4UM3P

Engineered ls-achbp with alpha4-alpha4 binding pocket in complex with ns3920
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
205
structure length
201
Chain Sequence
LDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRTLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSREISVDPTDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYLCHOLINE BINDING PROTEIN
publication title Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
pubmed doi rcsb
source organism Lymnaea stagnalis
molecule tags Signaling protein
total genus 47
structure length 201
sequence length 205
ec nomenclature
pdb deposition date 2014-05-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 4um3P00
2YKSA 3RIAA 4TNWA 3ZKRA 5KZUA 3GUAA 5J5IA 3IGQA 2BG9C 3WTNA 4UY2A 3WIPA 4UM3S 3UU5A 2X00D 4A98A 2PH9A 3JAEA 4BFQA 5KE4A 3WTLA 4EZ1A 2WNCA 4ZRUA 4DBMA 4ZR6A 4XHEA 1UX2A 4Z90A 2WZYA 4TWFA 5L47A 2ZJUA 3UU4A 2WN9A 5JMEA 2XQ5A 3RHWA 2Y56A 3UU6A 2W8FA 2XZ5A 1UW6A 4ILCA 2XQ7A 3WTHA 5BRXA 4ZJSA 3T4MA 3ZDGA 4X5TA 5HEUA 3EI0A 5BW2A 4D01A 4HFIA 2XYSA 2XZ6A 5J5FA 5AINA 3WTIA 5AFHA 3RI5A 3JAFA 4UM3P 3SH1A 3UU8A 4A97A 4QH5A 2XNTA 4COFA 5J0ZA 4IL9A 4QAAA 4AFHA 5AFJA 5J5HA 5AFMB 3U8MA 2Y54A 4NPPA 3EAMA 2Y7YA 5FJVA 2YN6A 5CO5A 2YOEA 2XQ6A 3WTKA 5HEOA 2WNLA 2XQ3A 2Y58A 5L4HA 2YMEA 5AFMA 5HEJA 3WTMA 4F8HA 3U8KA 3RQUA 2BYNA 4QH4A 4PIRA 3SQ6A 5HEGA 3TLWA 2XNVA 5BP0A 2XQ4A 1UV6A 4ALXA 4ZZBA 4UM1A 3SQ9A 4AFTA 2X00A 3C79A 2ZJVA 5HCMA 5AFKA 3SIOA 4HQPA 5AFLA 4ZK4A 2QC1B 2XQAA 5LXBA 2BG9B 3RIFA 5HCJA 3C84A 3ZDHA 3TLTA 3WTOA 2WNJA 4QACA 2BG9A 2YMDA 3P4WA 4LMLA 3P50A 4IREA 4LMJA 4TWHA 3JADA 4WV9A 2BYPA 5HEHA 4UXUA 2XYTA 2BR8A 4NZBA 3TLSA 2XQ8A 5J5GA 4FRRA 3U8JA 2PGZA 3PMZA 5LG3A 4Z91A 2C9TA 5TVCA 4ILAA 3U8LA 4BQTA 2W8GA 4HFEA 3UQ4A 3LSVA 4TNVA 4HFHA 4LMKA 2BJ0A 5SYOA 5L4EA 1I9BA 3EHZA 3WTJA 2BYSA 2XQ9A 4TWDA 4HFCA 5IUXA 4ZJTA 3TLUA 3RQWA 4ILBA 2Y57A 2BYRA 4QABA 3UU3A 2BR7A 2UZ6A 4HFDA 4QH1A 4XK9A 4UM3A 5AFNA 3TLVA 5CFBA 3PEOA 4IL4A 3UUBA 2BG9E 3UQ7A 4AFGA 2XNUA 2BYQA 4B5DA 4HFBA 2VL0A 4ZZCA 3U8NA 4ZK1A
chains in the Genus database with same CATH superfamily
