4UIWA

Bromodomain of human brd9 with n-(1,1-dioxo-1-thian-4-yl)-5-ethyl-4- oxo-7-3-(trifluoromethyl)phenyl-4h,5h-thieno-3,2-c-pyridine-2- carboximidamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
b'STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 9
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uiwA00
4NRAA 5IGMA 4WIVA 5F62A 5HELA 5J0DA 3O33A 5HRWA 4TYLA 3UV4A 4QYDA 2DATA 4IOQA 5EI4A 5KTWA 4QC1A 4YK0A 4N4IA 4NYWA 3DWYA 2WP1A 4NUEA 5CUGA 4UYEA 2GRCA 4ZQLA 5CRZA 5I89A 2L84A 5L8TA 5CGPA 2H60A 4YYMA 4CUTA 4QEVA 3QZSA 5A81A 4CUPA 3SVGA 2R10A 2L85A 5H1VA 3ONIA 4NR9A 4HXLA 3RCWA 4CURA 5F63A 4TU6A 2E3KA 5DBMA 5ENJA 4QSPA 4QSUA 4UYHA 5KU3A 4UYGA 5F2PA 4YYIA 5EP7A 4NYVA 4A9MA 4Y03A 5FE0A 4Z1QA 5DKHA 3JVMA 5CS8A 5TB6A 3ZYUA 5D3LA 4NYXA 4QZSA 3MXFA 4YBSA 3MB4A 5EPBA 5E9MA 5I83A 2KTBB 4ALHA 5E73A 4QYLA 5I80A 2E7NA 4LDFA 4TZ8A 2YEKA 2OSSA 4NQMA 4UYFB 5CQTA 5A83A 5IGLA 2WP2A 4O7EA 3HMHA 4TT4A 5CQ7A 4O76A 5E7DA 4J0RA 5H1TA 5FG6A 5HCLA 4IORA 4IR4A 4NR5A 3P1CA 5LKZA 5E9KA 1JSPB 4TQNA 4BW2A 5HM0A 5CP5A 4YABA 5A5SA 3LXJA 3U5OA 4O72A 5D3RA 4N4HA 5DX4A 5E9LA 4CFLA 5EWWA 3G0JA 4O77A 4A9LA 5C4QA 4QUTA 4ZC9A 4YYNA 5L98A 1F68A 5I88A 3G0LA 4PKLA 5FFWA 4QC3A 3P5OA 5D3HA 1EQFA 4O7CA 5DYXA 3MB3A 3UVYA 5E9IA 2YYNA 5EWDA 5ACYA 4QSXA 5FH7A 5CTLA 4A9HA 5A5OA 3UW9A 4HBWA 5ENCA 2RNYA 2FSAA 4QEWA 5KTXA 4YY4A 2D82A 5EVAA 5E3DA 2YELA 5AD2A 4UIXA 3P1DA 2DKWA 4UIVA 5CQ5A 3UV5A 5CU8A 5FH8A 3MQMA 5D3SA 5DKDA 2DVRA 3P1FA 3UVDA 5H85A 4MEQA 4HXPA 5L97A 3O37A 5CZGA 4UIUA 3LQJA 4TU4A 5F25A 4UIZA 4NS5A 5EPRA 5FE7A 5I7XA 3K2JA 3AADA 5CUCA 4PCIA 4E96A 4BJXA 5DKCA 4LRGA 5II2A 4TT2A 5CUDA 4MR4A 5IGKA 4HXSA 4J0SA 4YBMA 5DW1A 4A9OA 1E6IA 5FE6A 4UYFA 4DONA 5F1LA 5DLZA 5LJ2A 5CQ6A 5A5PA 3I3JA 4WHUA 4HXMA 5F60A 5BT4A 2L5EA 4MEOA 4MENA 2F6JA 3Q2EA 4LR6A 3QZTA 3JVKA 1ZS5A 5F61A 4QSVA 5ENFA 5II1A 4NUCA 5DFDA 3SVFA 5I29A 5K29A 5F1HA 3MULA 2YEMA 3O36A 4HXNA 4YBTA 4O71A 5LKUA 5HRVA 4LYWA 3O35A 2RI7A 5ENGA 4QUUA 5FH6A 3S91A 5CQ3A 4KV1A 5FB0A 4QEUA 4QR4A 5KHMA 4J1PA 4AKNA 4QR3A 5EWVA 4NRBA 4MR5A 4RVRA 4NR6A 4TT6A 4UITA 4Z6HA 5FE8A 4OGJA 4PTBA 3U5PA 3UVWA 4LZRA 4O75A 3U5LA 5CPEA 2N9GA 3GG3A 5EGUA 4NXJA 5LVRA 5CFWA 4HXKA 4UIWA 5FBXA 5CQ4A 5G4RA 4CUQA 3FKMX 4O70A 5EK9A 5FDZA 4MR6A 5EQ1A 4HXRA 5CY9A 4N3WA 2R0VA 3Q2FA 4O74A 5D0CA 5I7YA 3U5MA 4HBXA 4CLBA 5CQ8A 4PS5A 4TTEA 5FB1A 4A9NA 5F36A 5D25A 5I1QA 5I86A 4QSRA 5AD3A 4QSSA 3U5KA 5EWHA 3SVHA 5C85A 3LQIA 4NR7A 5FG4A 3AQAA 4QSQA 5EWCA 3U5JA 4QSTA 4YY6A 4QB3A 4O78A 4XY8A 4Z1SA 4PCEA 5L99A 5FE9A 2RO1A 5JI8A 4YYHA 5ENBA 5F3AA 1JM4B 5CUEA 5BT5A 2I7KA 5LKTA 5IG6A 3DAIA 4A9FA 5FG5A 5HLSA 4YC9A 4BW1A 5D24A 2I8NA 5LJ1A 4NR8A 2RNXA 4CUUA 3HMFA 4O7FA 5HQ7A 4CL9A 5DLXA 2MJVB 4A9JA 5HFRA 3JVLA 5IGNA 4YADA 4QBMA 4NR4A 4YAXA 2F6NA 5DFCA 2DVSA 4Z93A 4O7AA 4C67A 5A82A 4XUBA 5HEMA 4IR6A 2YDWA 4KCXA 4J3IA 4OUFA 4YH3A 4YYGA 3QZVA 2YW5A 4NUDA 5E0RA 5C7NA 3UV2A 4Q0NA 4NQNA 4N4GA 2OUOA 2RS9B 5FE4A 2G4AA 4XYAA 5HJCA 4IOOA 5EISA 2YQDA 5FE1A 4A9EA 4HBYA 4QSWA 4GPJA 5D26A 4A9KA 4XY9A 5ENHA 4LZ2A 5FE2A 5IIDA 5F5ZA 4QR5A 5DY7A 2NXBA 4HBVA 4A9IA 5FE3A 5H1UA 3HMEA 1WUMA 4YYDA 4XUAA 4MR3A 4X2IA 4YH4A 2DVQA 5EPSA 5A5RA 4QNSA 5A7CA 4QY4A 4HXOA 4FLPA 5FFVA 4OGIA 2LSPB 5C89A 2RNWA 5I40A 5CUAA 3LJWA 4MEPA 3S92A 3NXBA 5EM3A 5EU1A 4PY6A 5DYCA 4O7BA 5L96A 5LJ0A 5LVQA 4ZW1A 5A5QA 3LQHA 5D3JA 1X0JA 5E74A 5HRXA 5CQAA 4NRCA 5IBNA 5KO4A 5CUBA 2OO1A 4ALGA 4LYSA 4Z6IA 3IU5A 4UYDA 3P1EA 5EV9A 5C87A 5HFQA 3JVJA 5EICA 3O34A 4TS8A 5BT3A 4WHWA 5D3PA 4KV4A 2R0YA 2E7OA 2R0SA 4LYIA 5A85A 4YYJA 4LC2A 5D7XA 3D7CA 5FFYA 5ENEA 4CUSA 4TZ2A 4LZSA 5DFBA 3UVXA 4BW4A 4CFKA 4F3IA 5DW2A 4BW3A 2DVVA 5DYUA 4IR5A 2D9EA 5ENIA 5HENA 5D3TA 5L8UA 2DWWA 5ETDA 4YATA 4N4FA 5E9YA 4YYKA 3U5NA 3IU6A 5TCMA 1N72A 2RFJA 5G4SA 5LUUA 3MUKA 5JWMA 5CRMA 5D3NA 5EA1A 5ETBA 3TLPA 5KTUA 5E9VA 5AMEA 4BHWA 5HQ5A 5AMFA 1WUGA 5A5NA 5COIA 5DYAA 5E3GA 4Q0OA 4C66A 5C8GA 5FE5A 5HQ6A 4UIYA 5LKXA 4IR3A
