4UM3P

Engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
201
Chain Sequence
b'LDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 47
structure length 201
sequence length 205
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4um3P00
4NZBA 2XNUA 2BG9C 5J5GA 3RHWA 3EI0A 2ZJUA 2YKSA 2X00D 2Y58A 4TNWA 4X5TA 4QH5A 2XNVA 4A97A 2WNCA 3EHZA 2X00A 4ILCA 4WV9A 5L47A 3PMZA 3JAFA 2C9TA 5AFKA 3RIFA 2W8GA 2XQ8A 4HQPA 5J5IA 4LMJA 4TWDA 2Y57A 3EAMA 4NPPA 2BYRA 4TWFA 4ZZCA 1UW6A 4QH4A 4B5DA 4F8HA 1I9BA 5FJVA 3WTKA 4QABA 4QH1A 2XNTA 3U8NA 3TLWA 3RIAA 3UU4A 5BP0A 4LMKA 5AFLA 3UQ7A 3UU5A 5L4HA 5HEOA 1UX2A 5BW2A 5HCMA 2UZ6A 3WTOA 5HCJA 3ZDHA 3U8JA 2VL0A 3U8MA 2PGZA 2XQ9A 3WTNA 3WTJA 2BG9A 2Y56A 4DBMA 3WTMA 3UU8A 2QC1B 5LG3A 2XQ5A 4ZK4A 2BYNA 3SQ9A 4UM3A 2XYSA 3RI5A 3WIPA 4XK9A 4AFGA 4COFA 2BYPA 2XQ4A 5AFNA 3WTHA 2XQ7A 5KE4A 2WNJA 1UV6A 2BR7A 3JAEA 4Z91A 3ZDGA 4UY2A 2WN9A 4BQTA 5J5FA 2XQ6A 2PH9A 4ALXA 3SH1A 5HEJA 5AFMB 4IREA 5AINA 2YMEA 3C79A 4QACA 2W8FA 5J0ZA 3IGQA 5J5HA 2YOEA 3WTIA 3TLTA 5SYOA 4HFEA 3SQ6A 5JMEA 3GUAA 2XYTA 4ILBA 3TLSA 3U8KA 4UM3P 3RQWA 3ZKRA 4HFCA 4ILAA 2BG9E 2XQ3A 3UUBA 5L4EA 3WTLA 3T4MA 2BYQA 2BYSA 2BR8A 4LMLA 4TWHA 3UU3A 5CFBA 2YMDA 5TVCA 5LXBA 4D01A 3PEOA 4HFHA 4XHEA 3TLUA 5HEGA 3C84A 4PIRA 4HFBA 4FRRA 3U8LA 4ZJTA 4IL9A 4QAAA 5BRXA 3SIOA 2Y7YA 2WZYA 2BJ0A 4A98A 4Z90A 2XQAA 2XZ6A 4UM3S 4HFDA 4UM1A 5KZUA 3JADA 3P4WA 5AFMA 5CO5A 4TNVA 3TLVA 3UQ4A 4IL4A 3LSVA 3P50A 5AFHA 4BFQA 4ZR6A 2YN6A 4ZRUA 2ZJVA 5AFJA 2Y54A 5HEUA 3RQUA 5IUXA 2WNLA 4AFHA 4AFTA 4ZZBA 3UU6A 4HFIA 4UXUA 4EZ1A 4ZJSA 4ZK1A 2XZ5A 5HEHA 2BG9B
chains in the Genus database with same CATH superfamily
4NZBA 2XNUA 2BG9C 5J5GA 3RHWA 3EI0A 2ZJUA 2YKSA 2X00D 2Y58A 4TNWA 4X5TA 4QH5A 2XNVA 4A97A 2WNCA 3EHZA 2X00A 4ILCA 4WV9A 5L47A 3PMZA 3JAFA 2C9TA 5AFKA 3RIFA 2W8GA 2XQ8A 4HQPA 5J5IA 4LMJA 4TWDA 2Y57A 3EAMA 4NPPA 2BYRA 4TWFA 4ZZCA 1UW6A 4QH4A 4B5DA 4F8HA 1I9BA 5FJVA 3WTKA 4QABA 4QH1A 2XNTA 3U8NA 3TLWA 3RIAA 3UU4A 5BP0A 4LMKA 5AFLA 3UQ7A 3UU5A 5L4HA 5HEOA 1UX2A 5BW2A 5HCMA 2UZ6A 3WTOA 5HCJA 3ZDHA 3U8JA 2VL0A 3U8MA 2PGZA 2XQ9A 3WTNA 3WTJA 2BG9A 2Y56A 4DBMA 3WTMA 