2YKSA 3RIAA 4TNWA 3ZKRA 5KZUA 3GUAA 5J5IA 3IGQA 2BG9C 3WTNA 4UY2A 3WIPA 4UM3S 3UU5A 2X00D 4A98A 2PH9A 3JAEA 4BFQA 5KE4A 3WTLA 4EZ1A 2WNCA 4ZRUA 4DBMA 4ZR6A 4XHEA 1UX2A 4Z90A 2WZYA 4TWFA 5L47A 2ZJUA 3UU4A 2WN9A 5JMEA 2XQ5A 3RHWA 2Y56A 3UU6A 2W8FA 2XZ5A 1UW6A 4ILCA 2XQ7A 3WTHA 5BRXA 4ZJSA 3T4MA 3ZDGA 4X5TA 5HEUA 3EI0A 5BW2A 4D01A 4HFIA 2XYSA 2XZ6A 5J5FA 5AINA 3WTIA 5AFHA 3RI5A 3JAFA 4UM3P 3SH1A 3UU8A 4A97A 4QH5A 2XNTA 4COFA 5J0ZA 4IL9A 4QAAA 4AFHA 5AFJA 5J5HA 5AFMB 3U8MA 2Y54A 4NPPA 3EAMA 2Y7YA 5FJVA 2YN6A 5CO5A 2YOEA 2XQ6A 3WTKA 5HEOA 2WNLA 2XQ3A 2Y58A 5L4HA 2YMEA 5AFMA 5HEJA 3WTMA 4F8HA 3U8KA 3RQUA 2BYNA 4QH4A 4PIRA 3SQ6A 5HEGA 3TLWA 2XNVA 5BP0A 2XQ4A 1UV6A 4ALXA 4ZZBA 4UM1A 3SQ9A 4AFTA 2X00A 3C79A 2ZJVA 5HCMA 5AFKA 3SIOA 4HQPA 5AFLA 4ZK4A 2QC1B 2XQAA 5LXBA 2BG9B 3RIFA 5HCJA 3C84A 3ZDHA 3TLTA 3WTOA 2WNJA 4QACA 2BG9A 2YMDA 3P4WA 4LMLA 3P50A 4IREA 4LMJA 4TWHA 3JADA 4WV9A 2BYPA 5HEHA 4UXUA 2XYTA 2BR8A 4NZBA 3TLSA 2XQ8A 5J5GA 4FRRA 3U8JA 2PGZA 3PMZA 5LG3A 4Z91A 2C9TA 5TVCA 4ILAA 3U8LA 4BQTA 2W8GA 4HFEA 3UQ4A 3LSVA 4TNVA 4HFHA 4LMKA 2BJ0A 5SYOA 5L4EA 1I9BA 3EHZA 3WTJA 2BYSA 2XQ9A 4TWDA 4HFCA 5IUXA 4ZJTA 3TLUA 3RQWA 4ILBA 2Y57A 2BYRA 4QABA 3UU3A 2BR7A 2UZ6A 4HFDA 4QH1A 4XK9A 4UM3A 5AFNA 3TLVA 5CFBA 3PEOA 4IL4A 3UUBA 2BG9E 3UQ7A 4AFGA 2XNUA 2BYQA 4B5DA 4HFBA 2VL0A 4ZZCA 3U8NA 4ZK1A
chains in the Genus database with same CATH topology
2YKSA 3RIAA 4TNWA 3ZKRA 5KZUA 3GUAA 5J5IA 3IGQA 2BG9C 3WTNA 4UY2A 3WIPA 4UM3S 3UU5A 2X00D 4A98A 2PH9A 3JAEA 4BFQA 5KE4A 3WTLA 4EZ1A 2WNCA 4ZRUA 4DBMA 4ZR6A 4XHEA 1UX2A 4Z90A 2WZYA 4TWFA 5L47A 2ZJUA 3UU4A 2WN9A 5JMEA 2XQ5A 3RHWA 2Y56A 3UU6A 2W8FA 2XZ5A 1UW6A 4ILCA 2XQ7A 3WTHA 5BRXA 4ZJSA 3T4MA 3ZDGA 4X5TA 5HEUA 3EI0A 5BW2A 4D01A 4HFIA 2XYSA 2XZ6A 5J5FA 5AINA 3WTIA 5AFHA 3RI5A 3JAFA 4UM3P 3SH1A 3UU8A 4A97A 4QH5A 2XNTA 4COFA 5J0ZA 4IL9A 4QAAA 4AFHA 5AFJA 5J5HA 5AFMB 3U8MA 2Y54A 4NPPA 3EAMA 2Y7YA 5FJVA 2YN6A 5CO5A 2YOEA 2XQ6A 3WTKA 5HEOA 2WNLA 2XQ3A 2Y58A 5L4HA 2YMEA 5AFMA 5HEJA 3WTMA 4F8HA 3U8KA 3RQUA 2BYNA 4QH4A 4PIRA 3SQ6A 5HEGA 3TLWA 2XNVA 5BP0A 2XQ4A 1UV6A 4ALXA 4ZZBA 4UM1A 3SQ9A 4AFTA 2X00A 3C79A 2ZJVA 5HCMA 5AFKA 3SIOA 4HQPA 5AFLA 4ZK4A 2QC1B 2XQAA 5LXBA 2BG9B 3RIFA 5HCJA 3C84A 3ZDHA 3TLTA 3WTOA 2WNJA 4QACA 2BG9A 2YMDA 3P4WA 4LMLA 