4ULXA

Crystal structure of ancestral thioredoxin, relative to the last common ancestor of the cyanobacterial, deinococcus and thermus groups, lpbca-l89k mutant.
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
105
structure length
105
Chain Sequence
SVIEVTDENFEQEVLKSDKPVLVDFWAPWCGPCRMIAPIIEELAKEYEGKVKVVKVNVDENPNTAAQYGIRSIPTLLLFKNGQVVDRKVGAQPKEALKERIDKHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LPBCA-L89K THIOREDOXIN
publication title Mutational Studies on Resurrected Ancestral Proteins Reveal Conservation of Site-Specific Amino Acid Preferences Throughout Evolutionary History.
pubmed doi rcsb
source organism Synthetic construct
molecule tags Oxidoreductase
total genus 31
structure length 105
sequence length 105
ec nomenclature ec 4.7.1.4:
pdb deposition date 2014-05-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 4ulxA00
3HY2A 3ERWA 3FY7A 3G7JA 2H0HA 4MF6A 1SL0B 5J41A 2GTUA 2JSYA 5ECIB 5HFKA 2VO4A 4EDYA 20GSA 6GSUA 2VL3A 3L4NA 4ZBAA 1B4QA 1URMA 5CP1A 3IV4A 4IELA 3FZ5A 1K3YA 1A0FA 2B5YA 4TW5A 2VCXA 11GSA 1WMJA 1A0RP 2A2SA 2H1AA 3WGEA 2GLRA 1PRXA 4K9ZA 2ON7A 2AJQB 4JR6A 4KB3A 2GSTA 3ME8A 2LJAA 4ZL8A 4I2TA 4Z7XA 4MABA 1PN9A 1USBA 2LJRA 13GSA 3CXGA 2VIMA 3F4SA 2IJYA 2GSSA 5JCUA 1TRSA 1THOA 4PQ1A 2L6CA 2GSQA 4HZ2A 4PUAA 3UBKA 3HZ8A 2AYTA 1SK1A 1K0OA 2TRXA 3NIVA 1ERUA 1I5GA 2JL4A 4I5QA 1DE1A 1ML6A 4ID0A 1XW5A 1MD3A 3HVXA 5CNWA 1EZKA 3LXZA 1K3LA 2HRNA 4LL1B 4HOJA 5IOWA 3V1WA 2DC5A 3EMPA 1TRWA 1WJKA 5H5SA 2H73A 1WE0A 1K0NA 4G2EA 5DALA 3HA9A 3S9FA 3LEFA 2F8AA 2MYGA 3TRPA 1O81A 1NM3A 2G2QA 5D9XA 3I9V2 1YY7A 4JU5A 3F0IA 5GAND 2WDUA 1U3AA 2IMIA 1IYIA 5INYA 1XWBA 2PMTA 4OWYA 1ZZYA 2VL9A 2NTOA 3M9KA 3I69A 1MD4A 4BPYA 4KCAA 4OD7A 3DKSA 1A2JA 1F3AA 1J9BA 2RLIA 1KEBA 1XWKA 2CZ3A 3GX0A 1X9WB 2XC2A 2O85A 5HR0A 4GTUA 4L5OA 1C72A 1A24A 2ZNMA 1A23A 3TCOA 1R7HA 2N5AA 1EOGA 2X64A 1U3IA 4GQCA 4KA0A 1BQ7A 2WJUA 2RM5A 1E2YA 2JADA 3IDVA 1PKZA 1ON4A 1FO5A 1SKWB 3PH9A 2FGXA 3ZMKA 1A8YA 1GUHA 3P8WA 2K6VA 3M8NA 7GSSA 1YF1A 3M9JA 3EYTA 2WRTA 2MBSA 1X5EA 1MDKA 4MF7A 1GSYA 1LBKA 5HFGA 4RI6A 1JZRA 3TKSC 1TP9A 4DEJA 2E2MA 4PGTA 2LUSA 2VOCA 9GSSA 3F9UA 3L9SA 4RQRA 2CVKA 3GYKA 3H79A 1YKCA 3APSA 2O89A 1PX7A 1JZDA 2PVQA 3QCPA 3IBHA 1PD21 1SK2A 1ZGNA 5HFIA 5EY6A 4AJ6A 2B7JA 3H1NA 5IMZA 1UN2A 3A3TA 2KP1A 4QL9A 4TVEA 3GHAA 1T4YA 3DEXA 2Z9SA 2CVDA 2C0FA 3H8QA 4XCSA 4TR4A 4XS1A 2C1YA 1SKRB 3LFLA 2GSRA 4EL1A 3GMFA 2YZUA 1QFNA 1U6TA 1JFUA 2HSHA 3G9BA 3GL5A 1K0MA 2EIQA 4QL7A 2F9SA 2XPDA 2FWHA 3EMXA 5IMAA 1Z6MA 5B6NA 3LG6A 1OVNA 1X5DA 2H01A 3KGKA 5D96A 1GSDA 3HYPA 2IFQB 4KH7A 3GA4A 3L9UA 5AISA 2C4JA 3KIJA 2ON5A 3FZAA 4FYUA 2V6KA 3ZMLA 2A4VA 4N10A 3CSIA 4ZL9A 1TW9A 4IVFA 4NHZA 4O92A 4HUAA 4IGJA 3QMXA 3CSJA 2H70A 2YANA 4JRRA 6GSVA 4YAVA 1TI1A 3FKFA 3U6VA 1K0DA 2QGVA 2YJ7A 2H1BA 1F6MC 1VF3A 3IAS2 3W8SA 2OBIA 3HCZA 4K7OA 4K7NA 1YKAA 3TDGA 3UEMA 2GDRA 2F3MA 18GSA 4J57E 5FHIA 4EDZA 1DSBA 5EL8A 1XWAA 1S3DA 3KP9A 2NVLA 5JCGA 3UL3A 1NHOA 3GSSA 3RDWA 1GTUA 2I81A 4OCEA 4CDOA 1T1VA 1YQ1A 4AGSA 4IN0A 4KDUA 5IPHA 3ZL5A 4FYBA 4AJ7A 3Q6OA 5C00A 3TJBA 4XTSA 3FEUA 1GULA 1SKSB 2IFQA 3GUSA 4E8EA 5IIZA 1EP8A 1OKDA 1A2MA 1ABAA 4D73B 2HNLA 4O5RA 3QFBC 3VI7A 2OADA 4K1FA 4YQMA 2LRTA 2CA8A 2VL2C 1JZOA 2HFDA 2O8VB 3EU3A 4MZCA 2VUPA 1OE8A 2FY6A 2OACA 1N8JA 4G9HA 5ECNB 1OAZA 3WT1A 3QPMA 4ZB6A 5L71A 4NV5A 2DJKA 4TR1B 2LJKA 2DMLA 5JWRB 3TOUA 1UA5A 1EEMA 4WETA 3GH6A 4MMMA 3APQA 5GZZB 3KTLA 4F0CA 1X0RA 3ZYWA 1PX6A 4K8MA 1K0AA 5IO2A 4PXOA 1ERWA 1ZYEA 2C0DA 4CHSA 1Z5YE 1XW6A 5ELGA 4POMA 2MZCA 4WXTA 2DLXA 3KH9A 3IOSA 4TXVA 2GT5A 4LLRA 4PX1A 4WR5A 4POLA 3GX8A 5ECMB 2E0QA 1B4PA 2HT9A 4L0UA 1JLWA 4I2UA 1SD8A 1M2BA 3HJOA 1OYJA 5G5EA 3D4TA 4D73A 5A4VA 3TJFA 4PNFA 4JBBA 1QQ2A 2K8VA 1DBYA 1AUCA 1XVWA 2V1MA 1FAAA 3F3RA 1EGOA 2REMA 3TJGA 5LCZA 3TKSA 2GVPA 1XVQA 4KDXA 2HZEB 2EC4A 5ABRA 1JZWA 3C8EA 1AQVA 1PMTA 3EE2A 1V2AA 6GSYA 1TK8B 2F51A 2HLSA 1GUMA 2ZUPA 3ERFA 2CT6A 2YWOA 2K18A 3D5JA 3E3EA 2NPBA 5H5RA 4JZQA 3ZVJD 2M46A 3N5OA 6GSTA 3QAGA 2H66A 2PBJA 3CTFA 3A2WA 1SYRA 1ST9A 2BTOT 1KNGA 2L59A 2LSTA 2LTKA 1GSFA 2P5QA 3VK9A 4TN8A 2NDOA 4H86A 1BYEA 1HNBA 5KN3A 5DQSA 3LYPA 5ECQB 2PU9C 3KP8A 2IWTA 1M99A 1ZL9A 5D9TA 3GL3A 1G7EA 4ZB9A 2DIYA 1G6WA 1GLQA 1WP0A 2CVBA 2VD1A 5KN0A 5E59A 1NHYA 2LEGA 3P90A 4FYCA 4TOPA 4IJIA 4HJMA 1GH2A 1JLVA 2HSYA 1TOFA 3DMLA 2H6YA 4ECIA 2LS5A 4P3YB 3D4MA 2HZEA 5JWOB 2K9FA 1TU7A 4MPGA 4GSSA 3G7YA 5B6MA 1VRSD 2GZYA 2WGRA 1V98A 3A2XA 1ZYQB 2YCDA 1FB6A 2IMFA 2B1KA 2AUVA 3F3QA 2PN8A 5DVBA 1XW9A 2OE0A 1FB0A 4Q5FA 4WBJA 3D22A 3L9VA 5KEJA 3PGTA 3TUEA 1XPVA 2LQQA 2JZSA 1RQMA 3ZTLA 3FW2A 3I43A 2IN3A 5E4WA 5EPFA 3Q18A 3A2VA 4I8BA 5G5FA 4K0GA 3FR3A 1QGVA 4GRFA 1BX9A 4WBRD 3KMNA 2XBIA 4BVYA 3RPPA 4Q5NA 4X1UA 4KCEA 1H75A 3TGZA 5J4UA 2OJLA 4V1Ap 3UJ1A 3WT2A 1MDJA 2P0GA 1QMVA 1ILOA 4V1Ag 4MA9A 1N2AA 3KJYA 3TKPA 3GURA 5ECOB 1QXHA 3TRQA 5GSTA 5CRHA 4F9ZA 1BG5A 3DYRA 3UBLA 5IMCA 4K6XA 1GP1A 3US3A 4OCFA 2GQMA 3FZ4A 2L6DA 5B8AA 3MDKA 2V2GA 5J9CA 5ELAA 2H76A 2VL2A 2YV7A 3GKNA 3FHKA 3FK8A 1T4ZA 4PNGA 1XXUA 2QC7A 2GZPA 2H72A 2VCWA 3TKRA 2N5FA 1WOUA 3UIWA 2MMZA 2E2GA 3OR5A 2C80A 3ED3A 2H19A 3EVIA 3ZFBA 1GNWA 2V32A 1XOAA 5JWQB 3UVHA 3M0FA 2GGTA 2YPMA 1G7OA 4EUYA 4NXIA 2YNXA 1O85A 3O6TA 4DSRA 3Q19A 4IBPA 2XPEA 2H8LA 2E7PA 4IKHA 1S3AA 3DWVA 5IO0A 2FWEA 4ZILA 2FCHA 2OA7A 4WKWA 2X8GA 2I9HA 12GSA 1ZCPA 1IYHA 3W8JA 5COHA 3CSHA 1R26A 5ECSA 5DJLA 1HQOA 3HD5A 3LGCA 4F0BA 1GNEA 2VLVA 2H6ZA 1AIUA 2IPAA 2B5XA 1GTIA 3C1RA 3N9JA 2LRNA 3HZ4A 4KNDA 4MZBA 4IP1A 3BCKA 1RK4A 1EEJA 2FNOA 3APOA 5F06A 3IE3A 3LWAA 1EV9A 1GSUA 2YOIA 2YP6A 3LXTA 2DJ2A 2FD3A 2H74A 4N0VA 4XS4B 3GKMA 4N30A 2GQLA 3DRNA 3F4RA 5FT3A 4POBA 1CQHA 1O7UA 3P7XA 5ECHB 1Y6EA 2B1LA 2I4AA 3UOMA 2ALBA 3BCIA 1O73A 3PR8A 3GNJA 4WF5A 3UMAA 1Q98A 4XHMA 1TU8A 3GSTA 1SYXA 2KUCA 1BJXA 4PQHA 1TK0B 2KP2A 3GIXA 3Q74A 5HR1A 4V2NA 2H75A 6GSSA 1ACVA 2DIZA 4OO5A 2RM6A 3VI5A 1EGRA 4JR4A 4ULXA 2B5EA 1ZOFA 4Q5RA 2OE1A 1U88A 4LA1A 2PERA 1EV4A 1YZXA 1XOBA 4OFMA 4NPBA 1R5AA 1X5CA 2LRCA 2XHFA 5ENUA 2VM1A 2L4CA 2IMEA 3WD6A 4WF4A 2IMKA 4MP4A 5HR2A 1A8LA 1F9MA 1OC9B 3UARA 4XRDA 3EINA 3GV1A 3C73A 2JZTA 2LV3A 2H1DA 3DVXA 2OKAA 3KM6A 4BA7A 4TR3A 1THXA 2L5OA 1XCCA 2VAFA 3D21A 1GSQA 3EURA 1UVZA 4ECBA 1F2EA 16GSA 3VWUA 3CRUA 1K0BA 4PUFC 2HZFA 2KOKA 2WCIA 1AAZA 4MPFA 4MJCA 4XRAA 3TB2A 4WEYA 1F37A 4KUNA 1Z7RA 4L5LA 14GSA 2L4QA 3C7MA 3IHQA 2PPTA 2QSIA 3H4KA 5G2ZA 3JCML 3DGQA 4ZBBA 2MBTA 3BJ5A 2IMDA 4JE1A 3GFKA 4GF0A 4LMWA 2P31A 5G1LA 3C71A 5AIVA 3D6IA 3GN3A 4MJAA 2HYXA 3J7Yk 1I9DA 2GS3A 5ECKB 2B6MA 3EWLA 3KXOA 5CREA 2C0GA 1SENA 4GQFA 3EU4A 2B3SA 1OC8A 2FWFA 4ZXGA 1WWJA 3O76A 4N0ZA 1XWGA 2EIRA 2X8HA 3WGDA 1SU9A 3FZ9A 1PGTA 3TKSE 2V41A 2NBSA 4IHUA 4FIWA 5HQPA 4HU9A 1W4VA 1G6YA 2V6OA 2CV4A 5DDLA 1NSWA 3BBYA 1DUGA 5AN1A 4ZIJA 4CW9A 3GKKA 3MSZA 3ZITA 3RAZA 3CMIA 5LD0A 1XFLA 1Z7PA 3IXRA 1M2AA 3M3MA 3W6GA 2LKUA 1TDIA 4BL7A 1V57A 3TJKA 4TR1A 1UC7A 2R3XA 3UVTA 1K0CA 3CYNA 1BEDA 1S3CA 3E0UA 5IMDA 2JSZA 3O3TA 2C8UA 1GLPA 2L57A 2YWIA 5CO3A 2MMOA 2H6XA 2GT6A 4PURA 4ML1A 2R2JA 1Z3EA 4MJBA 4EXJA 3L78A 1V9WA 1T00A 2R4VA 2VCVA 3F63A 5ECPB 1B8XA 4F03A 3ZLPA 2RIIA 3FR6A 3VWWA 1PSQA 3IA1A 3VWVA 1OE7A 4PQIA 1SJ6A 4HS1A 4GXZA 4X43A 2C3QA 1TKDB 5F05A 1X9MB 1M9AA 5DALB 4V2LA 1FOVA 2CAQA 6GSXA 2VD0A 2AB6A 1EWXA 2VCZA 3MWHA 2HRFA 1TI3A 2YV9A 4TXOB 1EP7A 5B8BA 2VCTA 3CRTA 3ZVJA 1Y25A 3FRCA 2F8FA 1BAYA 1VGLA 3KTBA 1KTEA 3QDNA 2JZRA 3ZFLA 5A4UA 2O87A 3QOUA 1SL2B 1AW9A 3E9JB 3FR9A 4KX4A 4MJEA 1WIKA 5D9WA 2D2ZA 4MH3A 4GSTA 2LQOA 3RPNA 1J0FA 1XZOA 4TRXA 3TRXA 1MEKA 2HXKA 1FVKA 1QUWA 4EE0A 3F4TA 2GQKA 1AXDA 5H5QA 1T3BA 1VF2A 2H0IA 3CBUA 1K3OA 4IQ1A 1SD9A 3QAWA 2X99A 1FVJA 5G1KA 4OFTA 1ZMAA 3VPQA 5CRWA 3MAKA 2H1GA 4V2MA 5KN2A 2I3YA 1LU4A 3GTUB 4HJ2A 4TR0A 4IQAA 2R5GA 2YZHA 3HVVA 1QK8A 2R37A 5D73A 2PGTA 1JHBA 4K2DA 2FLSA 2BJXA 2CQ9A 4ILFA 3BD2A 4ISDA 3KD0A 2DJ3A 3G7IA 4O7HA 4KDYA 2XBQA 1KBNA 1MDIA 3KCMA 1V58A 3GKXA 2DJ1A 5DQYA 3ZZXA 1XIYA 4G10A 4TXOA 4IP6A 1FW1A 1RW1A 4EO3A 3DIEA 1W89A 3C1SA 4DSQA 1PA3A 1HNCA 1LJRA 3HDCA 1FG4A 4J2FA 5ID2B 2WB9A 5DCGA 5B7CA 3AY8A 4RI7A 3M1GA 2R6KA 1M7TA 1YEPA 2FHEA 2AHEA 3KZQA 4F2IA 4NMUA 3KEBA 1OC3A 3J7Yb 4GLTA 3QFAC 4MDCA 2H71A 2HI7A 1GSSA 1FHEA 4EVMA 2ES7A 4LMVA 5IQYA 3I6AA 2HE3A 1R5PA 3GTUA 1HD2A 3H93A 4KE3A 3TJJA 2C3TA 4ZB8A 3F6FA 2P5RA 4YAPA 4HQSA 1TTZA 3ZIJA 3BOAA 4L0WA 3VFIA 5IM9A 5KN1A 3SBCA 4J56E 2FWGA 4XS6A 4OO4A 2H0GA 5F0GA 2CX4A 5IMFA 3ZREA 3GH9A 4K7IA 1U87A 4F82A 1M2DA 5CYYA 1WRYA 2YJHA 1GUKA 4HZ4A 1PL2A 4KGIA 4HQZA 3HHVA 1GSEA 2WS2A 1T7PB 3LYKA 5ECRB 1PL1A 2JU5A 3HJMA 5DBQA 1EOHA 3VLNA 5ID2A 1GL8A 3HKRA 3WYWA 2QKEA 1Z9HA 4TKYA 19GSA 3NOFA 2KHPA 1SL1B 5IMVA 4BWQA 3LSZA 2AV4A 3DVWA 1OKTA 1T8EB 1TXXA 3F6DA 1VF1A 5A5KA 1CQGA 4AJ8A 1XBSA 2M80A 2M72A 2CAIA 2YWNA 4G19A 1X9SB 3CTGA 5A4WA 4ACSA 2TRCP 2LNSA 4ECCA 1AC1A 1O6JA 2VM2A 5F07A 1SJIA 5IOXA 4LL4B 2B7KA 1NW2A 2DBCA 17GSA 2G0FA 1SK0A 2PVOC 2LNTA 1B9YC 1VF4A 2A2RA 3UAPA 4IJ3A 1GTBA 5G30A 5ECLB 2RUEA 4HDEA 1M9BA 3A5WA 2OBKA 5C04A 4NV2A 3D0ZA 5CRGA 4MH2A 3P2AA 4I97A 2DJJA 3IK7A 1Q4JA 1MTCA 2WULA 4XIHA 2CZ2A 2J23A 4HEA2 1SJZA 2BMXA 1ERTA 1O8XA 4IS0A 5DJMA 1HNAA 2DSAA 3MNGA 2FA8A 3LQ7A 2I1UA 3ERGA 4L8EA 2MMNA 2K8SA 3IR4A 4QQ7A 2O7KA 4DSSB 5CRDA 4YH2A 3ZIVA 3RHBA 1O8WA 2YN1A 4YQVA 4POKA 4HI7A 3EC3A 4E8HA 2H30A 4I6XA 3ME7A 2WZ9A 1A2LA 4MK3A 4NWYA 2MMAA 3RHCA 4NAXA 4XS4A 1B9XC 1V40A 2VLTA 5G31A 2C3NA 2CX3A 4MF5A 3IK9A 4RQXA 5JCWA 3ISOA 4ZL7A 2OE3A 5D9VA 2VLUA 4WR4A 3LJRA 3KH7A 3RBTA 2JACA 1B48A 3FYGA 3QR6A 2DMMA 3NZNA 2WFCA 3TOTA 2KLXA 4MLYA 2PUKC 2ZCTA 3SWLA 4DVCA 2RUFA 3DXBA 3WGXA 2TIRA 4X0XA 5GSSA 1AQXA 2YWMA 1GTAA 1AQWA 4KSMA 3HVSA 1YJ6A 2IL3A 3VURA 4KAEA 3QD9A 4KSOA 1WPIA 4ML6A 5EVOA 4OFNA 3L0HA 2DJ0A 2GZZA 1YF0A 4K0NA 2AAWA 1XWCA 3K8NA 4BVXA 4DSSA 2X8CA 3HXSA 5GAPD 4BWSA 1OC9A 2N5BA 3IRAA 3TKQA 2EIOA 3KMOA 3VPTA 4OMVA 4KW6A 5DCHA 1TRVA 3ZRDA 2J9HA 5CAXA 1GWCA 5DAKB 4Q5QA 8GSSA 3IAM2 4AF2A 3PINA 4FH8A 2C0EA 4ZBDA 1DE2A 4MCUA 3GRXA 5AIXA 5LNKe 4RUVA 3HJPA 1J08A 4NHWA 5F8BA 1GRXA 1G0TA 3IC4A 4GCIA 5IPGA 1ERVA 1R4WA 2PWJA 4EF0A 1H4OA 1TK5B 6GSWA 5D93A 10GSA 1F3BA 5J9BA 1TJDA 4GSNA 4ECJA 4IW9A 5J3RA 1PQNA 22GSA 3U5RE 4MZWA 5FWGA 1YEXA 4JEDA 4FO5A 1M0UA 1HYUA 3LORA 5AGYA 4HU7A 5D8IA 3R2QA 4O32A 2IIYA 2VCQA 4EKZA 1PKWA 1E6BA 2FUG2 4EC0A 3DD3A 2FA4A 1YDKA 5HR3A 3VWXA 3QAVA 5DAKA 4YQUA 2L5LA 5J5NA 1TRUA 3IPZA 3F8UA 1Z6NA 4N11A 4GWRA