3UU8A 2QC1B 5LG3A 2XQ5A 4ZK4A 2BYNA 3SQ9A 4UM3A 2XYSA 3RI5A 3WIPA 4XK9A 4AFGA 4COFA 2BYPA 2XQ4A 5AFNA 3WTHA 2XQ7A 5KE4A 2WNJA 1UV6A 2BR7A 3JAEA 4Z91A 3ZDGA 4UY2A 2WN9A 4BQTA 5J5FA 2XQ6A 2PH9A 4ALXA 3SH1A 5HEJA 5AFMB 4IREA 5AINA 2YMEA 3C79A 4QACA 2W8FA 5J0ZA 3IGQA 5J5HA 2YOEA 3WTIA 3TLTA 5SYOA 4HFEA 3SQ6A 5JMEA 3GUAA 2XYTA 4ILBA 3TLSA 3U8KA 4UM3P 3RQWA 3ZKRA 4HFCA 4ILAA 2BG9E 2XQ3A 3UUBA 5L4EA 3WTLA 3T4MA 2BYQA 2BYSA 2BR8A 4LMLA 4TWHA 3UU3A 5CFBA 2YMDA 5TVCA 5LXBA 4D01A 3PEOA 4HFHA 4XHEA 3TLUA 5HEGA 3C84A 4PIRA 4HFBA 4FRRA 3U8LA 4ZJTA 4IL9A 4QAAA 5BRXA 3SIOA 2Y7YA 2WZYA 2BJ0A 4A98A 4Z90A 2XQAA 2XZ6A 4UM3S 4HFDA 4UM1A 5KZUA 3JADA 3P4WA 5AFMA 5CO5A 4TNVA 3TLVA 3UQ4A 4IL4A 3LSVA 3P50A 5AFHA 4BFQA 4ZR6A 2YN6A 4ZRUA 2ZJVA 5AFJA 2Y54A 5HEUA 3RQUA 5IUXA 2WNLA 4AFHA 4AFTA 4ZZBA 3UU6A 4HFIA 4UXUA 4EZ1A 4ZJSA 4ZK1A 2XZ5A 5HEHA 2BG9B
chains in the Genus database with same CATH topology
4NZBA 2XNUA 2BG9C 5J5GA 3RHWA 3EI0A 2ZJUA 2YKSA 2X00D 2Y58A 4TNWA 4X5TA 4QH5A 2XNVA 4A97A 2WNCA 3EHZA 2X00A 4ILCA 4WV9A 5L47A 3PMZA 3JAFA 2C9TA 5AFKA 3RIFA 2W8GA 2XQ8A 4HQPA 5J5IA 4LMJA 4TWDA 2Y57A 3EAMA 4NPPA 2BYRA 4TWFA 4ZZCA 1UW6A 4QH4A 4B5DA 4F8HA 1I9BA 5FJVA 3WTKA 4QABA 4QH1A 2XNTA 3U8NA 3TLWA 3RIAA 3UU4A 5BP0A 4LMKA 5AFLA 3UQ7A 3UU5A 5L4HA 5HEOA 1UX2A 5BW2A 5HCMA 2UZ6A 3WTOA 5HCJA 3ZDHA 3U8JA 2VL0A 3U8MA 2PGZA 2XQ9A 3WTNA 3WTJA 2BG9A 2Y56A 4DBMA 3WTMA 3UU8A 2QC1B 5LG3A 2XQ5A 4ZK4A 2BYNA 3SQ9A 4UM3A 2XYSA 3RI5A 3WIPA 4XK9A 4AFGA 4COFA 2BYPA 2XQ4A 5AFNA 3WTHA 2XQ7A 5KE4A 2WNJA 1UV6A 2BR7A 3JAEA 4Z91A 3ZDGA 4UY2A 2WN9A 4BQTA 5J5FA 2XQ6A 2PH9A 4ALXA 3SH1A 5HEJA 5AFMB 4IREA 5AINA 2YMEA 3C79A 4QACA 2W8FA 5J0ZA 3IGQA 5J5HA 2YOEA 3WTIA 3TLTA 5SYOA 4HFEA 3SQ6A 5JMEA 3GUAA 2XYTA 4ILBA 3TLSA 3U8KA 4UM3P 3RQWA 3ZKRA 4HFCA 4ILAA 2BG9E 2XQ3A 3UUBA 5L4EA 3WTLA 3T4MA 2BYQA 2BYSA 2BR8A 4LMLA 4TWHA 3UU3A 5CFBA 2YMDA 5TVCA 5LXBA 4D01A 3PEOA 4HFHA 4XHEA 3TLUA 5HEGA 3C84A 4PIRA 4HFBA 4FRRA 3U8LA 4ZJTA 4IL9A 4QAAA 5BRXA 3SIOA 2Y7YA 2WZYA 2BJ0A 4A98A 4Z90A 2XQAA 2XZ6A 4UM3S 4HFDA 4UM1A 5KZUA 3JADA 3P4WA 5AFMA 5CO5A 4TNVA 3TLVA 3UQ4A 4IL4A 3LSVA 3P50A 5AFHA 4BFQA 4ZR6A 