB3 A;  5EWW A;  4XY8 A;  2RO1 A;  4O70 A;  4MR3 A;  4A9H A;  1X0J A;  3TLP A;  3P1C A;  4TS8 A;  4IOQ A;  3HME A;  4QNS A;  5CY9 A;  5HCL A;  5E3G A;  4MEO A;  4QBM A;  4PS5 A;  3P1F A;  4ALG A;  3HMF A;  4QC1 A;  5DFC A;  2LSP B;  3K2J A;  4YAX A;  4YBT A;  5EM3 A;  5FFY A;  2RS9 B;  4NYW A;  4XUB A;  2DWW A;  5C85 A;  3UVX A;  3GG3 A;  5L98 A;  5ETD A;  4NR7 A;  5IBN A;  5ENG A;  5KHM A;  4IOR A;  5LKT A;  3LQJ A;  2OUO A;  4NUE A;  5E9L A;  3U5P A;  3MXF A;  5E73 A;  5FE0 A;  5EIS A;  2YEL A;  4UYH A;  4TU4 A;  4NUC A;  5I83 A;  3ZYU A;  4QUU A;  5FE1 A;  5FDZ A;  4BW1 A;  5LKX A;  4YY4 A;  3G0J A;  5LJ1 A;  5EWH A;  4YH4 A;  4UYF B;  2E7N A;  2YEM A;  4YYM A;  5FB1 A;  3O35 A;  3VKG A;  3MUK A;  5EI4 A;  5C4Q A;  3JVJ A;  4O71 A;  4OGI A;  5A5Q A;  5D3H A;  5I80 A;  4QSQ A;  3Q2E A;  5G4S A;  5I29 A;  5CQ7 A;  5HRV A;  5FE2 A;  5D3N A;  2D9E A;  5D0C A;  4UIV A;  1ZKR A;  4YYI A;  5F60 A;  2R0S A;  4J1P A;  4O72 A;  4QEU A;  5EWC A;  5AMF A;  5IID A;  4LZR A;  5DYU A;  4O7A A;  2GRC A;  5A83 A;  4YYH A;  4NYV A;  4UYG A;  5E9M A;  4A9K A;  2DVQ A;  3P1D A;  1ZS5 A;  5CUB A;  4E96 A;  4UIZ A;  5HQ5 A;  5EVA A;  5I1Q A;  5DW2 A;  4QZS A;  5E9K A;  4CFL A;  5A82 A;  4O7F A;  5K29 A;  4NRC A;  3SVG A;  5F2P A;  5CFW A;  2DVV A;  3ONI A;  3AAD A;  4TTE A;  5L8U A;  4QSW A;  2DVR A;  1PUO A;  4QEV A;  4O7E A;  5L97 A;  4QYL A;  3MB4 A;  3P1E A;  4YYJ A;  2F6N A;  5LUU A;  4CUR A;  4LYI A;  4NYX A;  2RNX A;  4HXS A;  2E7O A;  5IGK A;  4YAD A;  4Q0O A;  3S91 A;  4TT6 A;  5DY7 A;  2H60 A;  1EQF A;  4N4H A;  5KTU A;  3U5O A;  4TYL A;  5HRX A;  5G4R A;  5BT4 A;  4OUF A;  2R10 A;  2MJV B;  3MQM A;  3Q2F A;  4OGJ A;  4UIX A;  2YYN A;  5HRW A;  4O7B A;  4IR5 A;  5ACY A;  4QUT A;  3O34 A;  3D1B A;  4QEW A;  5ENE A;  5HQ6 A;  5DYX A;  5E7D A;  5FE5 A;  2RI7 A;  5CS8 A;  5ENH A;  5FH6 A;  4CUS A;  2G4A A;  5I86 A;  5EP7 A;  4YYK A;  4NRA A;  5FE9 A;  3U5L A;  4LZS A;  5DFD A;  4HXO A;  5HEM A;  4C66 A;  4LRG A;  5CPE A;  2RFJ A;  5KTW A;  5FBX A;  5D3S A;  4N3W A;  4O77 A;  4IR4 A;  4GPJ A;  5C7N A;  5DW1 A;  5ETB A;  5D7X A;  5A5O A;  4O75 A;  5D3J A;  5CUC A;  4A9O A;  5EA1 A;  4KV1 A;  5F3A A;  5I7X A;  4CFK A;  4LZ2 A;  5DFB A;  5FB0 A;  4UIW A;  4J0S A;  5I88 A;  5EK9 A;  5JI8 A;  4QSR A;  4QSX A;  5LVQ A;  5FE8 A;  3MB3 A;  2OSS A; 
#chains in the Genus database with same CATH homology