chains in the Genus database with same CATH superfamily
3HVNA 3HY2A 3ERWA 3FY7A 3G7JA 2H0HA 4MF6A 1SL0B 4G0LA 5J41A 2GTUA 2JSYA 5ECIB 1FOHA 2VO4A 5HFKA 4EDYA 20GSA 6GSUA 2VL3A 3L4NA 4ZBAA 1B4QA 1URMA 5CP1A 3IV4A 4IELA 3FZ5A 1K3YA 1A0FA 2B5YA 4TW5A 2VCXA 11GSA 1WMJA 1A0RP 2A2SA 4BVYB 2H1AA 3WGEA 2GLRA 1PRXA 4K9ZA 2ON7A 2AJQB 4JR6A 4KB3A 2GSTA 3ME8A 2LJAA 4ZL8A 4I2TA 4Z7XA 4MABA 1PN9A 1USBA 2LJRA 13GSA 3CXGA 2VIMA 3F4SA 2IJYA 2GSSA 5JCUA 1TRSA 1THOA 4PQ1A 2L6CA 2GSQA 4HZ2A 4PUAA 3UBKA 3HZ8A 2AYTA 1SK1A 1K0OA 2TRXA 3NIVA 4K2XA 1ERUA 1I5GA 2JL4A 4I5QA 1DE1A 1ML6A 4ID0A 1XW5A 1MD3A 3HVXA 5CNWA 1EZKA 3LXZA 1K3LA 2HRNA 4LL1B 4HOJA 5IOWA 3V1WA 2DC5A 3EMPA 1TRWA 1WJKA 5H5SA 2H73A 2A4HA 1WE0A 1K0NA 4G2EA 5DALA 3HA9A 3S9FA 3LEFA 2F8AA 2MYGA 3TRPA 1O81A 1NM3A 2G2QA 5D9XA 3I9V2 1YY7A 4JU5A 3F0IA 5GAND 4G0KA 2WDUA 1U3AA 2IMIA 1IYIA 5INYA 1XWBA 2PMTA 4OWYA 1ZZYA 2VL9A 2NTOA 3M9KA 3I69A 1MD4A 4BPYA 4KCAA 4OD7A 3DKSA 1A2JA 1F3AA 1J9BA 2RLIA 1KEBA 1XWKA 2CZ3A 3GX0A 1X9WB 2XC2A 2O85A 2R0PA 5HR0A 4GTUA 4L5OA 1C72A 1A24A 2ZNMA 1A23A 3TCOA 1R7HA 2N5AA 1EOGA 2X64A 1U3IA 4GQCA 4KA0A 1BQ7A 2WJUA 2RM5A 1E2YA 4USSA 2JADA 3IDVA 1PKZA 1ON4A 1FO5A 1SKWB 3PH9A 2FGXA 3ZMKA 1A8YA 1GUHA 3P8WA 2K6VA 3M8NA 7GSSA 1YF1A 3M9JA 3EYTA 2WRTA 2MBSA 1X5EA 1MDKA 4MF7A 1GSYA 1LBKA 5HFGA 4RI6A 1JZRA 3TKSC 1TP9A 4DEJA 2E2MA 4PGTA 2LUSA 2VOCA 9GSSA 3F9UA 3L9SA 4RQRA 2CVKA 3GYKA 3H79A 1YKCA 3APSA 2O89A 1PX7A 1JZDA 2PVQA 3QCPA 3IBHA 1PD21 1SK2A 1ZGNA 5HFIA 5EY6A 4AJ6A 2B7JA 3H1NA 5IMZA 1UN2A 3A3TA 2KP1A 4QL9A 3IC8A 4TVEA 3GHAA 1T4YA 3DEXA 2Z9SA 2CVDA 2C0FA 3H8QA 4XCSA 4TR4A 4XS1A 2C1YA 1SKRB 3LFLA 2GSRA 4EL1A 3GMFA 2YZUA 1QFNA 1U6TA 1JFUA 2HSHA 3G9BA 3GL5A 1K0MA 2EIQA 4QL7A 2F9SA 2XPDA 2FWHA 3EMXA 5IMAA 1Z6MA 2HRKA 5B6NA 3LG6A 1OVNA 1ZYNA 1X5DA 2H01A 3KGKA 5D96A 1GSDA 3HYPA 2IFQB 4KH7A 3GA4A 3L9UA 5AISA 2C4JA 3KIJA 2ON5A 3FZAA 4FYUA 2V6KA 3ZMLA 2A4VA 4N10A 3CSIA 4ZL9A 1TW9A 4IVFA 4NHZA 4O92A 4HUAA 4IGJA 3QMXA 3CSJA 2H70A 2YANA 4JRRA 6GSVA 4YAVA 1TI1A 3FKFA 3U6VA 1K0DA 2QGVA 2YJ7A 2H1BA 1F6MC 1VF3A 3IAS2 3W8SA 2OBIA 3HCZA 4K7OA 4K7NA 3IHGA 1YKAA 3TDGA 3UEMA 2GDRA 2F3MA 18GSA 4J57E 5FHIA 4EDZA 1DSBA 5EL8A 1XWAA 4YKFA 1S3DA 3KP9A 2NVLA 5JCGA 3UL3A 1NHOA 3GSSA 3RDWA 1GTUA 2I81A 4OCEA 4CDOA 1T1VA 1YQ1A 4AGSA 4IN0A 4KDUA 5IPHA 3ZL5A 4FYBA 4AJ7A 3Q6OA 5C00A 3TJBA 4XTSA 3FEUA 1GULA 1SKSB 2IFQA 3GUSA 4E8EA 5IIZA 1EP8A 1OKDA 1A2MA 1ABAA 4D73B 2HNLA 4O5RA 3QFBC 3VI7A 2OADA 4K5SA 4K1FA 4YQMA 2LRTA 2CA8A 2DKIA 2VL2C 1JZOA 2HFDA 2O8VB 3EU3A 4MZCA 2VUPA 1OE8A 2FY6A 2OACA 1N8JA 4G9HA 5ECNB 1OAZA 3WT1A 3QPMA 4ZB6A 5L71A 3MIXA 4NV5A 2DJKA 4TR1B 2LJKA 2DMLA 5JWRB 3TOUA 1UA5A 1EEMA 4WETA 3GH6A 4MMMA 3APQA 5GZZB 3KTLA 4F0CA 1X0RA 3ZYWA 1PX6A 4K8MA 1K0AA 5IO2A 4PXOA 1ERWA 1ZYEA 2C0DA 4CHSA 1Z5YE 1XW6A 5ELGA 4POMA 2MZCA 4WXTA 2DLXA 3KH9A 3IOSA 4TXVA 2GT5A 4LLRA 4PX1A 4WR5A 4POLA 3GX8A 5ECMB 2E0QA 1B4PA 2HT9A 4L0UA 1JLWA 4I2UA 1SD8A 1M2BA 3HJOA 1OYJA 5G5EA 3D4TA 4D73A 5A4VA 3TJFA 4Z2UA 4PNFA 4JBBA 1QQ2A 2K8VA 1DBYA 1AUCA 1XVWA 2V1MA 1FAAA 3F3RA 1EGOA 2REMA 3TJGA 5LCZA 3TKSA 5BRTA 1PFOA 2GVPA 1XVQA 4KDXA 2HZEB 2EC4A 5ABRA 1JZWA 3C8EA 1AQVA 5KOWA 1PMTA 3EE2A 1V2AA 4FQUA 6GSYA 2UZ8A 1TK8B 1XG8A 2F51A 2HLSA 1GUMA 2ZUPA 3ERFA 2CT6A 2YWOA 2K18A 3D5JA 3E3EA 2NPBA 5H5RA 2HRAA 4JZQA 3ZVJD 2M46A 3N5OA 6GSTA 3QAGA 4Z2RA 2H66A 2PBJA 3CTFA 3A2WA 1SYRA 1ST9A 2BTOT 2A2PA 1KNGA 2L59A 2LSTA 2LTKA 1GSFA 2P5QA 3VK9A 4TN8A 2NDOA 4H86A 1BYEA 1HNBA 5KN3A 5DQSA 3LYPA 5ECQB 2PU9C 3KP8A 2IWTA 1M99A 1ZL9A 5D9TA 3GL3A 1G7EA 4ZB9A 2DIYA 1G6WA 1GLQA 1WP0A 2CVBA 2VD1A 5KN0A 1NHYA 2LEGA 5E59A 3P90A 4FYCA 4TOPA 4IJIA 4HJMA 1GH2A 1JLVA 2HSYA 1TOFA 3DMLA 2H6YA 4ECIA 2LS5A 4P3YB 3D4MA 2HZEA 5JWOB 2QA1A 4EIQA 2K9FA 1TU7A 4MPGA 4GSSA 3G7YA 5B6MA 1VRSD 2GZYA 2WGRA 1V98A 3A2XA 1ZYQB 2YCDA 1FB6A 2IMFA 2B1KA 2AUVA 3F3QA 2PN8A 5DVBA 1XW9A 1PN0A 2X4AA 2OE0A 1FB0A 4Q5FA 4WBJA 3D22A 3L9VA 5KEJA 3PGTA 3TUEA 1XPVA 4KF9A 2LQQA 2JZSA 1RQMA 3ZTLA 3FW2A 3I43A 2IN3A 5E4WA 5EPFA 3Q18A 3A2VA 4I8BA 5G5FA 4K0GA 3FR3A 1QGVA 4GRFA 1BX9A 4WBRD 3KMNA 2XBIA 4BVYA 3RPPA 4Q5NA 4X1UA 4KCEA 1H75A 3TGZA 5J4UA 2OJLA 4V1Ap 3UJ1A 3WT2A 1MDJA 2P0GA 1QMVA 1ILOA 4V1Ag 4MA9A 1N2AA 3KJYA 3TKPA 3GURA 5ECOB 1QXHA 3TRQA 5GSTA 5CRHA 4F9ZA 1BG5A 3DYRA 3UBLA 5IMCA 4K6XA 1GP1A 3US3A 4OCFA 2GQMA 3FZ4A 2L6DA 5B8AA 3MDKA 2V2GA 5J9CA 5ELAA 2H76A 2VL2A 2YV7A 3GKNA 3FHKA 3FK8A 1T4ZA 4PNGA 1XXUA 2QC7A 2GZPA 2H72A 2VCWA 3TKRA 2N5FA 1WOUA 3UIWA 2MMZA 2E2GA 3OR5A 2C80A 3ED3A 2H19A 3EVIA 3ZFBA 2R0GA 1GNWA 2V32A 1XOAA 5JWQB 3UVHA 3M0FA 2GGTA 2YPMA 1G7OA 4EUYA 4NXIA 2YNXA 1O85A 3O6TA 4DSRA 4G0IA 3Q19A 4IBPA 2XPEA 2H8LA 2E7PA 4IKHA 1S3AA 3DWVA 5IO0A 2FWEA 4ZILA 2FCHA 2OA7A 4WKWA 2X8GA 2I9HA 12GSA 1ZCPA 1IYHA 3W8JA 5COHA 3CSHA 1R26A 5ECSA 5DJLA 1HQOA 3HD5A 3LGCA 4F0BA 4O5QA 1GNEA 2VLVA 2H6ZA 4HSCX 1AIUA 4PTSA 2IPAA 2B5XA 1GTIA 3C1RA 3N9JA 2LRNA 3HZ4A 4KNDA 4MZBA 1M3IA 4IP1A 3BCKA 1RK4A 1EEJA 2FNOA 3APOA 5F06A 3IE3A 3LWAA 1EV9A 1GSUA 2YOIA 2YP6A 3LXTA 2DJ2A 2FD3A 2H74A 4N0VA 4XS4B 3GKMA 4N30A 2GQLA 3DRNA 3F4RA 5FT3A 4POBA 1CQHA 1O7UA 3P7XA 5ECHB 1Y6EA 2B1LA 2I4AA 3UOMA 4A5PA 2ALBA 3BCIA 1O73A 3PR8A 3GNJA 4WF5A 3UMAA 1Q98A 4XHMA 1TU8A 3GSTA 1SYXA 2KUCA 1BJXA 4PQHA 1TK0B 2KP2A 3GIXA 3Q74A 5HR1A 4V2NA 2H75A 6GSSA 1ACVA 2DIZA 4OO5A 2RM6A 3VI5A 1EGRA 4JR4A 4ULXA 2B5EA 1ZOFA 4Q5RA 2OE1A 1U88A 4LA1A 2PERA 1EV4A 1YZXA 1XOBA 4OFMA 4NPBA 1R5AA 1X5CA 2LRCA 2XHFA 3FMWA 5ENUA 2R0CA 4BVXB 1M3JA 2VM1A 2L4CA 2IMEA 3WD6A 4WF4A 2IMKA 4MP4A 5HR2A 1A8LA 1F9MA 1OC9B 3UARA 2QA2A 4XRDA 3EINA 3GV1A 3C73A 2JZTA 2LV3A 2H1DA 3DVXA 2OKAA 3KM6A 4BA7A 4CY8A 4TR3A 1THXA 2L5OA 1XCCA 2VAFA 3D21A 1GSQA 3EURA 1UVZA 4ECBA 1F2EA 16GSA 3VWUA 3CRUA 1K0BA 4PUFC 2HZFA 2KOKA 2WCIA 1AAZA 4BIKA 4MPFA 4MJCA 4XRAA 3TB2A 4WEYA 1F37A 4KUNA 1Z7RA 4L5LA 14GSA 2L4QA 3PPUA 3C7MA 2HSMA 3IHQA 2PPTA 2QSIA 3H4KA 5G2ZA 3JCML 3LW9A 3DGQA 4ZBBA 4BL7B 2MBTA 3BJ5A 2IMDA 4JE1A 3GFKA 4GF0A 4LMWA 2P31A 5G1LA 3C71A 5AIVA 3D6IA 3GN3A 4MJAA 2HYXA 3J7Yk 1I9DA 2GS3A 5ECKB 2B6MA 3EWLA 1ZYPA 3KXOA 5CREA 2C0GA 1SENA 4GQFA 3EU4A 2B3SA 1OC8A 2FWFA 4ZXGA 1WWJA 3O76A 4N0ZA 1XWGA 2EIRA 2X8HA 3WGDA 1SU9A 3FZ9A 1PGTA 3TKSE 2V41A 2NBSA 4Z2TA 4IHUA 4FIWA 5HQPA 4HU9A 3R3EA 1W4VA 1G6YA 2V6OA 2CV4A 5DDLA 1NSWA 3BBYA 1DUGA 5AN1A 4ZIJA 4CW9A 3GKKA 3MSZA 3ZITA 3RAZA 3CMIA 5LD0A 1XFLA 1Z7PA 3IXRA 1M2AA 3M3MA 3W6GA 2LKUA 1TDIA 4BL7A 1V57A 3TJKA 4TR1A 1UC7A 2R3XA 3UVTA 1K0CA 3CYNA 1BEDA 1S3CA 3E0UA 5IMDA 2JSZA 3O3TA 2C8UA 1GLPA 2L57A 2YWIA 5CO3A 2MMOA 2H6XA 2GT6A 4PURA 4ML1A 2R2JA 1Z3EA 4MJBA 4EXJA 3L78A 1V9WA 1T00A 2R4VA 2VCVA 3F63A 5ECPB 1B8XA 4F03A 3ZLPA 2RIIA 3FR6A 3VWWA 1PSQA 3EPTA 3IA1A 3VWVA 1OE7A 4PQIA 1SJ6A 4HS1A 4GXZA 4X43A 2C3QA 1TKDB 5F05A 1X9MB 1M9AA 5DALB 4V2LA 1FOVA 2CAQA 6GSXA 2VD0A 2AB6A 1EWXA 2VCZA 3MWHA 2HRFA 1TI3A 2YV9A 4TXOB 1EP7A 5B8BA 2VCTA 3CRTA 3ZVJA 1Y25A 3FRCA 2F8FA 1BAYA 1S3RA 4O5UA 1VGLA 3KTBA 1KTEA 4CY6A 3QDNA 2JZRA 3ZFLA 5A4UA 2O87A 3QOUA 1SL2B 1AW9A 3E9JB 3FR9A 4KX4A 4MJEA 1WIKA 5D9WA 2D2ZA 4MH3A 4GSTA 2LQOA 3RPNA 1J0FA 1XZOA 4TRXA 3TRXA 1MEKA 2HXKA 1FVKA 1QUWA 4EE0A 3F4TA 2GQKA 1AXDA 5H5QA 1T3BA 1VF2A 2H0IA 3CBUA 1K3OA 4IQ1A 1SD9A 3QAWA 2X99A 1FVJA 5G1KA 4OFTA 1ZMAA 3VPQA 5CRWA 3MAKA 2H1GA 4V2MA 5KN2A 2I3YA 1LU4A 3GTUB 4HJ2A 4TR0A 4IQAA 2R5GA 2YZHA 3HVVA 1QK8A 2R37A 5D73A 2PGTA 1JHBA 4K2DA 2FLSA 2BJXA 2CQ9A 4ILFA 3BD2A 4ISDA 3KD0A 2DJ3A 3G7IA 4O7HA 4KDYA 2XBQA 1KBNA 1MDIA 3KCMA 1V58A 3GKXA 2DJ1A 5DQYA 3ZZXA 1XIYA 4G10A 4TXOA 4IP6A 4EIPA 1FW1A 1RW1A 4EO3A 3DIEA 1W89A 3C1SA 4DSQA 1PA3A 1HNCA 1LJRA 3HDCA 1FG4A 4J2FA 5ID2B 2WB9A 5DCGA 5B7CA 3AY8A 4RI7A 3M1GA 2R6KA 4MNNA 1M7TA 1YEPA 2FHEA 2AHEA 3KZQA 4F2IA 4NMUA 3KEBA 1OC3A 3J7Yb 4GLTA 3QFAC 4MDCA 2H71A 2HI7A 1GSSA 1FHEA 4EVMA 2ES7A 4LMVA 5IQYA 3I6AA 2HE3A 1R5PA 3GTUA 1HD2A 3H93A 4KE3A 3TJJA 2C3TA 4ZB8A 3F6FA 2P5RA 4YAPA 4HQSA 1TTZA 3ZIJA 3BOAA 4L0WA 3VFIA 5IM9A 5KN1A 3SBCA 4J56E 2FWGA 4XS6A 4OO4A 2H0GA 5F0GA 2CX4A 5IMFA 3ZREA 3GH9A 4K7IA 1U87A 4F82A 1M2DA 5CYYA 1WRYA 2YJHA 1GUKA 4HZ4A 1PL2A 4KGIA 4HQZA 3HHVA 1GSEA 2WS2A 1T7PB 3LYKA 5ECRB 1PL1A 2JU5A 3HJMA 5DBQA 1EOHA 3VLNA 5ID2A 1GL8A 3HKRA 3WYWA 2QKEA 1Z9HA 4TKYA 19GSA 3NOFA 2KHPA 1SL1B 5IMVA 4BWQA 3LSZA 2AV4A 3DVWA 1OKTA 