chains in the Genus database with same CATH superfamily
4NRAA 5IGMA 4WIVA 5F62A 5HELA 5J0DA 3O33A 5HRWA 4TYLA 3VKHA 3UV4A 4QYDA 2DATA 4IOQA 5EI4A 5KTWA 4QC1A 4YK0A 4N4IA 4NYWA 3DWYA 2WP1A 4NUEA 5CUGA 4UYEA 2GRCA 4ZQLA 5CRZA 5I89A 2L84A 5L8TA 5CGPA 2H60A 3D1DA 4YYMA 4CUTA 4QEVA 3QZSA 5A81A 1PUOA 4CUPA 3SVGA 2R10A 2L85A 5H1VA 3ONIA 4NR9A 4HXLA 3RCWA 4CURA 5F63A 4TU6A 2E3KA 5DBMA 5ENJA 4QSPA 4QSUA 4UYHA 5KU3A 4UYGA 5F2PA 4YYIA 5EP7A 4NYVA 4A9MA 4Y03A 5FE0A 4Z1QA 5DKHA 3JVMA 5CS8A 5TB6A 3ZYUA 5D3LA 4NYXA 4QZSA 3MXFA 4YBSA 3MB4A 5EPBA 5E9MA 5I83A 2KTBB 4ALHA 5E73A 4QYLA 5I80A 2E7NA 4LDFA 4TZ8A 2YEKA 2OSSA 4NQMA 4UYFB 5CQTA 5A83A 5IGLA 2WP2A 4O7EA 3HMHA 4TT4A 2EJNA 5CQ7A 4O76A 5E7DA 4J0RA 5H1TA 5FG6A 5HCLA 4IORA 4IR4A 4NR5A 3P1CA 5LKZA 5E9KA 1JSPB 4TQNA 4BW2A 5HM0A 5CP5A 4YABA 5A5SA 3LXJA 3U5OA 4O72A 5D3RA 4N4HA 5DX4A 5E9LA 4CFLA 5EWWA 3G0JA 4O77A 4A9LA 5C4QA 4QUTA 4ZC9A 4YYNA 5L98A 1F68A 5I88A 3G0LA 4PKLA 5FFWA 4QC3A 3P5OA 5D3HA 1EQFA 4O7CA 5DYXA 3MB3A 3UVYA 5E9IA 2YYNA 5EWDA 5ACYA 4QSXA 5FH7A 5CTLA 4A9HA 5A5OA 3UW9A 4HBWA 5ENCA 2RNYA 2FSAA 4QEWA 5KTXA 4YY4A 2D82A 5EVAA 5E3DA 2YELA 5AD2A 4UIXA 3P1DA 2DKWA 4UIVA 5CQ5A 3UV5A 5CU8A 5FH8A 3MQMA 5D3SA 5DKDA 2DVRA 3P1FA 3UVDA 5H85A 4MEQA 4HXPA 5L97A 4AKHA 3O37A 5CZGA 4UIUA 3LQJA 4TU4A 5F25A 4UIZA 4NS5A 5EPRA 5FE7A 5I7XA 3K2JA 3AADA 5CUCA 4PCIA 4E96A 4BJXA 5DKCA 4LRGA 5II2A 4TT2A 5CUDA 4MR4A 5IGKA 4HXSA 4J0SA 4YBMA 5DW1A 4A9OA 1E6IA 5FE6A 4UYFA 4DONA 5F1LA 5DLZA 5LJ2A 5CQ6A 5A5PA 3I3JA 4WHUA 4HXMA 5F60A 5BT4A 2L5EA 4MEOA 4MENA 2F6JA 3Q2EA 4LR6A 3QZTA 3JVKA 1ZS5A 5F61A 4QSVA 5ENFA 5II1A 4NUCA 5DFDA 3SVFA 5I29A 5K29A 5F1HA 3MULA 2YEMA 3O36A 4HXNA 4YBTA 4O71A 5LKUA 1ZKRA 4LYWA 5HRVA 3O35A 2RI7A 5ENGA 4QUUA 5FH6A 3S91A 5CQ3A 4KV1A 5FB0A 4QEUA 4QR4A 5KHMA 4J1PA 4AKNA 4QR3A 5EWVA 4NRBA 4MR5A 4RVRA 4NR6A 4TT6A 4UITA 4Z6HA 5FE8A 4OGJA 4PTBA 3U5PA 3UVWA 4LZRA 4O75A 3U5LA 5CPEA 2N9GA 3GG3A 5EGUA 4NXJA 5LVRA 5CFWA 4HXKA 4UIWA 5FBXA 5CQ4A 5G4RA 4CUQA 3FKMX 4O70A 5EK9A 5FDZA 4MR6A 5EQ1A 4HXRA 5CY9A 4N3WA 2R0VA 3Q2FA 4O74A 5D0CA 5I7YA 3U5MA 4HBXA 4CLBA 5CQ8A 4PS5A 4TTEA 5FB1A 4A9NA 5F36A 3ERRA 5D25A 5I1QA 5I86A 4QSRA 5AD3A 4QSSA 3U5KA 5EWHA 3SVHA 5C85A 3LQIA 4NR7A 5FG4A 3AQAA 4QSQA 5EWCA 3U5JA 4QSTA 4YY6A 4QB3A 4O78A 4XY8A 4Z1SA 4PCEA 5L99A 5FE9A 2RO1A 5JI8A 4YYHA 5ENBA 5F3AA 1JM4B 5CUEA 5BT5A 2I7KA 5LKTA 5IG6A 3DAIA 4A9FA 5FG5A 5HLSA 4YC9A 4BW1A 5D24A 2I8NA 5LJ1A 4NR8A 2RNXA 4CUUA 3HMFA 4O7FA 5HQ7A 4CL9A 5DLXA 2MJVB 4A9JA 5HFRA 3JVLA 5IGNA 4YADA 4QBMA 4NR4A 4YAXA 2F6NA 5DFCA 2DVSA 4Z93A 4O7AA 4C67A 5A82A 4XUBA 5HEMA 4IR6A 2YDWA 4KCXA 4J3IA 4OUFA 4YH3A 4YYGA 3QZVA 2YW5A 4NUDA 5E0RA 5C7NA 3UV2A 4Q0NA 4NQNA 4N4GA 2OUOA 2RS9B 5FE4A 2G4AA 4XYAA 5HJCA 4IOOA 5EISA 2YQDA 5FE1A 4A9EA 4HBYA 4QSWA 4GPJA 5D26A 4A9KA 4XY9A 5ENHA 4AKIA 4LZ2A 5FE2A 5IIDA 5F5ZA 4QR5A 5DY7A 2NXBA 4HBVA 4A9IA 5FE3A 5H1UA 3HMEA 1WUMA 4YYDA 4XUAA 4MR3A 4X2IA 4YH4A 2DVQA 5EPSA 5A5RA 4QNSA 5A7CA 4QY4A 4HXOA 4FLPA 5FFVA 4AI6A 4OGIA 2LSPB 5C89A 2RNWA 5I40A 5CUAA 