2YN6A 4ZRUA 2ZJVA 5AFJA 2Y54A 5HEUA 3RQUA 5IUXA 2WNLA 4AFHA 4AFTA 4ZZBA 3UU6A 4HFIA 4UXUA 4EZ1A 4ZJSA 4ZK1A 2XZ5A 5HEHA 2BG9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NZB A;  2XNU A;  2BG9 C;  5J5G A;  3RHW A;  3EI0 A;  2ZJU A;  2YKS A;  2X00 D;  2Y58 A;  4TNW A;  4X5T A;  4QH5 A;  2XNV A;  4A97 A;  2WNC A;  3EHZ A;  2X00 A;  4ILC A;  4WV9 A;  5L47 A;  3PMZ A;  3JAF A;  2C9T A;  5AFK A;  3RIF A;  2W8G A;  2XQ8 A;  4HQP A;  5J5I A;  4LMJ A;  4TWD A;  2Y57 A;  3EAM A;  4NPP A;  2BYR A;  4TWF A;  4ZZC A;  1UW6 A;  4QH4 A;  4B5D A;  4F8H A;  1I9B A;  5FJV A;  3WTK A;  4QAB A;  4QH1 A;  2XNT A;  3U8N A;  3TLW A;  3RIA A;  3UU4 A;  5BP0 A;  4LMK A;  5AFL A;  3UQ7 A;  3UU5 A;  5L4H A;  5HEO A;  1UX2 A;  5BW2 A;  5HCM A;  2UZ6 A;  3WTO A;  5HCJ A;  3ZDH A;  3U8J A;  2VL0 A;  3U8M A;  2PGZ A;  2XQ9 A;  3WTN A;  3WTJ A;  2BG9 A;  2Y56 A;  4DBM A;  3WTM A;  3UU8 A;  2QC1 B;  5LG3 A;  2XQ5 A;  4ZK4 A;  2BYN A;  3SQ9 A;  4UM3 A;  2XYS A;  3RI5 A;  3WIP A;  4XK9 A;  4AFG A;  4COF A;  2BYP A;  2XQ4 A;  5AFN A;  3WTH A;  2XQ7 A;  5KE4 A;  2WNJ A;  1UV6 A;  2BR7 A;  3JAE A;  4Z91 A;  3ZDG A;  4UY2 A;  2WN9 A;  4BQT A;  5J5F A;  2XQ6 A;  2PH9 A;  4ALX A;  3SH1 A;  5HEJ A;  5AFM B;  4IRE A;  5AIN A;  2YME A;  3C79 A;  4QAC A;  2W8F A;  5J0Z A;  3IGQ A;  5J5H A;  2YOE A;  3WTI A;  3TLT A;  5SYO A;  4HFE A;  3SQ6 A;  5JME A;  3GUA A;  2XYT A;  4ILB A;  3TLS A;  3U8K A;  4UM3 P;  3RQW A;  3ZKR A;  4HFC A;  4ILA A;  2BG9 E;  2XQ3 A;  3UUB A;  5L4E A;  3WTL A;  3T4M A;  2BYQ A;  2BYS A;  2BR8 A;  4LML A;  4TWH A;  3UU3 A;  5CFB A;  2YMD A;  5TVC A;  5LXB A;  4D01 A;  3PEO A;  4HFH A;  4XHE A;  3TLU A;  5HEG A;  3C84 A;  4PIR A;  4HFB A;  4FRR A;  3U8L A;  4ZJT A;  4IL9 A;  4QAA A;  5BRX A;  3SIO A;  2Y7Y A;  2WZY A;  2BJ0 A;  4A98 A;  4Z90 A;  2XQA A;  2XZ6 A;  4UM3 S;  4HFD A;  4UM1 A;  5KZU A;  3JAD A;  3P4W A;  5AFM A;  5CO5 A;  4TNV A;  3TLV A;  3UQ4 A;  4IL4 A;  3LSV A;  3P50 A;  5AFH A;  4BFQ A;  4ZR6 A;  2YN6 A;  4ZRU A;  2ZJV A;  5AFJ A;  2Y54 A;  5HEU A;  3RQU A;  5IUX A;  2WNL A;  4AFH A;  4AFT A;  4ZZB A;  3UU6 A;  4HFI A;  4UXU A;  4EZ1 A;  4ZJS A;  4ZK1 A;  2XZ5 A;  5HEH A;  2BG9 B; 
