4UIWA

Bromodomain of human brd9 with n-(1,1-dioxo-1-thian-4-yl)-5-ethyl-4- oxo-7-3-(trifluoromethyl)phenyl-4h,5h-thieno-3,2-c-pyridine-2- carboximidamide
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
101
structure length
101
Chain Sequence
STPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BROMODOMAIN-CONTAINING PROTEIN 9
publication title The Discovery of I-Brd9, a Selective Cell Active Chemical Probe for Bromodomain Containing Protein 9 Inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 37
structure length 101
sequence length 101
ec nomenclature
pdb deposition date 2015-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00439 Bromodomain Bromodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.920.10 Mainly Alpha Up-down Bundle Histone Acetyltransferase; Chain A Bromodomain-like 4uiwA00
3UW9A 5I7XA 5FE9A 4QUTA 4UIYA 3LQHA 4KV1A 4O77A 5LKTA 5EWCA 4TU6A 5DY7A 2L5EA 5F62A 2YW5A 5DW2A 5CRMA 4O7FA 4TT6A 2OO1A 5CP5A 5HFRA 4NYXA 4A9NA 4PKLA 4QNSA 5L97A 4TZ2A 5HQ5A 5EI4A 4PCIA 3UVXA 3DWYA 3QZVA 5EVAA 5E9VA 4NQMA 5FG5A 5FDZA 4IOOA 5HRVA 2E7OA 4O76A 4ZW1A 4CUQA 4HXKA 5EV9A 4Y03A 4O70A 4N4FA 5BT4A 5E74A 4WHUA 5D24A 3D7CA 4AKNA 4RVRA 2YDWA 5CQTA 4J0SA 5E9MA 4QSUA 5L8UA 4NXJA 4YC9A 5EQ1A 3P1FA 4LR6A 4HBYA 4LDFA 4IORA 4Z93A 1ZS5A 5DYUA 5C87A 5ENHA 2D82A 5HEMA 4O7BA 4UIUA 5EU1A 4XY9A 4QC1A 2RI7A 3MULA 4O7AA 4TTEA 3U5OA 5EWWA 5I40A 4YH3A 5CQ4A 5CU8A 5HRWA 4YBSA 4YYIA 5IGNA 4A9LA 2FSAA 4NUCA 3O33A 2OUOA 4HXMA 4UYFB 3S91A 4YY4A 3UVDA 5F1HA 5A81A 4C67A 5FB0A 4N4GA 5E9KA 3SVFA 4QR4A 5LJ0A 5HLSA 5IGKA 3U5JA 5E3DA 3G0LA 5FE7A 4J1PA 3ONIA 4YH4A 5AD3A 5F5ZA 4NR7A 2MJVB 4NUDA 5ENJA 2L84A 4MR6A 4NR4A 5DX4A 5KTUA 4O7EA 5EPRA 4UIVA 3U5LA 5LKUA 4HXLA 4QSRA 3U5PA 4NUEA 3MXFA 2DVVA 3UV5A 5F2PA 5D3RA 5LKZA 5FG4A 4LZ2A 5EWDA 4BHWA 5E9LA 4QSQA 2R10A 2YYNA 4CURA 5EWVA 4A9MA 3Q2EA 4A9EA 5EWHA 4LYIA 5ENBA 5CUEA 4IR6A 5CUDA 5DYCA 4BJXA 5AD2A 5DKDA 5JI8A 1X0JA 4ALHA 4YYMA 2NXBA 4E96A 5D3NA 2F6JA 3LXJA 4PCEA 2KTBB 2YQDA 4OGJA 4HXOA 5FE2A 4QC3A 2H60A 4MR5A 3K2JA 5CUCA 5E0RA 5II1A 3P1DA 3FKMX 4LYWA 5FE6A 5TB6A 3LQJA 3DAIA 4NR6A 4YK0A 5H1VA 5I89A 5ACYA 4YYGA 4A9OA 3U5MA 2E3KA 2DVSA 4UYDA 4QEVA 5BT5A 5F63A 4O72A 4IR5A 5DW1A 5FFWA 3U5KA 4TT4A 4QBMA 4CLBA 4J0RA 5II2A 4CUPA 5FE3A 5A83A 5IGLA 1E6IA 5A5SA 5KO4A 5D0CA 3QZTA 4Z1QA 5FH7A 4LZRA 4XUBA 5A5NA 4FLPA 4ZC9A 2WP1A 5FE8A 5FB1A 3P1EA 4HBWA 5EA1A 5DKHA 5D26A 4N4IA 4WHWA 5E3GA 5EISA 5F61A 5D25A 5F60A 3GG3A 4LZSA 5L98A 5HJCA 4N3WA 4A9FA 5EM3A 4YATA 4YY6A 4NRBA 5CQ8A 4QR5A 5CUAA 5AMEA 5D3LA 5LKXA 4YYDA 5JWMA 4O7CA 5DLZA 5EP7A 5AMFA 3U5NA 4CUSA 5H1UA 4Q0OA 2DATA 4C66A 4ALGA 3LJWA 3SVGA 4BW2A 4IR3A 5EK9A 2DWWA 5HM0A 4MENA 4J3IA 3LQIA 2D9EA 5DFDA 4QEWA 3TLPA 2DKWA 3O37A 5CZGA 2G4AA 3MQMA 5G4SA 5CUGA 5FBXA 4Z1SA 1WUMA 5CFWA 3MB3A 4O74A 3O36A 4LC2A 4ZQLA 4UIZA 4NRAA 3JVJA 5KTXA 4HXSA 5DLXA 3ZYUA 5FE5A 5CPEA 5CQ7A 5CQAA 5A5QA 4QYDA 5EPSA 5HQ7A 4YYJA 5F3AA 4YBTA 2YEMA 3P1CA 4O75A 2F6NA 2OSSA 4MEPA 2L85A 5F25A 5KHMA 4CL9A 3P5OA 5EGUA 5A5RA 1EQFA 3RCWA 5CGPA 5FG6A 5FFVA 5IIDA 4TZ8A 4IR4A 4BW4A 5C85A 4YABA 5IG6A 3MUKA 5C89A 5ENGA 3AQAA 4TQNA 5CQ3A 5C8GA 5HQ6A 3JVMA 4HXPA 3I3JA 3O34A 4LRGA 5C4QA 5DFCA 4XY8A 2RNYA 3IU6A 5CQ6A 5ENEA 5HRXA 4NQNA 4HBXA 5KTWA 5CTLA 4PY6A 5LJ2A 4LYSA 5DYXA 3SVHA 2YEKA 4KV4A 5D3JA 4Z6IA 4MR4A 2GRCA 2DVRA 4HXNA 5TCMA 2RNXA 4TS8A 3Q2FA 5L99A 5CRZA 4XYAA 3UV2A 4XUAA 5IGMA 4YYNA 5HELA 5FFYA 4GPJA 5H85A 1WUGA 5ETDA 4YYHA 4QEUA 5L96A 5EICA 4N4HA 4TT2A 5D3HA 3JVKA 5KU3A 5J0DA 4QR3A 5CS8A 5DKCA 4HBVA 