3LJWA 4MEPA 3S92A 3NXBA 5EM3A 5EU1A 4PY6A 5DYCA 4O7BA 5L96A 5LJ0A 5LVQA 4ZW1A 5A5QA 3LQHA 5D3JA 1X0JA 5E74A 5HRXA 5CQAA 4NRCA 5IBNA 5KO4A 5CUBA 2OO1A 4ALGA 4LYSA 4Z6IA 3IU5A 4UYDA 3P1EA 5EV9A 5C87A 5HFQA 3JVJA 5EICA 3O34A 4TS8A 5BT3A 4WHWA 5D3PA 4KV4A 2R0YA 2E7OA 2R0SA 4LYIA 5A85A 3VKGA 4YYJA 4LC2A 5D7XA 3D7CA 5FFYA 5ENEA 4CUSA 4TZ2A 4LZSA 5DFBA 3UVXA 4BW4A 4CFKA 4F3IA 5DW2A 4BW3A 2DVVA 5DYUA 4IR5A 2D9EA 5ENIA 5HENA 5D3TA 5L8UA 2DWWA 5ETDA 4YATA 4N4FA 5E9YA 4YYKA 3U5NA 3IU6A 5TCMA 1N72A 2RFJA 5G4SA 5LUUA 3MUKA 5JWMA 5CRMA 5D3NA 5EA1A 3D1BA 5ETBA 4AKGA 3TLPA 5KTUA 5E9VA 5AMEA 4BHWA 5HQ5A 5AMFA 1WUGA 5A5NA 5COIA 5DYAA 5E3GA 4Q0OA 4C66A 5C8GA 5FE5A 5HQ6A 4UIYA 5LKXA 4IR3A
chains in the Genus database with same CATH topology
4NRAA 5IGMA 4WIVA 5F62A 5HELA 5J0DA 3O33A 5HRWA 4TYLA 3UV4A 4QYDA 2DATA 4IOQA 5EI4A 5KTWA 4QC1A 4YK0A 4N4IA 4NYWA 3DWYA 2WP1A 4NUEA 5CUGA 4UYEA 2GRCA 4ZQLA 5CRZA 5I89A 2L84A 5L8TA 5CGPA 2H60A 4YYMA 4CUTA 4QEVA 3QZSA 5A81A 4CUPA 3SVGA 2R10A 2L85A 5H1VA 3ONIA 4NR9A 4HXLA 3RCWA 4CURA 5F63A 4TU6A 2E3KA 5DBMA 5ENJA 4QSPA 4QSUA 4UYHA 5KU3A 4UYGA 5F2PA 4YYIA 5EP7A 4NYVA 4A9MA 4Y03A 5FE0A 4Z1QA 5DKHA 3JVMA 5CS8A 5TB6A 3ZYUA 5D3LA 4NYXA 4QZSA 3MXFA 4YBSA 3MB4A 5EPBA 5E9MA 5I83A 2KTBB 4ALHA 5E73A 4QYLA 5I80A 2E7NA 4LDFA 4TZ8A 2YEKA 2OSSA 4NQMA 4UYFB 5CQTA 5A83A 5IGLA 2WP2A 4O7EA 3HMHA 4TT4A 5CQ7A 4O76A 5E7DA 4J0RA 5H1TA 5FG6A 5HCLA 4IORA 4IR4A 4NR5A 3P1CA 5LKZA 5E9KA 1JSPB 4TQNA 4BW2A 5HM0A 5CP5A 4YABA 5A5SA 3LXJA 3U5OA 4O72A 5D3RA 4N4HA 5DX4A 5E9LA 4CFLA 5EWWA 3G0JA 4O77A 4A9LA 5C4QA 4QUTA 4ZC9A 4YYNA 5L98A 1F68A 5I88A 3G0LA 4PKLA 5FFWA 4QC3A 3P5OA 5D3HA 1EQFA 4O7CA 5DYXA 3MB3A 3UVYA 5E9IA 2YYNA 5EWDA 5ACYA 4QSXA 5FH7A 5CTLA 4A9HA 5A5OA 3UW9A 4HBWA 5ENCA 2RNYA 2FSAA 4QEWA 5KTXA 4YY4A 2D82A 5EVAA 5E3DA 2YELA 5AD2A 4UIXA 3P1DA 2DKWA 4UIVA 5CQ5A 3UV5A 5CU8A 5FH8A 3MQMA 5D3SA 5DKDA 2DVRA 3P1FA 3UVDA 5H85A 4MEQA 4HXPA 5L97A 3O37A 5CZGA 4UIUA 3LQJA 4TU4A 5F25A 4UIZA 4NS5A 5EPRA 5FE7A 5I7XA 3K2JA 3AADA 5CUCA 4PCIA 4E96A 4BJXA 5DKCA 4LRGA 5II2A 4TT2A 5CUDA 4MR4A 5IGKA 4HXSA 4J0SA 4YBMA 5DW1A 4A9OA 1E6IA 5FE6A 4UYFA 4DONA 5F1LA 5DLZA 5LJ2A 5CQ6A 5A5PA 3I3JA 4WHUA 4HXMA 5F60A 5BT4A 2L5EA 4MEOA 4MENA 2F6JA 3Q2EA 4LR6A 3QZTA 3JVKA 1ZS5A 5F61A 4QSVA 5ENFA 5II1A 4NUCA 5DFDA 3SVFA 5I29A 5K29A 5F1HA 3MULA 2YEMA 3O36A 4HXNA 4YBTA 4O71A 5LKUA 5HRVA 4LYWA 3O35A 2RI7A 5ENGA 4QUUA 5FH6A 3S91A 5CQ3A 4KV1A 5FB0A 4QEUA 4QR4A 5KHMA 4J1PA 4AKNA 4QR3A 5EWVA 4NRBA 4MR5A 4RVRA 4NR6A 4TT6A 4UITA 4Z6HA 5FE8A 4OGJA 4PTBA 3U5PA 3UVWA 4LZRA 4O75A 3U5LA 5CPEA 2N9GA 3GG3A 5EGUA 4NXJA 5LVRA 5CFWA 4HXKA 4UIWA 5FBXA 5CQ4A 5G4RA 4CUQA 3FKMX 4O70A 5EK9A 5FDZA 4MR6A 5EQ1A 4HXRA 5CY9A 4N3WA 2R0VA 3Q2FA 4O74A 5D0CA 5I7YA 3U5MA 4HBXA 4CLBA 5CQ8A 4PS5A 4TTEA 5FB1A 4A9NA 5F36A 5D25A 5I1QA 5I86A 4QSRA 5AD3A 4QSSA 3U5KA 5EWHA 3SVHA 5C85A 3LQIA 4NR7A 5FG4A 3AQAA 4QSQA 5EWCA 3U5JA 4QSTA 4YY6A 4QB3A 4O78A 4XY8A 4Z1SA 4PCEA 5L99A 5FE9A 2RO1A 5JI8A 4YYHA 5ENBA 5F3AA 1JM4B 5CUEA 5BT5A 2I7KA 5LKTA 5IG6A 3DAIA 4A9FA 5FG5A 5HLSA 4YC9A 4BW1A 5D24A 2I8NA 5LJ1A 4NR8A 2RNXA 4CUUA 3HMFA 4O7FA 5HQ7A 4CL9A 5DLXA 2MJVB 4A9JA 5HFRA 3JVLA 5IGNA 4YADA 4QBMA 4NR4A 4YAXA 2F6NA 5DFCA 2DVSA 4Z93A 4O7AA 4C67A 5A82A 4XUBA 5HEMA 4IR6A 2YDWA 4KCXA 4J3IA 4OUFA 4YH3A 4YYGA 3QZVA 2YW5A 4NUDA 5E0RA 5C7NA 3UV2A 4Q0NA 4NQNA 4N4GA 2OUOA 2RS9B 5FE4A 2G4AA 4XYAA 5HJCA 4IOOA 5EISA 2YQDA 5FE1A 4A9EA 4HBYA 4QSWA 4GPJA 5D26A 4A9KA 4XY9A 5ENHA 4LZ2A 5FE2A 