3P50A 4IREA 4LMJA 4TWHA 3JADA 4WV9A 2BYPA 5HEHA 4UXUA 2XYTA 2BR8A 4NZBA 3TLSA 2XQ8A 5J5GA 4FRRA 3U8JA 2PGZA 3PMZA 5LG3A 4Z91A 2C9TA 5TVCA 4ILAA 3U8LA 4BQTA 2W8GA 4HFEA 3UQ4A 3LSVA 4TNVA 4HFHA 4LMKA 2BJ0A 5SYOA 5L4EA 1I9BA 3EHZA 3WTJA 2BYSA 2XQ9A 4TWDA 4HFCA 5IUXA 4ZJTA 3TLUA 3RQWA 4ILBA 2Y57A 2BYRA 4QABA 3UU3A 2BR7A 2UZ6A 4HFDA 4QH1A 4XK9A 4UM3A 5AFNA 3TLVA 5CFBA 3PEOA 4IL4A 3UUBA 2BG9E 3UQ7A 4AFGA 2XNUA 2BYQA 4B5DA 4HFBA 2VL0A 4ZZCA 3U8NA 4ZK1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YKS A;  3RIA A;  4TNW A;  3ZKR A;  5KZU A;  3GUA A;  5J5I A;  3IGQ A;  2BG9 C;  3WTN A;  4UY2 A;  3WIP A;  4UM3 S;  3UU5 A;  2X00 D;  4A98 A;  2PH9 A;  3JAE A;  4BFQ A;  5KE4 A;  3WTL A;  4EZ1 A;  2WNC A;  4ZRU A;  4DBM A;  4ZR6 A;  4XHE A;  1UX2 A;  4Z90 A;  2WZY A;  4TWF A;  5L47 A;  2ZJU A;  3UU4 A;  2WN9 A;  5JME A;  2XQ5 A;  3RHW A;  2Y56 A;  3UU6 A;  2W8F A;  2XZ5 A;  1UW6 A;  4ILC A;  2XQ7 A;  3WTH A;  5BRX A;  4ZJS A;  3T4M A;  3ZDG A;  4X5T A;  5HEU A;  3EI0 A;  5BW2 A;  4D01 A;  4HFI A;  2XYS A;  2XZ6 A;  5J5F A;  5AIN A;  3WTI A;  5AFH A;  3RI5 A;  3JAF A;  4UM3 P;  3SH1 A;  3UU8 A;  4A97 A;  4QH5 A;  2XNT A;  4COF A;  5J0Z A;  4IL9 A;  4QAA A;  4AFH A;  5AFJ A;  5J5H A;  5AFM B;  3U8M A;  2Y54 A;  4NPP A;  3EAM A;  2Y7Y A;  5FJV A;  2YN6 A;  5CO5 A;  2YOE A;  2XQ6 A;  3WTK A;  5HEO A;  2WNL A;  2XQ3 A;  2Y58 A;  5L4H A;  2YME A;  5AFM A;  5HEJ A;  3WTM A;  4F8H A;  3U8K A;  3RQU A;  2BYN A;  4QH4 A;  4PIR A;  3SQ6 A;  5HEG A;  3TLW A;  2XNV A;  5BP0 A;  2XQ4 A;  1UV6 A;  4ALX A;  4ZZB A;  4UM1 A;  3SQ9 A;  4AFT A;  2X00 A;  3C79 A;  2ZJV A;  5HCM A;  5AFK A;  3SIO A;  4HQP A;  5AFL A;  4ZK4 A;  2QC1 B;  2XQA A;  5LXB A;  2BG9 B;  3RIF A;  5HCJ A;  3C84 A;  3ZDH A;  3TLT A;  3WTO A;  2WNJ A;  4QAC A;  2BG9 A;  2YMD A;  3P4W A;  4LML A;  3P50 A;  4IRE A;  4LMJ A;  4TWH A;  3JAD A;  4WV9 A;  2BYP A;  5HEH A;  4UXU A;  2XYT A;  2BR8 A;  4NZB A;  3TLS A;  2XQ8 A;  5J5G A;  4FRR A;  3U8J A;  2PGZ A;  3PMZ A;  5LG3 A;  4Z91 A;  2C9T A;  5TVC A;  4ILA A;  3U8L A;  4BQT A;  2W8G A;  4HFE A;  3UQ4 A;  3LSV A;  4TNV A;  4HFH A;  4LMK A;  2BJ0 A;  5SYO A;  5L4E A;  1I9B A;  3EHZ A;  3WTJ A;  2BYS