5F36A 4A9IA 5LUUA 5H1TA 5D3PA 4NS5A 4UYGA 2R0SA 4UIWA 4O71A 5BT3A 5I83A 5A82A 5DFBA 2RO1A 3UV4A 2I7KA 4QSSA 5G4RA 5I7YA 3IU5A 4Q0NA 4QB3A 4CUUA 4PS5A 4IOQA 4QSXA 4DONA 4A9KA 5ENIA 5LVQA 5ETBA 5E9YA 3MB4A 4QSPA 4NR9A 5EPBA 4UYFA 4YADA 4OGIA 5FE1A 4NYWA 5A5PA 4X2IA 4A9JA 5I1QA 1JM4B 5FH6A 4OUFA 5L8TA 5IBNA 3AADA 4UYHA 2R0VA 5HENA 1F68A 3NXBA 4UIXA 4QSTA 5A85A 4PTBA 4YYKA 5A5OA 4YAXA 4MEOA 5FE4A 3S92A 5DBMA 4BW1A 2N9GA 3HMEA 5D7XA 1N72A 4QSVA 5FE0A 5D3TA 4HXRA 4QUUA 3O35A 2R0YA 5E7DA 5ENCA 4TYLA 5I88A 5COIA 3HMFA 2WP2A 3QZSA 5ENFA 4TU4A 4QZSA 4CFLA 4YBMA 4WIVA 5I86A 5FH8A 4UITA 4F3IA 5E73A 5LVRA 2RS9B 5HFQA 5DYAA 5CY9A 4KCXA 4QYLA 5CQ5A 5F1LA 2E7NA 4MEQA 4QSWA 3JVLA 4CFKA 2I8NA 4NR5A 2RNWA 4BW3A 4QY4A 5K29A 5I29A 2DVQA 4NR8A 5HCLA 4NYVA 2RFJA 4A9HA 5A7CA 3HMHA 4MR3A 1JSPB 2YELA 3G0JA 2LSPB 3UVWA 4UYEA 5C7NA 5LJ1A 4Z6HA 5CUBA 4NRCA 3UVYA 4CUTA 5D3SA 5E9IA 4O78A 5I80A
chains in the Genus database with same CATH superfamily
3UW9A 5I7XA 5FE9A 4QUTA 4UIYA 3LQHA 4KV1A 4O77A 5LKTA 5EWCA 4TU6A 3D1BA 5DY7A 2L5EA 5F62A 2YW5A 5DW2A 5CRMA 4O7FA 4TT6A 2OO1A 5CP5A 5HFRA 4NYXA 4A9NA 4PKLA 4QNSA 5L97A 4TZ2A 5HQ5A 5EI4A 4PCIA 3UVXA 3DWYA 3QZVA 5EVAA 5E9VA 4NQMA 5FG5A 5FDZA 4IOOA 5HRVA 2E7OA 4O76A 4ZW1A 4CUQA 4HXKA 5EV9A 4Y03A 4O70A 4N4FA 5BT4A 5E74A 4WHUA 5D24A 3D7CA 4AKNA 4RVRA 2YDWA 5CQTA 4J0SA 5E9MA 4QSUA 5L8UA 4NXJA 4YC9A 5EQ1A 1ZKRA 3P1FA 4LR6A 4HBYA 4LDFA 4IORA 4Z93A 1ZS5A 5DYUA 5C87A 5ENHA 2D82A 5HEMA 4O7BA 4UIUA 5EU1A 4XY9A 4AI6A 4QC1A 2RI7A 3MULA 4O7AA 4TTEA 3U5OA 5EWWA 5I40A 4YH3A 5CQ4A 5CU8A 5HRWA 4YBSA 4YYIA 5IGNA 4A9LA 2FSAA 4NUCA 3O33A 2OUOA 4HXMA 4UYFB 3S91A 4YY4A 3UVDA 5F1HA 5A81A 4C67A 5FB0A 4N4GA 5E9KA 3SVFA 4QR4A 5LJ0A 5HLSA 5IGKA 3U5JA 5E3DA 3G0LA 5FE7A 4J1PA 3ONIA 4YH4A 5AD3A 5F5ZA 4NR7A 2MJVB 4NUDA 5ENJA 2L84A 4MR6A 4AKHA 4NR4A 5DX4A 5KTUA 4O7EA 5EPRA 4UIVA 3U5LA 5LKUA 4HXLA 4QSRA 3U5PA 4NUEA 3MXFA 2DVVA 3UV5A 5F2PA 5D3RA 5LKZA 5FG4A 4LZ2A 5EWDA 4BHWA 5E9LA 4QSQA 2R10A 2YYNA 4CURA 5EWVA 1PUOA 4A9MA 3Q2EA 4A9EA 5EWHA 4LYIA 5ENBA 5CUEA 4IR6A 5CUDA 5DYCA 4BJXA 5AD2A 5DKDA 5JI8A 1X0JA 4ALHA 4YYMA 2NXBA 4E96A 5D3NA 2F6JA 3LXJA 4PCEA 2KTBB 2YQDA 4OGJA 4HXOA 5FE2A 4QC3A 2H60A 4MR5A 3K2JA 5CUCA 5E0RA 5II1A 3P1DA 3FKMX 4LYWA 5FE6A 5TB6A 3LQJA 3DAIA 4NR6A 4YK0A 5H1VA 5I89A 5ACYA 4YYGA 4A9OA 3U5MA 2E3KA 2DVSA 4UYDA 4QEVA 5BT5A 5F63A 4O72A 4IR5A 5DW1A 5FFWA 3U5KA 4TT4A 4QBMA 4CLBA 4J0RA 5II2A 4CUPA 5FE3A 5A83A 5IGLA 1E6IA 5A5SA 5KO4A 5D0CA 3QZTA 4Z1QA 4AKIA 5FH7A 4LZRA 4XUBA 5A5NA 4FLPA 4ZC9A 2WP1A 5FE8A 5FB1A 3P1EA 4HBWA 5EA1A 5DKHA 5D26A 4N4IA 4WHWA 5E3GA 5EISA 5F61A 5D25A 5F60A 3GG3A 4LZSA 5L98A 5HJCA 4N3WA 4A9FA 5EM3A 4YATA 4YY6A 4NRBA 5CQ8A 4QR5A 5CUAA 5AMEA 5D3LA 5LKXA 4YYDA 5JWMA 4O7CA 5DLZA 5EP7A 5AMFA 3U5NA 4CUSA 5H1UA 4Q0OA 2DATA 4C66A 4ALGA 3LJWA 3SVGA 4BW2A 4IR3A 5EK9A 2DWWA 5HM0A 4MENA 4J3IA 3LQIA 2D9EA 5DFDA 4QEWA 3TLPA 2DKWA 3O37A 5CZGA 2G4AA 3MQMA 5G4SA 5CUGA 5FBXA 4Z1SA 1WUMA 5CFWA 3MB3A 4O74A 3O36A 4LC2A 4ZQLA 4UIZA 4NRAA 3JVJA 5KTXA 4HXSA 5DLXA 3ZYUA 5FE5A 5CPEA 5CQ7A 5CQAA 5A5QA 4QYDA 5EPSA 5HQ7A 4YYJA 5F3AA 4YBTA 2YEMA 3P1CA 4O75A 2F6NA 2OSSA 4MEPA 2L85A 5F25A 5KHMA 4CL9A 3P5OA 5EGUA 5A5RA 3ERRA 1EQFA 3RCWA 5CGPA 5FG6A 5FFVA 5IIDA 4TZ8A 4IR4A 4BW4A 3D1DA 5C85A 4YABA 5IG6A 3MUKA 5C89A 5ENGA 3AQAA 4TQNA 5CQ3A 5C8GA 5HQ6A 3JVMA 4HXPA 3I3JA 3O34A 4LRGA 5C4QA 5DFCA 4XY8A 2RNYA 3IU6A 5CQ6A 5ENEA 5HRXA 3VKGA 4NQNA 4HBXA 5KTWA 5CTLA 4PY6A 5LJ2A 4LYSA 5DYXA 3SVHA 2YEKA 4KV4A 5D3JA 4Z6IA 4MR4A 2GRCA 2DVRA 4HXNA 5TCMA 2RNXA 4TS8A 3Q2FA 5L99A 