5IIDA 5F5ZA 4QR5A 5DY7A 2NXBA 4HBVA 4A9IA 5FE3A 5H1UA 3HMEA 1WUMA 4YYDA 4XUAA 4MR3A 4X2IA 4YH4A 2DVQA 5EPSA 5A5RA 4QNSA 5A7CA 4QY4A 4HXOA 4FLPA 5FFVA 4OGIA 2LSPB 5C89A 2RNWA 5I40A 5CUAA 3LJWA 4MEPA 3S92A 3NXBA 5EM3A 5EU1A 4PY6A 5DYCA 4O7BA 5L96A 5LJ0A 5LVQA 4ZW1A 5A5QA 3LQHA 5D3JA 1X0JA 5E74A 5HRXA 5CQAA 4NRCA 5IBNA 5KO4A 5CUBA 2OO1A 4ALGA 4LYSA 4Z6IA 3IU5A 4UYDA 3P1EA 5EV9A 5C87A 5HFQA 3JVJA 5EICA 3O34A 4TS8A 5BT3A 4WHWA 5D3PA 4KV4A 2R0YA 2E7OA 2R0SA 4LYIA 5A85A 4YYJA 4LC2A 5D7XA 3D7CA 5FFYA 5ENEA 4CUSA 4TZ2A 4LZSA 5DFBA 3UVXA 4BW4A 4CFKA 4F3IA 5DW2A 4BW3A 2DVVA 5DYUA 4IR5A 2D9EA 5ENIA 5HENA 5D3TA 5L8UA 2DWWA 5ETDA 4YATA 4N4FA 5E9YA 4YYKA 3U5NA 3IU6A 5TCMA 1N72A 2RFJA 5G4SA 5LUUA 3MUKA 5JWMA 5CRMA 5D3NA 5EA1A 5ETBA 3TLPA 5KTUA 5E9VA 5AMEA 4BHWA 5HQ5A 5AMFA 1WUGA 5A5NA 5COIA 5DYAA 5E3GA 4Q0OA 4C66A 5C8GA 5FE5A 5HQ6A 4UIYA 5LKXA 4IR3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NRA A;  5IGM A;  4WIV A;  5F62 A;  5HEL A;  5J0D A;  3O33 A;  5HRW A;  4TYL A;  3UV4 A;  4QYD A;  2DAT A;  4IOQ A;  5EI4 A;  5KTW A;  4QC1 A;  4YK0 A;  4N4I A;  4NYW A;  3DWY A;  2WP1 A;  4NUE A;  5CUG A;  4UYE A;  2GRC A;  4ZQL A;  5CRZ A;  5I89 A;  2L84 A;  5L8T A;  5CGP A;  2H60 A;  4YYM A;  4CUT A;  4QEV A;  3QZS A;  5A81 A;  4CUP A;  3SVG A;  2R10 A;  2L85 A;  5H1V A;  3ONI A;  4NR9 A;  4HXL A;  3RCW A;  4CUR A;  5F63 A;  4TU6 A;  2E3K A;  5DBM A;  5ENJ A;  4QSP A;  4QSU A;  4UYH A;  5KU3 A;  4UYG A;  5F2P A;  4YYI A;  5EP7 A;  4NYV A;  4A9M A;  4Y03 A;  5FE0 A;  4Z1Q A;  5DKH A;  3JVM A;  5CS8 A;  5TB6 A;  3ZYU A;  5D3L A;  4NYX A;  4QZS A;  3MXF A;  4YBS A;  3MB4 A;  5EPB A;  5E9M A;  5I83 A;  2KTB B;  4ALH A;  5E73 A;  4QYL A;  5I80 A;  2E7N A;  4LDF A;  4TZ8 A;  2YEK A;  2OSS A;  4NQM A;  4UYF B;  5CQT A;  5A83 A;  5IGL A;  2WP2 A;  4O7E A;  3HMH A;  4TT4 A;  5CQ7 A;  4O76 A;  5E7D A;  4J0R A;  5H1T A;  5FG6 A;  5HCL A;  4IOR A;  4IR4 A;  4NR5 A;  3P1C A;  5LKZ A;  5E9K A;  1JSP B;  4TQN A;  4BW2 A;  5HM0 A;  5CP5 A;  4YAB A;  5A5S A;  3LXJ A;  3U5O A;  4O72 A;  5D3R A;  4N4H A;  5DX4 A;  5E9L A;  4CFL A;  5EWW A;  3G0J A;  4O77 A;  4A9L A;  5C4Q A;  4QUT A;  4ZC9 A;  4YYN A;  5L98 A;  1F68 A;  5I88 A;  3G0L A;  4PKL A;  5FFW A;  4QC3 A;  3P5O A;  5D3H A;  1EQF A;  4O7C A;  5DYX A;  3MB3 A;  3UVY A;  5E9I A;  2YYN A;  5EWD A;  5ACY A;  4QSX A;  5FH7 A;  5CTL A;  4A9H A;  5A5O A;  3UW9 A;  4HBW A;  5ENC A;  2RNY A;  2FSA A;  4QEW A;  5KTX A;  4YY4 A;  2D82 A;  5EVA A;  5E3D A;  2YEL A;  5AD2 A;  4UIX A;  3P1D A;  2DKW A;  4UIV A;  5CQ5 A;  3UV5 A;  5CU8 A;  5FH8 A;  3MQM A;  5D3S A;  5DKD A;  2DVR A;  3P1F A;  3UVD A;  5H85 A;  4MEQ A;  4HXP A;  5L97 A;  3O37 A;  5CZG A;  4UIU A;  3LQJ A;  4TU4 A;  5F25 A;  4UIZ A;  4NS5 A;  5EPR A;  5FE7 A;  5I7X A;  3K2J A;  3AAD A;  5CUC A;  4PCI A;  4E96 A;  4BJX A;  5DKC A;  4LRG A;  5II2 A;  4TT2 A;  5CUD A;  4MR4 A;  5IGK A;  4HXS A;  4J0S A;  4YBM A;  5DW1 A;  4A9O A;  1E6I A;  5FE6 A;  4UYF A;  4DON A;  5F1L A;  5DLZ A;  5LJ2 A;  5CQ6 A;  5A5P A;  3I3J A;  4WHU A;  4HXM A;  5F60 A;  5BT4 A;  2L5E A;  4MEO A;  4MEN A;  2F6J A;  3Q2E A;  4LR6 A;  3QZT A;  3JVK A;  1ZS5 A;  5F61 A;  4QSV A;  5ENF A;  5II1 A;  4NUC A;  5DFD A;  3SVF A;  5I29 A;  5K29 A;  5F1H A;  3MUL A;  2YEM A;  3O36 A;  4HXN A;  4YBT A;  4O71 A;  5LKU A;  5HRV A;  4LYW A;  3O35 A;  2RI7 A;  5ENG A;  4QUU A;  5FH6 A;  3S91 A;  5CQ3 A;  4KV1 A;  5FB0 A;  4QEU A;  4QR4 A;  5KHM A;  4J1P