1T8EB 1TXXA 3F6DA 1VF1A 5A5KA 1CQGA 4AJ8A 1XBSA 2M80A 2M72A 2CAIA 2YWNA 4G19A 1X9SB 3CTGA 5A4WA 4K5RA 4ACSA 2TRCP 2LNSA 4ECCA 1AC1A 1O6JA 2VM2A 5F07A 1SJIA 5IOXA 4LL4B 2B7KA 1NW2A 2DBCA 17GSA 2G0FA 1SK0A 2PVOC 2LNTA 1B9YC 1VF4A 2A2RA 3UAPA 4IJ3A 1GTBA 5G30A 2RUEA 5ECLB 4HDEA 1M9BA 3A5WA 2OBKA 5C04A 4NV2A 5BMUA 3D0ZA 5CRGA 4MH2A 3P2AA 4I97A 2DJJA 3IK7A 1Q4JA 1MTCA 2WULA 4XIHA 2CZ2A 2J23A 4HEA2 1SJZA 2BMXA 1ERTA 1O8XA 4IS0A 5DJMA 1HNAA 2DSAA 3MNGA 2FA8A 3LQ7A 2I1UA 3ERGA 4L8EA 2MMNA 2K8SA 3IR4A 4QQ7A 2O7KA 4DSSB 5CRDA 4YH2A 3ZIVA 3RHBA 1O8WA 2YN1A 4YQVA 4POKA 4HI7A 3EC3A 4E8HA 2H30A 4I6XA 3A5IA 3ME7A 2WZ9A 1A2LA 4MK3A 4NWYA 2MMAA 3RHCA 4NAXA 4XS4A 1B9XC 1V40A 2VLTA 5G31A 2C3NA 2CX3A 4MF5A 3IK9A 4RQXA 5JCWA 3ISOA 4ZL7A 2OE3A 5D9VA 2VLUA 4WR4A 3LJRA 3KH7A 3RBTA 2JACA 1B48A 3FYGA 3MYDA 3QR6A 2DMMA 2DKHA 3NZNA 2WFCA 3TOTA 2KLXA 4MLYA 2PUKC 2ZCTA 3SWLA 4DVCA 2RUFA 3DXBA 4YKGA 3WGXA 2TIRA 4X0XA 5GSSA 1AQXA 2YWMA 1GTAA 1AQWA 4KSMA 3HVSA 1YJ6A 2IL3A 3VURA 4KAEA 3CQFA 3QD9A 4KSOA 1WPIA 4ML6A 5EVOA 4OFNA 3L0HA 2DJ0A 2GZZA 1YF0A 4K0NA 2AAWA 1XWCA 3K8NA 4BVXA 4DSSA 2X8CA 3HXSA 5GAPD 4BWSA 4ICYA 1OC9A 5KOXA 2N5BA 3IRAA 3TKQA 2EIOA 3KMOA 3VPTA 4OMVA 4KW6A 5DCHA 1TRVA 3ZRDA 2J9HA 5CAXA 1GWCA 5DAKB 4Q5QA 8GSSA 3IAM2 4AF2A 3PINA 4FH8A 2C0EA 4ZBDA 2X49A 1DE2A 4MCUA 3GRXA 5AIXA 5LNKe 4RUVA 3HJPA 1J08A 4NHWA 5F8BA 1GRXA 1G0TA 3IC4A 4GCIA 5IPGA 1ERVA 1R4WA 2PWJA 4EF0A 1H4OA 1TK5B 6GSWA 5D93A 10GSA 1F3BA 5J9BA 1TJDA 4GSNA 4ECJA 4IW9A 5J3RA 1PQNA 22GSA 3U5RE 4MZWA 5FWGA 1YEXA 4JEDA 4FO5A 1M0UA 1HYUA 3LORA 5AGYA 4HU7A 5D8IA 3R2QA 4O32A 2IIYA 2VCQA 4EKZA 1PKWA 1E6BA 2FUG2 4EC0A 3DD3A 2FA4A 1YDKA 5HR3A 3VWXA 3QAVA 5DAKA 4YQUA 2L5LA 5J5NA 1TRUA 3IPZA 3F8UA 1Z6NA 4N11A 4X4JA 4GWRA
chains in the Genus database with same CATH topology
3HY2A 3ERWA 3FY7A 3G7JA 2H0HA 4MF6A 1SL0B 4G0LA 5J41A 2GTUA 2JSYA 5ECIB 1FOHA 2VO4A 5HFKA 4EDYA 20GSA 6GSUA 2VL3A 3L4NA 4ZBAA 1B4QA 1URMA 5CP1A 3IV4A 4IELA 3FZ5A 1K3YA 1A0FA 2B5YA 4TW5A 2VCXA 11GSA 1WMJA 1A0RP 2A2SA 4BVYB 2H1AA 3WGEA 2GLRA 1PRXA 4K9ZA 2ON7A 2AJQB 4JR6A 4KB3A 2GSTA 3ME8A 2LJAA 4ZL8A 4I2TA 4Z7XA 4MABA 1PN9A 1USBA 2LJRA 13GSA 3CXGA 2VIMA 3F4SA 2IJYA 2GSSA 5JCUA 1TRSA 1THOA 4PQ1A 2L6CA 2GSQA 4HZ2A 4PUAA 3UBKA 3HZ8A 2AYTA 1SK1A 1K0OA 2TRXA 3NIVA 4K2XA 1ERUA 1I5GA 2JL4A 4I5QA 1DE1A 1ML6A 4ID0A 1XW5A 1MD3A 3HVXA 5CNWA 1EZKA 3LXZA 1K3LA 2HRNA 4LL1B 4HOJA 5IOWA 3V1WA 2DC5A 3EMPA 1TRWA 1WJKA 5H5SA 2H73A 2A4HA 1WE0A 1K0NA 4G2EA 5DALA 3HA9A 3S9FA 3LEFA 2F8AA 2MYGA 3TRPA 1O81A 1NM3A 2G2QA 5D9XA 3I9V2 1YY7A 4JU5A 3F0IA 5GAND 4G0KA 2WDUA 1U3AA 2IMIA 1IYIA 5INYA 1XWBA 2PMTA 4OWYA 1ZZYA 2VL9A 2NTOA 3M9KA 3I69A 1MD4A 4BPYA 4KCAA 4OD7A 3DKSA 1A2JA 1F3AA 1J9BA 2RLIA 1KEBA 1XWKA 2CZ3A 3GX0A 1X9WB 2XC2A 2O85A 2R0PA 5HR0A 4GTUA 4L5OA 1C72A 1A24A 2ZNMA 1A23A 3TCOA 1R7HA 2N5AA 1EOGA 2X64A 1U3IA 4GQCA 4KA0A 1BQ7A 2WJUA 2RM5A 1E2YA 4USSA 2JADA 3IDVA 1PKZA 1ON4A 1FO5A 1SKWB 3PH9A 2FGXA 3ZMKA 1A8YA 1GUHA 3P8WA 2K6VA 3M8NA 7GSSA 1YF1A 3M9JA 3EYTA 2WRTA 2MBSA 1X5EA 1MDKA 4MF7A 1GSYA 1LBKA 5HFGA 4RI6A 1JZRA 3TKSC 1TP9A 4DEJA 2E2MA 4PGTA 2LUSA 2VOCA 9GSSA 3F9UA 3L9SA 4RQRA 2CVKA 3GYKA 3H79A 1YKCA 3APSA 2O89A 1PX7A 1JZDA 2PVQA 3QCPA 3IBHA 1PD21 1SK2A 1ZGNA 5HFIA 5EY6A 4AJ6A 2B7JA 3H1NA 5IMZA 1UN2A 3A3TA 2KP1A 4QL9A 3IC8A 4TVEA 3GHAA 1T4YA 3DEXA 2Z9SA 2CVDA 2C0FA 3H8QA 4XCSA 4TR4A 4XS1A 2C1YA 1SKRB 3LFLA 2GSRA 4EL1A 3GMFA 2YZUA 1QFNA 1U6TA 1JFUA 2HSHA 3G9BA 3GL5A 1K0MA 2EIQA 4QL7A 2F9SA 2XPDA 2FWHA 3EMXA 5IMAA 1Z6MA 2HRKA 5B6NA 3LG6A 1OVNA 1ZYNA 1X5DA 2H01A 3KGKA 5D96A 1GSDA 3HYPA 2IFQB 4KH7A 3GA4A 3L9UA 5AISA 2C4JA 3KIJA 2ON5A 3FZAA 4FYUA 2V6KA 3ZMLA 2A4VA 4N10A 3CSIA 4ZL9A 1TW9A 4IVFA 4NHZA 4O92A 4HUAA 4IGJA 3QMXA 3CSJA 2H70A 2YANA 4JRRA 6GSVA 4YAVA 1TI1A 3FKFA 3U6VA 1K0DA 2QGVA 2YJ7A 2H1BA 1F6MC 1VF3A 3IAS2 3W8SA 2OBIA 3HCZA 4K7OA 4K7NA 3IHGA 1YKAA 3TDGA 3UEMA 2GDRA 2F3MA 18GSA 4J57E 5FHIA 4EDZA 1DSBA 5EL8A 1XWAA 4YKFA 1S3DA 3KP9A 2NVLA 5JCGA 3UL3A 1NHOA 3GSSA 3RDWA 1GTUA 2I81A 4OCEA 4CDOA 1T1VA 1YQ1A 4AGSA 4IN0A 4KDUA 5IPHA 3ZL5A 4FYBA 4AJ7A 3Q6OA 5C00A 3TJBA 4XTSA 3FEUA 1GULA 1SKSB 2IFQA 3GUSA 4E8EA 5IIZA 1EP8A 1OKDA 1A2MA 1ABAA 4D73B 2HNLA 4O5RA 3QFBC 3VI7A 2OADA 4K5SA 4K1FA 4YQMA 2LRTA 2CA8A 2DKIA 2VL2C 1JZOA 2HFDA 2O8VB 3EU3A 4MZCA 2VUPA 1OE8A 2FY6A 2OACA 1N8JA 4G9HA 5ECNB 1OAZA 3WT1A 3QPMA 4ZB6A 5L71A 3MIXA 4NV5A 2DJKA 4TR1B 2LJKA 2DMLA 5JWRB 3TOUA 1UA5A 1EEMA 4WETA 3GH6A 4MMMA 3APQA 5GZZB 3KTLA 4F0CA 1X0RA 3ZYWA 1PX6A 4K8MA 1K0AA 5IO2A 4PXOA 1ERWA 1ZYEA 2C0DA 4CHSA 1Z5YE 1XW6A 5ELGA 4POMA 2MZCA 4WXTA 2DLXA 3KH9A 3IOSA 4TXVA 2GT5A 4LLRA 4PX1A 4WR5A 4POLA 3GX8A 5ECMB 2E0QA 1B4PA 2HT9A 4L0UA 1JLWA 4I2UA 1SD8A 1M2BA 3HJOA 1OYJA 5G5EA 3D4TA 4D73A 5A4VA 3TJFA 4Z2UA 4PNFA 4JBBA 1QQ2A 2K8VA 1DBYA 1AUCA 1XVWA 2V1MA 1FAAA 3F3RA 1EGOA 2REMA 3TJGA 5LCZA 3TKSA 5BRTA 2GVPA 1XVQA 4KDXA 2HZEB 2EC4A 5ABRA 1JZWA 3C8EA 1AQVA 5KOWA 1PMTA 3EE2A 1V2AA 4FQUA 6GSYA 2UZ8A 1TK8B 2F51A 2HLSA 1GUMA 2ZUPA 3ERFA 2CT6A 2YWOA 2K18A 3D5JA 3E3EA 2NPBA 5H5RA 2HRAA 4JZQA 3ZVJD 2M46A 3N5OA 6GSTA 3QAGA 4Z2RA 2H66A 2PBJA 3CTFA 3A2WA 1SYRA 1ST9A 2BTOT 2A2PA 1KNGA 2L59A 2LSTA 2LTKA 1GSFA 2P5QA 3VK9A 4TN8A 2NDOA 4H86A 1BYEA 1HNBA 5KN3A 5DQSA 3LYPA 5ECQB 2PU9C 3KP8A 2IWTA 1M99A 1ZL9A 5D9TA 3GL3A 1G7EA 4ZB9A 2DIYA 1G6WA 1GLQA 1WP0A 2CVBA 2VD1A 5KN0A 1NHYA 2LEGA 5E59A 3P90A 4FYCA 4TOPA 4IJIA 4HJMA 1GH2A 1JLVA 2HSYA 1TOFA 3DMLA 2H6YA 4ECIA 2LS5A 4P3YB 3D4MA 2HZEA 5JWOB 2QA1A 4EIQA 2K9FA 1TU7A 4MPGA 4GSSA 3G7YA 5B6MA 1VRSD 2GZYA 2WGRA 1V98A 3A2XA 1ZYQB 2YCDA 1FB6A 2IMFA 2B1KA 2AUVA 3F3QA 2PN8A 5DVBA 1XW9A 1PN0A 2X4AA 2OE0A 1FB0A 4Q5FA 4WBJA 3D22A 3L9VA 5KEJA 3PGTA 3TUEA 1XPVA 4KF9A 2LQQA 2JZSA 1RQMA 3ZTLA 3FW2A 3I43A 2IN3A 5E4WA 5EPFA 3Q18A 3A2VA 4I8BA 5G5FA 4K0GA 3FR3A 1QGVA 4GRFA 1BX9A 4WBRD 3KMNA 2XBIA 4BVYA 3RPPA 4Q5NA 4X1UA 4KCEA 1H75A 3TGZA 5J4UA 2OJLA 4V1Ap 3UJ1A 3WT2A 1MDJA 2P0GA 1QMVA 1ILOA 4V1Ag 4MA9A 1N2AA 3KJYA 3TKPA 3GURA 5ECOB 1QXHA 3TRQA 5GSTA 5CRHA 4F9ZA 1BG5A 3DYRA 3UBLA 5IMCA 4K6XA 1GP1A 3US3A 4OCFA 2GQMA 3FZ4A 2L6DA 5B8AA 3MDKA 2V2GA 5J9CA 5ELAA 2H76A 2VL2A 2YV7A 3GKNA 3FHKA 3FK8A 1T4ZA 4PNGA 1XXUA 2QC7A 2GZPA 2H72A 2VCWA 3TKRA 2N5FA 1WOUA 3UIWA 2MMZA 2E2GA 3OR5A 2C80A 3ED3A 2H19A 3EVIA 3ZFBA 2R0GA 1GNWA 2V32A 1XOAA 5JWQB 3UVHA 3M0FA 2GGTA 2YPMA 1G7OA 4EUYA 4NXIA 2YNXA 1O85A 3O6TA 4DSRA 4G0IA 3Q19A 4IBPA 2XPEA 2H8LA 2E7PA 4IKHA 1S3AA 3DWVA 5IO0A 2FWEA 4ZILA 2FCHA 2OA7A 4WKWA 2X8GA 2I9HA 12GSA 1ZCPA 1IYHA 3W8JA 5COHA 3CSHA 1R26A 5ECSA 5DJLA 1HQOA 3HD5A 3LGCA 4F0BA 4O5QA 1GNEA 2VLVA 2H6ZA 4PTSA 1AIUA 2IPAA 2B5XA 1GTIA 3C1RA 3N9JA 2LRNA 3HZ4A 4KNDA 4MZBA 4IP1A 3BCKA 1RK4A 1EEJA 2FNOA 3APOA 5F06A 3IE3A 3LWAA 1EV9A 1GSUA 2YOIA 2YP6A 3LXTA 2DJ2A 2FD3A 2H74A 4N0VA 4XS4B 3GKMA 4N30A 2GQLA 3DRNA 3F4RA 5FT3A 4POBA 1CQHA 1O7UA 3P7XA 5ECHB 1Y6EA 2B1LA 2I4AA 3UOMA 4A5PA 2ALBA 3BCIA 1O73A 3PR8A 3GNJA 4WF5A 3UMAA 1Q98A 4XHMA 1TU8A 3GSTA 1SYXA 2KUCA 1BJXA 4PQHA 1TK0B 2KP2A 3GIXA 3Q74A 5HR1A 4V2NA 2H75A 6GSSA 1ACVA 2DIZA 4OO5A 2RM6A 3VI5A 1EGRA 4JR4A 4ULXA 2B5EA 1ZOFA 4Q5RA 2OE1A 1U88A 4LA1A 2PERA 1EV4A 1YZXA 1XOBA 4OFMA 4NPBA 1R5AA 1X5CA 2LRCA 2XHFA 3FMWA 5ENUA 2R0CA 4BVXB 2VM1A 2L4CA 2IMEA 3WD6A 4WF4A 2IMKA 4MP4A 5HR2A 1A8LA 1F9MA 1OC9B 3UARA 2QA2A 4XRDA 3EINA 3GV1A 3C73A 2JZTA 2LV3A 2H1DA 3DVXA 2OKAA 3KM6A 4BA7A 4CY8A 4TR3A 1THXA 2L5OA 1XCCA 2VAFA 3D21A 1GSQA 3EURA 1UVZA 4ECBA 1F2EA 16GSA 3VWUA 3CRUA 1K0BA 4PUFC 2HZFA 2KOKA 2WCIA 1AAZA 4MPFA 4MJCA 4XRAA 3TB2A 4WEYA 1F37A 4KUNA 1Z7RA 4L5LA 14GSA 2L4QA 3PPUA 3C7MA 2HSMA 3IHQA 2PPTA 2QSIA 3H4KA 5G2ZA 3JCML 3LW9A 3DGQA 4ZBBA 4BL7B 2MBTA 3BJ5A 2IMDA 4JE1A 3GFKA 4GF0A 4LMWA 2P31A 5G1LA 3C71A 5AIVA 3D6IA 3GN3A 4MJAA 2HYXA 3J7Yk 1I9DA 2GS3A 5ECKB 2B6MA 3EWLA 1ZYPA 3KXOA 5CREA 2C0GA 1SENA 4GQFA 3EU4A 2B3SA 1OC8A 2FWFA 4ZXGA 1WWJA 3O76A 4N0ZA 1XWGA 2EIRA 2X8HA 3WGDA 1SU9A 3FZ9A 1PGTA 3TKSE 2V41A 2NBSA 4Z2TA 4IHUA 4FIWA 5HQPA 4HU9A 3R3EA 1W4VA 1G6YA 2V6OA 2CV4A 5DDLA 1NSWA 3BBYA 1DUGA 5AN1A 4ZIJA 4CW9A 3GKKA 3MSZA 3ZITA 3RAZA 3CMIA 5LD0A 1XFLA 1Z7PA 3IXRA 1M2AA 3M3MA 3W6GA 2LKUA 1TDIA 4BL7A 1V57A 3TJKA 4TR1A 1UC7A 2R3XA 3UVTA 1K0CA 3CYNA 1BEDA 1S3CA 3E0UA 5IMDA 2JSZA 3O3TA 2C8UA 1GLPA 2L57A 2YWIA 5CO3A 2MMOA 2H6XA 2GT6A 4PURA 4ML1A 2R2JA 1Z3EA 4MJBA 4EXJA 3L78A 1V9WA 1T00A 2R4VA 2VCVA 3F63A 5ECPB 1B8XA 4F03A 3ZLPA 2RIIA 3FR6A 3VWWA 1PSQA 3EPTA 3IA1A 3VWVA 1OE7A 4PQIA 1SJ6A 4HS1A 4GXZA 4X43A 2C3QA 1TKDB 5F05A 1X9MB 1M9AA 5DALB 4V2LA 1FOVA 2CAQA 6GSXA 2VD0A 2AB6A 1EWXA 2VCZA 3MWHA 2HRFA 1TI3A 2YV9A 4TXOB 1EP7A 5B8BA 2VCTA 3CRTA 3ZVJA 1Y25A 3FRCA 2F8FA 1BAYA 4O5UA 1VGLA 3KTBA 1KTEA 4CY6A 3QDNA 2JZRA 3ZFLA 5A4UA 2O87A 3QOUA 1SL2B 1AW9A 3E9JB 3FR9A 4KX4A 4MJEA 1WIKA 5D9WA 2D2ZA 4MH3A 4GSTA 2LQOA 3RPNA 1J0FA 1XZOA 4TRXA 3TRXA 1MEKA 2HXKA 1FVKA 1QUWA 4EE0A 3F4TA 2GQKA 1AXDA 5H5QA 1T3BA 1VF2A 2H0IA 3CBUA 1K3OA 4IQ1A 1SD9A 3QAWA 2X99A 1FVJA 5G1KA 4OFTA 1ZMAA 3VPQA 5CRWA 3MAKA 2H1GA 4V2MA 5KN2A 2I3YA 1LU4A 3GTUB 4HJ2A 4TR0A 4IQAA 2R5GA 2YZHA 3HVVA 1QK8A 2R37A 5D73A 2PGTA 1JHBA 4K2DA 2FLSA 2BJXA 2CQ9A 4ILFA 3BD2A 4ISDA 3KD0A 2DJ3A 3G7IA 4O7HA 4KDYA 2XBQA 1KBNA 1MDIA 3KCMA 1V58A 3GKXA 2DJ1A 5DQYA 3ZZXA 1XIYA 4G10A 4TXOA 4IP6A 4EIPA 1FW1A 1RW1A 4EO3A 3DIEA 1W89A 3C1SA 4DSQA 1PA3A 1HNCA 1LJRA 3HDCA 1FG4A 4J2FA 5ID2B 2WB9A 5DCGA 5B7CA 