5CRZA 4XYAA 3UV2A 4XUAA 5IGMA 4YYNA 5HELA 5FFYA 4GPJA 5H85A 1WUGA 5ETDA 4YYHA 4QEUA 5L96A 5EICA 4N4HA 4TT2A 5D3HA 3JVKA 5KU3A 3VKHA 5J0DA 4QR3A 5CS8A 5DKCA 4HBVA 5F36A 4A9IA 5LUUA 5H1TA 5D3PA 4NS5A 4UYGA 2R0SA 4UIWA 4O71A 5BT3A 5I83A 5A82A 5DFBA 2RO1A 3UV4A 2I7KA 4QSSA 5G4RA 5I7YA 3IU5A 4Q0NA 4QB3A 4CUUA 4PS5A 4IOQA 4QSXA 4DONA 4A9KA 5ENIA 5LVQA 5ETBA 5E9YA 3MB4A 4QSPA 4NR9A 5EPBA 4UYFA 4YADA 4OGIA 5FE1A 4NYWA 5A5PA 4X2IA 4A9JA 5I1QA 1JM4B 5FH6A 4OUFA 5L8TA 5IBNA 3AADA 4UYHA 2R0VA 5HENA 1F68A 3NXBA 4UIXA 4QSTA 5A85A 4PTBA 4YYKA 5A5OA 4YAXA 4MEOA 5FE4A 3S92A 5DBMA 4BW1A 2N9GA 3HMEA 5D7XA 1N72A 4QSVA 5FE0A 5D3TA 4HXRA 4QUUA 3O35A 2R0YA 5E7DA 5ENCA 4TYLA 5I88A 5COIA 3HMFA 2WP2A 3QZSA 5ENFA 4TU4A 4QZSA 4CFLA 4AKGA 4YBMA 4WIVA 5I86A 2EJNA 5FH8A 4UITA 4F3IA 5E73A 5LVRA 2RS9B 5HFQA 5DYAA 5CY9A 4KCXA 4QYLA 5CQ5A 5F1LA 2E7NA 4MEQA 4QSWA 3JVLA 4CFKA 2I8NA 4NR5A 2RNWA 4BW3A 4QY4A 5K29A 5I29A 2DVQA 4NR8A 5HCLA 4NYVA 2RFJA 4A9HA 5A7CA 3HMHA 4MR3A 1JSPB 2YELA 3G0JA 2LSPB 3UVWA 4UYEA 5C7NA 5LJ1A 4Z6HA 5CUBA 4NRCA 3UVYA 4CUTA 5D3SA 5E9IA 4O78A 5I80A
chains in the Genus database with same CATH topology
3UW9A 5I7XA 5FE9A 4QUTA 4UIYA 3LQHA 4KV1A 4O77A 5LKTA 5EWCA 4TU6A 5DY7A 2L5EA 5F62A 2YW5A 5DW2A 5CRMA 4O7FA 4TT6A 2OO1A 5CP5A 5HFRA 4NYXA 4A9NA 4PKLA 4QNSA 5L97A 4TZ2A 5HQ5A 5EI4A 4PCIA 3UVXA 3DWYA 3QZVA 5EVAA 5E9VA 4NQMA 5FG5A 5FDZA 4IOOA 5HRVA 2E7OA 4O76A 4ZW1A 4CUQA 4HXKA 5EV9A 4Y03A 4O70A 4N4FA 5BT4A 5E74A 4WHUA 5D24A 3D7CA 4AKNA 4RVRA 2YDWA 5CQTA 4J0SA 5E9MA 4QSUA 5L8UA 4NXJA 4YC9A 5EQ1A 3P1FA 4LR6A 4HBYA 4LDFA 4IORA 4Z93A 1ZS5A 5DYUA 5C87A 5ENHA 2D82A 5HEMA 4O7BA 4UIUA 5EU1A 4XY9A 4QC1A 2RI7A 3MULA 4O7AA 4TTEA 3U5OA 5EWWA 5I40A 4YH3A 5CQ4A 5CU8A 5HRWA 4YBSA 4YYIA 5IGNA 4A9LA 2FSAA 4NUCA 3O33A 2OUOA 4HXMA 4UYFB 3S91A 4YY4A 3UVDA 5F1HA 5A81A 4C67A 5FB0A 4N4GA 5E9KA 3SVFA 4QR4A 5LJ0A 5HLSA 5IGKA 3U5JA 5E3DA 3G0LA 5FE7A 4J1PA 3ONIA 4YH4A 5AD3A 5F5ZA 4NR7A 2MJVB 4NUDA 5ENJA 2L84A 4MR6A 4NR4A 5DX4A 5KTUA 4O7EA 5EPRA 4UIVA 3U5LA 5LKUA 4HXLA 4QSRA 3U5PA 4NUEA 3MXFA 2DVVA 3UV5A 5F2PA 5D3RA 5LKZA 5FG4A 4LZ2A 5EWDA 4BHWA 5E9LA 4QSQA 2R10A 2YYNA 4CURA 5EWVA 4A9MA 3Q2EA 4A9EA 5EWHA 4LYIA 5ENBA 5CUEA 4IR6A 5CUDA 5DYCA 4BJXA 5AD2A 5DKDA 5JI8A 1X0JA 4ALHA 4YYMA 2NXBA 4E96A 5D3NA 2F6JA 3LXJA 4PCEA 2KTBB 2YQDA 4OGJA 4HXOA 5FE2A 4QC3A 2H60A 4MR5A 3K2JA 5CUCA 5E0RA 5II1A 3P1DA 3FKMX 4LYWA 5FE6A 5TB6A 3LQJA 3DAIA 4NR6A 4YK0A 5H1VA 5I89A 5ACYA 4YYGA 4A9OA 3U5MA 2E3KA 2DVSA 4UYDA 4QEVA 5BT5A 5F63A 4O72A 4IR5A 5DW1A 5FFWA 3U5KA 4TT4A 4QBMA 4CLBA 4J0RA 5II2A 4CUPA 5FE3A 5A83A 5IGLA 1E6IA 5A5SA 5KO4A 5D0CA 3QZTA 4Z1QA 5FH7A 4LZRA 4XUBA 5A5NA 4FLPA 4ZC9A 2WP1A 5FE8A 5FB1A 3P1EA 4HBWA 5EA1A 5DKHA 5D26A 4N4IA 4WHWA 5E3GA 5EISA 5F61A 5D25A 5F60A 3GG3A 4LZSA 5L98A 5HJCA 4N3WA 4A9FA 5EM3A 4YATA 4YY6A 4NRBA 5CQ8A 4QR5A 5CUAA 5AMEA 5D3LA 5LKXA 4YYDA 5JWMA 4O7CA 5DLZA 5EP7A 5AMFA 3U5NA 4CUSA 5H1UA 4Q0OA 2DATA 4C66A 4ALGA 3LJWA 3SVGA 4BW2A 4IR3A 5EK9A 2DWWA 5HM0A 4MENA 4J3IA 3LQIA 2D9EA 5DFDA 4QEWA 3TLPA 2DKWA 3O37A 5CZGA 2G4AA 3MQMA 5G4SA 5CUGA 5FBXA 4Z1SA 1WUMA 5CFWA 3MB3A 4O74A 3O36A 4LC2A 4ZQLA 4UIZA 4NRAA 3JVJA 5KTXA 4HXSA 5DLXA 3ZYUA 5FE5A 5CPEA 5CQ7A 5CQAA 5A5QA 4QYDA 5EPSA 5HQ7A 4YYJA 5F3AA 4YBTA 2YEMA 3P1CA 4O75A 2F6NA 2OSSA 4MEPA 2L85A 5F25A 5KHMA 4CL9A 3P5OA 5EGUA 5A5RA 1EQFA 3RCWA 5CGPA 5FG6A 5FFVA 5IIDA 4TZ8A 4IR4A 4BW4A 5C85A 4YABA 5IG6A 3MUKA 5C89A 5ENGA 3AQAA 4TQNA 5CQ3A 5C8GA 5HQ6A 3JVMA 4HXPA 3I3JA 3O34A 4LRGA 5C4QA 5DFCA 4XY8A 2RNYA 3IU6A 5CQ6A 5ENEA 5HRXA 4NQNA 4HBXA 