A;  4AKN A;  4QR3 A;  5EWV A;  4NRB A;  4MR5 A;  4RVR A;  4NR6 A;  4TT6 A;  4UIT A;  4Z6H A;  5FE8 A;  4OGJ A;  4PTB A;  3U5P A;  3UVW A;  4LZR A;  4O75 A;  3U5L A;  5CPE A;  2N9G A;  3GG3 A;  5EGU A;  4NXJ A;  5LVR A;  5CFW A;  4HXK A;  4UIW A;  5FBX A;  5CQ4 A;  5G4R A;  4CUQ A;  3FKM X;  4O70 A;  5EK9 A;  5FDZ A;  4MR6 A;  5EQ1 A;  4HXR A;  5CY9 A;  4N3W A;  2R0V A;  3Q2F A;  4O74 A;  5D0C A;  5I7Y A;  3U5M A;  4HBX A;  4CLB A;  5CQ8 A;  4PS5 A;  4TTE A;  5FB1 A;  4A9N A;  5F36 A;  5D25 A;  5I1Q A;  5I86 A;  4QSR A;  5AD3 A;  4QSS A;  3U5K A;  5EWH A;  3SVH A;  5C85 A;  3LQI A;  4NR7 A;  5FG4 A;  3AQA A;  4QSQ A;  5EWC A;  3U5J A;  4QST A;  4YY6 A;  4QB3 A;  4O78 A;  4XY8 A;  4Z1S A;  4PCE A;  5L99 A;  5FE9 A;  2RO1 A;  5JI8 A;  4YYH A;  5ENB A;  5F3A A;  1JM4 B;  5CUE A;  5BT5 A;  2I7K A;  5LKT A;  5IG6 A;  3DAI A;  4A9F A;  5FG5 A;  5HLS A;  4YC9 A;  4BW1 A;  5D24 A;  2I8N A;  5LJ1 A;  4NR8 A;  2RNX A;  4CUU A;  3HMF A;  4O7F A;  5HQ7 A;  4CL9 A;  5DLX A;  2MJV B;  4A9J A;  5HFR A;  3JVL A;  5IGN A;  4YAD A;  4QBM A;  4NR4 A;  4YAX A;  2F6N A;  5DFC A;  2DVS A;  4Z93 A;  4O7A A;  4C67 A;  5A82 A;  4XUB A;  5HEM A;  4IR6 A;  2YDW A;  4KCX A;  4J3I A;  4OUF A;  4YH3 A;  4YYG A;  3QZV A;  2YW5 A;  4NUD A;  5E0R A;  5C7N A;  3UV2 A;  4Q0N A;  4NQN A;  4N4G A;  2OUO A;  2RS9 B;  5FE4 A;  2G4A A;  4XYA A;  5HJC A;  4IOO A;  5EIS A;  2YQD A;  5FE1 A;  4A9E A;  4HBY A;  4QSW A;  4GPJ A;  5D26 A;  4A9K A;  4XY9 A;  5ENH A;  4LZ2 A;  5FE2 A;  5IID A;  5F5Z A;  4QR5 A;  5DY7 A;  2NXB A;  4HBV A;  4A9I A;  5FE3 A;  5H1U A;  3HME A;  1WUM A;  4YYD A;  4XUA A;  4MR3 A;  4X2I A;  4YH4 A;  2DVQ A;  5EPS A;  5A5R A;  4QNS A;  5A7C A;  4QY4 A;  4HXO A;  4FLP A;  5FFV A;  4OGI A;  2LSP B;  5C89 A;  2RNW A;  5I40 A;  5CUA A;  3LJW A;  4MEP A;  3S92 A;  3NXB A;  5EM3 A;  5EU1 A;  4PY6 A;  5DYC A;  4O7B A;  5L96 A;  5LJ0 A;  5LVQ A;  4ZW1 A;  5A5Q A;  3LQH A;  5D3J A;  1X0J A;  5E74 A;  5HRX A;  5CQA A;  4NRC A;  5IBN A;  5KO4 A;  5CUB A;  2OO1 A;  4ALG A;  4LYS A;  4Z6I A;  3IU5 A;  4UYD A;  3P1E A;  5EV9 A;  5C87 A;  5HFQ A;  3JVJ A;  5EIC A;  3O34 A;  4TS8 A;  5BT3 A;  4WHW A;  5D3P A;  4KV4 A;  2R0Y A;  2E7O A;  2R0S A;  4LYI A;  5A85 A;  4YYJ A;  4LC2 A;  5D7X A;  3D7C A;  5FFY A;  5ENE A;  4CUS A;  4TZ2 A;  4LZS A;  5DFB A;  3UVX A;  4BW4 A;  4CFK A;  4F3I A;  5DW2 A;  4BW3 A;  2DVV A;  5DYU A;  4IR5 A;  2D9E A;  5ENI A;  5HEN A;  5D3T A;  5L8U A;  2DWW A;  5ETD A;  4YAT A;  4N4F A;  5E9Y A;  4YYK A;  3U5N A;  3IU6 A;  5TCM A;  1N72 A;  2RFJ A;  5G4S A;  5LUU A;  3MUK A;  5JWM A;  5CRM A;  5D3N A;  5EA1 A;  5ETB A;  3TLP A;  5KTU A;  5E9V A;  5AME A;  4BHW A;  5HQ5 A;  5AMF A;  1WUG A;  5A5N A;  5COI A;  5DYA A;  5E3G A;  4Q0O A;  4C66 A;  5C8G A;  5FE5 A;  5HQ6 A;  4UIY A;  5LKX A;  4IR3 A; 
#chains in the Genus database with same CATH topology
 4NRA A;  5IGM A;  4WIV A;  5F62 A;  5HEL A;  5J0D A;  3O33 A;  5HRW A;  4TYL A;  3VKH A;  3UV4 A;  4QYD A;  2DAT A;  4IOQ A;  5EI4 A;  5KTW A;  4QC1 A;  4YK0 A;  4N4I A;  4NYW A;  3DWY A;  2WP1 A;  4NUE A;  5CUG A;  4UYE A;  2GRC A;  4ZQL A;  5CRZ A;  5I89 A;  2L84 A;  5L8T A;  5CGP A;  2H60 A;  3D1D A;  4YYM A;  4CUT A;  4QEV A;  3QZS A;  5A81 A;  1PUO A;  4CUP A;  3SVG A;  2R10 A;  2L85 A;  5H1V A;  3ONI A;  4NR9 A;  4HXL A;  3RCW A;  4CUR A;  5F63 A;  4TU6 A;  2E3K A;  5DBM A;  5ENJ A;  4QSP A;  4QSU A;  4UYH A;  5KU3 A;  4UYG A;  5F2P A;  