4UKDA

Ump/cmp kinase from slime mold complexed with adp, udp, beryllium fluoride
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
191
structure length
191
Chain Sequence
SKPNVVFVLGGPGSGKGTQCANIVRDFGWVHLSAGDLLRQEQQSGSKDGEMIATMIKNGEIVPSIVTVKLLKNAIDANQGKNFLVDGFPRNEENNNSWEENMKDFVDTKFVLFFDCPEEVMTQRLLKRGESSGRSDDNIESIKKRFNTFNVQTKLVIDHYNKFDKVKIIPANRDVNEVYNDVENLFKSMGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of active conformations of UMP kinase from Dictyostelium discoideum suggest phosphoryl transfer is associative.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Transferase
molecule keywords URIDYLMONOPHOSPHATE/CYTIDYLMONOPHOSPHATE KINASE
total genus 72
structure length 191
sequence length 191
ec nomenclature ec 2.7.4.14: UMP/CMP kinase.
pdb deposition date 1997-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00406 ADK Adenylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4ukdA00
4M8NE 3RYTC 2ONKA 5E7JA 1VCIA 5F9FA 3QBVA 4MGZR 1YVDA 3K0EA 3RANA 4LPKA 3SS8A 2CLCX 4HB4A 3RRNA 5AWFC 2XZLA 2VH5R 3VR6A 1TMKA 2J41A 1NMXA 2FA9A 1E79D 5AJWA 5FBWB 1OXXK 2VHTA 4MGKR 3R20A 3WHKA 2RHDA 4M1KA 1E6CA 1VYUA 4W5WA 5HCIA 1G4AE 2HLDD 3HYRA 3VX3A 1W5TA 1IY1A 1XPUA 3VNUA 2FE4A 1II0A 2BBSA 3NH6A 2QY9A 1ZINA 2C9YA 3TIFA 5SZIA 5J47A 4PAOA 5DN6A 5FUWA 2J0SA 1UBCA 2BBOA 1WCV1 2VRWA 4WW0A 3TSOA 4BLPA 2H8KA 1EFRD 1NVVQ 3OEED 4BLSA 3THYA 1FX0A 1UKEA 5JCPA 3J81k 2IF0A 2SHKA 3RWOA 4TLDA 1IOZA 3ZVMA 2ORWA 2OM2A 3OIUA 3PUYA 3N2EA 4ON9A 3C5HA 1XBTA 5AUQA 4YONB 4DBLC 2O8FA 2FWRA 2EWVA 2ZJ2A 2XGJA 4HAWA 1IJFA 3LDAA 5KSYA 3K0CC 2GRJA 3GLIA 1HUQA 3CBQA 4QM7A 4BFUA 1HEIA 1VYVA 4FCTA 4HLDA 1M8PA 1P7CA 3BJIC 4KYUA 2EFCB 3VTKA 1B0UA 1GUAA 5TB5A 2ZRDA 1ZUIA 3TR5A 2RGEA 1L2TA 4QM6A 1ZC3A 5EXXA 4RCYA 3TQFA 2Q3MA 3W3ZB 3IQXA 4Q00A 4N0EA 1N6PA 2WM9B 4HYYA 4V0OA 2ZTSA 4FCWA 1TL7C 4DDUA 2RGXA 3BOSA 2KJQA 2ZR7A 4HLCA 5FUYA 1FZQA 1N5LA 3I72A 2QQEA 3WY9A 2IS1A 1WA5A 4LJ6A 2DFLA 3GJ3A 1A1VA 1D8TA 4QGGA 1E2QA 1XZPA 1CJUC 1XB2A 3VKGA 1VKJA 4V0NA 4KFSA 1UEJA 2HXYA 1G41A 4LJ7A 1NN5A 4A92A 1X1SA 3AGPA 1XCGB 1AK2A 2FV8A 3RC3A 4QC2A 2VIIA 1NNEA 3UPUA 1ZRHA 5LD2B 2XXAA 3B1ZA 1P6XA 4TSFD 2Q21A 5TVKA 3GJ8A 1YU9A 1MV5A 3QJYA 2J87A 4P33A 1G3UA 4PSKA 2IYZA 1VPLA 1G3RA 1JBKA 3BGWA 3KKNA 1JAHA 5K8UA 3WNCA 2JJ1D 1AKEA 3X1YA 3ZQJA 2WPDD 4JLKA 1IN4A 3CRQA 3DVLA 2FZLA 2FSFA 3LA6A 1S3GA 4DLRA 2W0SA 1KZ7B 3R9XA 1V43A 2CK3D 2PH1A 1XP8A 1QVRA 3RRYA 2NOAA 1KSHA 3RSLA 1CRPA 2B8WA 1W0KD 1HY3A 3A1UA 2JASA 4YLGA 5F98A 4DLXA 3GLGA 2QP9X 5DI3A 2F1HA 2C95A 2IEZA 3NWJA 2R8RA 2QRNA 2OG2A 3CF2A 4KFRA 1NIJA 1BOFA 4LHYA 4JLPA 4NCNA 3AKEA 3JVUA 2O8EA 2BJWA 1JEEA 2ZE6A 1SXJA 2YWFA 3K09C 5G40A 1CRQA 1S3SA 2PX3A 4RD1A 4XTRA 2ZJAA 1CR1A 2G0NA 2GF9A 3U3OA 2O5VA 4LYHA 2WJJA 2CCJA 1U99A 1P75A 4XH9B 3P20A 1E9EA 3PCRB 4B47A 3VR2A 3B78A 2B7BA 1XTIA 1QHIA 1IM2A 1CR4A 1G21E 4PC6A 5KHOC 1W36C 1W4CA 5GJWC 4ARZB 5FTMA 2RGNC 4RSGA 1KI9A 4HSEA 2ZPTX 5AUNB 4QHTA 4JKYA 3RS7A 4IFBA 2V3CC 1SKYE 2V9PA 3KTAB 2F7SA 5EP1A 3H4MA 1YHNA 1FQKA 3SR0A 4A36A 3A4NA 3CPEA 1CF4A 1BIFA 4D4MA 5TMPA 2OCAA 3QPVA 4IVRA 4PANA 4TT3D 5CK5A 1YR7A 2FPKA 4WXRA 4CT5A 4YMVA 1UFQA 3BWDD 3S1AB 1N0WA 1P5ZB 2FGKA 2CVHA 2IYWA 4TMWA 4ZCLA 5KU1A 2OFXA 4QHSA 4TMTA 2QN6A 2CDNA 3KKQA 3AF3A 2ODWA 4MKIA 1MR3F 4NYIQ 1JPJA 4KBFA 5CB8A 3QBTA 4S35A 4URVR 2O8EB 4O3MA 4JVLA 2GZAA 1MOZA 2WPDA 3TMKA 2O8DB 1NP6A 3ZIAA 1MRNA 4PPNA 5JHHB 3AF4A 1UJ2A 4OHZA 2YV5A 1CJVC 1UADA 1Z83A 2W83A 5JI2E 1BMFA 1Q3TA 1HH4A 3LBNA 4LBZA 3K0FB 2QORA 4B43A 721PA 4LHWA 4LJ5A 2JGNA 2R44A 4PPFA 2VHQA 5FL7A 4DSTA 1E2JA 2IYRA 4JLDA 3PENA 2BM0A 4OL0A 2F9LA 3PEVA 4FWTA 1E9SA 3QKSA 5HKKA 5IK2D 3THYB 4TYYA 3F0TA 1P2VA 2WV9A 1BH2A 3L0PA 5G53C 3KQHA 4P4TA 2AK2A 4FMDF 3WYGA 3Q85A 4AYTA 1G4UR 4PC2A 1G3MA 4NBSA 5TV2A 1G7CA 2ZROA 5FTLA 1VG9B 4F7WA 5L8VA 1RIFA 1J99A 2GAOA 2ORVA 3QUSA 1GP2A 1KDTA 4NYMQ 1R8SA 1NLFA 4EPRA 1ZNYA 3G0HA 3LV8A 2ZI4A 4GZMA 3O8CA 1GNPA 5H1YA 5FTNA 2QMHA 4JVNA 5CJ2A 1GDDA 1W0JA 1R5OA 3I8XA 4HZUA 4AK9A 4BLTA 5CLQA 4KFUA 1GKYA 5AR1A 1DG1G 1NY6A 1K5DA 1E4YA 1P4SA 4DIEA 3SEAA 1RRFA 1KAGA 3R7WA 2DFKB 3EA5A 4R71A 4GL2A 1XEWY 5G3YA 2W2XA 2W2VA 5AJVB 4EAQA 2BC9A 4ESHA 1XTSA 2ZS8A 2R6CA 2QG6A 1YZUA 3TUZC 2JJ2A 3K9HA 2RH5A 1Z0DA 4MKGA 3T5DA 5CYPA 4KSBA 2YC4C 4L4UA 4UJ3A 2RAPA 3A36A 4LYFA 2JJ8A 2RGNA 4JBYA 1AN0A 4X8MA 3EIQA 3W8NA 4WIAA 3H0KA 4C0JA 5GVRA 1NG9A 1SKYB 2RMKA 5FOUA 1IXRC 4YXWD 4LBVA 1T3HA 1IBRA 2ZAOA 2Z5FA 2HDNB 1IJEA 2IYXA 2ASEA 2B8TA 2CHQA 4AKEA 4Q1BA 3L2OB 4DLWA 2IYYA 3U2QA 1A82A 2E9SA 3VU9A 3PUZA 1Q1QA 1FNNA 4IDPA 4URUR 5BW8A 4XWAA 1ZM3A 1GKIA 4A6XA 3K70B 4ZI2A 3AVXA 3K0AB 3KUDA 4FMDB 3AVWA 3QVVA 2Z83A 5DGXA 1Q57A 3T35A 4Q7MB 4C0LA 4US0R 2IWRA 4TSFA 1DEKA 4DB4A 3QPUA 1OFHA 2PLRA 1VCNA 3IIMA 1CJMA 3ZYCA 3MJHA 4QBHA 5AK0A 4DLZA 1NVVR 4MYCA 4UNQA 1EESA 3FPAA 1KI4A 2X1VA 5CJPA 4FIDA 3Q9LA 1OXSC 1DELA 4MYHA 4RD0A 2XB4A 2JLXA 3EASA 2O0HA 5TARA 4A0FA 4PC7A 4AG5A 2QT0A 5EE5B 4IVPA 2OE2A 3FMFA 3CX7A 5EZ5A 4NYMR 3K9LA 5AJZA 3UK6A 4QJ3A 5J4VA 1ZU5A 4OQLA 3NKVA 2K5UA 4G3XA 2BBTA 1OFTA 2JIZA 2NTYC 3X1WA 4PC3A 4CIDA 1LY1A 2JIZD 