5KTWA 5CTLA 4PY6A 5LJ2A 4LYSA 5DYXA 3SVHA 2YEKA 4KV4A 5D3JA 4Z6IA 4MR4A 2GRCA 2DVRA 4HXNA 5TCMA 2RNXA 4TS8A 3Q2FA 5L99A 5CRZA 4XYAA 3UV2A 4XUAA 5IGMA 4YYNA 5HELA 5FFYA 4GPJA 5H85A 1WUGA 5ETDA 4YYHA 4QEUA 5L96A 5EICA 4N4HA 4TT2A 5D3HA 3JVKA 5KU3A 5J0DA 4QR3A 5CS8A 5DKCA 4HBVA 5F36A 4A9IA 5LUUA 5H1TA 5D3PA 4NS5A 4UYGA 2R0SA 4UIWA 4O71A 5BT3A 5I83A 5A82A 5DFBA 2RO1A 3UV4A 2I7KA 4QSSA 5G4RA 5I7YA 3IU5A 4Q0NA 4QB3A 4CUUA 4PS5A 4IOQA 4QSXA 4DONA 4A9KA 5ENIA 5LVQA 5ETBA 5E9YA 3MB4A 4QSPA 4NR9A 5EPBA 4UYFA 4YADA 4OGIA 5FE1A 4NYWA 5A5PA 4X2IA 4A9JA 5I1QA 1JM4B 5FH6A 4OUFA 5L8TA 5IBNA 3AADA 4UYHA 2R0VA 5HENA 1F68A 3NXBA 4UIXA 4QSTA 5A85A 4PTBA 4YYKA 5A5OA 4YAXA 4MEOA 5FE4A 3S92A 5DBMA 4BW1A 2N9GA 3HMEA 5D7XA 1N72A 4QSVA 5FE0A 5D3TA 4HXRA 4QUUA 3O35A 2R0YA 5E7DA 5ENCA 4TYLA 5I88A 5COIA 3HMFA 2WP2A 3QZSA 5ENFA 4TU4A 4QZSA 4CFLA 4YBMA 4WIVA 5I86A 5FH8A 4UITA 4F3IA 5E73A 5LVRA 2RS9B 5HFQA 5DYAA 5CY9A 4KCXA 4QYLA 5CQ5A 5F1LA 2E7NA 4MEQA 4QSWA 3JVLA 4CFKA 2I8NA 4NR5A 2RNWA 4BW3A 4QY4A 5K29A 5I29A 2DVQA 4NR8A 5HCLA 4NYVA 2RFJA 4A9HA 5A7CA 3HMHA 4MR3A 1JSPB 2YELA 3G0JA 2LSPB 3UVWA 4UYEA 5C7NA 5LJ1A 4Z6HA 5CUBA 4NRCA 3UVYA 4CUTA 5D3SA 5E9IA 4O78A 5I80A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UW9 A;  5I7X A;  5FE9 A;  4QUT A;  4UIY A;  3LQH A;  4KV1 A;  4O77 A;  5LKT A;  5EWC A;  4TU6 A;  5DY7 A;  2L5E A;  5F62 A;  2YW5 A;  5DW2 A;  5CRM A;  4O7F A;  4TT6 A;  2OO1 A;  5CP5 A;  5HFR A;  4NYX A;  4A9N A;  4PKL A;  4QNS A;  5L97 A;  4TZ2 A;  5HQ5 A;  5EI4 A;  4PCI A;  3UVX A;  3DWY A;  3QZV A;  5EVA A;  5E9V A;  4NQM A;  5FG5 A;  5FDZ A;  4IOO A;  5HRV A;  2E7O A;  4O76 A;  4ZW1 A;  4CUQ A;  4HXK A;  5EV9 A;  4Y03 A;  4O70 A;  4N4F A;  5BT4 A;  5E74 A;  4WHU A;  5D24 A;  3D7C A;  4AKN A;  4RVR A;  2YDW A;  5CQT A;  4J0S A;  5E9M A;  4QSU A;  5L8U A;  4NXJ A;  4YC9 A;  5EQ1 A;  3P1F A;  4LR6 A;  4HBY A;  4LDF A;  4IOR A;  4Z93 A;  1ZS5 A;  5DYU A;  5C87 A;  5ENH A;  2D82 A;  5HEM A;  4O7B A;  4UIU A;  5EU1 A;  4XY9 A;  4QC1 A;  2RI7 A;  3MUL A;  4O7A A;  4TTE A;  3U5O A;  5EWW A;  5I40 A;  4YH3 A;  5CQ4 A;  5CU8 A;  5HRW A;  4YBS A;  4YYI A;  5IGN A;  4A9L A;  2FSA A;  4NUC A;  3O33 A;  2OUO A;  4HXM A;  4UYF B;  3S91 A;  4YY4 A;  3UVD A;  5F1H A;  5A81 A;  4C67 A;  5FB0 A;  4N4G A;  5E9K A;  3SVF A;  4QR4 A;  5LJ0 A;  5HLS A;  5IGK A;  3U5J A;  5E3D A;  3G0L A;  5FE7 A;  4J1P A;  3ONI A;  4YH4 A;  5AD3 A;  5F5Z A;  4NR7 A;  2MJV B;  4NUD A;  5ENJ A;  2L84 A;  4MR6 A;  4NR4 A;  5DX4 A;  5KTU A;  4O7E A;  5EPR A;  4UIV A;  3U5L A;  5LKU A;  4HXL A;  4QSR A;  3U5P A;  4NUE A;  3MXF A;  2DVV A;  3UV5 A;  5F2P A;  5D3R A;  5LKZ A;  5FG4 A;  4LZ2 A;  5EWD A;  4BHW A;  5E9L A;  4QSQ A;  2R10 A;  2YYN A;  4CUR A;  5EWV A;  4A9M A;  3Q2E A;  4A9E A;  5EWH A;  4LYI A;  5ENB A;  5CUE A;  4IR6 A;  5CUD A;  5DYC A;  4BJX A;  5AD2 A;  5DKD A;  5JI8 A;  1X0J A;  4ALH A;  4YYM A;  2NXB A;  4E96 A;  5D3N A;  2F6J A;  3LXJ A;  4PCE A;  2KTB B;  2YQD A;  4OGJ A;  4HXO A;  5FE2 A;  4QC3 A;  2H60 A;  4MR5 A;  3K2J A;  5CUC A;  5E0R A;  5II1 A;  3P1D A;  3FKM X;  4LYW A;  5FE6 A;  5TB6 A;  3LQJ A;  3DAI A;  4NR6 A;  4YK0 A;  5H1V A;  5I89 A;  5ACY A;  4YYG A;  4A9O A;  3U5M A;  2E3K A;  2DVS A;  4UYD A;  4QEV A;  5BT5 A;  5F63 A;  4O72 A;  4IR5 A;  5DW1 A;  5FFW A;  3U5K A;  4TT4 A;  4QBM A;  4CLB A;  4J0R A;  5II2 A;  4CUP A;  5FE3 A;  5A83 A;  5IGL A;  1E6I A;  5A5S A;  5KO4 A;  5D0C A;  3QZT A;  4Z1Q A;  5FH7 A;  4LZR A;  4XUB A;  5A5N A;  4FLP A;  4ZC9 A;  2WP1 A;  