4YYI A;  5EP7 A;  4NYV A;  4A9M A;  4Y03 A;  5FE0 A;  4Z1Q A;  5DKH A;  3JVM A;  5CS8 A;  5TB6 A;  3ZYU A;  5D3L A;  4NYX A;  4QZS A;  3MXF A;  4YBS A;  3MB4 A;  5EPB A;  5E9M A;  5I83 A;  2KTB B;  4ALH A;  5E73 A;  4QYL A;  5I80 A;  2E7N A;  4LDF A;  4TZ8 A;  2YEK A;  2OSS A;  4NQM A;  4UYF B;  5CQT A;  5A83 A;  5IGL A;  2WP2 A;  4O7E A;  3HMH A;  4TT4 A;  2EJN A;  5CQ7 A;  4O76 A;  5E7D A;  4J0R A;  5H1T A;  5FG6 A;  5HCL A;  4IOR A;  4IR4 A;  4NR5 A;  3P1C A;  5LKZ A;  5E9K A;  1JSP B;  4TQN A;  4BW2 A;  5HM0 A;  5CP5 A;  4YAB A;  5A5S A;  3LXJ A;  3U5O A;  4O72 A;  5D3R A;  4N4H A;  5DX4 A;  5E9L A;  4CFL A;  5EWW A;  3G0J A;  4O77 A;  4A9L A;  5C4Q A;  4QUT A;  4ZC9 A;  4YYN A;  5L98 A;  1F68 A;  5I88 A;  3G0L A;  4PKL A;  5FFW A;  4QC3 A;  3P5O A;  5D3H A;  1EQF A;  4O7C A;  5DYX A;  3MB3 A;  3UVY A;  5E9I A;  2YYN A;  5EWD A;  5ACY A;  4QSX A;  5FH7 A;  5CTL A;  4A9H A;  5A5O A;  3UW9 A;  4HBW A;  5ENC A;  2RNY A;  2FSA A;  4QEW A;  5KTX A;  4YY4 A;  2D82 A;  5EVA A;  5E3D A;  2YEL A;  5AD2 A;  4UIX A;  3P1D A;  2DKW A;  4UIV A;  5CQ5 A;  3UV5 A;  5CU8 A;  5FH8 A;  3MQM A;  5D3S A;  5DKD A;  2DVR A;  3P1F A;  3UVD A;  5H85 A;  4MEQ A;  4HXP A;  5L97 A;  4AKH A;  3O37 A;  5CZG A;  4UIU A;  3LQJ A;  4TU4 A;  5F25 A;  4UIZ A;  4NS5 A;  5EPR A;  5FE7 A;  5I7X A;  3K2J A;  3AAD A;  5CUC A;  4PCI A;  4E96 A;  4BJX A;  5DKC A;  4LRG A;  5II2 A;  4TT2 A;  5CUD A;  4MR4 A;  5IGK A;  4HXS A;  4J0S A;  4YBM A;  5DW1 A;  4A9O A;  1E6I A;  5FE6 A;  4UYF A;  4DON A;  5F1L A;  5DLZ A;  5LJ2 A;  5CQ6 A;  5A5P A;  3I3J A;  4WHU A;  4HXM A;  5F60 A;  5BT4 A;  2L5E A;  4MEO A;  4MEN A;  2F6J A;  3Q2E A;  4LR6 A;  3QZT A;  3JVK A;  1ZS5 A;  5F61 A;  4QSV A;  5ENF A;  5II1 A;  4NUC A;  5DFD A;  3SVF A;  5I29 A;  5K29 A;  5F1H A;  3MUL A;  2YEM A;  3O36 A;  4HXN A;  4YBT A;  4O71 A;  5LKU A;  1ZKR A;  4LYW A;  5HRV A;  3O35 A;  2RI7 A;  5ENG A;  4QUU A;  5FH6 A;  3S91 A;  5CQ3 A;  4KV1 A;  5FB0 A;  4QEU A;  4QR4 A;  5KHM A;  4J1P A;  4AKN A;  4QR3 A;  5EWV A;  4NRB A;  4MR5 A;  4RVR A;  4NR6 A;  4TT6 A;  4UIT A;  4Z6H A;  5FE8 A;  4OGJ A;  4PTB A;  3U5P A;  3UVW A;  4LZR A;  4O75 A;  3U5L A;  5CPE A;  2N9G A;  3GG3 A;  5EGU A;  4NXJ A;  5LVR A;  5CFW A;  4HXK A;  4UIW A;  5FBX A;  5CQ4 A;  5G4R A;  4CUQ A;  3FKM X;  4O70 A;  5EK9 A;  5FDZ A;  4MR6 A;  5EQ1 A;  4HXR A;  5CY9 A;  4N3W A;  2R0V A;  3Q2F A;  4O74 A;  5D0C A;  5I7Y A;  3U5M A;  4HBX A;  4CLB A;  5CQ8 A;  4PS5 A;  4TTE A;  5FB1 A;  4A9N A;  5F36 A;  3ERR A;  5D25 A;  5I1Q A;  5I86 A;  4QSR A;  5AD3 A;  4QSS A;  3U5K A;  5EWH A;  3SVH A;  5C85 A;  3LQI A;  4NR7 A;  5FG4 A;  3AQA A;  4QSQ A;  5EWC A;  3U5J A;  4QST A;  4YY6 A;  4QB3 A;  4O78 A;  4XY8 A;  4Z1S A;  4PCE A;  5L99 A;  5FE9 A;  2RO1 A;  5JI8 A;  4YYH A;  5ENB A;  5F3A A;  1JM4 B;  5CUE A;  5BT5 A;  2I7K A;  5LKT A;  5IG6 A;  3DAI A;  4A9F A;  5FG5 A;  5HLS A;  4YC9 A;  4BW1 A;  5D24 A;  2I8N A;  5LJ1 A;  4NR8 A;  2RNX A;  4CUU A;  3HMF A;  4O7F A;  5HQ7 A;  4CL9 A;  5DLX A;  2MJV B;  4A9J A;  5HFR A;  3JVL A;  5IGN A;  4YAD A;  4QBM A;  4NR4 A;  4YAX A;  2F6N A;  5DFC A;  2DVS A;  4Z93 A;  4O7A A;  4C67 A;  5A82 A;  4XUB A;  5HEM A;  4IR6 A;  2YDW A;  4KCX A;  4J3I A;  4OUF A;  4YH3 A;  4YYG A;  3QZV A;  2YW5 A;  4NUD A;  5E0R A;  5C7N A;  3UV2 A;  4Q0N A;  4NQN A;  4N4G A;  2OUO A;  2RS9 B;  5FE4 A;  2G4A A;  4XYA A;  5HJC A;  4IOO A;  5EIS A;  2YQD A;  5FE1 A;  4A9E A;  