3DMDA 2QROA 1ZU4A 2OUKA 2V8OA 1KK2A 2ZSAA 2CBZA 3AUYA 2HF9A 1N6KA 2VSFA 5CDFE 1W46A 4N1AA 1GAJA 1DPFA 2YOFA 3ADKA 3CX6A 2WSSA 4PHGA 3FWYA 4G01B 4P31A 1VECA 3PQCA 4N3NA 5KNBA 2FEMA 4U7DA 3U3RA 5HZHA 4GI7A 1YR8A 1X8JA 2W2TA 2ZRKA 5B2ZA 3DM9B 121PA 2ERXA 4A0GA 2ZRIA 1GNRA 2VO1A 2X2FA 1IONA 1H8ED 2DHRA 1ONBA 3QXHA 3L8YA 4HEJA 1ZJ6A 1Z6YA 2ZI9A 1N6OA 2Q9CA 3IIJA 5FUXA 5L3QB 2DY1A 4NYIR 3QXXA 4OHVA 1GILA 1G7TA 2BIFA 1YRBA 1HYQA 5FPHA 1G8HA 3NC0C 2ZU6A 1Q3HA 1SVOA 1I2DA 3OZXA 4GFDA 1H65A 4Q1CA 3AP3A 4M1TA 5BXQC 1F2TA 1R5BA 2JLQA 2BMJA 3B82A 5J4KA 2J59A 3VX4A 2ZUBA 5C4GB 3TW4A 1E2NA 3IQWA 4EPVA 1MH1A 4PR0A 2QAJA 1FUKA 1KI3A 5DHAA 1OT3A 1F48A 4TMZA 3OAAD 1HQYE 4KV9A 4Q4AB 2R62A 2XJ9A 5L3RA 1KKLA 2H5EA 2ZUCA 3PG5A 4IW3B 1XMSA 1E2PA 2HJVA 1H8HA 3AH8A 5HE8A 1W4AA 1ZIPA 2NQ2C 1XTRA 4C0QC 1QRAA 4JSTA 1XXHE 4R2HA 3E70C 1FP7A 2PBRA 3GP8A 3OESA 1XMJA 4Q4LA 5KTYA 1OYWA 1ZCBA 1P2SA 2LWIA 4ITRC 2GCOA 4ZCMA 4ERNA 5UKDA 4AKIA 2EU8A 2ZJYA 4HB0A 4E22A 3QXJA 1G18A 1US8A 3B1XA 2JDID 3GLFB 2WIBA 2IS2A 1ZVQA 4KVGA 4EFNA 4D80A 1QDEA 4TMKA 3ADBA 4YC7A 3FHTA 3TKLA 1Z28A 1LS1A 4QOSA 4Q9KA 3C16C 3OFNA 5FOTA 2WWGA 1PLLA 3SJZA 1X6VA 3AP1A 3K1JA 1DADA 4B48A 4US2R 3TK1A 1R2QA 2ZRNA 1S1CA 4RFSB 5FUVA 1GITA 4LRWA 1RYHA 2GCOB 2IYVA 2J7PA 4MQBA 2FJUA 1BYUA 5FFMA 2ZS9A 1N5IA 4F4CA 3CO5A 4FMBB 3IEUA 1C1YA 1N6IA 3WP1B 5FPTA 3QKUA 2GEUA 4OHXA 4DSOA 4FXPA 3NTUA 1T3LA 2JLRA 2YZ2A 2VF7A 4OI0A 3U7GA 1U8YA 1RW4A 2P2LA 1HURA 2WMNB 4D4JA 2A78A 4QGAA 4D82A 1XXHB 2ZSFA 3D8BA 3EG5A 2NPFA 3KQUA 4QBGB 3DL0A 3ECCA 1U9IC 2FFQA 4RD4A 1E32A 2VEDA 1Z47A 221PA 2WICA 1K8RA 3SN6A 1G3QA 3GJ0A 2ZJ8A 2AD5A 3D31A 4A2PA 2ZI7A 4I1SA 4L5BA 1IN5A 1BMFD 4KLZA 5BQ5A 1OPXA 1RFLA 4AURA 3N70A 2WJHA 3HR7A 3I4LA 5JI3E 2BKUA 3OEHD 4ZV4A 1XEXA 4G5OA 3CX8A 2BMDA 3DO6A 4ZCIA 4K81B 5K8LA 2QPOA 4JBXA 4Q4AA 5JJLA 1RZ3A 1K6MA 4M1YA 4U00A 4A0HA 1C9KA 3HPQA 2VHCA 4KO8A 1Z6AA 4LZZA 3NHBA 3C41J 3OE7A 2ZR0A 1OIXA 1I4LD 2JLVA 4HB2A 3ZIAD 1A2KC 2XZOA 2ODEA 3EIHA 3KXKA 3ZGXA 1KSGA 2ZJOA 4B44A 1D2MA 1I4DD 4FW9A 3KQKA 3GEIA 1NN0A 1G8YA 4GOKA 3CIOA 1NBME 3B8HA 4PQYA 3U5ZB 1KTVA 3TSWA 1LTQA 2H57A 4NONA 1US8B 1OH6A 3GD7A 4HLQB 4DCTA 1GFIA 2CVFA 421PA 3QXCA 4MRRA 1S0UA 5L3SB 4MKHA 1DAHA 1KDPA 3BBPA 3BB4A 5FPKA 1MRSA 2ODNA 2EYQA 2PEZA 5CM8B 4TTPA 3REGA 3IO5A 5FI0B 4C0KA 4LI0A 1CU1A 1LF0A 5EP4A 5D3MB 4US1R 3ASZA 5ELXA 4BE7B 4XIGS 3ZS9A 3A1TA 4XD7A 4LGMA 1FTNA 1CULC 5JJIA 1TF7A 1FL9A 2DWOA 2C98A 2D06A 4A2QA 1Q44A 1W36B 2GJ8A 5FTJA 4PHTA 4DT1A 2N42A 3A1WA 3MCAA 1U0JA 2CE7A 3WMGA 1E0SA 1GRQA 1MABB 3DZ8A 4PC1A 4BRUA 2X8AA 1PV4A 2QA5A 3QSYA 5CM9C 3U4QB 2IX3A 1G5TA 2NO6A 3L0OA 4MGYR 1E1RA 3Q7QA 1E9RA 2ZAMA 2GJAA 1M6NA 4I81A 1UBEA 2YVUA 4H9GA 3K0CA 3OIVA 3HU1A 3TH5A 2D2EA 3DDCA 5SZJA 5FL7D 2ZE8A 3SYKA 3C8UA 4NTZA 4A9AA 2P6RA 1GL7A 2GK7A 3KL4A 3KJEA 1IN6A 1OXUA 1FPMA 1IQPA 2ZSBA 1JR3D 2HV8A 4Z8XA 3GFOA 4B3XA 2ZVQX 3Q72A 3QF4A 1KO5A 2YINC 4QKQA 2QBYB 1Y63A 2FPLA 1N6HA 3LW8A 5JS7A 4PPQA 2GHIA 2I1QA 1G7SA 2OXRA 1DO2A 1Q0UA 1SVIA 2BEKA 3MRSA 2OCYC 5HE9A 1Z07A 2EVWX 1TX4B 1HE8B 4B73A 1QVAA 3KXLA 2GBLA 2CHGA 1W36D 1TEVA 3KB2A 4RZ2A 1D2EA 2CJWA 1E99A 1ZD1A 3F3YA 2IHBA 1NVWQ 4P4SA 5DYGA 2VP6A 2GF0A 2GTPA 2YKGA 2G3YA 1BYIA 2XNSA 4O2LA 3NHAA 1XD2B 3BRWD 4GSYA 5KO2A 1F3OA 3AVOA 5E7IA 2H1LA 3TW8B 2QBYA 3U4QA 2PT5A 4BFVA 5KSZA 3V4FA 2BCJQ 4HB3A 3MLEA 4HUQA 4MRPA 2Q9AA 3G5UA 4UNPA 1A2BA 3L8ZA 4LV6A 5FH9A 1YQTA 4JLBA 3ZZUA 1EGAA 1NJGA 4AYXA 2ODBA 4LHVA 2KBFA 1GVNB 1COWA 5JWRA 4ASUA 1OH8A 4EJSB 2KSQA 1OYYA 4W9MC 2O8CA 1RYFA 4CT4B 4MDEA 2ZSDA 4DEXA 1ZC4A 3KKPA 1L8QA 2ZUDA 2D3WA 2IXGA 4EJSC 4MITA 4JSYA 2OO7A 1JPNA 2VHUA 1IY2A 1G20E 1WF3A 3TVTA 1UBGA 4LJ4A 4NYJQ 3GMTA 1G1MA 1KI7A 1E94E 4FINA 4M9QA 4Q4JB 3UATA 4CGZA 2XSZD 1TQ2A 2IXEA 3LFUA 1ZCAA 4PSVA 3QVUA 4OI2A 4YDSA 2HEIA 1XPOA 4M53A 4K46A 1RPZA 1ODFA 3DEFA 1NRJB 3QG1A 1G6OA 5G41A 2FSGA 1AIPA 2REBA 1QHGA 4MUAA 5DN6D 5FOVA 3K9NA 2O8FB 3RLFA 4GPTA 4DC9A 3RS4A 2V4ZA 4HAZA 3GLIB 3FOZA 4A0RA 1L4YA 3OIWA 4B3GA 1QF9A 3IDQA 4WZAE 1NG1A 3U3MA 2XOKD 1T91A 2QL6A 4L9WA 1KI2A 3KKMA 3FMIA 2B92A 2IL1A 2ZRAA 2QPTA 1KI6A 3AKCA 1G5PA 1Q22A 3AGQA 4B6FA 3ADCA 2ZR9A 1HT1E 4S2EA 4WAUA 5CK4A 2BM1A 3M1IA 3A4LA 4KVAA 5FL3A 4F93B 1G19A 2AXNA 3CR7A 2GZDA 1X8LA 5DO9A 2WHXA 3DM5A 3FYHA 1SVLA 2DCUA 4IOLA 1Z0JA 3EWSA 1WBDA 3I8SA 1XRJA 2ZE7A 3W6NA 4B2LA 1U8ZA 3LVRE 4IOMA 2JEOA 5SZHB 2O0JA 2O8CB 4A1FA 4JLVA 1CBUA 3SQXA 4XVRA 1GL6A 5FBVB 2GKSA 4JLJA 1JB1A 4Q1DA 5H70A 2GA8A 5TDHA 1VTKA 3VMFA 4IDNA 3TSZA 2O52A 4OQFA 2GWHA 2A2ZA 1W47A 4TYPA 1WXQA 1ZW6A 1DOAA 4LJ9A 4C0HA 3Q7PA 4WA7A 3UWKA 3WNDA 4CW7A 4TQ9A 4II7A 3IIKA 1R7RA 3QEJA 3SQWA 4V0KA 4CRWB 3NC1C 4WVFA 3EPHA 2OBMA 4V0LA 4DCUA 1AGPA 1T5LA 5HPYB 4IVQA 3RNLA 1LB1B 1YKSA 4PO8A 1UF9A 3FHCB 3KZ1E 4E5UA 1KSJA 3RSOA 4EDHA 4GP7A 4B76A 3EZ7A 3FE2A 1E1QD 1T5IA 3IPYA 3MJRA 2IT1A 4B3CA 1TU3A 2HT6A 1IXSB 4M1SA 2EFDB 5DYIA 3QENA 1EG7A 3KFXA 2QP4A 2P3SA 3AUXA 2ANCA 4NZYA 4MH0R 2GAAA 1CJKC 3X2SA 3QPWA 4KU4A 2CJWB 2FSHA 1CEEA 1J8YF 3CRRA 1ZD8A 2D2FA 4QXAA 3THXA 8OHMA 5JJKA 2EFGA 1DVRA 1QHYA 2WJIA 1KIMA 3E2IA 4Z51A 1L4UA 2JLZA 4XWOA 3CF0A 2WBLC 4Q7KA 