5FE8 A;  5FB1 A;  3P1E A;  4HBW A;  5EA1 A;  5DKH A;  5D26 A;  4N4I A;  4WHW A;  5E3G A;  5EIS A;  5F61 A;  5D25 A;  5F60 A;  3GG3 A;  4LZS A;  5L98 A;  5HJC A;  4N3W A;  4A9F A;  5EM3 A;  4YAT A;  4YY6 A;  4NRB A;  5CQ8 A;  4QR5 A;  5CUA A;  5AME A;  5D3L A;  5LKX A;  4YYD A;  5JWM A;  4O7C A;  5DLZ A;  5EP7 A;  5AMF A;  3U5N A;  4CUS A;  5H1U A;  4Q0O A;  2DAT A;  4C66 A;  4ALG A;  3LJW A;  3SVG A;  4BW2 A;  4IR3 A;  5EK9 A;  2DWW A;  5HM0 A;  4MEN A;  4J3I A;  3LQI A;  2D9E A;  5DFD A;  4QEW A;  3TLP A;  2DKW A;  3O37 A;  5CZG A;  2G4A A;  3MQM A;  5G4S A;  5CUG A;  5FBX A;  4Z1S A;  1WUM A;  5CFW A;  3MB3 A;  4O74 A;  3O36 A;  4LC2 A;  4ZQL A;  4UIZ A;  4NRA A;  3JVJ A;  5KTX A;  4HXS A;  5DLX A;  3ZYU A;  5FE5 A;  5CPE A;  5CQ7 A;  5CQA A;  5A5Q A;  4QYD A;  5EPS A;  5HQ7 A;  4YYJ A;  5F3A A;  4YBT A;  2YEM A;  3P1C A;  4O75 A;  2F6N A;  2OSS A;  4MEP A;  2L85 A;  5F25 A;  5KHM A;  4CL9 A;  3P5O A;  5EGU A;  5A5R A;  1EQF A;  3RCW A;  5CGP A;  5FG6 A;  5FFV A;  5IID A;  4TZ8 A;  4IR4 A;  4BW4 A;  5C85 A;  4YAB A;  5IG6 A;  3MUK A;  5C89 A;  5ENG A;  3AQA A;  4TQN A;  5CQ3 A;  5C8G A;  5HQ6 A;  3JVM A;  4HXP A;  3I3J A;  3O34 A;  4LRG A;  5C4Q A;  5DFC A;  4XY8 A;  2RNY A;  3IU6 A;  5CQ6 A;  5ENE A;  5HRX A;  4NQN A;  4HBX A;  5KTW A;  5CTL A;  4PY6 A;  5LJ2 A;  4LYS A;  5DYX A;  3SVH A;  2YEK A;  4KV4 A;  5D3J A;  4Z6I A;  4MR4 A;  2GRC A;  2DVR A;  4HXN A;  5TCM A;  2RNX A;  4TS8 A;  3Q2F A;  5L99 A;  5CRZ A;  4XYA A;  3UV2 A;  4XUA A;  5IGM A;  4YYN A;  5HEL A;  5FFY A;  4GPJ A;  5H85 A;  1WUG A;  5ETD A;  4YYH A;  4QEU A;  5L96 A;  5EIC A;  4N4H A;  4TT2 A;  5D3H A;  3JVK A;  5KU3 A;  5J0D A;  4QR3 A;  5CS8 A;  5DKC A;  4HBV A;  5F36 A;  4A9I A;  5LUU A;  5H1T A;  5D3P A;  4NS5 A;  4UYG A;  2R0S A;  4UIW A;  4O71 A;  5BT3 A;  5I83 A;  5A82 A;  5DFB A;  2RO1 A;  3UV4 A;  2I7K A;  4QSS A;  5G4R A;  5I7Y A;  3IU5 A;  4Q0N A;  4QB3 A;  4CUU A;  4PS5 A;  4IOQ A;  4QSX A;  4DON A;  4A9K A;  5ENI A;  5LVQ A;  5ETB A;  5E9Y A;  3MB4 A;  4QSP A;  4NR9 A;  5EPB A;  4UYF A;  4YAD A;  4OGI A;  5FE1 A;  4NYW A;  5A5P A;  4X2I A;  4A9J A;  5I1Q A;  1JM4 B;  5FH6 A;  4OUF A;  5L8T A;  5IBN A;  3AAD A;  4UYH A;  2R0V A;  5HEN A;  1F68 A;  3NXB A;  4UIX A;  4QST A;  5A85 A;  4PTB A;  4YYK A;  5A5O A;  4YAX A;  4MEO A;  5FE4 A;  3S92 A;  5DBM A;  4BW1 A;  2N9G A;  3HME A;  5D7X A;  1N72 A;  4QSV A;  5FE0 A;  5D3T A;  4HXR A;  4QUU A;  3O35 A;  2R0Y A;  5E7D A;  5ENC A;  4TYL A;  5I88 A;  5COI A;  3HMF A;  2WP2 A;  3QZS A;  5ENF A;  4TU4 A;  4QZS A;  4CFL A;  4YBM A;  4WIV A;  5I86 A;  5FH8 A;  4UIT A;  4F3I A;  5E73 A;  5LVR A;  2RS9 B;  5HFQ A;  5DYA A;  5CY9 A;  4KCX A;  4QYL A;  5CQ5 A;  5F1L A;  2E7N A;  4MEQ A;  4QSW A;  3JVL A;  4CFK A;  2I8N A;  4NR5 A;  2RNW A;  4BW3 A;  4QY4 A;  5K29 A;  5I29 A;  2DVQ A;  4NR8 A;  5HCL A;  4NYV A;  2RFJ A;  4A9H A;  5A7C A;  3HMH A;  4MR3 A;  1JSP B;  2YEL A;  3G0J A;  2LSP B;  3UVW A;  4UYE A;  5C7N A;  5LJ1 A;  4Z6H A;  5CUB A;  4NRC A;  3UVY A;  4CUT A;  5D3S A;  5E9I A;  4O78 A;  5I80 A; 
#chains in the Genus database with same CATH topology