4HBY A;  4QSW A;  4GPJ A;  5D26 A;  4A9K A;  4XY9 A;  5ENH A;  4AKI A;  4LZ2 A;  5FE2 A;  5IID A;  5F5Z A;  4QR5 A;  5DY7 A;  2NXB A;  4HBV A;  4A9I A;  5FE3 A;  5H1U A;  3HME A;  1WUM A;  4YYD A;  4XUA A;  4MR3 A;  4X2I A;  4YH4 A;  2DVQ A;  5EPS A;  5A5R A;  4QNS A;  5A7C A;  4QY4 A;  4HXO A;  4FLP A;  5FFV A;  4AI6 A;  4OGI A;  2LSP B;  5C89 A;  2RNW A;  5I40 A;  5CUA A;  3LJW A;  4MEP A;  3S92 A;  3NXB A;  5EM3 A;  5EU1 A;  4PY6 A;  5DYC A;  4O7B A;  5L96 A;  5LJ0 A;  5LVQ A;  4ZW1 A;  5A5Q A;  3LQH A;  5D3J A;  1X0J A;  5E74 A;  5HRX A;  5CQA A;  4NRC A;  5IBN A;  5KO4 A;  5CUB A;  2OO1 A;  4ALG A;  4LYS A;  4Z6I A;  3IU5 A;  4UYD A;  3P1E A;  5EV9 A;  5C87 A;  5HFQ A;  3JVJ A;  5EIC A;  3O34 A;  4TS8 A;  5BT3 A;  4WHW A;  5D3P A;  4KV4 A;  2R0Y A;  2E7O A;  2R0S A;  4LYI A;  5A85 A;  3VKG A;  4YYJ A;  4LC2 A;  5D7X A;  3D7C A;  5FFY A;  5ENE A;  4CUS A;  4TZ2 A;  4LZS A;  5DFB A;  3UVX A;  4BW4 A;  4CFK A;  4F3I A;  5DW2 A;  4BW3 A;  2DVV A;  5DYU A;  4IR5 A;  2D9E A;  5ENI A;  5HEN A;  5D3T A;  5L8U A;  2DWW A;  5ETD A;  4YAT A;  4N4F A;  5E9Y A;  4YYK A;  3U5N A;  3IU6 A;  5TCM A;  1N72 A;  2RFJ A;  5G4S A;  5LUU A;  3MUK A;  5JWM A;  5CRM A;  5D3N A;  5EA1 A;  3D1B A;  5ETB A;  4AKG A;  3TLP A;  5KTU A;  5E9V A;  5AME A;  4BHW A;  5HQ5 A;  5AMF A;  1WUG A;  5A5N A;  5COI A;  5DYA A;  5E3G A;  4Q0O A;  4C66 A;  5C8G A;  5FE5 A;  5HQ6 A;  4UIY A;  5LKX A;  4IR3 A; 
#chains in the Genus database with same CATH homology
 4NRA A;  5IGM A;  4WIV A;  5F62 A;  5HEL A;  5J0D A;  3O33 A;  5HRW A;  4TYL A;  3UV4 A;  4QYD A;  2DAT A;  4IOQ A;  5EI4 A;  5KTW A;  4QC1 A;  4YK0 A;  4N4I A;  4NYW A;  3DWY A;  2WP1 A;  4NUE A;  5CUG A;  4UYE A;  2GRC A;  4ZQL A;  5CRZ A;  5I89 A;  2L84 A;  5L8T A;  5CGP A;  2H60 A;  4YYM A;  4CUT A;  4QEV A;  3QZS A;  5A81 A;  4CUP A;  3SVG A;  2R10 A;  2L85 A;  5H1V A;  3ONI A;  4NR9 A;  4HXL A;  3RCW A;  4CUR A;  5F63 A;  4TU6 A;  2E3K A;  5DBM A;  5ENJ A;  4QSP A;  4QSU A;  4UYH A;  5KU3 A;  4UYG A;  5F2P A;  4YYI A;  5EP7 A;  4NYV A;  4A9M A;  4Y03 A;  5FE0 A;  4Z1Q A;  5DKH A;  3JVM A;  5CS8 A;  5TB6 A;  3ZYU A;  5D3L A;  4NYX A;  4QZS A;  3MXF A;  4YBS A;  3MB4 A;  5EPB A;  5E9M A;  5I83 A;  2KTB B;  4ALH A;  5E73 A;  4QYL A;  5I80 A;  2E7N A;  4LDF A;  4TZ8 A;  2YEK A;  2OSS A;  4NQM A;  4UYF B;  5CQT A;  5A83 A;  5IGL A;  2WP2 A;  4O7E A;  3HMH A;  4TT4 A;  5CQ7 A;  4O76 A;  5E7D A;  4J0R A;  5H1T A;  5FG6 A;  5HCL A;  4IOR A;  4IR4 A;  4NR5 A;  3P1C A;  5LKZ A;  5E9K A;  1JSP B;  4TQN A;  4BW2 A;  5HM0 A;  5CP5 A;  4YAB A;  5A5S A;  3LXJ A;  3U5O A;  4O72 A;  5D3R A;  4N4H A;  5DX4 A;  5E9L A;  4CFL A;  5EWW A;  3G0J A;  4O77 A;  4A9L A;  5C4Q A;  4QUT A;  4ZC9 A;  4YYN A;  5L98 A;  1F68 A;  5I88 A;  3G0L A;  4PKL A;  5FFW A;  4QC3 A;  3P5O A;  5D3H A;  1EQF A;  4O7C A;  5DYX A;  3MB3 A;  3UVY A;  5E9I A;  2YYN A;  5EWD A;  5ACY A;  4QSX A;  5FH7 A;  5CTL A;  4A9H A;  5A5O A;  3UW9 A;  4HBW A;  5ENC A;  2RNY A;  2FSA A;  4QEW A;  5KTX A;  4YY4 A;  2D82 A;  5EVA A;  5E3D A;  2YEL A;  5AD2 A;  4UIX A;  3P1D A;  2DKW A;  4UIV A;  5CQ5 A;  3UV5 A;  5CU8 A;  5FH8 A;  3MQM A;  5D3S A;  5DKD A;  2DVR A;  3P1F A;  3UVD A;  5H85 A;  4MEQ A;  4HXP A;  5L97 A;  3O37 A;  5CZG A;  4UIU A;  3LQJ A;  4TU4 A;  5F25 A;  4UIZ A;  4NS5 A;  5EPR A;  5FE7 A;  5I7X A;  3K2J A;  3AAD A;  5CUC A;  4PCI A;  4E96 A;  4BJX A;  5DKC A;  4LRG A;  5II2 A;  4TT2 A;  5CUD A;  