3W8RA 3TE6A 3WBJA 2EQBA 4UNRA 2QE7A 4JJZA 3I3SR 2E87A 4XSGA 5DE3A 1P2TA 2XSZA 1E3MA 2V1UA 3THWA 3W6OA 4Q01A 3S1AA 1KJYA 4HDOB 4IEIA 3U6BA 4CDGA 1OB2A 3KX2A 1KGDA 3UG7A 3ZZTA 3EA0A 4XJXA 5JRJA 4JL8A 4URYR 2Q0HA 5JLJA 1MKYA 3VR5A 3Q5EA 4M9SA 3AM1A 1XPRA 4JL6A 3ZVRA 2QGZA 2A30A 1MT0A 4C3ZA 4KITB 3AVVA 1DAMA 3A4MA 3NDBB 3NBXX 4UJ5A 3LXXA 5CLLA 3AB3A 1KY2A 1XZQA 4KXFB 3FKSD 4TYQA 1G3IA 1JNYA 5FBRB 4MYTA 2JLYA 2IUSA 3R8CA 4D4KA 1P60A 2MSCB 2R6FA 1ZUHA 3N5CA 3WP0A 4R9UC 2HCJB 2RHMA 1E4VA 2J45A 1U94A 5B58C 4C0BA 2ZM5A 4JLOA 2JJ1A 2GXUA 2PCJA 4ZPXA 4P4UA 2ZRLA 4NKRA 3VQTA 3AQ4A 4EQ6A 3EZ9A 5HKKD 5JFGA 3EZFA 1AJEA 4ZKEA 3I92A 5GVSA 2JATA 2ZI3A 3T61A 1IY0A 4WXPA 1E0KA 4B32A 2NPIA 1P9WA 4M9XA 3BFXA 2ZANA 2BOVA 4PQFA 1UKYA 3GJ6A 2FU5C 2IUUA 3W5JA 1GWNA 2RGAA 3CR8A 4A2WA 2CCGA 1DO0A 2WAYA 2W0MA 4AWXA 1C4OA 4IDOA 4B6EA 4B3FX 4TMXA 4XVUA 4F38A 3BXZA 4HDQB 4NYJR 4QL3A 1S9DA 4BZQA 1N5JA 2XJ4A 2ZRGA 2V1XA 4D25A 5IDVA 4LV5B 3SBEA 4TL9A 4HATA 3B9QA 2ZRFA 3I32A 5JHGB 3VAAA 3IGFA 1D9ZA 1DBSA 1Z6TA 1XTKA 1XFAA 4O2RA 2HT1A 4L8GA 1PJRA 1TEXA 2UZ3A 3IHWA 3AEZA 3BC1A 4W5HA 2XB2A 1RVDA 5E95A 1JEDA 4C0SA 3GLGB 4JT2A 2RGBA 2EW1A 2W6JD 4JYBA 3ZZ0A 1AS3A 2GCNA 4LX0A 1R0YA 4OQNA 4URZR 2D74A 2IW3A 5TXGA 2ZRPA 1TAGA 2RB4A 4JYCA 1PUIA 1EFRA 3GLGE 3U7FB 2XITA 2A3RA 3W5IA 1S9HA 4F92B 3DKPA 3NEJA 1QHHA 2DPXA 3QF4B 3PEWA 4KODA 1W4BA 4X8HA 1HQCA 3LBIA 2F1IA 1S4QA 2LCFA 2WKRA 4PZZA 1O87A 2QRZA 2VYFA 3ZLJA 2N46A 3RVBA 4R98A 4RD3A 2WMOB 3BK7A 4IXNA 4AI6A 4GT1A 2CK3A 5EE0A 2ZIAA 1HT2E 3CWZA 2VPPA 1FOEB 4F4JA 2OESA 4RD6A 1U81A 3NEYA 4DZZA 1MO6A 1N6LA 4G1UC 1R6BX 3MWLA 1VG8A 4DUGA 3DZDA 3EPJA 1VCOA 1KK3A 2PCLA 4Y0AA 4DWJA 4HAXA 3BB3A 4DDTA 4OK3A 4Q03A 2R6AA 2AFIE 5AJXA 4KHZA 2OFWA 3PUWA 3P4YA 3LBHA 5DI9A 1RC8A 1B23P 2QSZA 4CEIB 4PZLA 1NMZA 1N3BA 2A5JA 2H16A 2AWOA 1T6NA 1ANKA 4BUJA 5AJYA 1VHLA 2CL0X 3DMNA 2N1BA 3EARA 4MA4A 1EWQA 1J2JA 3BE4A 3SYLA 2NO9A 1J8MF 3U6KA 2Q9BA 3MFYA 3EXAA 4G5RA 1NIPA 2MMGA 4H1VA 2BMFA 4UXIA 3IHLA 2DWPA 1Z22A 2AK3A 5L3VA 4FWIB 4PAQA 3B1WA 2GJ9A 5CDFA 1ZNZA 1Z5ZA 4LC0A 2AD1A 2FMXA 4KAXA 1FW6A 4FCVA 2JLSA 4C2UA 2A5GA 4LJAA 4LBWA 2CLSA 5KSOA 1F60A 1E9FA 3GQBA 3IILA 3THWB 1IAQA 1ELOA 2G0TA 3JZAA 1JQJC 4DRZA 2ZITA 3KFVA 2G77B 2IHYA 5G3ZA 1HA3A 2QP3A 3H86A 4J0QA 5A4JA 1AQUA 1W0KA 4F4IA 2F3RA 1W48A 3EWAA 2GNOA 2ECKA 5IF9A 2ONJA 3HR8A 4G5GA 5CYOA 2PJRA 2GETA 2IYSA 1NSTA 4Z8YA 1BS1A 4M0LA 1KO1A 4BFWA 1F6BA 5C2JB 2CE2X 2CL6X 4Q4HA 3T1VA 1DE0A 3EZ2A 1S2MA 4OJQA 3K70D 1G17A 4TZ6A 3IBYA 2AL7A 3WHLA 3O8RA 3SJAA 3DHWC 4ACBA 1VYTA 4BFSA 4BZPA 1F2UB 4ESVA 3SHFA 3P26A 2BMEA 2C78A 3WYFA 2IS4A 4UQOA 3A1VA 5TY0A 4D6PA 521PA 2QUZA 1G16A 2DFTA 1G9XA 4CZ2A 3I5XA 1FX0B 1XMVA 4QBFA 1EWRA 2OILA 3A1SA 1TPZA 4JJKA 3P4XA 1NVUQ 4OI1A 2IXFA 3SOPA 2QMEA 3UMSA 4DLYA 2ORIA 2PZFA 1Q1BA 1ZM2A 4Y0VA 4MRNA 3MG9A 2YWHA 3UANA 1CLUA 2WVJA 4Q02A 1NLZA 1U98A 2C8VA 5M04A 2ZRJA 2ZJBA 1W49A 1S8FA 4V03A 3SFVA 3QNUA 2YHSA 5DISB 3V9PA 5EXPA 4BEJA 5JRZA 1JAIA 4A6PA 4DSNA 1SXJE 2OSBA 1KYIA 4QNRA 5FR1A 5JSZB 1AS0A 3HJNA 1E9CA 5FI1B 1JJ7A 1Q20A 5EP2A 3GLIE 1VMAA 2CMKA 2BV3A 4RFVA 3BERA 3LX5A 1AGRA 5KSPA 1WRBA 1X3SA 3T1TA 1WB9A 1AM4D 1A4RA 2OCBA 1SXJB 4OYHA 1KNQA 4GRAA 1G8PA 2MMCA 1R8QA 2BVNA 1G7RA 5JWHA 2A5DA 2H7VA 2J46A 4IJMA 3R8FA 1KZGB 4IOKA 1FNMA 1TUEA 3AKYA 4TT3A 4N0DA 3R9IA 3WMFA 2B7CA 3CB4A 1OFIA 5HZKA 2XTNA 4IKEA 4MKFA 4EPYA 2WWWA 3CNNA 1OHHD 1XJ0A 1IHUA 3PUXA 1EFCA 3OAAA 3UG6A 4B74A 1UDWA 2OZEA 5BN3A 2Z6VA 5BWMA 4JLMA 5EE1A 2C03A 4MRVA 4LC1A 1AS2A 1R10A 2ZQ5A 4OI4A 5C18A 4Q66C 5EE9A 3MWJA 4OQXA 4PSAA 5F9HA 1UKZA 2F3TA 3FFAA 5H68A 4R7ZA 1SVMA 2YWEA 3A58B 1KY3A 2J5XA 1NBMD 4HZUB 3TUJC 4O0MA 2J7PD 2MSEB 5JECA 3PR1A 2ATXA 2OFOA 1CJTC 2ZJZA 1E2FA 2GBLC 1HE1C 1GZSA 1N0UA 1ZM4A 2HYDA 2A9KA 5FBLB 2FH5B 4ABYA 1SGWA 3PVSA 1CTQA 2REXB 1LW7A 1N0VC 4OHYA 3SC3A 5EXTA 4BFTA 1DAEA 1QG4A 2AWNA 4CEHA 1MO3A 3IPXA 2GXSA 4FD2A 3SU8A 1CKEA 2W58A 2J1LA 4DKXA 1ZAKA 2DYKA 1U2RA 4TTRA 4C4PA 5KDOA 2XZPA 4RZ3A 5KPJA 1Z0FA 4G5SA 3VR1A 1BO6A 3SBDA 4LWZA 4BFZA 4I1UA 2ZXUA 2FN4A 3FMOB 4LUCA 5LB4A 2FDCA 1RJ9B 2GILA 1E2MA 4E07A 4Q9JA 1J90A 2C77A 1KJZA 2P0EA 2RGDA 3SYNA 2OAQ1 3ZD6A 1XD2A 1WDTA 4Q19A 5DIFA 2G9NA 4I99A 1ZNWA 3HP1A 3ICQB 1P9RA 4NP6A 4M1MA 2OAP1 1LFDB 3VFDA 1KOFA 2R2AA 3BORA 3T06B 4L9SA 3THOA 3GEHA 1Z6XA 4YMTA 1P3JA 2OHFA 1P72A 1SZPA 5BYKA 4IOJA 5KYKA 1SVSA 2GXQA 5E3HA 3T15A 4B34A 3K0AA 1UPTA 2QM8A 1E2KA 1E69A 5SZKB 3FB4A 4TQAA 4A8JC 1TQ4A 2FFAA 3L0SA 4RZXA 1OB5A 4KYIB 3T1QA 1DG3A 3VKWA 2AR7A 1QHHB 4NH0A 4UXJA 3B13B 1TF2A 2RGCA 2VBCA 3LQRA 3U3KA 4WZ6A 3AVQA 1E2GA 2ZEJA 1TADA 3BIFA 3CH4B 3OF5A 1SVKA 1R5NA 4Z54A 2G1JA 4ZDJA 4RCZA 1YZKA 2Z43A 4NCIA 3QF7A 1SULA 5K8IA 1JECA 1F2UA 3H84A 3GLHE 4Z1MA 2BWJA 3C14C 2WWYA 3E5HA 3RRMA 2NIPA 4LSGA 2BBWA 4ARZA 4QBIA 2FX3A 1SHZA 4NHOA 1SVWA 1OW3B 2G6BA 2I3BA 3PUVA 2C99A 3QQ5A 3LWNA 1PVOA 1OH5A 4DUGD 4RJLA 4DB2A 1Q1EA 1NMYA 1Q1ZA 2H17A 2VP4A 2WJVA 5BN4A 4P3YA 2Z0MA 3KJGA 1YZQA 4NCKA 2GK6A 3DPUA 4OHWA 2QU8A 1TTTA 3ZJYA 4YQFA 1JXMA 4ZDIA 1NKTA 5D3MA 3BFKA 5FPSA 4ZKDA 3NH9A 2JJ2D 3BFVA 3KUCA 3RABA 3W34A 4YXWA 1Z0IA 4JMPA 3WRYC 2QNRA 