 3UW9 A;  5I7X A;  5FE9 A;  4QUT A;  4UIY A;  3LQH A;  4KV1 A;  4O77 A;  5LKT A;  5EWC A;  4TU6 A;  3D1B A;  5DY7 A;  2L5E A;  5F62 A;  2YW5 A;  5DW2 A;  5CRM A;  4O7F A;  4TT6 A;  2OO1 A;  5CP5 A;  5HFR A;  4NYX A;  4A9N A;  4PKL A;  4QNS A;  5L97 A;  4TZ2 A;  5HQ5 A;  5EI4 A;  4PCI A;  3UVX A;  3DWY A;  3QZV A;  5EVA A;  5E9V A;  4NQM A;  5FG5 A;  5FDZ A;  4IOO A;  5HRV A;  2E7O A;  4O76 A;  4ZW1 A;  4CUQ A;  4HXK A;  5EV9 A;  4Y03 A;  4O70 A;  4N4F A;  5BT4 A;  5E74 A;  4WHU A;  5D24 A;  3D7C A;  4AKN A;  4RVR A;  2YDW A;  5CQT A;  4J0S A;  5E9M A;  4QSU A;  5L8U A;  4NXJ A;  4YC9 A;  5EQ1 A;  1ZKR A;  3P1F A;  4LR6 A;  4HBY A;  4LDF A;  4IOR A;  4Z93 A;  1ZS5 A;  5DYU A;  5C87 A;  5ENH A;  2D82 A;  5HEM A;  4O7B A;  4UIU A;  5EU1 A;  4XY9 A;  4AI6 A;  4QC1 A;  2RI7 A;  3MUL A;  4O7A A;  4TTE A;  3U5O A;  5EWW A;  5I40 A;  4YH3 A;  5CQ4 A;  5CU8 A;  5HRW A;  4YBS A;  4YYI A;  5IGN A;  4A9L A;  2FSA A;  4NUC A;  3O33 A;  2OUO A;  4HXM A;  4UYF B;  3S91 A;  4YY4 A;  3UVD A;  5F1H A;  5A81 A;  4C67 A;  5FB0 A;  4N4G A;  5E9K A;  3SVF A;  4QR4 A;  5LJ0 A;  5HLS A;  5IGK A;  3U5J A;  5E3D A;  3G0L A;  5FE7 A;  4J1P A;  3ONI A;  4YH4 A;  5AD3 A;  5F5Z A;  4NR7 A;  2MJV B;  4NUD A;  5ENJ A;  2L84 A;  4MR6 A;  4AKH A;  4NR4 A;  5DX4 A;  5KTU A;  4O7E A;  5EPR A;  4UIV A;  3U5L A;  5LKU A;  4HXL A;  4QSR A;  3U5P A;  4NUE A;  3MXF A;  2DVV A;  3UV5 A;  5F2P A;  5D3R A;  5LKZ A;  5FG4 A;  4LZ2 A;  5EWD A;  4BHW A;  5E9L A;  4QSQ A;  2R10 A;  2YYN A;  4CUR A;  5EWV A;  1PUO A;  4A9M A;  3Q2E A;  4A9E A;  5EWH A;  4LYI A;  5ENB A;  5CUE A;  4IR6 A;  5CUD A;  5DYC A;  4BJX A;  5AD2 A;  5DKD A;  5JI8 A;  1X0J A;  4ALH A;  4YYM A;  2NXB A;  4E96 A;  5D3N A;  2F6J A;  3LXJ A;  4PCE A;  2KTB B;  2YQD A;  4OGJ A;  4HXO A;  5FE2 A;  4QC3 A;  2H60 A;  4MR5 A;  3K2J A;  5CUC A;  5E0R A;  5II1 A;  3P1D A;  3FKM X;  4LYW A;  5FE6 A;  5TB6 A;  3LQJ A;  3DAI A;  4NR6 A;  4YK0 A;  5H1V A;  5I89 A;  5ACY A;  4YYG A;  4A9O A;  3U5M A;  2E3K A;  2DVS A;  4UYD A;  4QEV A;  5BT5 A;  5F63 A;  4O72 A;  4IR5 A;  5DW1 A;  5FFW A;  3U5K A;  4TT4 A;  4QBM A;  4CLB A;  4J0R A;  5II2 A;  4CUP A;  5FE3 A;  5A83 A;  5IGL A;  1E6I A;  5A5S A;  5KO4 A;  5D0C A;  3QZT A;  4Z1Q A;  4AKI A;  5FH7 A;  4LZR A;  4XUB A;  5A5N A;  4FLP A;  4ZC9 A;  2WP1 A;  5FE8 A;  5FB1 A;  3P1E A;  4HBW A;  5EA1 A;  5DKH A;  5D26 A;  4N4I A;  4WHW A;  5E3G A;  5EIS A;  5F61 A;  5D25 A;  5F60 A;  3GG3 A;  4LZS A;  5L98 A;  5HJC A;  4N3W A;  4A9F A;  5EM3 A;  4YAT A;  4YY6 A;  4NRB A;  5CQ8 A;  4QR5 A;  5CUA A;  5AME A;  5D3L A;  5LKX A;  4YYD A;  5JWM A;  4O7C A;  5DLZ A;  5EP7 A;  5AMF A;  3U5N A;  4CUS A;  5H1U A;  4Q0O A;  2DAT A;  4C66 A;  4ALG A;  3LJW A;  3SVG A;  4BW2 A;  4IR3 A;  5EK9 A;  2DWW A;  5HM0 A;  4MEN A;  4J3I A;  3LQI A;  2D9E A;  5DFD A;  4QEW A;  3TLP A;  2DKW A;  3O37 A;  5CZG A;  2G4A A;  3MQM A;  5G4S A;  5CUG A;  5FBX A;  4Z1S A;  1WUM A;  5CFW A;  3MB3 A;  4O74 A;  3O36 A;  4LC2 A;  4ZQL A;  4UIZ A;  4NRA A;  3JVJ A;  5KTX A;  4HXS A;  5DLX A;  3ZYU A;  5FE5 A;  5CPE A;  5CQ7 A;  5CQA A;  5A5Q A;  4QYD A;  5EPS A;  5HQ7 A;  4YYJ A;  5F3A A;  4YBT A;  2YEM A;  3P1C A;  4O75 A;  2F6N A;  2OSS A;  4MEP A;  2L85 A;  5F25 A;  5KHM A;  4CL9 A;  3P5O A;  5EGU A;  5A5R A;  3ERR A;  1EQF A;  3RCW A;  5CGP A;  5FG6 A;  5FFV A;  5IID A;  4TZ8 A;  4IR4 A;  4BW4 A;  3D1D A;  5C85 A;  4YAB A;  5IG6 A;  3MUK A;  5C89 A;  5ENG A;  3AQA A;  4TQN A;  5CQ3 A;  5C8G A;  5HQ6 A;  3JVM A;  4HXP A;  3I3J A;  3O34 A;  4LRG A;  5C4Q A;  5DFC A;  4XY8 A;  2RNY A;  3IU6 A;  5CQ6 A;  5ENE A;  5HRX A;  3VKG A;  4NQN A;  4HBX A;  5KTW A;  5CTL A;  4PY6 A;  5LJ2 A;  4LYS A;  5DYX A;  3SVH A;  2YEK A;  4KV4 A;  5D3J A;  4Z6I A;  4MR4 A;  2GRC A;  2DVR A;  4HXN A;  5TCM A;  2RNX A;  4TS8 A;  3Q2F A;  5L99 A;  5CRZ A;  4XYA A;  3UV2 A;  4XUA A;  5IGM A;  4YYN A;  5HEL