4MR4 A;  5IGK A;  4HXS A;  4J0S A;  4YBM A;  5DW1 A;  4A9O A;  1E6I A;  5FE6 A;  4UYF A;  4DON A;  5F1L A;  5DLZ A;  5LJ2 A;  5CQ6 A;  5A5P A;  3I3J A;  4WHU A;  4HXM A;  5F60 A;  5BT4 A;  2L5E A;  4MEO A;  4MEN A;  2F6J A;  3Q2E A;  4LR6 A;  3QZT A;  3JVK A;  1ZS5 A;  5F61 A;  4QSV A;  5ENF A;  5II1 A;  4NUC A;  5DFD A;  3SVF A;  5I29 A;  5K29 A;  5F1H A;  3MUL A;  2YEM A;  3O36 A;  4HXN A;  4YBT A;  4O71 A;  5LKU A;  5HRV A;  4LYW A;  3O35 A;  2RI7 A;  5ENG A;  4QUU A;  5FH6 A;  3S91 A;  5CQ3 A;  4KV1 A;  5FB0 A;  4QEU A;  4QR4 A;  5KHM A;  4J1P A;  4AKN A;  4QR3 A;  5EWV A;  4NRB A;  4MR5 A;  4RVR A;  4NR6 A;  4TT6 A;  4UIT A;  4Z6H A;  5FE8 A;  4OGJ A;  4PTB A;  3U5P A;  3UVW A;  4LZR A;  4O75 A;  3U5L A;  5CPE A;  2N9G A;  3GG3 A;  5EGU A;  4NXJ A;  5LVR A;  5CFW A;  4HXK A;  4UIW A;  5FBX A;  5CQ4 A;  5G4R A;  4CUQ A;  3FKM X;  4O70 A;  5EK9 A;  5FDZ A;  4MR6 A;  5EQ1 A;  4HXR A;  5CY9 A;  4N3W A;  2R0V A;  3Q2F A;  4O74 A;  5D0C A;  5I7Y A;  3U5M A;  4HBX A;  4CLB A;  5CQ8 A;  4PS5 A;  4TTE A;  5FB1 A;  4A9N A;  5F36 A;  5D25 A;  5I1Q A;  5I86 A;  4QSR A;  5AD3 A;  4QSS A;  3U5K A;  5EWH A;  3SVH A;  5C85 A;  3LQI A;  4NR7 A;  5FG4 A;  3AQA A;  4QSQ A;  5EWC A;  3U5J A;  4QST A;  4YY6 A;  4QB3 A;  4O78 A;  4XY8 A;  4Z1S A;  4PCE A;  5L99 A;  5FE9 A;  2RO1 A;  5JI8 A;  4YYH A;  5ENB A;  5F3A A;  1JM4 B;  5CUE A;  5BT5 A;  2I7K A;  5LKT A;  5IG6 A;  3DAI A;  4A9F A;  5FG5 A;  5HLS A;  4YC9 A;  4BW1 A;  5D24 A;  2I8N A;  5LJ1 A;  4NR8 A;  2RNX A;  4CUU A;  3HMF A;  4O7F A;  5HQ7 A;  4CL9 A;  5DLX A;  2MJV B;  4A9J A;  5HFR A;  3JVL A;  5IGN A;  4YAD A;  4QBM A;  4NR4 A;  4YAX A;  2F6N A;  5DFC A;  2DVS A;  4Z93 A;  4O7A A;  4C67 A;  5A82 A;  4XUB A;  5HEM A;  4IR6 A;  2YDW A;  4KCX A;  4J3I A;  4OUF A;  4YH3 A;  4YYG A;  3QZV A;  2YW5 A;  4NUD A;  5E0R A;  5C7N A;  3UV2 A;  4Q0N A;  4NQN A;  4N4G A;  2OUO A;  2RS9 B;  5FE4 A;  2G4A A;  4XYA A;  5HJC A;  4IOO A;  5EIS A;  2YQD A;  5FE1 A;  4A9E A;  4HBY A;  4QSW A;  4GPJ A;  5D26 A;  4A9K A;  4XY9 A;  5ENH A;  4LZ2 A;  5FE2 A;  5IID A;  5F5Z A;  4QR5 A;  5DY7 A;  2NXB A;  4HBV A;  4A9I A;  5FE3 A;  5H1U A;  3HME A;  1WUM A;  4YYD A;  4XUA A;  4MR3 A;  4X2I A;  4YH4 A;  2DVQ A;  5EPS A;  5A5R A;  4QNS A;  5A7C A;  4QY4 A;  4HXO A;  4FLP A;  5FFV A;  4OGI A;  2LSP B;  5C89 A;  2RNW A;  5I40 A;  5CUA A;  3LJW A;  4MEP A;  3S92 A;  3NXB A;  5EM3 A;  5EU1 A;  4PY6 A;  5DYC A;  4O7B A;  5L96 A;  5LJ0 A;  5LVQ A;  4ZW1 A;  5A5Q A;  3LQH A;  5D3J A;  1X0J A;  5E74 A;  5HRX A;  5CQA A;  4NRC A;  5IBN A;  5KO4 A;  5CUB A;  2OO1 A;  4ALG A;  4LYS A;  4Z6I A;  3IU5 A;  4UYD A;  3P1E A;  5EV9 A;  5C87 A;  5HFQ A;  3JVJ A;  5EIC A;  3O34 A;  4TS8 A;  5BT3 A;  4WHW A;  5D3P A;  4KV4 A;  2R0Y A;  2E7O A;  2R0S A;  4LYI A;  5A85 A;  4YYJ A;  4LC2 A;  5D7X A;  3D7C A;  5FFY A;  5ENE A;  4CUS A;  4TZ2 A;  4LZS A;  5DFB A;  3UVX A;  4BW4 A;  4CFK A;  4F3I A;  5DW2 A;  4BW3 A;  2DVV A;  5DYU A;  4IR5 A;  2D9E A;  5ENI A;  5HEN A;  5D3T A;  5L8U A;  2DWW A;  5ETD A;  4YAT A;  4N4F A;  5E9Y A;  4YYK A;  3U5N A;  3IU6 A;  5TCM A;  1N72 A;  2RFJ A;  5G4S A;  5LUU A;  3MUK A;  5JWM A;  5CRM A;  5D3N A;  5EA1 A;  5ETB A;  3TLP A;  5KTU A;  5E9V A;  5AME A;  4BHW A;  5HQ5 A;  5AMF A;  1WUG A;  5A5N A;  5COI A;  5DYA A;  5E3G A;  4Q0O A;  4C66 A;  5C8G A;  5FE5 A;  5HQ6 A;  4UIY A;  5LKX A;  4IR3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...