5E4FA 5GJVC 1NN1A 1XCPA 1PUJA 4P0TA 5A5GA 3A37A 4YDHB 2QQ0A 2WSMA 4LY6A 2P65A 4B75A 2F9MA 3P32A 5LPNA 2JDIA 2ZRHA 3VHLB 3NG1A 4JKIA 5HTKA 4Q9HA 1GIAA 1EXMA 2WAXA 3FDIA 4LBYA 4M1WA 4LOAA 2NO1A 4B2PA 2OLKA 4D0NA 1NY5A 5JWOA 1XXHA 3LVQE 4PAMA 4FMCB 1SQ5A 5EUMA 4BQSA 3CRW1 3KQNA 1U90A 1LNZA 1M7GA 4CF7A 3QIAA 3OIYA 3IKJA 4LPSA 3PXGA 3IEVA 2X2EA 1TUIA 3MGCA 1T0HB 3F8TA 4HLUA 3SI7A 4C9BA 3RAPR 4BECA 2FEOA 2RGGA 5JCZA 2AX4A 2GEVA 2YC2C 1LV7A 4ZDWA 1J7KA 2C04A 1KO7A 1II8B 1UEIA 2GCPA 2HUPA 1M74A 3CNLA 1I2MA 1OIWA 3L0IB 2OBLA 2WWXA 4X8LA 4I4LA 5FOSA 5C4MA 3GFPA 3K53A 3MSXA 4HDCA 1GM5A 1KNXA 2XNDA 3GJ5A 2WIAA 4HAYA 1NI3A 1QZXA 4KFTA 5JMTA 4TZ0A 3K8YA 4TTQA 1G8GA 3ZS8A 3TQCA 2V55B 4DLTA 5GJCA 1Z06A 4URWR 4KSCA 4DDWA 2ATVA 1KI8A 1XNJA 3ASYA 4Q21A 3EPKA 3UMRA 2WJYA 2GXAA 1KKMA 1JJVA 1QHNA 3QG5A 1ESNA 4PO1A 3I62A 4TYWA 4GNKA 2RKOA 4D4LA 2Q6TA 3ETLA 2QPAA 1SXJD 4GMXA 2IK8A 4MUBA 1TU4A 1K5GA 1DAGA 2F1JA 2CNWA 2V7QD 2ZE5A 1W4RA 4G5QA 821PA 5J4HA 3I61A 1OF1A 2HJGA 3ONWA 1IXZA 2UVQA 3D6TB 3C15C 2J0UA 4NE2A 1G5RA 4A82A 2AXPA 4AKHA 2HF8A 2WWHA 3GCGA 3KB1A 1ETUA 5D3QA 4QG7A 1JR6A 4KI0A 5J5CA 3CZPA 3K0FA 4L16A 4Q1FA 1P2UA 4XD7D 2EYUA 4DEYA 5CB6A 1DARA 1IN7A 2C9CA 4MDFA 2L0XA 1XDBA 2UZIR 1P61B 2XTZA 4WOPA 1N2CE 2C9OA 4KLNA 5P21A 3MWKA 1YR9A 4NMMA 3I1FA 3TAUA 5CITA 1X1RA 3I73A 2W6ID 4OKSA 4DLSA 4E03A 5GJBA 2GVDC 4DXAA 3M0EA 1NF3A 1ZD9A 1AZTA 1R0WA 1YZTA 4RKEA 5K8TA 2GESA 2IYTA 3FFBA 3IBGA 1N6RA 3NBFA 2Y8EA 4KJZA 2QENA 5EZ6B 4A8JB 3CONA 4TN1A 1A5TA 3KJHA 4HZIA 3LRPA 4HAUA 2R9VA 3RRZA 3X1DA 3V4RA 1O3YA 1OJLA 1E1RD 2G1KA 5FBQB 6Q21A 4LYAA 2P5TB 4PO9A 4TL8A 1UBFA 3CW2A 2ZREA 3QKTA 4BEBA 2EFEB 1XEWX 3U3JA 3U7HB 2ZJ5A 1ZM7A 2IEYA 3RHFA 4RFSA 1VG0B 4IXMA 1F5NA 1S96A 1T0JB 3X1XA 4AKGA 4Q18A 5B64A 4Q1EA 1TQ6A 2GJKA 4MYUA 3Q8XB 1JR3A 5KUTA 4M4SA 1JQLB 3FHOA 3R7WB 4LYJA 1XX6A 2OEPA 4JLNA 5CIWA 5HR5A 1XJCA 3U44A 1OH7A 3ICEA 3R9WA 3AVPA 3LLUA 4BASA 4CYMA 3GLHB 4CEHB 2VTKA 1IN8A 2GVZC 1DS6A 3CUEF 4M9ZA 2HLDA 3JVVA 3PEYA 1TNDA 1XJQA 2A5YB 3SZRA 4OQMA 2QM7A 1AQYA 1ZM9A 4V02A 4XOIA 2PZEA 1FQJA 2ANBA 2AKAB 2YJTD 1GRNA 1M2OB 3ZVLA 1F2TB 4PHFA 3PFIA 5E7MA 3K09A 5C1BA 3K70C 2QTFA 2KWIA 5KNDA 4QRHA 4ZO4A 1ZMXA 2OCPA 4DCVA 3K9GA 1N5KA 4W7SA 4HUTA 3CNOA 3UXMA 1XEXB 5J4LA 5J4YA 2X19A 4YMUA 5L3SA 2WWIA 3LH5A 4V0MA 5BYJA 2FPMA 4BFYA 4IDHA 1OFUX 2VP9A 1RRGA 4XTCS 1Z2CA 2BKEA 2GJSA 4ASUD 4KCGA 1RKBA 4YMWA 5F2EA 3GJXC 3NXSA 2R65A 4MRSA 4RY2A 3SFZA 2FOLA 1T4GA 4ZDKA 1I4TD 1NN3A 3AVUA 4LHZA 3QKSB 5IT5A 1E1QA 2F1RA 1ZUNB 3GFTA 4HI0E 4WBSA 1WBBA 2FZ4A 2KE5A 2QT1A 2IBMA 3N2IA 1LVGA 1VG1A 4OK5A 1GG2A 1Y3AA 3AKDA 3M4YA 3C4JA 5KDLA 4JLAA 3CPHA 2RCNA 1D9XA 3DOFA 2BHRA 4PHHA 1E9BA 1JR3E 5JS8A 3VHXA 1ZBDA 4LK2A 2C5LA 4D0GA 4M21A 1SXJC 2IF2A 1KO4A 1KHTA 3BS4A 1GL9B 1W2HA 3CM0A 4Q9LA 3CLVA 1PLJA 4DVGA 1GNQA 1HV8A 2AN9A 3T1OA 1ESMA 1V5WA 2VA8A 4C0AC 1U0LA 1R0XA 4NPHA 2JLUA 4I1OA 2IC5A 4JBWA 4IFEA 1WE2A 1NKSA 1E79A 5EXSA 4PXAA 5HCNA 1FFHA 3GLFE 5ANRB 1T9HA 1W2GA 1QHXA 2GZHA 3L43A 3MUFA 3SNHA 1VDZA 2FG5A 2CHVA 1LF5A 3BH6A 5DI3B 4EPWA 2NGRA 4Z1MD 3H2YA 4QHYA 1NL3A 2XEXA 4M2LA 2P67A 2ZRCA 4BRWA 4EUNA 5KDDA 3PIRA 2A7QA 4OBEA 2NG1A 2QMOA 1AA9A 1DAIA 1Z2AA 1E96A 3DKVA 2FF7A 2LKDA 3KQLA 1ZYUA 2IWHA 1FP6A 3O8BA 3W3AA 3SDZA 2D7DA 1SHKA 3REFA 3VNVA 2OLJA 1U0HC 3B60A 5L3QA 2OT3B 2Z4SA 1XTJA 2V54A 2IA5A 1P62B 3BB1A 4HLUC 3X1ZA 3GPLA 1OXTA 1E0JA 3GEEA 2P5SA 5DNYB 2JA1A 5KOYA 1UM8A 1KDRA 3TR0A 2VF8A 4BFXA 4BLOA 1RRCA 4CEJA 2O8BA 1XD8A 4FI3C 4QFMA 3ZQ6A 4RKFA 4DCNA 1CR2A 2FSIA 5J40A 2CNWD 3EPLA 5IK2A 4URXR 1NBMA 3IUYA 4PTLA 4D2IA 1XF9A 3TBKA 1OKKA 2PZGA 1EK0A 3OE7D 2WJGA 3ND9A 4PX9A 1YJ5A 4RZUA 1GOTA 1XU4A 1D6JA 1II8A 1N25A 3WYAA 2GDJA 2FGJA 2WKQA 3HYTA 1XMIA 4PFSA 1II9A 2H18A 3B1VA 2G83A 4Q7LA 1H8EA 4JVMA 2PT7A 4K8OA 3ADDA 1SKQA 621PA 4AG6A 3SE0A 1G291 3WBKA 3THXB 3WMEA 3AVYA 2Z4RA 5EE3A 1R0ZA 5C46F 4IDQA 2KI5A 2JLWA 2I1VB 2DFNA 2TMKA 4Q48A 1KK0A 4ACAA 3P1JA 3GLHA 2WKPA 1Z08A 4QJ4A 4AD8A 2W6IA 1CP2A 2OBNA 2ZI5A 3O47A 4PZYA 4Q4JA 2BCGY 3B1YA 4D0LB 1COWD 3QEOA 4G0NA 3CKLA 1VIAA 2PX0A 4QGFA 4PQRA 4C2TA 2AFHE 2QZ4A 2VP5A 4JS0A 3T5GA 1YZNA 4CVNA 2O8BB 1NJFA 2HXSA 3LX8A 3RWMB 1RE0A 1Q12A 2QE7D 3QOFA 5LBIA 3WNBA 2JCSA 5DSZA 1W1WA 2WSSD 1KMHA 4BWYA 2E1RA 4UNNA 1VHTA 2ZETA 1EFTA 2J0QA 2ZYVX 1Z0AA 5JZVA 4UNSA 2VL7A 4LHXA 4YMSA 4UKDA 4B71A 3A6PC 4HUQB 1WMSA 1ZP6A 3EIEA 4EIWA 4DCSA 4DLUA 4DDVA 1E98A 1KK1A 5DLQC 2PL3A 2WOOA 3GJ4A 4LV8B 2CL7X 2V6JA 2QAGA 3E1SA 4LJYA 2PLFA 4TLCA 1W44A 1D5CA 4LJ8A 5EQTA 1XCMA 1T8UA 1Z63A 2V6IA 1X86B 1YRAA 3CPJB 3Q3JB 1Z8FA 4RVCA 2VSOA 2PMDA 4WZBE 3ZVNA 4Q4HB 3G82C 3QI2A 3WXMA 2VQSA 4EQ6B 1YZGA 2VHJA 4JIMA 4DIDA 3KJIA 1W0JD 2AKYA 3PJRA 2QMUA 3MD0A 1M34E 2D62A 2XTMA 4LDJA 2WZQA 1TF5A 1P73A 1VCMA 4M1OA 1GKUB 4TQUS 4DLVA 4ILEA 3TGPA 1FUUA 1GTVA 4UXHA 4AIIA 2DB3A 2GEDA 3FVQA 3MWYW 4EJSA 4U5XA 3FGNA 3AF2A 1QG2A 1CXZA 1MO5A 2ZYTX 3GJ7A 2PEYA 2QAGB 4E09A 2XX3A 1G8FA 1T8TA 3PITA 3RS5A 3LXRA 3FKQA 4PPGA 2O0KA 4GZLA 3CRMA 4Q1AA 3GLFA 4HAVA 2ERYA 2HCBA 3W9YA 3NDPA 1E2EA 2XNDD 3LQQA 1MO4A 2F55A 4GDFA 1DTSA 3D3QA 2QSYA 3CZQA 4D81A 5F3WB 3I5YA 5EUQB 2ZRBA 