#chains in the Genus database with same CATH topology
 4NZB A;  2XNU A;  2BG9 C;  5J5G A;  3RHW A;  3EI0 A;  2ZJU A;  2YKS A;  2X00 D;  2Y58 A;  4TNW A;  4X5T A;  4QH5 A;  2XNV A;  4A97 A;  2WNC A;  3EHZ A;  2X00 A;  4ILC A;  4WV9 A;  5L47 A;  3PMZ A;  3JAF A;  2C9T A;  5AFK A;  3RIF A;  2W8G A;  2XQ8 A;  4HQP A;  5J5I A;  4LMJ A;  4TWD A;  2Y57 A;  3EAM A;  4NPP A;  2BYR A;  4TWF A;  4ZZC A;  1UW6 A;  4QH4 A;  4B5D A;  4F8H A;  1I9B A;  5FJV A;  3WTK A;  4QAB A;  4QH1 A;  2XNT A;  3U8N A;  3TLW A;  3RIA A;  3UU4 A;  5BP0 A;  4LMK A;  5AFL A;  3UQ7 A;  3UU5 A;  5L4H A;  5HEO A;  1UX2 A;  5BW2 A;  5HCM A;  2UZ6 A;  3WTO A;  5HCJ A;  3ZDH A;  3U8J A;  2VL0 A;  3U8M A;  2PGZ A;  2XQ9 A;  3WTN A;  3WTJ A;  2BG9 A;  2Y56 A;  4DBM A;  3WTM A;  3UU8 A;  2QC1 B;  5LG3 A;  2XQ5 A;  4ZK4 A;  2BYN A;  3SQ9 A;  4UM3 A;  2XYS A;  3RI5 A;  3WIP A;  4XK9 A;  4AFG A;  4COF A;  2BYP A;  2XQ4 A;  5AFN A;  3WTH A;  2XQ7 A;  5KE4 A;  2WNJ A;  1UV6 A;  2BR7 A;  3JAE A;  4Z91 A;  3ZDG A;  4UY2 A;  2WN9 A;  4BQT A;  5J5F A;  2XQ6 A;  2PH9 A;  4ALX A;  3SH1 A;  5HEJ A;  5AFM B;  4IRE A;  5AIN A;  2YME A;  3C79 A;  4QAC A;  2W8F A;  5J0Z A;  3IGQ A;  5J5H A;  2YOE A;  3WTI A;  3TLT A;  5SYO A;  4HFE A;  3SQ6 A;  5JME A;  3GUA A;  2XYT A;  4ILB A;  3TLS A;  3U8K A;  4UM3 P;  3RQW A;  3ZKR A;  4HFC A;  4ILA A;  2BG9 E;  2XQ3 A;  3UUB A;  5L4E A;  3WTL A;  3T4M A;  2BYQ A;  2BYS A;  2BR8 A;  4LML A;  4TWH A;  3UU3 A;  5CFB A;  2YMD A;  5TVC A;  5LXB A;  4D01 A;  3PEO A;  4HFH A;  4XHE A;  3TLU A;  5HEG A;  3C84 A;  4PIR A;  4HFB A;  4FRR A;  3U8L A;  4ZJT A;  4IL9 A;  4QAA A;  5BRX A;  3SIO A;  2Y7Y A;  2WZY A;  2BJ0 A;  4A98 A;  4Z90 A;  2XQA A;  2XZ6 A;  4UM3 S;  4HFD A;  4UM1 A;  5KZU A;  3JAD A;  3P4W A;  5AFM A;  5CO5 A;  4TNV A;  3TLV A;  3UQ4 A;  4IL4 A;  3LSV A;  3P50 A;  5AFH A;  4BFQ A;  4ZR6 A;  2YN6 A;  4ZRU A;  2ZJV A;  5AFJ A;  2Y54 A;  5HEU A;  3RQU A;  5IUX A;  2WNL A;  4AFH A;  4AFT A;  4ZZB A;  3UU6 A;  4HFI A;  4UXU A;  4EZ1 A;  4ZJS A;  4ZK1 A;  2XZ5 A;  5HEH A;  2BG9 B; 