A;  2XQ9 A;  4TWD A;  4HFC A;  5IUX A;  4ZJT A;  3TLU A;  3RQW A;  4ILB A;  2Y57 A;  2BYR A;  4QAB A;  3UU3 A;  2BR7 A;  2UZ6 A;  4HFD A;  4QH1 A;  4XK9 A;  4UM3 A;  5AFN A;  3TLV A;  5CFB A;  3PEO A;  4IL4 A;  3UUB A;  2BG9 E;  3UQ7 A;  4AFG A;  2XNU A;  2BYQ A;  4B5D A;  4HFB A;  2VL0 A;  4ZZC A;  3U8N A;  4ZK1 A; 
#chains in the Genus database with same CATH topology
 2YKS A;  3RIA A;  4TNW A;  3ZKR A;  5KZU A;  3GUA A;  5J5I A;  3IGQ A;  2BG9 C;  3WTN A;  4UY2 A;  3WIP A;  4UM3 S;  3UU5 A;  2X00 D;  4A98 A;  2PH9 A;  3JAE A;  4BFQ A;  5KE4 A;  3WTL A;  4EZ1 A;  2WNC A;  4ZRU A;  4DBM A;  4ZR6 A;  4XHE A;  1UX2 A;  4Z90 A;  2WZY A;  4TWF A;  5L47 A;  2ZJU A;  3UU4 A;  2WN9 A;  5JME A;  2XQ5 A;  3RHW A;  2Y56 A;  3UU6 A;  2W8F A;  2XZ5 A;  1UW6 A;  4ILC A;  2XQ7 A;  3WTH A;  5BRX A;  4ZJS A;  3T4M A;  3ZDG A;  4X5T A;  5HEU A;  3EI0 A;  5BW2 A;  4D01 A;  4HFI A;  2XYS A;  2XZ6 A;  5J5F A;  5AIN A;  3WTI A;  5AFH A;  3RI5 A;  3JAF A;  4UM3 P;  3SH1 A;  3UU8 A;  4A97 A;  4QH5 A;  2XNT A;  4COF A;  5J0Z A;  4IL9 A;  4QAA A;  4AFH A;  5AFJ A;  5J5H A;  5AFM B;  3U8M A;  2Y54 A;  4NPP A;  3EAM A;  2Y7Y A;  5FJV A;  2YN6 A;  5CO5 A;  2YOE A;  2XQ6 A;  3WTK A;  5HEO A;  2WNL A;  2XQ3 A;  2Y58 A;  5L4H A;  2YME A;  5AFM A;  5HEJ A;  3WTM A;  4F8H A;  3U8K A;  3RQU A;  2BYN A;  4QH4 A;  4PIR A;  3SQ6 A;  5HEG A;  3TLW A;  2XNV A;  5BP0 A;  2XQ4 A;  1UV6 A;  4ALX A;  4ZZB A;  4UM1 A;  3SQ9 A;  4AFT A;  2X00 A;  3C79 A;  2ZJV A;  5HCM A;  5AFK A;  3SIO A;  4HQP A;  5AFL A;  4ZK4 A;  2QC1 B;  2XQA A;  5LXB A;  2BG9 B;  3RIF A;  5HCJ A;  3C84 A;  3ZDH A;  3TLT A;  3WTO A;  2WNJ A;  4QAC A;  2BG9 A;  2YMD A;  3P4W A;  4LML A;  3P50 A;  4IRE A;  4LMJ A;  4TWH A;  3JAD A;  4WV9 A;  2BYP A;  5HEH A;  4UXU A;  2XYT A;  2BR8 A;  4NZB A;  3TLS A;  2XQ8 A;  5J5G A;  4FRR A;  3U8J A;  2PGZ A;  3PMZ A;  5LG3 A;  4Z91 A;  2C9T A;  5TVC A;  4ILA A;  3U8L A;  4BQT A;  2W8G A;  4HFE A;  3UQ4 A;  3LSV A;  4TNV A;  4HFH A;  4LMK A;  2BJ0 A;  5SYO A;  5L4E A;  1I9B A;  3EHZ A;  3WTJ A;  2BYS A;  2XQ9 A;  4TWD A;  4HFC A;  5IUX A;  4ZJT A;  3TLU A;  3RQW A;  4ILB A;  2Y57 A;  2BYR A;  4QAB A;  3UU3 A;  2BR7 A;  2UZ6 A;  4HFD A;  4QH1 A;  4XK9 A;  4UM3 A;  5AFN A;  3TLV A;  5CFB A;  3PEO A;  4IL4 A;  3UUB A;  2BG9 E;  3UQ7 A;  4AFG A;  2XNU A;  2BYQ A;  4B5D A;  4HFB A;  2VL0 A;  4ZZC A;  3U8N A;  4ZK1 A; 