5AUPB 1A7JA 2Q3HA 5AUOB 1NVXQ 3W6PA 2I4IA 1R4AA 4TL7A 1UKVY 4BZXA 4A15A 3RS2A 2NZJA 4W5JA 4EKDA 3LLMA 4NCHA 2WOJA 3BH7A 1L7VC 1OSNA 1VIYA 3ND8A 2IYQA 4Q7JB 2BDTA 1RJ9A 1KI6B 1EFHA 3BD9A 4TWZA 4JT4A 2F6RA 1EX6A 5LB2A 3SJBA 4AY2A 2WWFA 2CLDX 2O8DA 3OFND 3OHMA 4BLQA 2VLIA 4M22A 2IS6A 3NBYC 1U9IA 1X8KA 2VP0A 2OXCA 2FFBA 2LKCA 2QI9C 2J0VA 3RS3A 3U61B 3VR4A 1TQDA 4B33A 4B2IA 5H8WA 2CXXA 1KAOA 1E2HA 1OKKD 1QHSA 4QGHA 5LD2C 1YZLA 1E2IA 4POAA 1KJWA 3EZ6A 3QKRA 1KMQA 1YR6A 3B6EA 4CEJB 1FTSA 1G64A 3BH0A 4GP6A 3V00A 1M7BA 2J3EA 1S1MA 1PLKA 5JBQA 4EPTA 2H92A 1DAKA 1JXOA 1OIVA 1NSFA 1U8AA 3CRVA 3O8DA 5CIQA 1W7AA 2QTVB 2MSDB 2YOHA 2CEAA 2CCKA 5DHFA 5LDDC 3U44B 4NCJA 2P6UA 4U02A 3RS0A 2P6NA 2D4HA 1E2DA 1GSIA 1M1YE 2ZU0C 2R6GA 2NO0A 4JVSB 1UDXA 1Z6GA 1EFUA 3EC1A 3PV0A 2VSXA 4EFMA 2QGNA 1XWIA 1WP9A 3OEEA 2DBYA 2IYLD 2OV2A 5DH9A 3AF1A 2B21A 3H1TA 2XXAB 3AVTA 2ZYUX 4XSHA 5JSZA 1XEFA 4EPXA 3TAHA 4TLEA 3B2EA 4P4SB 4C30A 4B3BA 2VP2A 1T3SA 2J7KA 2J9RA 3LY5A 3TRFA 1JI0A 3LNCA 4GMDA 2J0UB 4Q47A 5B30A 1QBKC 2DWQA 3EAQA 4EFLA 3P27A 4XWKA 1FMJA 4NDZA 3QY0A 1AZSC 3CWQA 4TLAA 2ZVPX 4DSUA 1W5SA 3A8TA 2ZI6A 3U7EB 3UWOA 1N6NA 3VR3A 4KBGA 1CS4C 3B5JA 3AP2A 1OHHA 1Z29A 1OXVA 1Z3IX 1Z0KA 1E2LA 2YOGA 4AC9A 5B57C 1ZIOA 3T34A 2EFHB 2JAQA 3SHWA 5KPDA 3QXSA 1KMHB 3L82B 5FPYA 3AF0A 4ZI3A 3JZMA 4B35A 2QTHA 2HYIC 4V0ME 2QEQA 2ZRMA 4GOJA 2YNMA 5FOXA 3LD9A 5GADl 2W6JA 3PEUA 1Q21A 4R2IA 4RD2A 1FMLA 5A0FA 3K0SA 2W00A 2ZS7A 1M7HA 2DR3A 3EX7C 2KB0A 2XOKA 4H1UA 5KNCA 1WQ1R 4OK6A 1OLOA 3B9PA 5FOWA 4BGDA 4GOXA 3B7GA 3QE0A 2UKDA 5FTKA 1XTQA 1NLYA 1KSFX 2AHOA 3M6AA 4JL5A 4ZIRB 3HWSA 3W90A 3SJCA 3MAAC 1GRRA 2PMKA 1XD9A 4DHEA 3T12A 4LCBA 3OEHA 2YYZA 4AYWA 2IYUA 1PZNA 1P9NA 2G88A 2ZSEA 2D7CA 3UKDA 5EJEA 5IHPA 4I1VA 3C5CA 5IRCD 3F5FA 3ZD7A 4NL4H 3U60B 4JZKA 2F43B 2IUTA 4QJ5A 1UAAA 4A4DA 4DJTA 1HTWA 2NO7A 2C96A 3CH5A 2ZYWX 4X8OA 3FTQA 4DT1B 4TYNA 2FNAA 3BAFA 4BPBA 4NU0A 1JALA 4Q5IA 3TNFA 1CIPA 2EWWA 4C7OA 1LS6A 1MABA 2PJZA 4F91B 3UMFA 2V7QA 2R6DA 3UIEA 4CEIA 2QAGC 4XVQA 1E9AA 2Q3FA 1CR0A 4QNMA 3RDPA 4BLRA 4IHQA 5BN5A 4D26A 3LW7A 1KI1A 3FMPB 3HU2A 3KKOA 4MGIR 4OJKA 3TLXA 3ZDQA 5JEDA 4B3DA 3IO3A 3HU3A 1OV4A 5EP3A 3AV0B 4L15A 3FKSA 3LAWA 1AKYA 3VKHA 3RC8A 3HPRA 4ZIRA 4IRUB 1E0AA 2REOA 4TMVA 4O25A 2WTUA 2NMVA 1BKDR 2BJVA 2FFHA 4C7OB 1EX7A 4IEEA 3VU9B 2YWGA 1RRPA 3D7MA 3DOEA 3NIBA 5JEEA 3LO5A 1YE8A 4FN5A 1E9DA 3NVAA 3Q5DA 4P32A 2BEJA 5FR2A 3EW9A 3WRXC 3C7KA 2F43A 2X77A 3B85A 3QKRB 1H8HD 3EC2A 3KXIA 3TJZA 1J70A 2XAUA 2B6HA 4TL6A 3ZH9B 3TVDA 1D2NA 4GBMA 1KO8A 3KDSE 1G6HA 3CF6R 2NZ8A 4TLBA 1DAFA 3KTAA 4FMCF 3MMPA 1OE0A 3NBZC 2C2HA 3HDTA 1KDOA 2KBEA 4Q9IA 4A8JA 2A5FA 3TUIC 1ZNXA
chains in the Genus database with same CATH superfamily
5KJFA 4YAUA 2ONKA 5B2EA 2IEGA 2FEKA 3D8NA 2X15A 4PGAA 2R6HA 4MEBA 4N0PA 1BROA 1USIA 4RW0A 2OOSA 2PT9A 4BX8A 4ENWA 1NP7A 2HM7A 4D3SA 3QITA 3JAMA 3GRCA 1S89A 3ZUPA 4YO7A 5CW1A 4EMUA 4Y2HA 2JB9A 4MS1B 1NMXA 1FTYA 4MPJA 5CDHA 2VHTA 3CT4A 3ESYA 4FOPA 2FR1A 1EP3B 1RBZA 2W11A 3R20A 5A04A 2YIDA 2RHDA 5EGNA 1VYUA 1ZGJA 2VTEA 5D8DA 3ZHZA 3ZCVA 1HORA 1SBNE 1W5TA 2E6UX 1XPUA 1FMTA 3PPIA 4PY2A 4PIPA 2E89A 4HN9A 1U3DA 2WVAA 3KAJA 3NH6A 1QFSA 3AETB 1H2WA 5JO0A 2PJUA 2Z08A 4OGWA 3ANNA 3E9QA 3NGLA 2VAWA 2W4QA 3IUSA 4PAOA 5DN6A 5DBOA 1JG7A 2WQ6A 2BBOA 3F4KA 1DIHA 3ZJUA 3JQEA 2QWXA 2O7NA 1THTA 1U2TA 1EFRD 1NVVQ 1I14A 2H8KA 3OEED 4YQEA 5BNFA 4BLPA 4BLSA 1FX0A 3J81k 3GAMA 3SSAA 3RWOA 4CMKA 3FF1A 1APBA 4QGSA 5BWOA 1PE0A 4GLOA 4WN9A 4GPBA 4LFCB 4IQFA 4JD5A 5SV2A 1EPUA 5AUQA 2O8FA 2FWRA 5KWEA 3MFQA 2N75A 3W8EA 1N77A 1ZWLA 1PL7A 4CT0A 3H9JA 5ESXA 2HR1A 4EYOA 3UUFA 3E82A 4MW5A 4X1IB 2ZP1A 1QJ4A 3TQIA 1N34B 1P31A 3IAM1 3WJ1A 3CBQA 2O50A 3AR8A 3PE6A 5A4FS 1VYVA 1D2AA 3BJIC 4HNAA 2HA4A 2PIDA 4XB1A 2IYEA 1AMUA 2QJRA 3UJ8A 2ZRDA 3QMWA 5FKJA 2MHCA 1LXCA 2BEUB 2WT9A 3IBTA 3QX9A 1GPNA 3CG4A 3F46A 4IM7A 2OORC 4QPZA 1T6BY 5EXXA 1ISFA 5F73A 2Q3MA 4Q00A 2BFDB 1ORRA 1YDEA 1CQIB 4KR3A 1QKIA 3TLEA 2QLJA 2WIKA 4OXIA 3K96A 4DDUA 1XN4A 3BMQA 3EA4A 2ZR7A 4QQ8A 4B4UA 3M6WA 2CBXA 5BN3B 4ZODA 1E6EA 1V7ZA 1XRRA 2ZT7A 3EXFA 3HHPA 1WA5A 4Q9NA 3E03A 4AWBA 2EQAA 3EDQA 4JU8A 2IS1A 1RFGE 3C5EA 2QS9A 3JTEA 1A1VA 1F8GA 3FOFC 2ROQA 2JCYA 2VTDA 5B12A 4RULA 4KPEC 3SWWA 2I8CA 3VKGA 5A3RA 4DN6A 4IGKA 4LJ7A 3HVRA 3LY9A 4JOCA 1Y1KE 5AJHA 1X1SA 4EFDA 1XDWA 4AW9A 2FV8A 5JR3A 1C5KA 4BVAA 1CQXA 1DKPA 2XXAA 1P6XA 4A6DA 1SUCA 4TSFD 3GJ8A 1YU9A 3MOGA 1CQIA 1RQ7A 4UAVA 2Z5VA 3NHFA 4NNPA 4PSKA 3BMCB 3I9V6 4L78A 3BGWA 1PFVA 5K8UA 2N1MA 3X1YA 2JJ1D 3AEQA 3ZQJA 3JRXA 1G21B 1IQRA 4J43A 5A9TA 4JLKA 4HMPA 2CJXA 2FZLA 3KZVA 3LA6A 3HFJA 1UPAA 2ISQA 3K8OE 3R9XA 1V43A 2BCEA 3RRYA 1MOSA 1OD6A 2WTMA 3EGOA 1DC6A 5F78A 2H52A 4O29A 2JFQA 5IBRA 1QG0A 3N6VA 3L4EA 1E1MA 5EA2A 2FHSA 4D02A 2QP9X 2ZBVA 4Q3LA 1OWOA 5DI3A 2Y71A 3FBGA 2IEZA 3E7XA 1IU9A 1LCIA 2R8RA 2QRNA 3FVTA 3Q3GE 4AMYA 5JNWA 1IZYA 1BOFA 3R77A 4OSPA 3CEPB 3Q8WA 4NCNA 2H5IA 2XE7A 3JVUA 2GEFA 4JELA 1ECPA 2E5FA 3WLMA 1PD1A 3I2FA 4ZMRA 2YFYA 4JQYA 3RLIA 4XDHA 1XZMA 4TKZA 2OKGA 3K09C 3H3XA 4J7XA 4XTRA 2V6FA 2ZJAA 2ZYSA 2G0NA 1VMEA 1QUEA 2O5VA 