3AY8A 4RI7A 3M1GA 2R6KA 4MNNA 1M7TA 1YEPA 2FHEA 2AHEA 3KZQA 4F2IA 4NMUA 3KEBA 1OC3A 3J7Yb 4GLTA 3QFAC 4MDCA 2H71A 2HI7A 1GSSA 1FHEA 4EVMA 2ES7A 4LMVA 5IQYA 3I6AA 2HE3A 1R5PA 3GTUA 1HD2A 3H93A 4KE3A 3TJJA 2C3TA 4ZB8A 3F6FA 2P5RA 4YAPA 4HQSA 1TTZA 3ZIJA 3BOAA 4L0WA 3VFIA 5IM9A 5KN1A 3SBCA 4J56E 2FWGA 4XS6A 4OO4A 2H0GA 5F0GA 2CX4A 5IMFA 3ZREA 3GH9A 4K7IA 1U87A 4F82A 1M2DA 5CYYA 1WRYA 2YJHA 1GUKA 4HZ4A 1PL2A 4KGIA 4HQZA 3HHVA 1GSEA 2WS2A 1T7PB 3LYKA 5ECRB 1PL1A 2JU5A 3HJMA 5DBQA 1EOHA 3VLNA 5ID2A 1GL8A 3HKRA 3WYWA 2QKEA 1Z9HA 4TKYA 19GSA 3NOFA 2KHPA 1SL1B 5IMVA 4BWQA 3LSZA 2AV4A 3DVWA 1OKTA 1T8EB 1TXXA 3F6DA 1VF1A 5A5KA 1CQGA 4AJ8A 1XBSA 2M80A 2M72A 2CAIA 2YWNA 4G19A 1X9SB 3CTGA 5A4WA 4K5RA 4ACSA 2TRCP 2LNSA 4ECCA 1AC1A 1O6JA 2VM2A 5F07A 1SJIA 5IOXA 4LL4B 2B7KA 1NW2A 2DBCA 17GSA 2G0FA 1SK0A 2PVOC 2LNTA 1B9YC 1VF4A 2A2RA 3UAPA 4IJ3A 1GTBA 5G30A 2RUEA 5ECLB 4HDEA 1M9BA 3A5WA 2OBKA 5C04A 4NV2A 5BMUA 3D0ZA 5CRGA 4MH2A 3P2AA 4I97A 2DJJA 3IK7A 1Q4JA 1MTCA 2WULA 4XIHA 2CZ2A 2J23A 4HEA2 1SJZA 2BMXA 1ERTA 1O8XA 4IS0A 5DJMA 1HNAA 2DSAA 3MNGA 2FA8A 3LQ7A 2I1UA 3ERGA 4L8EA 2MMNA 2K8SA 3IR4A 4QQ7A 2O7KA 4DSSB 5CRDA 4YH2A 3ZIVA 3RHBA 1O8WA 2YN1A 4YQVA 4POKA 4HI7A 3EC3A 4E8HA 2H30A 4I6XA 3A5IA 3ME7A 2WZ9A 1A2LA 4MK3A 4NWYA 2MMAA 3RHCA 4NAXA 4XS4A 1B9XC 1V40A 2VLTA 5G31A 2C3NA 2CX3A 4MF5A 3IK9A 4RQXA 5JCWA 3ISOA 4ZL7A 2OE3A 5D9VA 2VLUA 4WR4A 3LJRA 3KH7A 3RBTA 2JACA 1B48A 3FYGA 3MYDA 3QR6A 2DMMA 2DKHA 3NZNA 2WFCA 3TOTA 2KLXA 4MLYA 2PUKC 2ZCTA 3SWLA 4DVCA 2RUFA 3DXBA 4YKGA 3WGXA 2TIRA 4X0XA 5GSSA 1AQXA 2YWMA 1GTAA 1AQWA 4KSMA 3HVSA 1YJ6A 2IL3A 3VURA 4KAEA 3QD9A 4KSOA 1WPIA 4ML6A 5EVOA 4OFNA 3L0HA 2DJ0A 2GZZA 1YF0A 4K0NA 2AAWA 1XWCA 3K8NA 4BVXA 4DSSA 2X8CA 3HXSA 5GAPD 4BWSA 4ICYA 1OC9A 5KOXA 2N5BA 3IRAA 3TKQA 2EIOA 3KMOA 3VPTA 4OMVA 4KW6A 5DCHA 1TRVA 3ZRDA 2J9HA 5CAXA 1GWCA 5DAKB 4Q5QA 8GSSA 3IAM2 4AF2A 3PINA 4FH8A 2C0EA 4ZBDA 2X49A 1DE2A 4MCUA 3GRXA 5AIXA 5LNKe 4RUVA 3HJPA 1J08A 4NHWA 5F8BA 1GRXA 1G0TA 3IC4A 4GCIA 5IPGA 1ERVA 1R4WA 2PWJA 4EF0A 1H4OA 1TK5B 6GSWA 5D93A 10GSA 1F3BA 5J9BA 1TJDA 4GSNA 4ECJA 4IW9A 5J3RA 1PQNA 22GSA 3U5RE 4MZWA 5FWGA 1YEXA 4JEDA 4FO5A 1M0UA 1HYUA 3LORA 5AGYA 4HU7A 5D8IA 3R2QA 4O32A 2IIYA 2VCQA 4EKZA 1PKWA 1E6BA 2FUG2 4EC0A 3DD3A 2FA4A 1YDKA 5HR3A 3VWXA 3QAVA 5DAKA 4YQUA 2L5LA 5J5NA 1TRUA 3IPZA 3F8UA 1Z6NA 4N11A 4X4JA 4GWRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HY2 A;  3ERW A;  3FY7 A;  3G7J A;  2H0H A;  4MF6 A;  1SL0 B;  5J41 A;  2GTU A;  2JSY A;  5ECI B;  5HFK A;  2VO4 A;  4EDY A;  20GS A;  6GSU A;  2VL3 A;  3L4N A;  4ZBA A;  1B4Q A;  1URM A;  5CP1 A;  3IV4 A;  4IEL A;  3FZ5 A;  1K3Y A;  1A0F A;  2B5Y A;  4TW5 A;  2VCX A;  11GS A;  1WMJ A;  1A0R P;  2A2S A;  2H1A A;  3WGE A;  2GLR A;  1PRX A;  4K9Z A;  2ON7 A;  2AJQ B;  4JR6 A;  4KB3 A;  2GST A;  3ME8 A;  2LJA A;  4ZL8 A;  4I2T A;  4Z7X A;  4MAB A;  1PN9 A;  1USB A;  2LJR A;  13GS A;  3CXG A;  2VIM A;  3F4S A;  2IJY A;  2GSS A;  5JCU A;  1TRS A;  1THO A;  4PQ1 A;  2L6C A;  2GSQ A;  4HZ2 A;  4PUA A;  3UBK A;  3HZ8 A;  2AYT A;  1SK1 A;  1K0O A;  2TRX A;  3NIV A;  1ERU A;  1I5G A;  2JL4 A;  4I5Q A;  1DE1 A;  1ML6 A;  4ID0 A;  1XW5 A;  1MD3 A;  3HVX A;  5CNW A;  1EZK A;  3LXZ A;  1K3L A;  2HRN A;  4LL1 B;  4HOJ A;  5IOW A;  3V1W A;  2DC5 A;  3EMP A;  1TRW A;  1WJK A;  5H5S A;  2H73 A;  1WE0 A;  1K0N A;  4G2E A;  5DAL A;  3HA9 A;  3S9F A;  3LEF A;  2F8A A;  2MYG A;  3TRP A;  1O81 A;  1NM3 A;  2G2Q A;  5D9X A;  3I9V 2;  1YY7 A;  4JU5 A;  3F0I A;  5GAN D;  2WDU A;  1U3A A;  2IMI A;  1IYI A;  5INY A;  1XWB A;  2PMT A;  4OWY A;  1ZZY A;  2VL9 A;  2NTO A;  3M9K A;  3I69 A;  1MD4 A;  4BPY A;  4KCA A;  4OD7 A;  3DKS A;  1A2J A;  1F3A A;  1J9B A;  2RLI A;  1KEB A;  1XWK A;  2CZ3 A;  3GX0 A;  1X9W B;  2XC2 A;  2O85 A;  5HR0 A;  4GTU A;  4L5O A;  1C72 A;  1A24 A;  2ZNM A;  1A23 A;  3TCO A;  1R7H A;  2N5A A;  1EOG A;  2X64 A;  1U3I A;  4GQC A;  4KA0 A;  1BQ7 A;  2WJU A;  2RM5 A;  1E2Y A;  2JAD A;  3IDV A;  1PKZ A;  1ON4 A;  1FO5 A;  1SKW B;  3PH9 A;  2FGX A;  3ZMK A;  1A8Y A;  1GUH A;  3P8W A;  2K6V A;  3M8N A;  7GSS A;  1YF1 A;  3M9J A;  3EYT A;  2WRT A;  2MBS A;  1X5E A;  1MDK A;  4MF7 A;  1GSY A;  1LBK A;  5HFG A;  4RI6 A;  1JZR A;  3TKS C;  1TP9 A;  4DEJ A;  2E2M A;  4PGT A;  2LUS A;  2VOC A;  9GSS A;  3F9U A;  3L9S A;  4RQR A;  2CVK A;  3GYK A;  3H79 A;  1YKC A;  3APS A;  2O89 A;  1PX7 A;  1JZD A;  2PVQ A;  3QCP A;  3IBH A;  1PD2 1;  1SK2 A;  1ZGN A;  5HFI A;  5EY6 A;  4AJ6 A;  2B7J A;  3H1N A;  5IMZ A;  1UN2 A;  3A3T A;  2KP1 A;  4QL9 A;  4TVE A;  3GHA A;  1T4Y A;  3DEX A;  2Z9S A;  2CVD A;  2C0F A;  3H8Q A;  4XCS A;  4TR4 A;  4XS1 A;  2C1Y A;  1SKR B;  3LFL A;  2GSR A;  4EL1 A;  3GMF A;  2YZU A;  1QFN A;  1U6T A;  1JFU A;  2HSH A;  3G9B A;  3GL5 A;  1K0M A;  2EIQ A;  4QL7 A;  2F9S A;  2XPD A;  2FWH A;  3EMX A;  5IMA A;  1Z6M A;  5B6N A;  3LG6 A;  1OVN A;  1X5D A;  2H01 A;  3KGK A;  5D96 A;  1GSD A;  3HYP A;  2IFQ B;  4KH7 A;  3GA4 A;  3L9U A;  5AIS A;  2C4J A;  3KIJ A;  2ON5 A;  3FZA A;  4FYU A;  2V6K A;  3ZML A;  2A4V A;  4N10 A;  3CSI A;  4ZL9 A;  1TW9 A;  4IVF A;  4NHZ A;  4O92 A;  4HUA A;  4IGJ A;  3QMX A;  3CSJ A;  2H70 A;  2YAN A;  4JRR A;  6GSV A;  4YAV A;  1TI1 A;  3FKF A;  3U6V A;  1K0D A;  2QGV A;  2YJ7 A;  2H1B A;  1F6M C;  1VF3 A;  3IAS 2;  3W8S A;  2OBI A;  3HCZ A;  4K7O A;  4K7N A;  1YKA A;  3TDG A;  3UEM A;  2GDR A;  2F3M A;  18GS A;  4J57 E;  5FHI A;  4EDZ A;  1DSB A;  5EL8 A;  1XWA A;  1S3D A;  3KP9 A;  2NVL A;  5JCG A;  3UL3 A;  1NHO A;  3GSS A;  3RDW A;  1GTU A;  2I81 A;  4OCE A;  4CDO A;  1T1V A;  1YQ1 A;  4AGS A;  4IN0 A;  4KDU A;  5IPH A;  3ZL5 A;  4FYB A;  4AJ7 A;  3Q6O A;  5C00 A;  3TJB A;  4XTS A;  3FEU A;  1GUL A;  1SKS B;  2IFQ A;  3GUS A;  4E8E A;  5IIZ A;  1EP8 A;  1OKD A;  1A2M A;  1ABA A;  4D73 B;  2HNL A;  4O5R A;  3QFB C;  3VI7 A;  2OAD A;  4K1F A;  4YQM A;  2LRT A;  2CA8 A;  2VL2 C;  1JZO A;  2HFD A;  2O8V B;  3EU3 A;  4MZC A;  2VUP A;  1OE8 A;  2FY6 A;  2OAC A;  1N8J A;  4G9H A;  5ECN B;  1OAZ A;  3WT1 A;  3QPM A;  4ZB6 A;  5L71 A;  4NV5 A;  2DJK A;  4TR1 B;  2LJK A;  2DML A;  5JWR B;  3TOU A;  1UA5 A;  1EEM A;  4WET A;  3GH6 A;  4MMM A;  3APQ A;  5GZZ B;  3KTL A;  4F0C A;  1X0R A;  3ZYW A;  1PX6 A;  4K8M A;  1K0A A;  5IO2 A;  4PXO A;  1ERW A;  1ZYE A;  2C0D A;  4CHS A;  1Z5Y E;  1XW6 A;  5ELG A;  4POM A;  2MZC A;  4WXT A;  2DLX A;  3KH9 A;  3IOS A;  4TXV A;  2GT5 A;  4LLR A;  4PX1 A;  4WR5 A;  4POL A;  3GX8 A;  5ECM B;  2E0Q A;  1B4P A;  2HT9 A;  4L0U A;  1JLW A;  4I2U A;  1SD8 A;  1M2B A;  3HJO A;  1OYJ A;  5G5E A;  3D4T A;  4D73 A;  5A4V A;  3TJF A;  4PNF A;  4JBB A;  1QQ2 A;  2K8V A;  1DBY A;  1AUC A;  1XVW A;  2V1M A;  1FAA A;  3F3R A;  1EGO A;  2REM A;  3TJG A;  5LCZ A;  3TKS A;  2GVP A;  1XVQ A;  4KDX A;  2HZE B;  2EC4 A;  5ABR A;  1JZW A;  3C8E A;  1AQV A;  1PMT A;  3EE2 A;  1V2A A;  6GSY A;  1TK8 B;  2F51 A;  2HLS A;  1GUM A;  2ZUP A;  3ERF A;  2CT6 A;  2YWO A;  2K18 A;  3D5J A;  3E3E A;  2NPB A;  5H5R A;  4JZQ A;  3ZVJ D;  2M46 A;  3N5O A;  6GST A;  3QAG A;  2H66 A;  2PBJ A;  3CTF A;  3A2W A;  1SYR A;  1ST9 A;  2BTO T;  1KNG A;  2L59 A;  2LST A;  2LTK A;  1GSF A;  2P5Q A;  3VK9 A;  4TN8 A;  2NDO A;  4H86 A;  1BYE A;  1HNB A;  5KN3 A;  5DQS A;  3LYP A;  5ECQ B;  2PU9 C;  3KP8 A;  2IWT A;  1M99 A;  1ZL9 A;  5D9T A;  3GL3 A;  1G7E A;  4ZB9 A;  2DIY A;  1G6W A;  1GLQ A;  1WP0 A;  2CVB A;  2VD1 A;  5KN0 A;  5E59 A;  1NHY A;  2LEG A;  3P90 A;  4FYC A;  4TOP A;  4IJI A;  4HJM A;  1GH2 A;  1JLV A;  2HSY A;  1TOF A;  3DML A;  2H6Y A;  4ECI A;  2LS5 A;  4P3Y B;  3D4M A;  2HZE A;  5JWO B;  2K9F A;  1TU7 A;  4MPG A;  4GSS A;  3G7Y A;  5B6M A;  1VRS D;  2GZY A;  2WGR A;  1V98 A;  3A2X A;  1ZYQ B;  2YCD A;  1FB6 A;  2IMF A;  2B1K A;  2AUV A;  3F3Q A;  2PN8 A;  5DVB A;  1XW9 A;  2OE0 A;  1FB0 A;  4Q5F A;  4WBJ A;  3D22 A;  3L9V A;  5KEJ A;  3PGT A;  3TUE A;  1XPV A;  2LQQ A;  2JZS A;  1RQM A;  3ZTL A;  3FW2 A;  3I43 A;  2IN3 A;  5E4W A;  5EPF A;  3Q18 A;  3A2V A;  4I8B A;  5G5F A;  4K0G A;  3FR3 A;  1QGV A;  4GRF A;  1BX9 A;  4WBR D;  3KMN A;  2XBI A;  4BVY A;  3RPP A;  4Q5N A;  4X1U A;  4KCE A;  1H75 A;  3TGZ A;  5J4U A;  2OJL A;  4V1A p;  3UJ1 A;  3WT2 A;  1MDJ A;  2P0G A;  1QMV A;  1ILO A;  4V1A g;  4MA9 A;  1N2A A;  3KJY A;  3TKP A;  3GUR A;  5ECO B;  1QXH A;  3TRQ A;  5GST A;  5CRH A;  4F9Z A;  1BG5 A;  3DYR A;  3UBL A;  5IMC A;  4K6X A;  1GP1 A;  3US3 A;  4OCF A;  2GQM A;  3FZ4 A;  2L6D A;  5B8A A;  3MDK A;  2V2G A;  5J9C A;  5ELA A;  2H76 A;  2VL2 A;  2YV7 A;  3GKN A;  3FHK A;  3FK8 A;  1T4Z A;  4PNG A;  1XXU A;  2QC7 A;  2GZP A;  2H72 A;  2VCW A;  3TKR A;  2N5F A;  1WOU A;  3UIW A;  2MMZ A;  2E2G A;  3OR5 A;  2C80 A;  3ED3 A;  2H19 A;  3EVI A;  3ZFB A;  1GNW A;  2V32 A;  1XOA A;  5JWQ B;  3UVH A;  3M0F A;  2GGT A;  2YPM A;  1G7O A;  4EUY A;  4NXI A;  2YNX A;  1O85 A;  3O6T A;  4DSR A;  3Q19 A;  4IBP A;  2XPE A;  2H8L A;  2E7P A;  4IKH A;  1S3A A;  3DWV A;  5IO0 A;  2FWE A;  4ZIL A;  2FCH A;  2OA7 A;  4WKW A;  2X8G A;  2I9H A;  12GS A;  1ZCP A;  1IYH A;  3W8J A;  5COH A;  3CSH A;  1R26 A;  5ECS A;  5DJL A;  1HQO A;  3HD5 A;  3LGC A;  4F0B A;  1GNE A;  2VLV A;  2H6Z A;  1AIU A;  2IPA A;  2B5X A;  1GTI A;  3C1R