 5H1T A;  4LYS A;  5BT5 A;  5F36 A;  4QSP A;  4PCE A;  3UVY A;  4CUT A;  3HMH A;  2L84 A;  5ENF A;  4N4F A;  4NUD A;  3G0L A;  5L8T A;  5DX4 A;  4X2I A;  4A9M A;  4TZ2 A;  3P5O A;  3U5M A;  5E9Y A;  2E3K A;  4ZW1 A;  5C8G A;  5KTX A;  4TZ8 A;  2R0Y A;  5F62 A;  4PKL A;  5TCM A;  5HEL A;  4HBV A;  5E74 A;  4CUP A;  4Z6I A;  5FE7 A;  2NXB A;  4HBW A;  2FSA A;  5CGP A;  4A9J A;  4Y03 A;  4MR5 A;  5A5S A;  4AKN A;  5FFV A;  4HXM A;  3SVF A;  2L5E A;  5JWM A;  4O7C A;  4TT4 A;  1JM4 B;  3IU5 A;  5EU1 A;  2D82 A;  4MR6 A;  4PY6 A;  4YYN A;  3SVH A;  4XUA A;  5DLX A;  2DVS A;  3FKM X;  5HEN A;  4QSU A;  5FG6 A;  5FG5 A;  5AD2 A;  4BHW A;  3U5J A;  4TT2 A;  5CTL A;  4IR3 A;  5EWV A;  4PTB A;  4ZQL A;  5CQ6 A;  3NXB A;  4Z1Q A;  5F1H A;  4NRB A;  5A5N A;  3O33 A;  4YAT A;  5DYC A;  2RNW A;  3S92 A;  4QR5 A;  4Z93 A;  4C67 A;  5I40 A;  5IG6 A;  4IR6 A;  4WHU A;  4TU6 A;  5LJ0 A;  4QY4 A;  4FLP A;  3QZT A;  1WUG A;  3LQH A;  2YEK A;  4MR4 A;  5COI A;  5H85 A;  4BW3 A;  4LR6 A;  4NXJ A;  5ENC A;  4CUU A;  5I7Y A;  4YYG A;  4BW2 A;  5D3T A;  2DAT A;  5DKD A;  4KCX A;  4QYD A;  5A5P A;  4HBX A;  5HFQ A;  5A7C A;  5L99 A;  5LKU A;  3UV4 A;  5DKH A;  4WHW A;  3JVM A;  5FE6 A;  4CUQ A;  5CQ4 A;  5BT3 A;  4QC3 A;  4KV4 A;  5CQ8 A;  5A81 A;  5AME A;  3LJW A;  4RVR A;  3IU6 A;  5F63 A;  5F1L A;  5HM0 A;  3JVL A;  5CUE A;  3DWY A;  4A9I A;  5EQ1 A;  4UYD A;  5EGU A;  5D26 A;  5E0R A;  5D3P A;  4BJX A;  4NR4 A;  5KO4 A;  4NR9 A;  4O76 A;  4Z6H A;  4CLB A;  3O36 A;  5D3R A;  4BW4 A;  3QZV A;  4F3I A;  5F5Z A;  5EPR A;  3UV2 A;  3UVD A;  5E3D A;  3JVK A;  4IOO A;  3QZS A;  5CQA A;  3O37 A;  5FE3 A;  2KTB B;  5L96 A;  1JSP B;  4N4I A;  5CUA A;  4N4G A;  5CQ5 A;  4UIY A;  4ZC9 A;  4HXN A;  5LVR A;  5HLS A;  4LDF A;  4QSV A;  5CRZ A;  4XY9 A;  5AD3 A;  4MEP A;  4O74 A;  4UYE A;  4UIU A;  3U5N A;  5DLZ A;  3RCW A;  2YW5 A;  5EIC A;  5C89 A;  3UV5 A;  5CQ3 A;  4YC9 A;  4ALH A;  4NR8 A;  5CP5 A;  4NR6 A;  5F61 A;  5HFR A;  4YYD A;  4O78 A;  4UIT A;  4LC2 A;  4A9L A;  5FG4 A;  5IGL A;  2R0V A;  3AQA A;  5CUG A;  4J3I A;  5A85 A;  5F25 A;  4NQN A;  4TQN A;  4Z1S A;  5FE4 A;  5EWD A;  4HXK A;  5I89 A;  5KU3 A;  2DKW A;  5II2 A;  2YDW A;  5EPS A;  5H1U A;  5DKC A;  5FH8 A;  4QR3 A;  4HBY A;  2RNY A;  5E9I A;  4DON A;  5IGM A;  1WUM A;  5EPB A;  1F68 A;  2YQD A;  1E6I A;  3I3J A;  5A5R A;  4QST A;  4YBS A;  2F6J A;  4HXP A;  5E9V A;  5CU8 A;  5D24 A;  4WIV A;  5DBM A;  5D3L A;  3DAI A;  2WP1 A;  4HXR A;  2N9G A;  5EV9 A;  5ENB A;  5HQ7 A;  2I7K A;  3U5K A;  4LYW A;  5HJC A;  1N72 A;  3UW9 A;  5LJ2 A;  3LQI A;  4NS5 A;  5CRM A;  4PCI A;  3MUL A;  4MEQ A;  3UVW A;  5FH7 A;  5CZG A;  5H1V A;  2WP2 A;  4J0R A;  4YH3 A;  5FFW A;  2OO1 A;  5TB6 A;  3LXJ A;  4A9F A;  2I8N A;  2L85 A;  5LKZ A;  5IGN A;  