1Y89A 1R8YA 2Y27A 1P75A 5JSKA 1YA4A 1Z17A 3OZEA 1E9EA 2IQ5A 4CKBA 3ANTA 4MUEA 3O2JA 1LQ2A 5JNRA 3D0OA 1NV9A 3B78A 1XTIA 4GOMD 1IM2A 4PC6A 4BKOA 1VKOA 4KIWA 3E61A 5KHOC 3IP6A 1DUSA 4HX5A 1W36C 1W4CA 4FLEA 3W4KA 2NTVA 5JAHA 5FTMA 1V95A 2RGNC 4HGOA 4RC9A 4RSGA 4HSEA 5KNCD 2ZPTX 1MC8A 5AUNB 2F90A 1U2PA 4HMQA 4JKYA 3RS7A 4HWKA 4P82A 3RJMA 2PRIA 4HTFA 5EKTA 2F7SA 5HCUA 1ZHHA 2GN8A 3JWIA 2Y4NA 3ZDAA 3QEMA 1IN1A 2C07A 4Q24A 3IT1A 4MSUA 1BIFA 3RYHA 1C30B 1LTKA 2OCAA 3QPVA 1F0YA 3OJCA 4EF4A 1YR7A 2YASA 2FPKA 4J0GA 4JA2A 4XLLA 1KVUA 1WHSB 1QU3A 4KDEA 3RVRA 3D3EA 2CVHA 2JJMA 4GWKA 4ZCLA 1K7YA 3SJ7A 3L7BA 2OFXA 4FIZA 4LSWA 4V1CI 3KKQA 4P53A 1XZJA 3LDGA 4RVGA 1X3LA 4CXMA 4OP3A 4KBFA 5DCLA 3RC2A 5CB8A 4URVR 1HDIA 2HK8A 4JVLA 1YK0A 2O8DB 4M0FA 5FJIA 1U4OA 3DO5A 1EGHA 1RTTA 1OCEA 1S01A 3PD7A 1PT8A 4MR9B 5BQOA 1NI5A 1ZH6A 2C2ZA 2JNWA 4PU0A 1TKCA 1BMFA 1J24A 2Q99A 1HH4A 3LPNA 3MINB 4EG7A 2QORA 4EGQA 3OD1A 2EDAA 2JGNA 2AMLA 3OX2A 1GZVA 5KKNB 4EB8A 1YT5A 5CBKA 1N1GA 1A5SB 4HWSA 2F9LA 1DMSA 3L93A 4ZHQA 5IK2D 3EEQA 4TYYA 5B7QA 2HTEA 1SK9A 4IQ0A 4ESOA 2BGLA 2RIPA 3TIXB 4UHCA 4D9JA 3KQHA 2W8BB 3OLZA 4A8TA 1QPZA 4W6ZA 3Q85A 4AYTA 2I1WA 3L4BC 4MVWA 3NT2A 4NBSA 4INAA 3KSMA 2R86A 4KNVA 5L8VA 1ZNQO 5HF9A 4AXXA 1GPWB 1DEXA 3O84A 4LXYA 1T9KA 4BNKA 1HRKA 2ORVA 3DOHA 3QUSA 4Z7OB 3A26A 1N36B 5L45A 3RT9A 1R8SA 3NHZA 1Z5PA 1N7JA 4ZYZA 3H1BA 5KYWB 1F38A 3O93A 3O8CA 5A05A 2A9JA 3GDFA 3OIDA 4DUPA 4N5DA 2O2ZA 2FW6A 1G5QA 1UQTA 1R5OA 1W0JA 2AN5A 3QW4B 4XVHA 5C1PA 1W59A 3DTYA 5LM3A 4KFUA 4W9NC 3WK4A 1OWMA 1V9SA 2WZCA 4HYTA 1DG1G 2GFHA 5COQA 1SC1A 2W8BA 3F6EX 4TV9B 4DIEA 1JT2A 3SEAA 1JG6A 1W34A 1X15A 4UOZA 3L7NA 1TYCA 2ZBQA 1GGNA 2NZYA 5AKHA 3FPLA 3KOZA 4J0DA 3OZ7A 5EZSA 3RQIA 3DVSX 1RQNA 1DUVG 2OCGA 2W2XA 5G3YA 1XELA 4EAQA 1XTSA 3KQYA 3FAZA 5CVEA 3KOXA 1QR2A 1R0KA 1MHPA 2B98A 1QAQA 5CYPA 1RLTA 3K31A 4L4UA 1RM0A 2RAPA 1C8BA 1VE9A 2J07A 2JFBA 3A36A 3CIFA 1B6RA 1XMXA 2DFVA 2JHAA 3NHRA 4KAFA 1ACMA 1QQ5A 2X7JA 3K1AB 3M83A 3N6XA 4BP1A 4RPKA 4RWEA 1BQEA 2WFZA 3RC1A 1SKYB 2I33A 4IG9A 4IP0A 4KQFA 4PVCA 3WLQA 4LBVA 2PUJA 1YV9A 3LQ4A 3OTWA 5KNBD 2ASEA 5GONF 4MKXA 2FW0A 4RMGA 4AKEA 1XFDA 5BVHB 5ALWA 1N9ZA 3ND5A 4GZ6A 3VU9A 4E2XA 1A82A 2D2XA 3LKDA 5CX1A 1EH5A 1FXSA 4QO8A 4CKZA 1Q1QA 4H15A 2X9VA 3W2FA 3JAKB 2X42A 2H0QA 1TE2A 1PEYA 1OFGA 3JVIA 3D02A 4XWAA 1GKIA 2GMWA 3MS4A 4AQYB 2RG1A 3QVSA 4RTJA 3BKXA 1E6UA 1K3FA 2HCFA 3KUDA 3IT2A 1NNSA 4FMDB 2Z83A 4WY5A 5IMBA 4C4AA 3AVWA 4CM1A 1TCVA 2B20A 2O3JA 2HHAA 3OX3A 4JNCA 2WF7A 3QUBA 2IWRA 1DEKA 2WJ3A 3DEJA 3L9WA 5JTTA 2PLRA 3IIMA 1X7HA 3IVRA 4ND4A 4WVLA 4DLZA 4BQNA 4YMGA 1GTRA 1NVVR 5DXAA 2W2NA 2AJBA 3AJ8A 3AM3A 5EQJB 3I9NA 4FOLA 2Q28A 4M87A 2YCLA 1HSOA 3GQVA 4DOMA 2RD2A 1DELA 4RD0A 4A10A 2XB4A 2JLXA 1HE4A 1ZK3A 3EASA 3V2IA 5JQWA 3NDIA 4A0FA 1M0WA 2WU3A 3LBFA 5G1NA 2FN3A 3R7DA 3FMFA 2NV6A 3CX7A 2XWQA 1LQTA 4NYMR 3FIUA 3I4CA 3E4DA 5AI8A 5AJZA 4QXQA 3IAUA 1LJLA 2BSAA 1R6UA 5L3SB 2ZUFA 5CDUA 1QQ7A 1R6AA 3GEMA 1NQAO 3JYLA 2K5UA 4PZAA 4X0EA 2GEBA 4NK4A 4CIDA 2J5KA 4N8DA 2QROA 4HYEA 3VOAA 4Y67A 4HQRA 2ZSAA 2CBZA 3OX1A 2HF9A 4FYXA 1Z4PX 2VSFA 4MWBA 4QTZA 2OFFA 4DLKA 5LDHA 3QJGA 1W46A 2XDWA 5IAOA 3DGFC 4E5NA 1P1CA 4FE7A 2ECFA 1Z2NX 2W98A 3AJDA 3CX6A 3OFVA 4CKEB 2W2KA 4YT4A 4IGFA 4P31A 1Z2OX 5JH7B 5FWDA 3BN3A 1OZFA 4J9VA 5H0IA 5BSWA 1EK6A 1YAHA 1L4MA 3GGDA 5A9SB 3ZCQA 1JE1A 1YR8A 4QDTA 2O54A 3BMXA 5J63A 4F5DA 1CQZA 3NGXA 1KJJA 2TSYB 2UUOA 2YVQA 2YN4A 1KS9A 2O6HA 3G8CA 3PFGA 1JIKA 2ZRIA 3HYCA 1GNRA 4K86A 4A0GA 3D1LA 1ESCA 5BW5A 1RMYA 2HBZA 4AM8A 2GTIA 3OCVA 1PGJA 2YRFA 1FB5A 3FZGA 4HEJA 3TPCA 5B4TA 4P6VF 5DIZA 1POXA 3G6WA 1Z6YA 4NZOA 1PR5A 4JT9A 4N6OA 1G2QA 2XEDA 1MX5A 3G8YA 1YRBA 3NTOA 5FPHA 2V74B 3KSRA 4UTXA 1GGJA 2WA2A 2ZW9A 1UMDA 2PMWB 1I2DA 2EARA 3A4TA 4Q1CA 1GG8A 2JLQA 3UBMA 3SY8A 2VPZA 2CVPA 3NW9A 2GSWA 4MUHA 3BZUA 4YUXA 2HJWA 3EIFA 3VU3A 3IQFA 4G56A 3LNTA 1WY7A 4FBGA 4TKMA 3TW4A 2O19A 2DBVO 3JWEA 1L4GA 2CFIA 1BFKA 2QAJA 1OT3A 1F48A 1M1XB 1VMKA 3GT7A 4LDRA 2JH9A 1HQDA 4Q4AB 5L3RA 5ITZB 1BNCA 3F96A 3O8LA 1KKLA 3PG5A 3D2LA 3ROKA 2DU8A 2WJZB 3BMOA 1Z3CA 3OM8A 1EEXB 3QVWA 2NQ2C 1XTRA 5IKEA 1F0NA 1XXHE 2PBRA 5AW8A 1T9CA 1XRQA 3OESA 4I1IA 4WOKA 1QRUA 3KCQA 3M49A 2JGLA 2YXEA 2H1OA 4RORA 2PH5A 3GPBA 4XPZA 1E20A 3PB3A 4C2TA 4ZCMA 2BR5A 4AKIA 4Q1VA 1BE1A 3EPKA 5A1JA 4QLAA 5GZ3A 1A8UA 4E22A 1RXIA 3GLFB 1G18A 1US8A 1WQ3A 2JLBA 3ODPA 1XZGA 1ZVQA 4KVGA 5ILOA 3R23A 4J75A 4CCYB 4D80A 4YAIA 1IDN1 4TMKA 3IJEB 3ADBA 1GY8A 1LLQA 4JJ4A 4YC7A 3FHTA 1VKRA 4UTRA 4Z99A 4ZRDA 1Z28A 2Y77A 3N2ZB 1JN0A 4WY2A 1JQAA 5AXDA 1JNXX 3C16C 4RH3A 2WWGA 2VK8A 2Y9PB 1GSHA 1A27A 1XPJA 4X7BA 1DADA 4BLUA 2NV2B 4I9UA 1GG5A 4US2R 5SY6A 3UF0A 1E3WA 4DDHA 3UPDA 2V59A 1S1CA 1H3NA 5AVUA 1L5RA 4LOLA 4M8IA 2VNKA 4LRWA 5ALIA 5GQSA 1X7YB 1XL1A 3M6IA 3NPAA 4C88A 4HAWA 1IEVA 1KL7A 2ZSHA 3G13A 3CO5A 3VO1A 4NJMB 3ZHYA 1C1YA 3WP1B 4ECEA 4EYEA 5CFMA 3WSVA 2QVXX 4DSOA 4I55A 5ULLA 1T3LA 3N3BC 1PYDA 2VUUA 3VU1A 3U7GA 2XRYA 3QM1A 1ML3A 1FP4A 4PICA 2VQDA 3QVKA 2HIMA 1Z4LA 4QGAA 3GJSA 1NR5A 3P2EA 1XXHB 2ZSFA 3RHTA 5TQVA 1VKNA 3ZC3A 4BS9A 4D41A 4YRBA 5IG2A 