A;  3N9J A;  2LRN A;  3HZ4 A;  4KND A;  4MZB A;  4IP1 A;  3BCK A;  1RK4 A;  1EEJ A;  2FNO A;  3APO A;  5F06 A;  3IE3 A;  3LWA A;  1EV9 A;  1GSU A;  2YOI A;  2YP6 A;  3LXT A;  2DJ2 A;  2FD3 A;  2H74 A;  4N0V A;  4XS4 B;  3GKM A;  4N30 A;  2GQL A;  3DRN A;  3F4R A;  5FT3 A;  4POB A;  1CQH A;  1O7U A;  3P7X A;  5ECH B;  1Y6E A;  2B1L A;  2I4A A;  3UOM A;  2ALB A;  3BCI A;  1O73 A;  3PR8 A;  3GNJ A;  4WF5 A;  3UMA A;  1Q98 A;  4XHM A;  1TU8 A;  3GST A;  1SYX A;  2KUC A;  1BJX A;  4PQH A;  1TK0 B;  2KP2 A;  3GIX A;  3Q74 A;  5HR1 A;  4V2N A;  2H75 A;  6GSS A;  1ACV A;  2DIZ A;  4OO5 A;  2RM6 A;  3VI5 A;  1EGR A;  4JR4 A;  4ULX A;  2B5E A;  1ZOF A;  4Q5R A;  2OE1 A;  1U88 A;  4LA1 A;  2PER A;  1EV4 A;  1YZX A;  1XOB A;  4OFM A;  4NPB A;  1R5A A;  1X5C A;  2LRC A;  2XHF A;  5ENU A;  2VM1 A;  2L4C A;  2IME A;  3WD6 A;  4WF4 A;  2IMK A;  4MP4 A;  5HR2 A;  1A8L A;  1F9M A;  1OC9 B;  3UAR A;  4XRD A;  3EIN A;  3GV1 A;  3C73 A;  2JZT A;  2LV3 A;  2H1D A;  3DVX A;  2OKA A;  3KM6 A;  4BA7 A;  4TR3 A;  1THX A;  2L5O A;  1XCC A;  2VAF A;  3D21 A;  1GSQ A;  3EUR A;  1UVZ A;  4ECB A;  1F2E A;  16GS A;  3VWU A;  3CRU A;  1K0B A;  4PUF C;  2HZF A;  2KOK A;  2WCI A;  1AAZ A;  4MPF A;  4MJC A;  4XRA A;  3TB2 A;  4WEY A;  1F37 A;  4KUN A;  1Z7R A;  4L5L A;  14GS A;  2L4Q A;  3C7M A;  3IHQ A;  2PPT A;  2QSI A;  3H4K A;  5G2Z A;  3JCM L;  3DGQ A;  4ZBB A;  2MBT A;  3BJ5 A;  2IMD A;  4JE1 A;  3GFK A;  4GF0 A;  4LMW A;  2P31 A;  5G1L A;  3C71 A;  5AIV A;  3D6I A;  3GN3 A;  4MJA A;  2HYX A;  3J7Y k;  1I9D A;  2GS3 A;  5ECK B;  2B6M A;  3EWL A;  3KXO A;  5CRE A;  2C0G A;  1SEN A;  4GQF A;  3EU4 A;  2B3S A;  1OC8 A;  2FWF A;  4ZXG A;  1WWJ A;  3O76 A;  4N0Z A;  1XWG A;  2EIR A;  2X8H A;  3WGD A;  1SU9 A;  3FZ9 A;  1PGT A;  3TKS E;  2V41 A;  2NBS A;  4IHU A;  4FIW A;  5HQP A;  4HU9 A;  1W4V A;  1G6Y A;  2V6O A;  2CV4 A;  5DDL A;  1NSW A;  3BBY A;  1DUG A;  5AN1 A;  4ZIJ A;  4CW9 A;  3GKK A;  3MSZ A;  3ZIT A;  3RAZ A;  3CMI A;  5LD0 A;  1XFL A;  1Z7P A;  3IXR A;  1M2A A;  3M3M A;  3W6G A;  2LKU A;  1TDI A;  4BL7 A;  1V57 A;  3TJK A;  4TR1 A;  1UC7 A;  2R3X A;  3UVT A;  1K0C A;  3CYN A;  1BED A;  1S3C A;  3E0U A;  5IMD A;  2JSZ A;  3O3T A;  2C8U A;  1GLP A;  2L57 A;  2YWI A;  5CO3 A;  2MMO A;  2H6X A;  2GT6 A;  4PUR A;  4ML1 A;  2R2J A;  1Z3E A;  4MJB A;  4EXJ A;  3L78 A;  1V9W A;  1T00 A;  2R4V A;  2VCV A;  3F63 A;  5ECP B;  1B8X A;  4F03 A;  3ZLP A;  2RII A;  3FR6 A;  3VWW A;  1PSQ A;  3IA1 A;  3VWV A;  1OE7 A;  4PQI A;  1SJ6 A;  4HS1 A;  4GXZ A;  4X43 A;  2C3Q A;  1TKD B;  5F05 A;  1X9M B;  1M9A A;  5DAL B;  4V2L A;  1FOV A;  2CAQ A;  6GSX A;  2VD0 A;  2AB6 A;  1EWX A;  2VCZ A;  3MWH A;  2HRF A;  1TI3 A;  2YV9 A;  4TXO B;  1EP7 A;  5B8B A;  2VCT A;  3CRT A;  3ZVJ A;  1Y25 A;  3FRC A;  2F8F A;  1BAY A;  1VGL A;  3KTB A;  1KTE A;  3QDN A;  2JZR A;  3ZFL A;  5A4U A;  2O87 A;  3QOU A;  1SL2 B;  1AW9 A;  3E9J B;  3FR9 A;  4KX4 A;  4MJE A;  1WIK A;  5D9W A;  2D2Z A;  4MH3 A;  4GST A;  2LQO A;  3RPN A;  1J0F A;  1XZO A;  4TRX A;  3TRX A;  1MEK A;  2HXK A;  1FVK A;  1QUW A;  4EE0 A;  3F4T A;  2GQK A;  1AXD A;  5H5Q A;  1T3B A;  1VF2 A;  2H0I A;  3CBU A;  1K3O A;  4IQ1 A;  1SD9 A;  3QAW A;  2X99 A;  1FVJ A;  5G1K A;  4OFT A;  1ZMA A;  3VPQ A;  5CRW A;  3MAK A;  2H1G A;  4V2M A;  5KN2 A;  2I3Y A;  1LU4 A;  3GTU B;  4HJ2 A;  4TR0 A;  4IQA A;  2R5G A;  2YZH A;  3HVV A;  1QK8 A;  2R37 A;  5D73 A;  2PGT A;  1JHB A;  4K2D A;  2FLS A;  2BJX A;  2CQ9 A;  4ILF A;  3BD2 A;  4ISD A;  3KD0 A;  2DJ3 A;  3G7I A;  4O7H A;  4KDY A;  2XBQ A;  1KBN A;  1MDI A;  3KCM A;  1V58 A;  3GKX A;  2DJ1 A;  5DQY A;  3ZZX A;  1XIY A;  4G10 A;  4TXO A;  4IP6 A;  1FW1 A;  1RW1 A;  4EO3 A;  3DIE A;  1W89 A;  3C1S A;  4DSQ A;  1PA3 A;  1HNC A;  1LJR A;  3HDC A;  1FG4 A;  4J2F A;  5ID2 B;  2WB9 A;  5DCG A;  5B7C A;  3AY8 A;  4RI7 A;  3M1G A;  2R6K A;  1M7T A;  1YEP A;  2FHE A;  2AHE A;  3KZQ A;  4F2I A;  4NMU A;  3KEB A;  1OC3 A;  3J7Y b;  4GLT A;  3QFA C;  4MDC A;  2H71 A;  2HI7 A;  1GSS A;  1FHE A;  4EVM A;  2ES7 A;  4LMV A;  5IQY A;  3I6A A;  2HE3 A;  1R5P A;  3GTU A;  1HD2 A;  3H93 A;  4KE3 A;  3TJJ A;  2C3T A;  4ZB8 A;  3F6F A;  2P5R A;  4YAP A;  4HQS A;  1TTZ A;  3ZIJ A;  3BOA A;  4L0W A;  3VFI A;  5IM9 A;  5KN1 A;  3SBC A;  4J56 E;  2FWG A;  4XS6 A;  4OO4 A;  2H0G A;  5F0G A;  2CX4 A;  5IMF A;  3ZRE A;  3GH9 A;  4K7I A;  1U87 A;  4F82 A;  1M2D A;  5CYY A;  1WRY A;  2YJH A;  1GUK A;  4HZ4 A;  1PL2 A;  4KGI A;  4HQZ A;  3HHV A;  1GSE A;  2WS2 A;  1T7P B;  3LYK A;  5ECR B;  1PL1 A;  2JU5 A;  3HJM A;  5DBQ A;  1EOH A;  3VLN A;  5ID2 A;  1GL8 A;  3HKR A;  3WYW A;  2QKE A;  1Z9H A;  4TKY A;  19GS A;  3NOF A;  2KHP A;  1SL1 B;  5IMV A;  4BWQ A;  3LSZ A;  2AV4 A;  3DVW A;  1OKT A;  1T8E B;  1TXX A;  3F6D A;  1VF1 A;  5A5K A;  1CQG A;  4AJ8 A;  1XBS A;  2M80 A;  2M72 A;  2CAI A;  2YWN A;  4G19 A;  1X9S B;  3CTG A;  5A4W A;  4ACS A;  2TRC P;  2LNS A;  4ECC A;  1AC1 A;  1O6J A;  2VM2 A;  5F07 A;  1SJI A;  5IOX A;  4LL4 B;  2B7K A;  1NW2 A;  2DBC A;  17GS A;  2G0F A;  1SK0 A;  2PVO C;  2LNT A;  1B9Y C;  1VF4 A;  2A2R A;  3UAP A;  4IJ3 A;  1GTB A;  5G30 A;  5ECL B;  2RUE A;  4HDE A;  1M9B A;  3A5W A;  2OBK A;  5C04 A;  4NV2 A;  3D0Z A;  5CRG A;  4MH2 A;  3P2A A;  4I97 A;  2DJJ A;  3IK7 A;  1Q4J A;  1MTC A;  2WUL A;  4XIH A;  2CZ2 A;  2J23 A;  4HEA 2;  1SJZ A;  2BMX A;  1ERT A;  1O8X A;  4IS0 A;  5DJM A;  1HNA A;  2DSA A;  3MNG A;  2FA8 A;  3LQ7 A;  2I1U A;  3ERG A;  4L8E A;  2MMN A;  2K8S A;  3IR4 A;  4QQ7 A;  2O7K A;  4DSS B;  5CRD A;  4YH2 A;  3ZIV A;  3RHB A;  1O8W A;  2YN1 A;  4YQV A;  4POK A;  4HI7 A;  3EC3 A;  4E8H A;  2H30 A;  4I6X A;  3ME7 A;  2WZ9 A;  1A2L A;  4MK3 A;  4NWY A;  2MMA A;  3RHC A;  4NAX A;  4XS4 A;  1B9X C;  1V40 A;  2VLT A;  5G31 A;  2C3N A;  2CX3 A;  4MF5 A;  3IK9 A;  4RQX A;  5JCW A;  3ISO A;  4ZL7 A;  2OE3 A;  5D9V A;  2VLU A;  4WR4 A;  3LJR A;  3KH7 A;  3RBT A;  2JAC A;  1B48 A;  3FYG A;  3QR6 A;  2DMM A;  3NZN A;  2WFC A;  3TOT A;  2KLX A;  4MLY A;  2PUK C;  2ZCT A;  3SWL A;  4DVC A;  2RUF A;  3DXB A;  3WGX A;  2TIR A;  4X0X A;  5GSS A;  1AQX A;  2YWM A;  1GTA A;  1AQW A;  4KSM A;  3HVS A;  1YJ6 A;  2IL3 A;  3VUR A;  4KAE A;  3QD9 A;  4KSO A;  1WPI A;  4ML6 A;  5EVO A;  4OFN A;  3L0H A;  2DJ0 A;  2GZZ A;  1YF0 A;  4K0N A;  2AAW A;  1XWC A;  3K8N A;  4BVX A;  4DSS A;  2X8C A;  3HXS A;  5GAP D;  4BWS A;  1OC9 A;  2N5B A;  3IRA A;  3TKQ A;  2EIO A;  3KMO A;  3VPT A;  4OMV A;  4KW6 A;  5DCH A;  1TRV A;  3ZRD A;  2J9H A;  5CAX A;  1GWC A;  5DAK B;  4Q5Q A;  8GSS A;  3IAM 2;  4AF2 A;  3PIN A;  4FH8 A;  2C0E A;  4ZBD A;  1DE2 A;  4MCU A;  3GRX A;  5AIX A;  5LNK e;  4RUV A;  3HJP A;  1J08 A;  4NHW A;  5F8B A;  1GRX A;  1G0T A;  3IC4 A;  4GCI A;  5IPG A;  1ERV A;  1R4W A;  2PWJ A;  4EF0 A;  1H4O A;  1TK5 B;  6GSW A;  5D93 A;  10GS A;  1F3B A;  5J9B A;  1TJD A;  4GSN A;  4ECJ A;  4IW9 A;  5J3R A;  1PQN A;  22GS A;  3U5R E;  4MZW A;  5FWG A;  1YEX A;  4JED A;  4FO5 A;  1M0U A;  1HYU A;  3LOR A;  5AGY A;  4HU7 A;  5D8I A;  3R2Q A;  4O32 A;  2IIY A;  2VCQ A;  4EKZ A;  1PKW A;  1E6B A;  2FUG 2;  4EC0 A;  3DD3 A;  2FA4 A;  1YDK A;  5HR3 A;  3VWX A;  3QAV A;  5DAK A;  4YQU A;  2L5L A;  5J5N A;  1TRU A;  3IPZ A;  3F8U A;  1Z6N A;  4N11 A;  4GWR A; 
#chains in the Genus database with same CATH topology
 3HVN A;  3HY2 A;  3ERW A;  3FY7 A;  3G7J A;  2H0H A;  4MF6 A;  1SL0 B;  4G0L A;  5J41 A;  2GTU A;  2JSY A;  5ECI B;  1FOH A;  2VO4 A;  5HFK A;  4EDY A;  20GS A;  6GSU A;  2VL3 A;  3L4N A;  4ZBA A;  1B4Q A;  1URM A;  5CP1 A;  3IV4 A;  4IEL A;  3FZ5 A;  1K3Y A;  1A0F A;  2B5Y A;  4TW5 A;  2VCX A;  11GS A;  1WMJ A;  1A0R P;  2A2S A;  4BVY B;  2H1A A;  3WGE A;  2GLR A;  1PRX A;  4K9Z A;  2ON7 A;  2AJQ B;  4JR6 A;  4KB3 A;  2GST A;  3ME8 A;  2LJA A;  4ZL8 A;  4I2T A;  4Z7X A;  4MAB A;  1PN9 A;  1USB A;  2LJR A;  13GS A;  3CXG A;  2VIM A;  3F4S A;  2IJY A;  2GSS A;  5JCU A;  1TRS A;  1THO A;  4PQ1 A;  2L6C A;  2GSQ A;  4HZ2 A;  4PUA A;  3UBK A;  3HZ8 A;  2AYT A;  1SK1 A;  1K0O A;  2TRX A;  3NIV A;  4K2X A;  1ERU A;  1I5G A;  2JL4 A;  4I5Q A;  1DE1 A;  1ML6 A;  4ID0 A;  1XW5 A;  1MD3 A;  3HVX A;  5CNW A;  1EZK A;  3LXZ A;  1K3L A;  2HRN A;  4LL1 B;  4HOJ A;  5IOW A;  3V1W A;  2DC5 A;  3EMP A;  1TRW A;  1WJK A;  5H5S A;  2H73 A;  2A4H A;  1WE0 A;  1K0N A;  4G2E A;  5DAL A;  3HA9 A;  3S9F A;  3LEF A;  2F8A A;  2MYG A;  3TRP A;  1O81 A;  1NM3 A;  2G2Q A;  5D9X A;  3I9V 2;  1YY7 A;  4JU5 A;  3F0I A;  5GAN D;  4G0K A;  2WDU A;  1U3A A;  2IMI A;  1IYI A;  5INY A;  1XWB A;  2PMT A;  4OWY A;  1ZZY A;  2VL9 A;  2NTO A;  3M9K A;  3I69 A;  1MD4 A;  4BPY A;  4KCA A;  4OD7 A;  3DKS A;  1A2J A;  1F3A A;  1J9B A;  2RLI A;  1KEB A;  1XWK A;  2CZ3 A;  3GX0 A;  1X9W B;  2XC2 A;  2O85 A;  2R0P A;  5HR0 A;  4GTU A;  4L5O A;  1C72 A;  1A24 A;  2ZNM A;  1A23 A;  3TCO A;  1R7H A;  2N5A A;  1EOG A;  2X64 A;  1U3I A;  4GQC A;  4KA0 A;  1BQ7 A;  2WJU A;  2RM5 A;  1E2Y A;  4USS A;  2JAD A;  3IDV A;  1PKZ A;  1ON4 A;  1FO5 A;  1SKW B;  3PH9 A;  2FGX A;  3ZMK A;  1A8Y A;  1GUH A;  3P8W A;  2K6V A;  3M8N A;  7GSS A;  1YF1 A;  3M9J A;  3EYT A;  2WRT A;  2MBS A;  1X5E A;  1MDK A;  4MF7 A;  1GSY A;  1LBK A;  5HFG