#chains in the Genus database with same CATH homology
 4NZB A;  2XNU A;  2BG9 C;  5J5G A;  3RHW A;  3EI0 A;  2ZJU A;  2YKS A;  2X00 D;  2Y58 A;  4TNW A;  4X5T A;  4QH5 A;  2XNV A;  4A97 A;  2WNC A;  3EHZ A;  2X00 A;  4ILC A;  4WV9 A;  5L47 A;  3PMZ A;  3JAF A;  2C9T A;  5AFK A;  3RIF A;  2W8G A;  2XQ8 A;  4HQP A;  5J5I A;  4LMJ A;  4TWD A;  2Y57 A;  3EAM A;  4NPP A;  2BYR A;  4TWF A;  4ZZC A;  1UW6 A;  4QH4 A;  4B5D A;  4F8H A;  1I9B A;  5FJV A;  3WTK A;  4QAB A;  4QH1 A;  2XNT A;  3U8N A;  3TLW A;  3RIA A;  3UU4 A;  5BP0 A;  4LMK A;  5AFL A;  3UQ7 A;  3UU5 A;  5L4H A;  5HEO A;  1UX2 A;  5BW2 A;  5HCM A;  2UZ6 A;  3WTO A;  5HCJ A;  3ZDH A;  3U8J A;  2VL0 A;  3U8M A;  2PGZ A;  2XQ9 A;  3WTN A;  3WTJ A;  2BG9 A;  2Y56 A;  4DBM A;  3WTM A;  3UU8 A;  2QC1 B;  5LG3 A;  2XQ5 A;  4ZK4 A;  2BYN A;  3SQ9 A;  4UM3 A;  2XYS A;  3RI5 A;  3WIP A;  4XK9 A;  4AFG A;  4COF A;  2BYP A;  2XQ4 A;  5AFN A;  3WTH A;  2XQ7 A;  5KE4 A;  2WNJ A;  1UV6 A;  2BR7 A;  3JAE A;  4Z91 A;  3ZDG A;  4UY2 A;  2WN9 A;  4BQT A;  5J5F A;  2XQ6 A;  2PH9 A;  4ALX A;  3SH1 A;  5HEJ A;  5AFM B;  4IRE A;  5AIN A;  2YME A;  3C79 A;  4QAC A;  2W8F A;  5J0Z A;  3IGQ A;  5J5H A;  2YOE A;  3WTI A;  3TLT A;  5SYO A;  4HFE A;  3SQ6 A;  5JME A;  3GUA A;  2XYT A;  4ILB A;  3TLS A;  3U8K A;  4UM3 P;  3RQW A;  3ZKR A;  4HFC A;  4ILA A;  2BG9 E;  2XQ3 A;  3UUB A;  5L4E A;  3WTL A;  3T4M A;  2BYQ A;  2BYS A;  2BR8 A;  4LML A;  4TWH A;  3UU3 A;  5CFB A;  2YMD A;  5TVC A;  5LXB A;  4D01 A;  3PEO A;  4HFH A;  4XHE A;  3TLU A;  5HEG A;  3C84 A;  4PIR A;  4HFB A;  4FRR A;  3U8L A;  4ZJT A;  4IL9 A;  4QAA A;  5BRX A;  3SIO A;  2Y7Y A;  2WZY A;  2BJ0 A;  4A98 A;  4Z90 A;  2XQA A;  2XZ6 A;  4UM3 S;  4HFD A;  4UM1 A;  5KZU A;  3JAD A;  3P4W A;  5AFM A;  5CO5 A;  4TNV A;  3TLV A;  3UQ4 A;  4IL4 A;  3LSV A;  3P50 A;  5AFH A;  4BFQ A;  4ZR6 A;  2YN6 A;  4ZRU A;  2ZJV A;  5AFJ A;  2Y54 A;  5HEU A;  3RQU A;  5IUX A;  2WNL A;  4AFH A;  4AFT A;  4ZZB A;  3UU6 A;  4HFI A;  4UXU A;  4EZ1 A;  4ZJS A;  4ZK1 A;  2XZ5 A;  5HEH A;  2BG9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...