2LDXA 2NPFA 3PYMA 2QD3A 4QREA 3VZDA 1E32A 3PHLA 1Z47A 3PWTA 3GJ0A 2ZJ8A 2AD5A 4A2PA 2GT1A 4JP1A 4I1SA 2J5BA 4KI7A 1BMFD 3GELA 4Y9RA 5GGXA 3T4UA 4AURA 4JV5B 2WJHA 3VJMA 2J9GA 4YY3B 3N0RA 2CLLB 2X14A 5JI3E 4NC9A 1G0OA 3MB5A 3OEHD 4HS9A 1FSZA 4YPFA 3RIYA 1K2VN 3CX8A 5BPHA 2WWVD 2Z2KA 4XEUA 2XZTA 4WINA 3UK1A 1DAOA 4QX6A 5BNIA 1RZ3A 4DDKA 5JD5A 1S2GA 2AFHB 4ZAFA 1C9KA 3QU2A 4KAAA 4LZZA 2PUBA 3NWOA 2RHOA 3VC2A 3KKKA 3C41J 1OGIA 1I4LD 1GTSA 4RGVA 4LOHA 3V8BA 5INTA 1A2KC 3R7NA 4ATNA 2XZOA 2OZLA 7REQA 4A8HA 4PGHA 3KXKA 2AYZA 2Q41A 3A04A 3FCXA 1SCNE 1VBFA 2J85A 4BB0A 2RKWA 3G23A 1ORDA 1RQGA 6NULA 5IJ9B 6ABPA 3KQKA 1QE3A 3FHJA 1GU1A 3F2IA 1PI3A 1NBME 1TZKA 2FMFA 3IMGA 4PQYA 5E6SB 2Q5FA 4DPKA 5IVHA 4WQMA 2C3MA 4MB6A 3ROTA 1LTQA 4MS4B 2VRCA 4TKUA 5E6RB 3RBAA 4CLRB 2EERA 5IJWA 1RWNA 1UXIA 4IYRA 4I9GA 4AECA 1E5LA 3MVEA 1S0UA 3KB6A 4E15A 1IJBA 3EVTA 4X95A 1MRSA 2X4DA 3D9QX 4NAVA 1IEXA 4TTPA 1FK8A 4Y1FA 4KPYA 1TC2A 1ISMA 5FI0B 1VE6A 3CWCA 5E6UA 4C08A 1Q11A 4DCPA 1LZLA 1TQHA 2PO7A 3KAQA 3RG8A 4HV4A 1JIUA 3HLKA 5AK5A 3UFXA 2BF4A 1QOZA 2JGDA 2RBEA 4US1R 2HL6A 4KGDA 4UPDA 4L9AA 4CJXA 5ELXA 4BE7B 3MRXA 4WDQA 4LGMA 3Q8KA 2DFDA 4NARA 4RPCA 1CULC 1JYSA 1TF7A 1RPAA 3U48A 4CLHA 5AKZA 4UZFA 2C98A 1X2EA 1W36B 3AKZA 3OU6A 4RM3A 4J1TC 4PHTA 3O82A 3IQGX 2Q3CA 2F62A 4ZEOA 1XYVA 1G66A 2CE7A 5C32A 3ZXYA 4BRUA 1KP2A 2A9OA 4PC1A 2QA5A 5LWQA 2PWBA 4D9BA 5IXSA 5JZOA 5CM9C 3PFWO 4TRNA 1SPBS 3WIDA 1NVGA 4NBTA 1C41A 4CM4A 1E1RA 3ZY6A 2A0YA 1MBZA 2YUIA 3KZOA 1M6NA 4JGIA 1UBEA 4H9GA 1RD4A 1KFBB 4FS8A 3JW8A 3K0CA 5KTSA 3TH5A 3HU1A 5HFJA 3PLAE 2SECE 3DDCA 2C59A 3OUZA 3V4LA 2JPDA 5FL7D 5TT0A 4F2DA 3SYKA 5EIXA 4X3CA 1I0ZA 1LNSA 4A9AA 3ZG6A 3B89A 4LDQA 4OQPA 1OXUA 4CBVA 1IQPA 2TS1A 2HV8A 1KZYC 3O8OA 3TM4A 3GFOA 1N3YA 2ZVQX 3Q72A 3QF4A 4PYLA 3IE1A 1ZVMA 4MP3A 4O8CA 2A57A 2JVKA 3DOIA 4KBYA 3H0CA 1N6HA 2PANA 3L4BA 4NMHA 4PPQA 2GHIA 1K4KA 2Z1NA 1GVHA 4OFWA 4TVBA 5LLTA 3C2QA 2ZB3A 3NATA 1Y8QA 2OXRA 2O48X 1Q0UA 3PQ4A 3Q9NA 4Z0TA 1YVRA 2E7ZA 3H2IA 5DNWA 2C2MA 1HFEL 2ZIXA 4Y6LA 5KJ1A 1NVBA 4I3FA 4MW1A 2CLHB 1HE8B 5JVDA 1QVAA 3UMJA 2YBDA 2XWBF 4OUDB 5ALFA 3B3AA 2CHGA 2EF1A 4QDOA 4X6LA 3BXXA 3W05A 4FFVA 2Q62A 1D2EA 3G2PA 3WICA 3BT7A 3DG9A 3QNMA 2FTKE 1UM9A 1XYYA 4IGIA 4OYLA 4P4SA 5EJIA 1BYIA 3A2MA 4ESEA 4YI5A 5DNCA 3LFTA 4FR0A 4CR8A 2JIRA 1XT6A 3NHAA 4BNJA 3I9LA 2COEA 1LDEA 3M1LA 1V2GA 4U2DA 5EMNA 5SY4A 4A8PA 4CL3A 5K7SA 3S8EA 5KO2A 1NPDA 1F3OA 2IKSA 4C4YA 2W42A 2QNIA 2R7MA 3TL3A 4ZCPA 1HR0B 1LSSA 4HB3A 3OZUA 3M9WA 1TO2E 4HUQA 3ONFA 4IJKA 4R8KA 5CFZA 1PFYA 2EKZA 3ZBPA 3GFQA 1QU2A 3L8ZA 1GAWA 4CR7A 4IZIA 3WB2A 4CTJA 5DXJA 3OZSA 4ARVA 2VDQB 2XMGA 2OGUA 5JWRA 4ASUA 2D5BA 2UXBB 1UANA 1OYYA 1DZ3A 5CG2A 2E5WA 4R01A 1RYFA 3Q2IA 4CT4B 2IGBA 3VZPA 4P7KA 2P4EA 2PXCA 5L7WA 2CV0A 4QU9A 4B6PA 1FY2A 1JDSA 2ZUDA 2D3WA 2ZJ7A 4D1YA 5CW2A 2IXGA 3ZDFA 1U0OC 1B16A 1FXWA 2ACKA 4XX0A 1BQ3A 2IHJA 4GI2A 3PD0A 1LPNA 3UH1A 4B4OA 1P7PA 5DFAA 3L4KA 1GARA 1VSTA 3ITDA 4RM2A 3SXUB 3ZYZA 5BNZA 3ZLVA 4UHKA 3WLJA 1C0EA 3RIEA 4K9NA 2HF7A 2IXEA 5HIIA 1YCFA 4PSVA 4RQBA 1VLMA 4U2FA 3TGWA 6CHYA 1QH0A 4WY8A 3QFFA 3HO8A 2GPAA 1XPOA 2C9DA 4RHFA 1A9YA 1GNTA 5EWMA 1ODFA 3DEFA 1C3LA 1E3JA 1QR6A 4G0MA 5AT1A 3MGGA 1G6OA 5G41A 2FSGA 3LDHA 4UC0A 5BNTA 1AQNA 3OOSA 4Z4CA 3D2CA 3WWPA 4IKPA 3UA4A 4MS3B 2O8FB 4K9SA 1VJTA 1N5MA 2OB1A 4QYTA 4M89A 1V1RB 2XCTB 5BT9A 4MQFA 2EX4A 1KBZA 4KH0A 4L5AA 3UJ9A 3FOZA 1XRLA 4C4RA 2YUTA 3OCJA 4B3GA 3E7FA 5CYGA 3CEJA 3IDQA 5LMUB 5SICE 4G0WA 1O6GA 1K5HA 4GD3Q 5AK3A 1EFKA 1KI2A 1HK7A 3TE7A 2C58A 1XVLA 4BC0A 2B92A 5DCYA 3ZOZA 3GWGA 1ZK2A 2QPTA 2PUHA 3AGQA 4R2LA 2IPXA 4IIUA 4BO6A 4C6SA 4HR7A 2PV0A 3HCDA 1ZZGA 4WERA 1DT3A 4N7JA 2I2AA 4REQB 5DULA 3UOWA 5K20A 4AP9A 1T2DA 1VCHA 1F0KA 3RROA 1X19A 4PLWA 4Q12A 1XLWA 2CMFA 3M33A 3OETA 1U1GA 1X8LA 2BSQA 4BNDB 4CGYA 3MQ2A 1SVLA 2DCUA 5AOCA 3AIKA 3EWSA 1CIVA 1OROA 2WWRA 1WBDA 2MSKA 1IM5A 4M98A 4IOMA 2GAJA 5I5GA 4A1FA 4D3DA 1KH1A 2Q4RA 4G07A 4UE2A 3MNFA 2I8AA 5FBVB 1P74A 4JLJA 1TM5E 1VL0A 2I0FA 3I5AA 4O4JB 1JB1A 4UU8A 5ECDA 4CHTA 2OBXA 4R83A 2DPGA 5H70A 3IUEA 1AQIA 4IHAA 3A1EA 3GRVA 3TSZA 5I5EA 4IDDA 4YTEA 4AS3A 4M3NA 3LK7A 4UREA 4V2IA 3S4YA 1UBLS 1Q7BA 4JZYA 2O7VA 1KXZA 3IYLW 1DOAA 2IHUA 2PRJA 1YOVA 4FFPA 1PZHA 2CLOB 4L4RA 1QQAA 2XV1A 5KWIA 3Q7PA 4UBNA 5K03A 4WA7A 3KEMA 5CT5A 2C31A 3B12A 3OQ1A 1VJCA 2NW6A 2V5VA 2V9CA 4RVFA 3UQZA 5ADUS 4TQ9A 5KSWB 1P1RA 1VL2A 4S12A 3BDVA 4OQ4A 5F52A 3LYHA 3ORQA 5MN6A 1H94A 4PLGA 5I4IA 2YZ7A 4D8XA 3NC1C 3PC3A 5BSVA 1ONSA 2OBMA 2OCXA 3CN9A 1AGPA 3R24A 3I9V1 3ST7A 3USZA 3NV7A 3K6SB 4IVQA 2JFNA 4LZPA 3RNLA 4PO8A 3RSGA 4F9TA 3KZ1E 1QDLB 2YXDA 4QUGA 1NI4B 5JARA 4E5UA 1J56A 2FUG1 3RSOA 4EDHA 3AYZB 4B76A 4BBZA 3EZ7A 1Y8QB 2ABWA 5ICFA 2MYUA 1E1QD 1T5IA 2CDAA 1O2DA 3CUTA 5A3SA 4B3CA 4BX2A 1Z5GA 2ZYAA 3ETCA 4H17A 3VBEA 2BGIA 4A23A 1L5OA 2K4MA 1Z6PA 2DCMA 1PQYA 2GAAA 4KWCA 1CJKC 1YVEI 4ZAGA 5C0OE 4OLBA 3DBLA 3R0JA 3TZKA 1P81A 2FSHA 3TWOA 2W6ZA 1H2BA 3CRRA 3G0IA 1GAXA 2AG5A 1Y7PA 1OWPA 2GUGA 4E4YA 3NUZA 1GA4A 1Q2XA 1WVIA 3A6KA 2EFGA 3DFKA 3JQCA 1V7QA 4KV7A 1QK3A 4R3WA 3CF0A 4L51A 1Z4NA 3W8RA 1IUNA 