A;  5FFY A;  4GPJ A;  5H85 A;  1WUG A;  5ETD A;  4YYH A;  4QEU A;  5L96 A;  5EIC A;  4N4H A;  4TT2 A;  5D3H A;  3JVK A;  5KU3 A;  3VKH A;  5J0D A;  4QR3 A;  5CS8 A;  5DKC A;  4HBV A;  5F36 A;  4A9I A;  5LUU A;  5H1T A;  5D3P A;  4NS5 A;  4UYG A;  2R0S A;  4UIW A;  4O71 A;  5BT3 A;  5I83 A;  5A82 A;  5DFB A;  2RO1 A;  3UV4 A;  2I7K A;  4QSS A;  5G4R A;  5I7Y A;  3IU5 A;  4Q0N A;  4QB3 A;  4CUU A;  4PS5 A;  4IOQ A;  4QSX A;  4DON A;  4A9K A;  5ENI A;  5LVQ A;  5ETB A;  5E9Y A;  3MB4 A;  4QSP A;  4NR9 A;  5EPB A;  4UYF A;  4YAD A;  4OGI A;  5FE1 A;  4NYW A;  5A5P A;  4X2I A;  4A9J A;  5I1Q A;  1JM4 B;  5FH6 A;  4OUF A;  5L8T A;  5IBN A;  3AAD A;  4UYH A;  2R0V A;  5HEN A;  1F68 A;  3NXB A;  4UIX A;  4QST A;  5A85 A;  4PTB A;  4YYK A;  5A5O A;  4YAX A;  4MEO A;  5FE4 A;  3S92 A;  5DBM A;  4BW1 A;  2N9G A;  3HME A;  5D7X A;  1N72 A;  4QSV A;  5FE0 A;  5D3T A;  4HXR A;  4QUU A;  3O35 A;  2R0Y A;  5E7D A;  5ENC A;  4TYL A;  5I88 A;  5COI A;  3HMF A;  2WP2 A;  3QZS A;  5ENF A;  4TU4 A;  4QZS A;  4CFL A;  4AKG A;  4YBM A;  4WIV A;  5I86 A;  2EJN A;  5FH8 A;  4UIT A;  4F3I A;  5E73 A;  5LVR A;  2RS9 B;  5HFQ A;  5DYA A;  5CY9 A;  4KCX A;  4QYL A;  5CQ5 A;  5F1L A;  2E7N A;  4MEQ A;  4QSW A;  3JVL A;  4CFK A;  2I8N A;  4NR5 A;  2RNW A;  4BW3 A;  4QY4 A;  5K29 A;  5I29 A;  2DVQ A;  4NR8 A;  5HCL A;  4NYV A;  2RFJ A;  4A9H A;  5A7C A;  3HMH A;  4MR3 A;  1JSP B;  2YEL A;  3G0J A;  2LSP B;  3UVW A;  4UYE A;  5C7N A;  5LJ1 A;  4Z6H A;  5CUB A;  4NRC A;  3UVY A;  4CUT A;  5D3S A;  5E9I A;  4O78 A;  5I80 A; 
#chains in the Genus database with same CATH homology
 3UW9 A;  5I7X A;  5FE9 A;  4QUT A;  4UIY A;  3LQH A;  4KV1 A;  4O77 A;  5LKT A;  5EWC A;  4TU6 A;  5DY7 A;  2L5E A;  5F62 A;  2YW5 A;  5DW2 A;  5CRM A;  4O7F A;  4TT6 A;  2OO1 A;  5CP5 A;  5HFR A;  4NYX A;  4A9N A;  4PKL A;  4QNS A;  5L97 A;  4TZ2 A;  5HQ5 A;  5EI4 A;  4PCI A;  3UVX A;  3DWY A;  3QZV A;  5EVA A;  5E9V A;  4NQM A;  5FG5 A;  5FDZ A;  4IOO A;  5HRV A;  2E7O A;  4O76 A;  4ZW1 A;  4CUQ A;  4HXK A;  5EV9 A;  4Y03 A;  4O70 A;  4N4F A;  5BT4 A;  5E74 A;  4WHU A;  5D24 A;  3D7C A;  4AKN A;  4RVR A;  2YDW A;  5CQT A;  4J0S A;  5E9M A;  4QSU A;  5L8U A;  4NXJ A;  4YC9 A;  5EQ1 A;  3P1F A;  4LR6 A;  4HBY A;  4LDF A;  4IOR A;  4Z93 A;  1ZS5 A;  5DYU A;  5C87 A;  5ENH A;  2D82 A;  5HEM A;  4O7B A;  4UIU A;  5EU1 A;  4XY9 A;  4QC1 A;  2RI7 A;  3MUL A;  4O7A A;  4TTE A;  3U5O A;  5EWW A;  5I40 A;  4YH3 A;  5CQ4 A;  5CU8 A;  5HRW A;  4YBS A;  4YYI A;  5IGN A;  4A9L A;  2FSA A;  4NUC A;  3O33 A;  2OUO A;  4HXM A;  4UYF B;  3S91 A;  4YY4 A;  3UVD A;  5F1H A;  5A81 A;  4C67 A;  5FB0 A;  4N4G A;  5E9K A;  3SVF A;  4QR4 A;  5LJ0 A;  5HLS A;  5IGK A;  3U5J A;  5E3D A;  3G0L A;  5FE7 A;  4J1P A;  3ONI A;  4YH4 A;  5AD3 A;  5F5Z A;  4NR7 A;  2MJV B;  4NUD A;  5ENJ A;  2L84 A;  4MR6 A;  4NR4 A;  5DX4 A;  5KTU A;  4O7E A;  5EPR A;  4UIV A;  3U5L A;  5LKU A;  4HXL A;  4QSR A;  3U5P A;  4NUE A;  3MXF A;  2DVV A;  3UV5 A;  5F2P A;  5D3R A;  5LKZ A;  5FG4 A;  4LZ2 A;  5EWD A;  4BHW A;  5E9L A;  4QSQ A;  2R10 A;  2YYN A;  4CUR A;  5EWV A;  4A9M A;  3Q2E A;  4A9E A;  5EWH A;  4LYI A;  5ENB A;  5CUE A;  4IR6 A;  5CUD A;  5DYC A;  4BJX A;  5AD2 A;  5DKD A;  5JI8 A;  1X0J A;  4ALH A;  4YYM A;  2NXB A;  4E96 A;  5D3N A;  2F6J A;  3LXJ A;  4PCE A;  2KTB B;  2YQD A;  4OGJ A;  4HXO A;  5FE2 A;  4QC3 A;  2H60 A;  4MR5 A;  3K2J A;  5CUC A;  5E0R A;  5II1 A;  3P1D A;  3FKM X;  4LYW A;  5FE6 A;  5TB6 A;  3LQJ A;  3DAI A;  