4XYA A;  5ENI A;  4A9N A;  5J0D A;  4YBM A;  4NR5 A;  3D7C A;  4YY6 A;  5ENJ A;  4CL9 A;  4YK0 A;  4QSS A;  4YAB A;  5C87 A;  4MEN A;  4QR4 A;  4UYF A;  4A9E A;  4NQM A;  5DYA A;  5D25 A;  5II1 A;  5CQT A;  4HXL A;  4Q0N A;  5CUD A;  4QB3 A;  5EWW A;  4XY8 A;  2RO1 A;  4O70 A;  4MR3 A;  4A9H A;  1X0J A;  3TLP A;  3P1C A;  4TS8 A;  4IOQ A;  3HME A;  4QNS A;  5CY9 A;  5HCL A;  5E3G A;  4MEO A;  4QBM A;  4PS5 A;  3P1F A;  4ALG A;  3HMF A;  4QC1 A;  5DFC A;  2LSP B;  3K2J A;  4YAX A;  4YBT A;  5EM3 A;  5FFY A;  2RS9 B;  4NYW A;  4XUB A;  2DWW A;  5C85 A;  3UVX A;  3GG3 A;  5L98 A;  5ETD A;  4NR7 A;  5IBN A;  5ENG A;  5KHM A;  4IOR A;  5LKT A;  3LQJ A;  2OUO A;  4NUE A;  5E9L A;  3U5P A;  3MXF A;  5E73 A;  5FE0 A;  5EIS A;  2YEL A;  4UYH A;  4TU4 A;  4NUC A;  5I83 A;  3ZYU A;  4QUU A;  5FE1 A;  5FDZ A;  4BW1 A;  5LKX A;  4YY4 A;  3G0J A;  5LJ1 A;  5EWH A;  4YH4 A;  4UYF B;  2E7N A;  2YEM A;  4YYM A;  5FB1 A;  3O35 A;  3MUK A;  5EI4 A;  5C4Q A;  3JVJ A;  4O71 A;  4OGI A;  5A5Q A;  5D3H A;  5I80 A;  4QSQ A;  3Q2E A;  5G4S A;  5I29 A;  5CQ7 A;  5HRV A;  5FE2 A;  5D3N A;  2D9E A;  5D0C A;  4UIV A;  4YYI A;  5F60 A;  2R0S A;  4J1P A;  4O72 A;  4QEU A;  5EWC A;  5AMF A;  5IID A;  4LZR A;  5DYU A;  4O7A A;  2GRC A;  5A83 A;  4YYH A;  4NYV A;  4UYG A;  5E9M A;  4A9K A;  2DVQ A;  3P1D A;  1ZS5 A;  5CUB A;  4E96 A;  4UIZ A;  5HQ5 A;  5EVA A;  5I1Q A;  5DW2 A;  4QZS A;  5E9K A;  4CFL A;  5A82 A;  4O7F A;  5K29 A;  4NRC A;  3SVG A;  5F2P A;  5CFW A;  2DVV A;  3ONI A;  3AAD A;  4TTE A;  5L8U A;  4QSW A;  2DVR A;  4QEV A;  4O7E A;  5L97 A;  4QYL A;  3MB4 A;  3P1E A;  4YYJ A;  2F6N A;  5LUU A;  4CUR A;  4LYI A;  4NYX A;  2RNX A;  4HXS A;  2E7O A;  5IGK A;  4YAD A;  4Q0O A;  3S91 A;  4TT6 A;  5DY7 A;  2H60 A;  1EQF A;  4N4H A;  5KTU A;  3U5O A;  4TYL A;  5HRX A;  5G4R A;  5BT4 A;  4OUF A;  2R10 A;  2MJV B;  3MQM A;  3Q2F A;  4OGJ A;  4UIX A;  2YYN A;  5HRW A;  4O7B A;  4IR5 A;  5ACY A;  4QUT A;  3O34 A;  4QEW A;  5ENE A;  5HQ6 A;  5DYX A;  5E7D A;  5FE5 A;  2RI7 A;  5CS8 A;  5ENH A;  5FH6 A;  4CUS A;  2G4A A;  5I86 A;  5EP7 A;  4YYK A;  4NRA A;  5FE9 A;  3U5L A;  4LZS A;  5DFD A;  4HXO A;  5HEM A;  4C66 A;  4LRG A;  5CPE A;  2RFJ A;  5KTW A;  5FBX A;  5D3S A;  4N3W A;  4O77 A;  4IR4 A;  4GPJ A;  5C7N A;  5DW1 A;  5ETB A;  5D7X A;  5A5O A;  4O75 A;  5D3J A;  5CUC A;  4A9O A;  5EA1 A;  4KV1 A;  5F3A A;  5I7X A;  4CFK A;  4LZ2 A;  5DFB A;  5FB0 A;  4UIW A;  4J0S A;  5I88 A;  5EK9 A;  5JI8 A;  4QSR A;  4QSX A;  5LVQ A;  5FE8 A;  3MB3 A;  2OSS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...