1RMTA 2E87A 4XSGA 4AZ0B 3WHIA 3EGEA 2XSZA 3FDZB 1ILWA 1RU3A 3ZK7A 1KAEA 3KUKA 5K3CA 1GFWA 5CB0A 3JATA 3BQNB 4HP8A 4X63A 3THWA 4IJUA 4WNAB 5ILQA 4I3HA 3KOUA 3PICA 3S1AA 4C6TA 4HUJA 1IYZA 3RFFA 4HDOB 3B7WA 4B1FA 3F6BX 3KX2A 3KQPA 3M70A 5IYZB 3QU4A 4NQRA 5AHXA 2VR1A 4ZVTA 5B53A 4IL5A 3BRCA 3A4VA 3PDIA 4M6WA 3UG7A 4URYR 2JAWA 1CR6A 2Q0HA 3PT5A 1Y7TA 1EUDB 1G0NA 2YV2A 3Q5EA 4YH1A 2PUGA 4DDMA 4ZZIA 4IDGA 4JLUA 4L02A 1XPRA 1JB9A 3AVVA 4KITB 4C4OA 4P84A 1QFXA 4UHHA 5H80A 1O4WA 4HDRB 3I0ZA 3ZN2A 4UJ5A 2Q1XA 2WTEA 1GGKA 3E8SA 5M3BA 1XZQA 4KXFB 1T0PA 3FKSD 4NU6A 1SC4A 4MYTA 3JVDA 5A3QA 1HNZB 4WX2B 4BKPA 2JLYA 2IUSA 3K0KA 4KN9S 5EMMA 5TPWA 4EI8A 4D4KA 1DKQA 3NYIA 3WP0A 1GTG1 3ZCXA 4CN9A 1EA5A 2HCJB 2A1UA 2RHMA 4J7CA 2J45A 3VO2A 2H1VA 5JNVA 3I53A 1UH5A 2D5LA 2Q1WA 2X7XA 3C24A 2CXRA 5E38A 4P9NA 1N1EA 2YVAA 1J2UA 4X20A 2EG5A 3CKKA 2PCJA 1IIRA 2VBFA 4LZJA 2HUNA 3PGVA 2GAFA 2HJHA 4V1CA 3RR2A 3ADPA 3VQTA 1ECCA 1VE7A 4G9EA 3GR6A 1CHDA 4XKJA 3KDAA 5F1OA 2YN0A 1ENPA 2NV0A 3M4NA 3I92A 3C98A 4Y9TA 4GLLA 3QLEA 3JAWA 1E0KA 3EXEB 2W7TA 1DTWB 4N82A 5EPUA 1TM4E 3CSUA 2YV4A 3F97A 1IRIA 1NXOA 1PCXA 1UKYA 2FU5C 2PZLA 3DMTC 3W5JA 4AZWA 4REMA 2JRCA 1GUYA 2BONA 4CTMA 4A2WA 2IODA 2WJ6A 4D97A 1DO0A 3QVTA 4NG5A 2G9RA 2W0MA 2WAYA 2OGZA 5ENZA 2IDMA 4B6EA 2VAPA 4TMXA 5EIOA 4E2ZA 4CETA 1RYZA 4TWAA 3TXAA 4RTKA 3HVKA 1PGNA 1S9DA 1CDDA 3FSRA 3ITKA 3HGTA 1KMIY 3ELDA 4I5DA 4XR4A 4D25A 3SHTA 3A6EA 4FDVA 1MEOA 3WOHA 3A3KA 2E55A 3B9QA 3VAAA 3IGFA 1QP8A 4AO7A 5BQFA 1XTKA 2HT1A 4L8GA 4QUHA 4FB5A 3KQVA 3PNPA 4G26A 5IPFA 3BM5A 4FFBA 3A1FA 3BWXA 2UZ3A 3QWFA 3WQBA 1V0JA 3ACCA 2XRZA 3W6UA 1YS4A 4JR1A 1GCAA 4JT2A 3BSYA 2EW1A 4GNRA 4ARSA 1AS3A 2GCNA 4LX0A 5AK6A 3ER8A 3DV0B 4S1VA 3UUGA 2XVXA 1UJ5A 1LSUA 4CMEA 3ZY3A 1TAUA 1EFRA 3PRKE 3U7FB 2GK3A 2JBHA 4UBOA 4BN0A 4HQOA 1TZJA 1EBUA 1JGTA 1KPHA 2DKFA 3KALA 3OM9A 4U6NA 3R9KA 4EARA 2F1IA 4PZZA 3AESB 1R6VA 1KFJB 4CKYA 3AFNA 1XQYA 4LISA 4UBIA 2N46A 5BWLA 4KQ2A 4R98A 3RVBA 2P5YA 4BNZA 2M6LA 4MVJI 3BK7A 5KEIA 2O8EB 2ZDGA 3NV9A 4F4JA 2OESA 3QY9A 1YK1A 1E7QA 1L4NA 3D5QA 1R6TA 1D6MA 4FSXA 7ABPA 5HQ3A 4BV3A 1N6LA 5FUQA 1WPXA 2VJQA 1IJKA 4DUGA 1KQOA 1U9ZA 4DJFC 4DDTA 4QNNA 2WTXA 4HAXA 3BB3A 4L08A 1UOEA 3FJOA 4G0PA 2IZ7A 4PNPA 2B4TO 3TNLA 3VR0A 1BTOA 5AJXA 4Q4DA 3H2KA 4AO8A 3IMKA 3AWDA 4K26A 1RC8A 1E1CB 3EIXA 4CEIB 2G9ZA 3MERA 4WGGA 1VHQA 4K6GA 2A5JA 1QOPB 2BFOA 2EKQA 4ER5A 4L4ZA 1ANKA 4D3ZA 4Z3OA 1J9EA 1GQFA 1Y33E 2H2HA 4I6GA 2QZJA 4L4XA 2BY4A 3H9QA 3L46A 4MQLA 5BORA 3U6KA 3RRBA 4ARAA 2FPRA 4G5RA 3JARB 4OG2A 3TAUA 3VSAA 5JSQA 4H1VA 1CYDA 3IJRA 3GL9A 4IFTA 2DUWA 2DWPA 2IZ1A 5LMCA 5L3VA 4J3FA 3HKEB 4IIBA 2QRMA 3OT1B 4PAQA 5FJJA 3ZKWB 2NXWA 2A88A 5EI5A 4TS3A 3DFZA 1YUMA 3ZBTA 3ZX5A 3HBFA 2AD1A 3DF7A 2XLCA 2FMXA 4Y9UA 1TW2A 2BFEA 4RIIA 3IURA 4EB3A 4KRYA 4GPD1 3DE3X 5I4BA 2E5LB 2YTZA 3OA2A 4CKWA 1FW6A 3CX4A 3K0HA 3G8DA 2IXTA 2P9YA 2I22A 4BVBA 4ZJYA 1E9FA 3IILA 4PS1A 2VJMA 3ISJA 1ELOA 2G0TA 5F1KA 1G2PA 1R9MA 2NX2A 4LXXA 1JQJC 4YRGA 2BKXA 1CLEA 3RBXA 2IHYA 5ALLA 4ZHQB 5H4HA 1X9HA 5A4JA 3LPDA 2IELA 1W0KA 2CDBA 4WZAB 5BSGA 2PAAA 3EWAA 1HF3A 4DM3A 1VGVA 1UKCA 2FG7C 2EX1A 1D3AA 4G5GA 1XNGA 4EF5A 1EK2A 1ODTC 1EVKA 2VHXA 4PG7A 2BP7A 4R69A 1NSTA 1VSQA 3EODA 1CHNA 1FF9A 1DE0A 3EMVA 1R4NA 2FN9A 3N07A 3IBYA 4I9NA 4K9LA 4NOMA 4UATA 1VYTA 4BFSA 4CFZA 2G1PA 1RI3A 1ZWKA 2QD1A 5KINB 1X94A 2C78A 2WD8A 3KYIB 1AKQA 3A1VA 4RF4A 4YCSA 5TY0A 1YOBA 2QPLA 3LL7A 4GUAA 4OA5A 3DVAB 4XJTA 2XYPA 4OO3A 2XCLA 2CBGA 1CVRA 3SYTA 4CZ2A 3KWLA 4QBFA 3EF3A 4LDZA 1TPZA 2XVMA 4AZSA 3P4XA 5DM2A 2QTAA 2QD2A 2V0CA 1JHVA 4KSYA 5D3KA 2GEJA 3AERB 4FZRA 1PP4A 2ORIA 3QMMA 2P8JA 4RPLA 2Q2WA 2QQGA 4WZBA 4MRNA 3MG9A 3O74A 1H05A 2DBQA 3Q2OA 3T7RA 1F9EA 2WVJA 4Q02A 3DMPA 2O2HA 2C8VA 2QL9A 3PDJA 3FI9A 4JK3A 5M04A 3JAWB 4ENVA 1CNMA 3KWMA 2GD0A 3QNUA 2XQVA 2YHSA 1UDAA 5EXPA 5G02A 1P2DA 2B3TA 3HVUA 4W7IA 5EZYB 4A6PA 2ZIFA 1KYIA 2EEPA 2HA3A 5FR1A 1QIDA 2VYQA 1AS0A 1EJBA 5AHKA 4BX3A 5FLYA 1SY7A 2BV3A 2PGDA 2CY0A 2JD1A 2PSDA 1U7HA 1FFGA 1XZEA 3GPIA 4ZICA 1WB9A 4HO1X 5LBUA 4XX1A 1Y1PA 1EFPB 4URFA 3OJOA 4OYHA 5CX1B 2L19A 2BMWA 2G7MC 5EZQA 5ICGA 4BKMA 2MMCA 1JJAA 1R8QA 2BVNA 2AW3A 1EHIA 1BVYF 2QD4A 3BHNA 1GTL1 3JZFA 4ZOCA 2DFPA 4FQ5A 4GAEA 4M0PA 5TJHA 1DKNA 1RWVA 3EVEA 4TT3A 5BSTA 3DZCA 4EHDA 5CA0B 1C4WA 4CF5A 3WL5A 4B2YA 4X54A 5FBKA 3H1AA 2RHBA 3QH4A 1J42A 1M2OA 3KE8A 1PS8A 3N8IA 1A2QA 1P33A 3FFWA 3MRVA 3SK0A 4JLSA 1DJNA 2JW5A 4Y6PA 4ND5A 5CDGA 1WUTA 1IHUA 4PVDA 3SKYA 4NJEA 3RE1A 3UG6A 1C1DB 2AXQA 1UDWA 3LPMA 3RFTA 5YASA 1GG9A 1E7RA 3BTSA 4XGNA 4ZYVA 1RWKA 3KT0A 4N39A 2UVPB 3V9AA 4Y6QA 5BWMA 4UQPA 1CZKA 4ZT3A 3GNSA 3VV3A 3TECE 4ZTUB 1J22A 2IPOA 1O95A 4LC1A 3LCJA 3EF0A 3KVOA 4V39A 3FZEA 2I7CA 3TRHA 1YU6A 3DZKA 4CL0A 1RWPA 5C18A 4OQXA 4X6YA 5JPDA 1C3JA 4PSAA 4P34A 1UKZA 3E6AA 2BN4A 3W4JA 3ABRB 1SVMA 3KWJA 1NQUA 2J5XA 2Y1WA 2C3YA 3LWZA 1U04A 1RHKA 2MSEB 2XWJI 1TO1E 3BILA 2ATXA 2O0LA 4O0MA 3W78A 1E2FA 1VL1A 3LIIA 5DLDA 4QTXA 1N0UA 3GVXA 1E92A 2BUCA 3OLXA 5FV7A 1CTQA 1LW7A 1N0VC 3KCNA 3RNOA 3ANLA 3SC3A 1QO9A 5FO0A 1A4UA 1YGYA 1QG4A 5IUKC 2AF4C 5LJIA 1UAYA 4WJZA 4ZAWA