4NR6 A;  4YK0 A;  5H1V A;  5I89 A;  5ACY A;  4YYG A;  4A9O A;  3U5M A;  2E3K A;  2DVS A;  4UYD A;  4QEV A;  5BT5 A;  5F63 A;  4O72 A;  4IR5 A;  5DW1 A;  5FFW A;  3U5K A;  4TT4 A;  4QBM A;  4CLB A;  4J0R A;  5II2 A;  4CUP A;  5FE3 A;  5A83 A;  5IGL A;  1E6I A;  5A5S A;  5KO4 A;  5D0C A;  3QZT A;  4Z1Q A;  5FH7 A;  4LZR A;  4XUB A;  5A5N A;  4FLP A;  4ZC9 A;  2WP1 A;  5FE8 A;  5FB1 A;  3P1E A;  4HBW A;  5EA1 A;  5DKH A;  5D26 A;  4N4I A;  4WHW A;  5E3G A;  5EIS A;  5F61 A;  5D25 A;  5F60 A;  3GG3 A;  4LZS A;  5L98 A;  5HJC A;  4N3W A;  4A9F A;  5EM3 A;  4YAT A;  4YY6 A;  4NRB A;  5CQ8 A;  4QR5 A;  5CUA A;  5AME A;  5D3L A;  5LKX A;  4YYD A;  5JWM A;  4O7C A;  5DLZ A;  5EP7 A;  5AMF A;  3U5N A;  4CUS A;  5H1U A;  4Q0O A;  2DAT A;  4C66 A;  4ALG A;  3LJW A;  3SVG A;  4BW2 A;  4IR3 A;  5EK9 A;  2DWW A;  5HM0 A;  4MEN A;  4J3I A;  3LQI A;  2D9E A;  5DFD A;  4QEW A;  3TLP A;  2DKW A;  3O37 A;  5CZG A;  2G4A A;  3MQM A;  5G4S A;  5CUG A;  5FBX A;  4Z1S A;  1WUM A;  5CFW A;  3MB3 A;  4O74 A;  3O36 A;  4LC2 A;  4ZQL A;  4UIZ A;  4NRA A;  3JVJ A;  5KTX A;  4HXS A;  5DLX A;  3ZYU A;  5FE5 A;  5CPE A;  5CQ7 A;  5CQA A;  5A5Q A;  4QYD A;  5EPS A;  5HQ7 A;  4YYJ A;  5F3A A;  4YBT A;  2YEM A;  3P1C A;  4O75 A;  2F6N A;  2OSS A;  4MEP A;  2L85 A;  5F25 A;  5KHM A;  4CL9 A;  3P5O A;  5EGU A;  5A5R A;  1EQF A;  3RCW A;  5CGP A;  5FG6 A;  5FFV A;  5IID A;  4TZ8 A;  4IR4 A;  4BW4 A;  5C85 A;  4YAB A;  5IG6 A;  3MUK A;  5C89 A;  5ENG A;  3AQA A;  4TQN A;  5CQ3 A;  5C8G A;  5HQ6 A;  3JVM A;  4HXP A;  3I3J A;  3O34 A;  4LRG A;  5C4Q A;  5DFC A;  4XY8 A;  2RNY A;  3IU6 A;  5CQ6 A;  5ENE A;  5HRX A;  4NQN A;  4HBX A;  5KTW A;  5CTL A;  4PY6 A;  5LJ2 A;  4LYS A;  5DYX A;  3SVH A;  2YEK A;  4KV4 A;  5D3J A;  4Z6I A;  4MR4 A;  2GRC A;  2DVR A;  4HXN A;  5TCM A;  2RNX A;  4TS8 A;  3Q2F A;  5L99 A;  5CRZ A;  4XYA A;  3UV2 A;  4XUA A;  5IGM A;  4YYN A;  5HEL A;  5FFY A;  4GPJ A;  5H85 A;  1WUG A;  5ETD A;  4YYH A;  4QEU A;  5L96 A;  5EIC A;  4N4H A;  4TT2 A;  5D3H A;  3JVK A;  5KU3 A;  5J0D A;  4QR3 A;  5CS8 A;  5DKC A;  4HBV A;  5F36 A;  4A9I A;  5LUU A;  5H1T A;  5D3P A;  4NS5 A;  4UYG A;  2R0S A;  4UIW A;  4O71 A;  5BT3 A;  5I83 A;  5A82 A;  5DFB A;  2RO1 A;  3UV4 A;  2I7K A;  4QSS A;  5G4R A;  5I7Y A;  3IU5 A;  4Q0N A;  4QB3 A;  4CUU A;  4PS5 A;  4IOQ A;  4QSX A;  4DON A;  4A9K A;  5ENI A;  5LVQ A;  5ETB A;  5E9Y A;  3MB4 A;  4QSP A;  4NR9 A;  5EPB A;  4UYF A;  4YAD A;  4OGI A;  5FE1 A;  4NYW A;  5A5P A;  4X2I A;  4A9J A;  5I1Q A;  1JM4 B;  5FH6 A;  4OUF A;  5L8T A;  5IBN A;  3AAD A;  4UYH A;  2R0V A;  5HEN A;  1F68 A;  3NXB A;  4UIX A;  4QST A;  5A85 A;  4PTB A;  4YYK A;  5A5O A;  4YAX A;  4MEO A;  5FE4 A;  3S92 A;  5DBM A;  4BW1 A;  2N9G A;  3HME A;  5D7X A;  1N72 A;  4QSV A;  5FE0 A;  5D3T A;  4HXR A;  4QUU A;  3O35 A;  2R0Y A;  5E7D A;  5ENC A;  4TYL A;  5I88 A;  5COI A;  3HMF A;  2WP2 A;  3QZS A;  5ENF A;  4TU4 A;  4QZS A;  4CFL A;  4YBM A;  4WIV A;  5I86 A;  5FH8 A;  4UIT A;  4F3I A;  5E73 A;  5LVR A;  2RS9 B;  5HFQ A;  5DYA A;  5CY9 A;  4KCX A;  4QYL A;  5CQ5 A;  5F1L A;  2E7N A;  4MEQ A;  4QSW A;  3JVL A;  4CFK A;  2I8N A;  4NR5 A;  2RNW A;  4BW3 A;  4QY4 A;  5K29 A;  5I29 A;  2DVQ A;  4NR8 A;  5HCL A;  4NYV A;  2RFJ A;  4A9H A;  5A7C A;  3HMH A;  4MR3 A;  1JSP B;  2YEL A;  3G0J A;  2LSP B;  3UVW A;  4UYE A;  5C7N A;  5LJ1 A;  4Z6H A;  5CUB A;  4NRC A;  3UVY A;  4CUT A;  5D3S A;  5E9I A;  4O78 A;  5I80 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...