A;  4RI6 A;  1JZR A;  3TKS C;  1TP9 A;  4DEJ A;  2E2M A;  4PGT A;  2LUS A;  2VOC A;  9GSS A;  3F9U A;  3L9S A;  4RQR A;  2CVK A;  3GYK A;  3H79 A;  1YKC A;  3APS A;  2O89 A;  1PX7 A;  1JZD A;  2PVQ A;  3QCP A;  3IBH A;  1PD2 1;  1SK2 A;  1ZGN A;  5HFI A;  5EY6 A;  4AJ6 A;  2B7J A;  3H1N A;  5IMZ A;  1UN2 A;  3A3T A;  2KP1 A;  4QL9 A;  3IC8 A;  4TVE A;  3GHA A;  1T4Y A;  3DEX A;  2Z9S A;  2CVD A;  2C0F A;  3H8Q A;  4XCS A;  4TR4 A;  4XS1 A;  2C1Y A;  1SKR B;  3LFL A;  2GSR A;  4EL1 A;  3GMF A;  2YZU A;  1QFN A;  1U6T A;  1JFU A;  2HSH A;  3G9B A;  3GL5 A;  1K0M A;  2EIQ A;  4QL7 A;  2F9S A;  2XPD A;  2FWH A;  3EMX A;  5IMA A;  1Z6M A;  2HRK A;  5B6N A;  3LG6 A;  1OVN A;  1ZYN A;  1X5D A;  2H01 A;  3KGK A;  5D96 A;  1GSD A;  3HYP A;  2IFQ B;  4KH7 A;  3GA4 A;  3L9U A;  5AIS A;  2C4J A;  3KIJ A;  2ON5 A;  3FZA A;  4FYU A;  2V6K A;  3ZML A;  2A4V A;  4N10 A;  3CSI A;  4ZL9 A;  1TW9 A;  4IVF A;  4NHZ A;  4O92 A;  4HUA A;  4IGJ A;  3QMX A;  3CSJ A;  2H70 A;  2YAN A;  4JRR A;  6GSV A;  4YAV A;  1TI1 A;  3FKF A;  3U6V A;  1K0D A;  2QGV A;  2YJ7 A;  2H1B A;  1F6M C;  1VF3 A;  3IAS 2;  3W8S A;  2OBI A;  3HCZ A;  4K7O A;  4K7N A;  3IHG A;  1YKA A;  3TDG A;  3UEM A;  2GDR A;  2F3M A;  18GS A;  4J57 E;  5FHI A;  4EDZ A;  1DSB A;  5EL8 A;  1XWA A;  4YKF A;  1S3D A;  3KP9 A;  2NVL A;  5JCG A;  3UL3 A;  1NHO A;  3GSS A;  3RDW A;  1GTU A;  2I81 A;  4OCE A;  4CDO A;  1T1V A;  1YQ1 A;  4AGS A;  4IN0 A;  4KDU A;  5IPH A;  3ZL5 A;  4FYB A;  4AJ7 A;  3Q6O A;  5C00 A;  3TJB A;  4XTS A;  3FEU A;  1GUL A;  1SKS B;  2IFQ A;  3GUS A;  4E8E A;  5IIZ A;  1EP8 A;  1OKD A;  1A2M A;  1ABA A;  4D73 B;  2HNL A;  4O5R A;  3QFB C;  3VI7 A;  2OAD A;  4K5S A;  4K1F A;  4YQM A;  2LRT A;  2CA8 A;  2DKI A;  2VL2 C;  1JZO A;  2HFD A;  2O8V B;  3EU3 A;  4MZC A;  2VUP A;  1OE8 A;  2FY6 A;  2OAC A;  1N8J A;  4G9H A;  5ECN B;  1OAZ A;  3WT1 A;  3QPM A;  4ZB6 A;  5L71 A;  3MIX A;  4NV5 A;  2DJK A;  4TR1 B;  2LJK A;  2DML A;  5JWR B;  3TOU A;  1UA5 A;  1EEM A;  4WET A;  3GH6 A;  4MMM A;  3APQ A;  5GZZ B;  3KTL A;  4F0C A;  1X0R A;  3ZYW A;  1PX6 A;  4K8M A;  1K0A A;  5IO2 A;  4PXO A;  1ERW A;  1ZYE A;  2C0D A;  4CHS A;  1Z5Y E;  1XW6 A;  5ELG A;  4POM A;  2MZC A;  4WXT A;  2DLX A;  3KH9 A;  3IOS A;  4TXV A;  2GT5 A;  4LLR A;  4PX1 A;  4WR5 A;  4POL A;  3GX8 A;  5ECM B;  2E0Q A;  1B4P A;  2HT9 A;  4L0U A;  1JLW A;  4I2U A;  1SD8 A;  1M2B A;  3HJO A;  1OYJ A;  5G5E A;  3D4T A;  4D73 A;  5A4V A;  3TJF A;  4Z2U A;  4PNF A;  4JBB A;  1QQ2 A;  2K8V A;  1DBY A;  1AUC A;  1XVW A;  2V1M A;  1FAA A;  3F3R A;  1EGO A;  2REM A;  3TJG A;  5LCZ A;  3TKS A;  5BRT A;  1PFO A;  2GVP A;  1XVQ A;  4KDX A;  2HZE B;  2EC4 A;  5ABR A;  1JZW A;  3C8E A;  1AQV A;  5KOW A;  1PMT A;  3EE2 A;  1V2A A;  4FQU A;  6GSY A;  2UZ8 A;  1TK8 B;  1XG8 A;  2F51 A;  2HLS A;  1GUM A;  2ZUP A;  3ERF A;  2CT6 A;  2YWO A;  2K18 A;  3D5J A;  3E3E A;  2NPB A;  5H5R A;  2HRA A;  4JZQ A;  3ZVJ D;  2M46 A;  3N5O A;  6GST A;  3QAG A;  4Z2R A;  2H66 A;  2PBJ A;  3CTF A;  3A2W A;  1SYR A;  1ST9 A;  2BTO T;  2A2P A;  1KNG A;  2L59 A;  2LST A;  2LTK A;  1GSF A;  2P5Q A;  3VK9 A;  4TN8 A;  2NDO A;  4H86 A;  1BYE A;  1HNB A;  5KN3 A;  5DQS A;  3LYP A;  5ECQ B;  2PU9 C;  3KP8 A;  2IWT A;  1M99 A;  1ZL9 A;  5D9T A;  3GL3 A;  1G7E A;  4ZB9 A;  2DIY A;  1G6W A;  1GLQ A;  1WP0 A;  2CVB A;  2VD1 A;  5KN0 A;  1NHY A;  2LEG A;  5E59 A;  3P90 A;  4FYC A;  4TOP A;  4IJI A;  4HJM A;  1GH2 A;  1JLV A;  2HSY A;  1TOF A;  3DML A;  2H6Y A;  4ECI A;  2LS5 A;  4P3Y B;  3D4M A;  2HZE A;  5JWO B;  2QA1 A;  4EIQ A;  2K9F A;  1TU7 A;  4MPG A;  4GSS A;  3G7Y A;  5B6M A;  1VRS D;  2GZY A;  2WGR A;  1V98 A;  3A2X A;  1ZYQ B;  2YCD A;  1FB6 A;  2IMF A;  2B1K A;  2AUV A;  3F3Q A;  2PN8 A;  5DVB A;  1XW9 A;  1PN0 A;  2X4A A;  2OE0 A;  1FB0 A;  4Q5F A;  4WBJ A;  3D22 A;  3L9V A;  5KEJ A;  3PGT A;  3TUE A;  1XPV A;  4KF9 A;  2LQQ A;  2JZS A;  1RQM A;  3ZTL A;  3FW2 A;  3I43 A;  2IN3 A;  5E4W A;  5EPF A;  3Q18 A;  3A2V A;  4I8B A;  5G5F A;  4K0G A;  3FR3 A;  1QGV A;  4GRF A;  1BX9 A;  4WBR D;  3KMN A;  2XBI A;  4BVY A;  3RPP A;  4Q5N A;  4X1U A;  4KCE A;  1H75 A;  3TGZ A;  5J4U A;  2OJL A;  4V1A p;  3UJ1 A;  3WT2 A;  1MDJ A;  2P0G A;  1QMV A;  1ILO A;  4V1A g;  4MA9 A;  1N2A A;  3KJY A;  3TKP A;  3GUR A;  5ECO B;  1QXH A;  3TRQ A;  5GST A;  5CRH A;  4F9Z A;  1BG5 A;  3DYR A;  3UBL A;  5IMC A;  4K6X A;  1GP1 A;  3US3 A;  4OCF A;  2GQM A;  3FZ4 A;  2L6D A;  5B8A A;  3MDK A;  2V2G A;  5J9C A;  5ELA A;  2H76 A;  2VL2 A;  2YV7 A;  3GKN A;  3FHK A;  3FK8 A;  1T4Z A;  4PNG A;  1XXU A;  2QC7 A;  2GZP A;  2H72 A;  2VCW A;  3TKR A;  2N5F A;  1WOU A;  3UIW A;  2MMZ A;  2E2G A;  3OR5 A;  2C80 A;  3ED3 A;  2H19 A;  3EVI A;  3ZFB A;  2R0G A;  1GNW A;  2V32 A;  1XOA A;  5JWQ B;  3UVH A;  3M0F A;  2GGT A;  2YPM A;  1G7O A;  4EUY A;  4NXI A;  2YNX A;  1O85 A;  3O6T A;  4DSR A;  4G0I A;  3Q19 A;  4IBP A;  2XPE A;  2H8L A;  2E7P A;  4IKH A;  1S3A A;  3DWV A;  5IO0 A;  2FWE A;  4ZIL A;  2FCH A;  2OA7 A;  4WKW A;  2X8G A;  2I9H A;  12GS A;  1ZCP A;  1IYH A;  3W8J A;  5COH A;  3CSH A;  1R26 A;  5ECS A;  5DJL A;  1HQO A;  3HD5 A;  3LGC A;  4F0B A;  4O5Q A;  1GNE A;  2VLV A;  2H6Z A;  4HSC X;  1AIU A;  4PTS A;  2IPA A;  2B5X A;  1GTI A;  3C1R A;  3N9J A;  2LRN A;  3HZ4 A;  4KND A;  4MZB A;  1M3I A;  4IP1 A;  3BCK A;  1RK4 A;  1EEJ A;  2FNO A;  3APO A;  5F06 A;  3IE3 A;  3LWA A;  1EV9 A;  1GSU A;  2YOI A;  2YP6 A;  3LXT A;  2DJ2 A;  2FD3 A;  2H74 A;  4N0V A;  4XS4 B;  3GKM A;  4N30 A;  2GQL A;  3DRN A;  3F4R A;  5FT3 A;  4POB A;  1CQH A;  1O7U A;  3P7X A;  5ECH B;  1Y6E A;  2B1L A;  2I4A A;  3UOM A;  4A5P A;  2ALB A;  3BCI A;  1O73 A;  3PR8 A;  3GNJ A;  4WF5 A;  3UMA A;  1Q98 A;  4XHM A;  1TU8 A;  3GST A;  1SYX A;  2KUC A;  1BJX A;  4PQH A;  1TK0 B;  2KP2 A;  3GIX A;  3Q74 A;  5HR1 A;  4V2N A;  2H75 A;  6GSS A;  1ACV A;  2DIZ A;  4OO5 A;  2RM6 A;  3VI5 A;  1EGR A;  4JR4 A;  4ULX A;  2B5E A;  1ZOF A;  4Q5R A;  2OE1 A;  1U88 A;  4LA1 A;  2PER A;  1EV4 A;  1YZX A;  1XOB A;  4OFM A;  4NPB A;  1R5A A;  1X5C A;  2LRC A;  2XHF A;  3FMW A;  5ENU A;  2R0C A;  4BVX B;  1M3J A;  2VM1 A;  2L4C A;  2IME A;  3WD6 A;  4WF4 A;  2IMK A;  4MP4 A;  5HR2 A;  1A8L A;  1F9M A;  1OC9 B;  3UAR A;  2QA2 A;  4XRD A;  3EIN A;  3GV1 A;  3C73 A;  2JZT A;  2LV3 A;  2H1D A;  3DVX A;  2OKA A;  3KM6 A;  4BA7 A;  4CY8 A;  4TR3 A;  1THX A;  2L5O A;  1XCC A;  2VAF A;  3D21 A;  1GSQ A;  3EUR A;  1UVZ A;  4ECB A;  1F2E A;  16GS A;  3VWU A;  3CRU A;  1K0B A;  4PUF C;  2HZF A;  2KOK A;  2WCI A;  1AAZ A;  4BIK A;  4MPF A;  4MJC A;  4XRA A;  3TB2 A;  4WEY A;  1F37 A;  4KUN A;  1Z7R A;  4L5L A;  14GS A;  2L4Q A;  3PPU A;  3C7M A;  2HSM A;  3IHQ A;  2PPT A;  2QSI A;  3H4K A;  5G2Z A;  3JCM L;  3LW9 A;  3DGQ A;  4ZBB A;  4BL7 B;  2MBT A;  3BJ5 A;  2IMD A;  4JE1 A;  3GFK A;  4GF0 A;  4LMW A;  2P31 A;  5G1L A;  3C71 A;  5AIV A;  3D6I A;  3GN3 A;  4MJA A;  2HYX A;  3J7Y k;  1I9D A;  2GS3 A;  5ECK B;  2B6M A;  3EWL A;  1ZYP A;  3KXO A;  5CRE A;  2C0G A;  1SEN A;  4GQF A;  3EU4 A;  2B3S A;  1OC8 A;  2FWF A;  4ZXG A;  1WWJ A;  3O76 A;  4N0Z A;  1XWG A;  2EIR A;  2X8H A;  3WGD A;  1SU9 A;  3FZ9 A;  1PGT A;  3TKS E;  2V41 A;  2NBS A;  4Z2T A;  4IHU A;  4FIW A;  5HQP A;  4HU9 A;  3R3E A;  1W4V A;  1G6Y A;  2V6O A;  2CV4 A;  5DDL A;  1NSW A;  3BBY A;  1DUG A;  5AN1 A;  4ZIJ A;  4CW9 A;  3GKK A;  3MSZ A;  3ZIT A;  3RAZ A;  3CMI A;  5LD0 A;  1XFL A;  1Z7P A;  3IXR A;  1M2A A;  3M3M A;  3W6G A;  2LKU A;  1TDI A;  4BL7 A;  1V57 A;  3TJK A;  4TR1 A;  1UC7 A;  2R3X A;  3UVT A;  1K0C A;  3CYN A;  1BED A;  1S3C A;  3E0U A;  5IMD A;  2JSZ A;  3O3T A;  2C8U A;  1GLP A;  2L57 A;  2YWI A;  5CO3 A;  2MMO A;  2H6X A;  2GT6 A;  4PUR A;  4ML1 A;  2R2J A;  1Z3E A;  4MJB A;  4EXJ A;  3L78 A;  1V9W A;  1T00 A;  2R4V A;  2VCV A;  3F63 A;  5ECP B;  1B8X A;  4F03 A;  3ZLP A;  2RII A;  3FR6 A;  3VWW A;  1PSQ A;  3EPT A;  3IA1 A;  3VWV A;  1OE7 A;  4PQI A;  1SJ6 A;  4HS1 A;  4GXZ A;  4X43 A;  2C3Q A;  1TKD B;  5F05 A;  1X9M B;  1M9A A;  5DAL B;  4V2L A;  1FOV A;  2CAQ A;  6GSX A;  2VD0 A;  2AB6 A;  1EWX A;  2VCZ A;  3MWH A;  2HRF A;  1TI3 A;  2YV9 A;  4TXO B;  1EP7 A;  5B8B A;  2VCT A;  3CRT A;  3ZVJ A;  1Y25 A;  3FRC A;  2F8F A;  1BAY A;  1S3R A;  4O5U A;  1VGL A;  3KTB A;  1KTE A;  4CY6 A;  3QDN A;  2JZR A;  3ZFL A;  5A4U A;  2O87 A;  3QOU A;  1SL2 B;  1AW9 A;  3E9J B;  3FR9 A;  4KX4 A;  4MJE A;  1WIK A;  5D9W A;  2D2Z A;  4MH3 A;  4GST A;  2LQO A;  3RPN A;  1J0F A;  1XZO A;  4TRX A;  3TRX A;  1MEK A;  2HXK A;  1FVK A;  1QUW A;  4EE0 A;  3F4T A;  2GQK A;  1AXD A;  5H5Q A;  1T3B A;  1VF2 A;  2H0I A;  3CBU A;  1K3O A;  4IQ1 A;  1SD9 A;  3QAW A;  2X99 A;  1FVJ A;  5G1K A;  4OFT A;  1ZMA A;  3VPQ A;  5CRW A;  3MAK A;  2H1G A;  4V2M A;  5KN2 A;  2I3Y A;  1LU4 A;  3GTU B;  4HJ2 A;  4TR0 A;  4IQA A;  2R5G A;  2YZH A;  3HVV A;  1QK8 A;  2R37 A;  5D73 A;  2PGT A;  1JHB A;  4K2D A;  2FLS A;  2BJX A;  2CQ9 A;  4ILF A;  3BD2 A;  4ISD A;  3KD0 A;  2DJ3 A;  3G7I A;  4O7H A;  4KDY A;  2XBQ A;  1KBN A;  1MDI A;  3KCM A;  1V58 A;  3GKX A;  2DJ1 A;  5DQY A;  3ZZX A;  1XIY A;  4G10 A;  4TXO A;  4IP6 A;  4EIP A;  1FW1 A;  1RW1 A;  4EO3 A;  3DIE A;  1W89 A;  3C1S A;  4DSQ A;  1PA3 A;  1HNC A;  1LJR A;  3HDC A;  1FG4 A;  4J2F A;  5ID2 B;  2WB9 A;  5DCG A;  5B7C A;  3AY8 A;  4RI7 A;  3M1G A;  2R6K A;  4MNN A;  1M7T A;  1YEP A;  2FHE A;  2AHE A;  3KZQ A;  4F2I A;  4NMU A;  3KEB A;  1OC3 A;  3J7Y b;  4GLT A;  3QFA C;  4MDC A;  2H71 A;  2HI7 A;  1GSS A;  1FHE A;  4EVM A;  2ES7 A;  4LMV A;  5IQY A;  3I6A A;  2HE3 A;  1R5P A;  3GTU A;  1HD2 A;  3H93 A;  4KE3 A;  3TJJ A;  2C3T A;  4ZB8 A;  3F6F A;  2P5R A;  4YAP A;  4HQS A;  1TTZ A;  3ZIJ A;  3BOA A;  4L0W A;  3VFI A;  5IM9 A;  5KN1 A;  3SBC A;  4J56 E;  2FWG A;  4XS6 A;  4OO4 A;  2H0G A;  5F0G A;  2CX4 A;  5IMF A;  3ZRE A;  3GH9 A;  4K7I A;  1U87 A;  4F82 A;  1M2D A;  5CYY A;  1WRY A;  2YJH A;  1GUK A;  4HZ4 A;  1PL2 A;  4KGI A;  4HQZ A;  3HHV A;  1GSE A;  2WS2 A;  1T7P B;  3LYK A;  5ECR B;  1PL1 A;  2JU5 A;  3HJM A;  5DBQ A;  1EOH A;  3VLN A;  5ID2 A;  1GL8 A;  3HKR A;  3WYW A;  2QKE A;  1Z9H A;  4TKY A;  19GS A;  3NOF A;  2KHP A;  1SL1 B;  5IMV A;  4BWQ A;  3LSZ A;  2AV4 A;  3DVW A;  1OKT A;  1T8E B;  1TXX A;  3F6D A;  1VF1 A;  5A5K A;  1CQG A;  4AJ8 A;  1XBS A;  2M80 A;  2M72 A;  2CAI A;  2YWN A;  4G19 A;  1X9S B;  3CTG A;  5A4W A;  4K5R A;  4ACS A;  2TRC P;  2LNS A;  4ECC A;  1AC1 A;  1O6J A;  2VM2 A;  5F07 A;  1SJI A;  5IOX A;  4LL4 B;  2B7K A;  1NW2 A;  2DBC A;  17GS A;  2G0F A;  1SK0 A;  2PVO C;  2LNT A;  1B9Y C;  1VF4 A;  2A2R A;  3UAP A;  4IJ3 A;  1GTB A;  5G30 A;  2RUE A;  5ECL B;  4HDE A;  1M9B A;  3A5W A;  2OBK A;  5C04 A;  4NV2 A;  5BMU A;  3D0Z A;  5CRG A;  4MH2 A;  3P2A A;  4I97 A;  2DJJ A;  3IK7 A;  1Q4J A;  1MTC A;  2WUL A;  4XIH A;  2CZ2 A;  2J23 A;  4HEA 2;  1SJZ A;  2BMX A;  1ERT A;  1O8X A;  4IS0 A;  5DJM A;  1HNA A;  2DSA A;  3MNG A;  2FA8 A;  3LQ7 A;  2I1U A;  3ERG A;  4L8E A;  2MMN A;  2K8S A;  3IR4 A;  4QQ7 A;  2O7K A;  4DSS B;  5CRD A;  4YH2 A;  3ZIV A;  3RHB A;  1O8W A;  2YN1 A;  4YQV A;  4POK A;  4HI7 A;  3EC3 A;  4E8H A;  2H30 A;  4I6X A;  3A5I A;  3ME7 A;  2WZ9 A;  1A2L A;  4MK3 A;  4NWY A;  2MMA A;  3RHC A;  4NAX A;  4XS4 A;  1B9X C;  1V40 A;  2VLT A;  5G31 A;  2C3N A;  2CX3 A;  4MF5 A;  3IK9 A;  4RQX A;  5JCW A;  3ISO A;  4ZL7 A;  2OE3 A;  5D9V A;  2VLU A;  4WR4 A;  3LJR A;  3KH7 A;  3RBT A;  2JAC A;  1B48 A;  3FYG A;  3MYD A;  3QR6 A;  2DMM A;  2DKH A;  3NZN A;  2WFC A;  3TOT A;  2KLX A;  4MLY A;  2PUK C;  2ZCT A;  3SWL A;  4DVC A;  2RUF A;  3DXB A;  4YKG A;  3WGX A;  2TIR A;  4X0X A;  5GSS A;  1AQX A;  2YWM A;  1GTA A;  1AQW A;  4KSM A;  3HVS A;  1YJ6 A;  2IL3 A;  3VUR A;  4KAE A;  3CQF A;  3QD9 A;  4KSO A;  1WPI A;  4ML6 A;  5EVO A;  4OFN A;  3L0H A;  2DJ0 A;  2GZZ A;  1YF0 A;  4K0N A;  2AAW A;  1XWC A;  3K8N A;  4BVX A;  4DSS A;  2X8C A;  3HXS A;  5GAP D;  4BWS A;  4ICY A;  1OC9 A;  5KOX A;  2N5B A;  3IRA A;  3TKQ A;  2EIO A;  3KMO A;  3VPT A;  4OMV A;  4KW6 A;  5DCH A;  1TRV A;  3ZRD A;  2J9H A;  5CAX A;  1GWC A;  5DAK B;  4Q5Q A;  8GSS A;  3IAM 2;  4AF2 A;  3PIN A;  4FH8 A;  2C0E A;  4ZBD A;  2X49 A;  1DE2 A;  4MCU A;  3GRX A;  5AIX A;  5LNK e;  4RUV A;  3HJP A;  1J08 A;  4NHW A;  5F8B A;  1GRX A;  1G0T A;  3IC4 A;  4GCI A;  5IPG A;  1ERV A;  1R4W A;  2PWJ A;  4EF0 A;  1H4O A;  1TK5 B;  6GSW A;  5D93 A;  10GS A;  1F3B A;  5J9B A;  1TJD A;  4GSN A;  4ECJ A;  4IW9 A;  5J3R A;  1PQN A;  22GS A;  3U5R E;  4MZW A;  5FWG A;  1YEX A;  4JED A;  4FO5 A;  1M0U A;  1HYU A;  3LOR A;  5AGY A;  4HU7 A;  5D8I A;  3R2Q A;  4O32 A;  2IIY A;  2VCQ A;  4EKZ A;  1PKW A;  1E6B A;  2FUG 2;  4EC0 A;  3DD3 A;  2FA4 A;  1YDK A;  5HR3 A;  3VWX A;  3QAV A;  5DAK A;  4YQU A;  2L5L A;  5J5N A;  1TRU A;  3IPZ A;  3F8U A;  1Z6N A;  4N11 A;  4X4J A;  4GWR A; 
#chains in the Genus database with same CATH homology
 3HY2 A;  3ERW A;  3FY7 A;  3G7J A;  2H0H A;  4MF6 A;  1SL0 B;  4G0L A;  5J41 A;  2GTU A;  2JSY A;  5ECI B;  1FOH A;  2VO4 A;  5HFK A;  4EDY A;  20GS A;  6GSU A;  2VL3 A;  3L4N A;  4ZBA A;  1B4Q A;  1URM A;  5CP1 A;  3IV4 A;  4IEL A;  3FZ5 A;  1K3Y A;  1A0F A;  2B5Y A;  4TW5 A;  2VCX A;  11GS A;  1WMJ A;  1A0R P;  2A2S A;  4BVY B;  2H1A A;  3WGE A;  2GLR A;  1PRX A;  4K9Z A;  2ON7 A;  2AJQ B;  4JR6 A;  4KB3 A;  2GST A;  3ME8 A;  2LJA A;  4ZL8 A;  4I2T A;  4Z7X A;  4MAB A;  1PN9 A;  1USB A;  2LJR A;  13GS A;  3CXG A;  2VIM A;  3F4S A;  2IJY A;  2GSS A;  5JCU A;  1TRS A;  1THO A;  4PQ1 A;  2L6C A;  2GSQ A;  4HZ2 A;  4PUA A;  3UBK A;  3HZ8 A;  2AYT A;  1SK1 A;  1K0O A;  2TRX A;  3NIV A;  4K2X A;  1ERU A;  1I5G A;  2JL4 A;  4I5Q A;  1DE1 A;  1ML6 A;  4ID0 A;  1XW5 A;  1MD3 A;  3HVX A;  5CNW A;  1EZK A;  3LXZ A;  1K3L A;  2HRN A;  4LL1 B;  4HOJ A;  5IOW A;  3V1W A;  2DC5 A;  3EMP A;  1TRW A;  1WJK A;  5H5S A;  2H73 A;  2A4H A;  1WE0 A;  1K0N A;  4G2E A;  5DAL A;  3HA9 A;  3S9F A;  3LEF A;  2F8A A;  2MYG A;  3TRP A;  1O81 A;  1NM3 A;  2G2Q A;  5D9X A;  3I9V 2;  1YY7 A;  4JU5 A;  3F0I A;  5GAN D;  4G0K A;  2WDU A;  1U3A A;  2IMI A;  1IYI A;  5INY A;  1XWB A;  2PMT A;  4OWY A;  1ZZY A;  2VL9 A;  2NTO A;  3M9K A;  3I69 A;  1MD4 A;  4BPY A;  4KCA A;  4OD7 A;  3DKS A;  1A2J A;  1F3A A;  1J9B A;  2RLI A;  1KEB A;  1XWK A;  2CZ3 A;  3GX0 A;  1X9W B;  2XC2 A;  2O85 A;  2R0P A;  5HR0 A;  4GTU A;  4L5O A;  1C72 A;  1A24 A;  2ZNM A;  1A23 A;  3TCO A;  1R7H A;  2N5A A;  1EOG A;  2X64 A;  1U3I A;  4GQC A;  4KA0 A;  1BQ7 A;  2WJU A;  2RM5 A;  1E2Y A;  4USS A;  2JAD A;  3IDV A;  1PKZ A;  1ON4 A;  1FO5 A;  1SKW B;  3PH9 A;  2FGX A;  3ZMK A;  1A8Y A;  1GUH A;  3P8W A;  2K6V A;  3M8N A;  7GSS A;  1YF1 A;  3M9J A;  3EYT A;  2WRT A;  2MBS A;  1X5E A;  1MDK A;  4MF7 A;  1GSY A;  1LBK A;  5HFG A;  4RI6 A;  1JZR A;  3TKS C;  1TP9 A;  4DEJ A;  2E2M A;  4PGT A;  2LUS A;  2VOC A;  9GSS A;  3F9U A;  3L9S A;  4RQR A;  2CVK A;  3GYK A;  3H79 A;  1YKC A;  3APS A;  2O89 A;  1PX7 A;  1JZD A;  2PVQ A;  3QCP A;  3IBH A;  1PD2 1;  1SK2 A;  1ZGN A;  5HFI A;  5EY6 A;  4AJ6 A;  2B7J A;  3H1N A;  5IMZ A;  1UN2 A;  3A3T A;  2KP1 A;  4QL9 A;  3IC8 A;  4TVE A;  3GHA A;  1T4Y A;  3DEX A;  2Z9S A;  2CVD A;  2C0F A;  3H8Q A;  4XCS A;  4TR4 A;  4XS1 A;  2C1Y A;  1SKR B;  3LFL A;  2GSR A;  4EL1 A;  3GMF A;  2YZU A;  1QFN A;  1U6T A;  1JFU A;  2HSH A;  3G9B A;  3GL5 A;  1K0M A;  2EIQ A;  4QL7 A;  2F9S A;  2XPD A;  2FWH A;  3EMX A;  5IMA A;  1Z6M A;  2HRK A;  5B6N A;  3LG6 A;  1OVN A;  1ZYN A;  1X5D A;  2H01 A;  3KGK A;  5D96 A;  1GSD A;  3HYP A;  2IFQ B;  4KH7 A;  3GA4 A;  3L9U A;  5AIS A;  2C4J A;  3KIJ A;  2ON5 A;  3FZA A;  4FYU A;  2V6K A;  3ZML A;  2A4V A;  4N10 A;  3CSI A;  4ZL9 A;  1TW9 A;  4IVF A;  4NHZ A;  4O92 A;  4HUA A;  4IGJ A;  3QMX A;  3CSJ A;  2H70 A;  2YAN A;  4JRR A;  6GSV A;  4YAV A;  1TI1 A;  3FKF A;  3U6V A;  1K0D A;  2QGV A;  2YJ7 A;  2H1B A;  1F6M C;  1VF3 A;  3IAS 2;  3W8S A;  2OBI A;  3HCZ A;  4K7O A;  4K7N A;  3IHG A;  1YKA A;  3TDG A;  3UEM A;  2GDR A;  2F3M A;  18GS A;  4J57 E;  5FHI A;  4EDZ A;  1DSB A;  5EL8 A;  1XWA A;  4YKF A;  1S3D A;  3KP9 A;  2NVL A;  5JCG A;  3UL3 A;  1NHO A;  3GSS A;  3RDW A;  1GTU A;  2I81 A;  4OCE A;  4CDO A;  1T1V A;  1YQ1 A;  4AGS A;  4IN0 A;  4KDU A;  5IPH A;  3ZL5 A;  4FYB A;  4AJ7 A;  3Q6O A;  5C00 A;  3TJB A;  4XTS A;  3FEU A;  1GUL A;  1SKS B;  2IFQ A;  3GUS A;  4E8E A;  5IIZ A;  1EP8 A;  1OKD A;  1A2M A;  1ABA A;  4D73 B;  2HNL A;  4O5R A;  3QFB C;  3VI7 A;  2OAD A;  4K5S A;  4K1F A;  4YQM A;  2LRT A;  2CA8 A;  2DKI A;  2VL2 C;  1JZO A;  2HFD A;  2O8V B;  3EU3 A;  4MZC A;  2VUP A;  1OE8 A;  2FY6 A;  2OAC A;  1N8J A;  4G9H A;  5ECN B;  1OAZ A;  3WT1 A;  3QPM A;  4ZB6 A;  5L71 A;  3MIX A;  4NV5 A;  2DJK A;  4TR1 B;  2LJK A;  2DML A;  5JWR B;  3TOU A;  1UA5 A;  1EEM A;  4WET A;  3GH6 A;  4MMM A;  3APQ A;  5GZZ B;  3KTL A;  4F0C A;  1X0R A;  3ZYW A;  1PX6 A;  4K8M A;  1K0A A;  5IO2 A;  4PXO A;  1ERW A;  1ZYE A;  2C0D A;  4CHS A;  1Z5Y E;  1XW6 A;  5ELG A;  4POM A;  2MZC A;  4WXT A;  2DLX A;  3KH9 A;  3IOS A;  4TXV A;  2GT5 A;  4LLR A;  4PX1 A;  4WR5 A;  4POL A;  3GX8 A;  5ECM B;  2E0Q A;  1B4P A;  2HT9 A;  4L0U A;  1JLW A;  4I2U A;  1SD8 A;  1M2B A;  3HJO A;  1OYJ A;  5G5E A;  3D4T A;  4D73 A;  5A4V A;  3TJF A;  4Z2U A;  4PNF A;  4JBB A;  1QQ2 A;  2K8V A;  1DBY A;  1AUC A;  1XVW A;  2V1M A;  1FAA A;  3F3R A;  1EGO A;  2REM A;  3TJG A;  5LCZ A;  3TKS A;  5BRT A;  2GVP A;  1XVQ A;  4KDX A;  2HZE B;  2EC4 A;  5ABR A;  1JZW A;  3C8E A;  1AQV A;  5KOW A;  1PMT A;  3EE2 A;  1V2A A;  4FQU A;  6GSY A;  2UZ8 A;  1TK8 B;  2F51 A;  2HLS A;  1GUM A;  2ZUP A;  3ERF A;  2CT6 A;  2YWO A;  2K18 A;  3D5J A;  3E3E A;  2NPB A;  5H5R A;  2HRA A;  4JZQ A;  3ZVJ D;  2M46 A;  3N5O A;  6GST A;  3QAG A;  4Z2R A;  2H66 A;  2PBJ A;  3CTF A;  3A2W A;  1SYR A;  1ST9 A;  2BTO T;  2A2P A;  1KNG A;  2L59 A;  2LST A;  2LTK A;  1GSF A;  2P5Q A;  3VK9 A;  4TN8 A;  2NDO A;  4H86 A;  1BYE A;  1HNB A;  5KN3 A;  5DQS A;  3LYP A;  5ECQ B;  2PU9 C;  3KP8 A;  2IWT A;  1M99 A;  1ZL9 A;  5D9T A;  3GL3 A;  1G7E A;  4ZB9 A;  2DIY A;  1G6W A;  1GLQ A;  1WP0 A;  2CVB A;  2VD1 A;  5KN0 A;  1NHY A;  2LEG A;  5E59 A;  3P90 A;  4FYC A;  4TOP A;  4IJI A;  4HJM A;  1GH2 A;  1JLV A;  2HSY A;  1TOF A;  3DML A;  2H6Y A;  4ECI A;  2LS5 A;  4P3Y B;  3D4M A;  2HZE A;  5JWO B;  2QA1 A;  4EIQ A;  2K9F A;  1TU7 A;  4MPG A;  4GSS A;  3G7Y A;  5B6M A;  1VRS D;  2GZY A;  2WGR A;  1V98 A;  3A2X A;  1ZYQ B;  2YCD A;  1FB6 A;  2IMF A;  2B1K A;  2AUV A;  3F3Q A;  2PN8 A;  5DVB A;  1XW9 A;  1PN0 A;  2X4A A;  2OE0 A;  1FB0 A;  4Q5F A;  4WBJ A;  3D22 A;  3L9V A;  5KEJ A;  3PGT A;  3TUE A;  1XPV A;  4KF9 A;  2LQQ A;  2JZS A;  1RQM A;  3ZTL A;  3FW2 A;  3I43 A;  2IN3 A;  5E4W A;  5EPF A;  3Q18 A;  3A2V A;  4I8B A;  5G5F A;  4K0G A;  3FR3 A;  1QGV A;  4GRF A;  1BX9 A;  4WBR D;  3KMN A;  2XBI A;  4BVY A;  3RPP A;  4Q5N A;  4X1U A;  4KCE A;  1H75 A;  3TGZ A;  5J4U A;  2OJL A;  4V1A p;  3UJ1 A;  3WT2 A;  1MDJ A;  2P0G A;  1QMV A;  1ILO A;  4V1A g;  4MA9 A;  1N2A A;  3KJY A;  3TKP A;  3GUR A;  5ECO B;  1QXH A;  3TRQ A;  5GST A;  5CRH A;  4F9Z A;  1BG5 A;  3DYR A;  3UBL A;  5IMC A;  4K6X A;  1GP1 A;  3US3 A;  4OCF A;  2GQM A;  3FZ4 A;  2L6D A;  5B8A A;  3MDK A;  2V2G A;  5J9C A;  5ELA A;  2H76 A;  2VL2 A;  2YV7 A;  3GKN A;  3FHK A;  3FK8 A;  1T4Z A;  4PNG A;  1XXU A;  2QC7 A;  2GZP A;  2H72 A;  2VCW A;  3TKR A;  2N5F A;  1WOU A;  3UIW A;  2MMZ A;  2E2G A;  3OR5 A;  2C80 A;  3ED3 A;  2H19 A;  3EVI A;  3ZFB A;  2R0G A;  1GNW A;  2V32 A;  1XOA A;  5JWQ B;  3UVH A;  3M0F A;  2GGT A;  2YPM A;  1G7O A;  4EUY A;  4NXI A;  2YNX A;  1O85 A;  3O6T A;  4DSR A;  4G0I A;  3Q19 A;  4IBP A;  2XPE A;  2H8L A;  2E7P A;  4IKH A;  1S3A A;  3DWV A;  5IO0 A;  2FWE A;  4ZIL A;  2FCH A;  2OA7 A;  4WKW A;  2X8G A;  2I9H A;  12GS A;  1ZCP A;  1IYH A;  3W8J A;  5COH A;  3CSH A;  1R26 A;  5ECS A;  5DJL A;  1HQO A;  3HD5 A;  3LGC A;  4F0B A;  4O5Q A;  1GNE A;  2VLV A;  2H6Z A;  4PTS A;  1AIU A;  2IPA A;  2B5X A;  1GTI A;  3C1R A;  3N9J A;  2LRN A;  3HZ4 A;  4KND A;  4MZB A;  4IP1 A;  3BCK A;  1RK4 A;  1EEJ A;  2FNO A;  3APO A;  5F06 A;  3IE3 A;  3LWA A;  1EV9 A;  1GSU A;  2YOI A;  2YP6 A;  3LXT A;  2DJ2 A;  2FD3 A;  2H74 A;  4N0V A;  4XS4 B;  3GKM A;  4N30 A;  2GQL A;  3DRN A;  3F4R A;  5FT3 A;  4POB A;  1CQH A;  1O7U A;  3P7X A;  5ECH B;  1Y6E A;  2B1L A;  2I4A A;  3UOM A;  4A5P A;  2ALB A;  3BCI A;  1O73 A;  3PR8 A;  3GNJ A;  4WF5 A;  3UMA A;  1Q98 A;  4XHM A;  1TU8 A;  3GST A;  1SYX A;  2KUC A;  1BJX A;  4PQH A;  1TK0 B;  2KP2 A;  3GIX A;  3Q74 A;  5HR1 A;  4V2N A;  2H75 A;  6GSS A;  1ACV A;  2DIZ A;  4OO5 A;  2RM6 A;  3VI5 A;  1EGR A;  4JR4 A;  4ULX A;  2B5E A;  1ZOF A;  4Q5R A;  2OE1 A;  1U88 A;  4LA1 A;  2PER A;  1EV4 A;  1YZX A;  1XOB A;  4OFM A;  4NPB A;  1R5A A;  1X5C A;  2LRC A;  2XHF A;  3FMW A;  5ENU A;  2R0C A;  4BVX B;  2VM1 A;  2L4C A;  2IME A;  3WD6 A;  4WF4 A;  2IMK A;  4MP4 A;  5HR2 A;  1A8L A;  1F9M A;  1OC9 B;  3UAR A;  2QA2 A;  4XRD A;  3EIN A;  3GV1 A;  3C73 A;  2JZT A;  2LV3 A;  2H1D A;  3DVX A;  2OKA A;  3KM6 A;  4BA7 A;  4CY8 A;  4TR3 A;  1THX A;  2L5O A;  1XCC A;  2VAF A;  3D21 A;  1GSQ A;  3EUR A;  1UVZ A;  4ECB A;  1F2E A;  16GS A;  3VWU A;  3CRU A;  1K0B A;  4PUF C;  2HZF A;  2KOK A;  2WCI A;  1AAZ A;  4MPF A;  4MJC A;  4XRA A;  3TB2 A;  4WEY A;  1F37 A;  4KUN A;  1Z7R A;  4L5L A;  14GS A;  2L4Q A;  3PPU A;  3C7M A;  2HSM A;  3IHQ A;  2PPT A;  2QSI A;  3H4K A;  5G2Z A;  3JCM L;  3LW9 A;  3DGQ A;  4ZBB A;  4BL7 B;  2MBT A;  3BJ5 A;  2IMD A;  4JE1 A;  3GFK A;  4GF0 A;  4LMW A;  2P31 A;  5G1L A;  3C71 A;  5AIV A;  3D6I A;  3GN3 A;  4MJA A;  2HYX A;  3J7Y k;  1I9D A;  2GS3 A;  5ECK B;  2B6M A;  3EWL A;  1ZYP A;  3KXO A;  5CRE A;  2C0G A;  1SEN A;  4GQF A;  3EU4 A;  2B3S A;  1OC8 A;  2FWF A;  4ZXG A;  1WWJ A;  3O76 A;  4N0Z A;  1XWG A;  2EIR A;  2X8H A;  3WGD A;  1SU9 A;  3FZ9 A;  1PGT A;  3TKS E;  2V41 A;  2NBS A;  4Z2T A;  4IHU A;  4FIW A;  5HQP A;  4HU9 A;  3R3E A;  1W4V A;  1G6Y A;  2V6O A;  2CV4 A;  5DDL A;  1NSW A;  3BBY A;  1DUG A;  5AN1 A;  4ZIJ A;  4CW9 A;  3GKK A;  3MSZ A;  3ZIT A;  3RAZ A;  3CMI A;  5LD0 A;  1XFL A;  1Z7P A;  3IXR A;  1M2A A;  3M3M A;  3W6G A;  2LKU A;  1TDI A;  4BL7 A;  1V57 A;  3TJK A;  4TR1 A;  1UC7 A;  2R3X A;  3UVT A;  1K0C A;  3CYN A;  1BED A;  1S3C A;  3E0U A;  5IMD A;  2JSZ A;  3O3T A;  2C8U A;  1GLP A;  2L57 A;  2YWI A;  5CO3 A;  2MMO A;  2H6X A;  2GT6 A;  4PUR A;  4ML1 A;  2R2J A;  1Z3E A;  4MJB A;  4EXJ A;  3L78 A;  1V9W A;  1T00 A;  2R4V A;  2VCV A;  3F63 A;  5ECP B;  1B8X A;  4F03 A;  3ZLP A;  2RII A;  3FR6 A;  3VWW A;  1PSQ A;  3EPT A;  3IA1 A;  3VWV A;  1OE7 A;  4PQI A;  1SJ6 A;  4HS1 A;  4GXZ A;  4X43 A;  2C3Q A;  1TKD B;  5F05 A;  1X9M B;  1M9A A;  5DAL B;  4V2L A;  1FOV A;  2CAQ A;  6GSX A;  2VD0 A;  2AB6 A;  1EWX A;  2VCZ A;  3MWH A;  2HRF A;  1TI3 A;  2YV9 A;  4TXO B;  1EP7 A;  5B8B A;  2VCT A;  3CRT A;  3ZVJ A;  1Y25 A;  3FRC A;  2F8F A;  1BAY A;  4O5U A;  1VGL A;  3KTB A;  1KTE A;  4CY6 A;  3QDN A;  2JZR A;  3ZFL A;  5A4U A;  2O87 A;  3QOU A;  1SL2 B;  1AW9 A;  3E9J B;  3FR9 A;  4KX4 A;  4MJE A;  1WIK A;  5D9W A;  2D2Z A;  4MH3 A;  4GST A;  2LQO A;  3RPN A;  1J0F A;  1XZO A;  4TRX A;  3TRX A;  1MEK A;  2HXK A;  1FVK A;  1QUW A;  4EE0 A;  3F4T A;  2GQK A;  1AXD A;  5H5Q A;  1T3B A;  1VF2 A;  2H0I A;  3CBU A;  1K3O A;  4IQ1 A;  1SD9 A;  3QAW A;  2X99 A;  1FVJ A;  5G1K A;  4OFT A;  1ZMA A;  3VPQ A;  5CRW A;  3MAK A;  2H1G A;  4V2M A;  5KN2 A;  2I3Y A;  1LU4 A;  3GTU B;  4HJ2 A;  4TR0 A;  4IQA A;  2R5G A;  2YZH A;  3HVV A;  1QK8 A;  2R37 A;  5D73 A;  2PGT A;  1JHB A;  4K2D A;  2FLS A;  2BJX A;  2CQ9 A;  4ILF A;  3BD2 A;  4ISD A;  3KD0 A;  2DJ3 A;  3G7I A;  4O7H A;  4KDY A;  2XBQ A;  1KBN A;  1MDI A;  3KCM A;  1V58 A;  3GKX A;  2DJ1 A;  5DQY A;  3ZZX A;  1XIY A;  4G10 A;  4TXO A;  4IP6 A;  4EIP A;  1FW1 A;  1RW1 A;  4EO3 A;  3DIE A;  1W89 A;  3C1S A;  4DSQ A;  1PA3 A;  1HNC A;  1LJR A;  3HDC A;  1FG4 A;  4J2F A;  5ID2 B;  2WB9 A;  5DCG A;  5B7C A;  3AY8 A;  4RI7 A;  3M1G A;  2R6K A;  4MNN A;  1M7T A;  1YEP A;  2FHE A;  2AHE A;  3KZQ A;  4F2I A;  4NMU A;  3KEB A;  1OC3 A;  3J7Y b;  4GLT A;  3QFA C;  4MDC A;  2H71 A;  2HI7 A;  1GSS A;  1FHE A;  4EVM A;  2ES7 A;  4LMV A;  5IQY A;  3I6A A;  2HE3 A;  1R5P A;  3GTU A;  1HD2 A;  3H93 A;  4KE3 A;  3TJJ A;  2C3T A;  4ZB8 A;  3F6F A;  2P5R A;  4YAP A;  4HQS A;  1TTZ A;  3ZIJ A;  3BOA A;  4L0W A;  3VFI A;  5IM9 A;  5KN1 A;  3SBC A;  4J56 E;  2FWG A;  4XS6 A;  4OO4 A;  2H0G A;  5F0G A;  2CX4 A;  5IMF A;  3ZRE A;  3GH9 A;  4K7I A;  1U87 A;  4F82 A;  1M2D A;  5CYY A;  1WRY A;  2YJH A;  1GUK A;  4HZ4 A;  1PL2 A;  4KGI A;  4HQZ A;  3HHV A;  1GSE A;  2WS2 A;  1T7P B;  3LYK A;  5ECR B;  1PL1 A;  2JU5 A;  3HJM A;  5DBQ A;  1EOH A;  3VLN A;  5ID2 A;  1GL8 A;  3HKR A;  3WYW A;  2QKE A;  1Z9H A;  4TKY A;  19GS A;  3NOF A;  2KHP A;  1SL1 B;  5IMV A;  4BWQ A;  3LSZ A;  2AV4 A;  3DVW A;  1OKT A;  1T8E B;  1TXX A;  3F6D A;  1VF1 A;  5A5K A;  1CQG A;  4AJ8 A;  1XBS A;  2M80 A;  2M72 A;  2CAI A;  2YWN A;  4G19 A;  1X9S B;  3CTG A;  5A4W A;  4K5R A;  4ACS A;  2TRC P;  2LNS A;  4ECC A;  1AC1 A;  1O6J A;  2VM2 A;  5F07 A;  1SJI A;  5IOX A;  4LL4 B;  2B7K A;  1NW2 A;  2DBC A;  17GS A;  2G0F A;  1SK0 A;  2PVO C;  2LNT A;  1B9Y C;  1VF4 A;  2A2R A;  3UAP A;  4IJ3 A;  1GTB A;  5G30 A;  2RUE A;  5ECL B;  4HDE A;  1M9B A;  3A5W A;  2OBK A;  5C04 A;  4NV2 A;  5BMU A;  3D0Z A;  5CRG A;  4MH2 A;  3P2A A;  4I97 A;  2DJJ A;  3IK7 A;  1Q4J A;  1MTC A;  2WUL A;  4XIH A;  2CZ2 A;  2J23 A;  4HEA 2;  1SJZ A;  2BMX A;  1ERT A;  1O8X A;  4IS0 A;  5DJM A;  1HNA A;  2DSA A;  3MNG A;  2FA8 A;  3LQ7 A;  2I1U A;  3ERG A;  4L8E A;  2MMN A;  2K8S A;  3IR4 A;  4QQ7 A;  2O7K A;  4DSS B;  5CRD A;  4YH2 A;  3ZIV A;  3RHB A;  1O8W A;  2YN1 A;  4YQV A;  4POK A;  4HI7 A;  3EC3 A;  4E8H A;  2H30 A;  4I6X A;  3A5I A;  3ME7 A;  2WZ9 A;  1A2L A;  4MK3 A;  4NWY A;  2MMA A;  3RHC A;  4NAX A;  4XS4 A;  1B9X C;  1V40 A;  2VLT A;  5G31 A;  2C3N A;  2CX3 A;  4MF5 A;  3IK9 A;  4RQX A;  5JCW A;  3ISO A;  4ZL7 A;  2OE3 A;  5D9V A;  2VLU A;  4WR4 A;  3LJR A;  3KH7 A;  3RBT A;  2JAC A;  1B48 A;  3FYG A;  3MYD A;  3QR6 A;  2DMM A;  2DKH A;  3NZN A;  2WFC A;  3TOT A;  2KLX A;  4MLY A;  2PUK C;  2ZCT A;  3SWL A;  4DVC A;  2RUF A;  3DXB A;  4YKG A;  3WGX A;  2TIR A;  4X0X A;  5GSS A;  1AQX A;  2YWM A;  1GTA A;  1AQW A;  4KSM A;  3HVS A;  1YJ6 A;  2IL3 A;  3VUR A;  4KAE A;  3QD9 A;  4KSO A;  1WPI A;  4ML6 A;  5EVO A;  4OFN A;  3L0H A;  2DJ0 A;  2GZZ A;  1YF0 A;  4K0N A;  2AAW A;  1XWC A;  3K8N A;  4BVX A;  4DSS A;  2X8C A;  3HXS A;  5GAP D;  4BWS A;  4ICY A;  1OC9 A;  5KOX A;  2N5B A;  3IRA A;  3TKQ A;  2EIO A;  3KMO A;  3VPT A;  4OMV A;  4KW6 A;  5DCH A;  1TRV A;  3ZRD A;  2J9H A;  5CAX A;  1GWC A;  5DAK B;  4Q5Q A;  8GSS A;  3IAM 2;  4AF2 A;  3PIN A;  4FH8 A;  2C0E A;  4ZBD A;  2X49 A;  1DE2 A;  4MCU A;  3GRX A;  5AIX A;  5LNK e;  4RUV A;  3HJP A;  1J08 A;  4NHW A;  5F8B A;  1GRX A;  1G0T A;  3IC4 A;  4GCI A;  5IPG A;  1ERV A;  1R4W A;  2PWJ A;  4EF0 A;  1H4O A;  1TK5 B;  6GSW A;  5D93 A;  10GS A;  1F3B A;  5J9B A;  1TJD A;  4GSN A;  4ECJ A;  4IW9 A;  5J3R A;  1PQN A;  22GS A;  3U5R E;  4MZW A;  5FWG A;  1YEX A;  4JED A;  4FO5 A;  1M0U A;  1HYU A;  3LOR A;  5AGY A;  4HU7 A;  5D8I A;  3R2Q A;  4O32 A;  2IIY A;  2VCQ A;  4EKZ A;  1PKW A;  1E6B A;  2FUG 2;  4EC0 A;  3DD3 A;  2FA4 A;  1YDK A;  5HR3 A;  3VWX A;  3QAV A;  5DAK A;  4YQU A;  2L5L A;  5J5N A;  1TRU A;  3IPZ A;  3F8U A;  1Z6N A;  4N11 A;  4X4J A;  4GWR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...