#chains in the Genus database with same CATH homology
 2YKS A;  3RIA A;  4TNW A;  3ZKR A;  5KZU A;  3GUA A;  5J5I A;  3IGQ A;  2BG9 C;  3WTN A;  4UY2 A;  3WIP A;  4UM3 S;  3UU5 A;  2X00 D;  4A98 A;  2PH9 A;  3JAE A;  4BFQ A;  5KE4 A;  3WTL A;  4EZ1 A;  2WNC A;  4ZRU A;  4DBM A;  4ZR6 A;  4XHE A;  1UX2 A;  4Z90 A;  2WZY A;  4TWF A;  5L47 A;  2ZJU A;  3UU4 A;  2WN9 A;  5JME A;  2XQ5 A;  3RHW A;  2Y56 A;  3UU6 A;  2W8F A;  2XZ5 A;  1UW6 A;  4ILC A;  2XQ7 A;  3WTH A;  5BRX A;  4ZJS A;  3T4M A;  3ZDG A;  4X5T A;  5HEU A;  3EI0 A;  5BW2 A;  4D01 A;  4HFI A;  2XYS A;  2XZ6 A;  5J5F A;  5AIN A;  3WTI A;  5AFH A;  3RI5 A;  3JAF A;  4UM3 P;  3SH1 A;  3UU8 A;  4A97 A;  4QH5 A;  2XNT A;  4COF A;  5J0Z A;  4IL9 A;  4QAA A;  4AFH A;  5AFJ A;  5J5H A;  5AFM B;  3U8M A;  2Y54 A;  4NPP A;  3EAM A;  2Y7Y A;  5FJV A;  2YN6 A;  5CO5 A;  2YOE A;  2XQ6 A;  3WTK A;  5HEO A;  2WNL A;  2XQ3 A;  2Y58 A;  5L4H A;  2YME A;  5AFM A;  5HEJ A;  3WTM A;  4F8H A;  3U8K A;  3RQU A;  2BYN A;  4QH4 A;  4PIR A;  3SQ6 A;  5HEG A;  3TLW A;  2XNV A;  5BP0 A;  2XQ4 A;  1UV6 A;  4ALX A;  4ZZB A;  4UM1 A;  3SQ9 A;  4AFT A;  2X00 A;  3C79 A;  2ZJV A;  5HCM A;  5AFK A;  3SIO A;  4HQP A;  5AFL A;  4ZK4 A;  2QC1 B;  2XQA A;  5LXB A;  2BG9 B;  3RIF A;  5HCJ A;  3C84 A;  3ZDH A;  3TLT A;  3WTO A;  2WNJ A;  4QAC A;  2BG9 A;  2YMD A;  3P4W A;  4LML A;  3P50 A;  4IRE A;  4LMJ A;  4TWH A;  3JAD A;  4WV9 A;  2BYP A;  5HEH A;  4UXU A;  2XYT A;  2BR8 A;  4NZB A;  3TLS A;  2XQ8 A;  5J5G A;  4FRR A;  3U8J A;  2PGZ A;  3PMZ A;  5LG3 A;  4Z91 A;  2C9T A;  5TVC A;  4ILA A;  3U8L A;  4BQT A;  2W8G A;  4HFE A;  3UQ4 A;  3LSV A;  4TNV A;  4HFH A;  4LMK A;  2BJ0 A;  5SYO A;  5L4E A;  1I9B A;  3EHZ A;  3WTJ A;  2BYS A;  2XQ9 A;  4TWD A;  4HFC A;  5IUX A;  4ZJT A;  3TLU A;  3RQW A;  4ILB A;  2Y57 A;  2BYR A;  4QAB A;  3UU3 A;  2BR7 A;  2UZ6 A;  4HFD A;  4QH1 A;  4XK9 A;  4UM3 A;  5AFN A;  3TLV A;  5CFB A;  3PEO A;  4IL4 A;  3UUB A;  2BG9 E;  3UQ7 A;  4AFG A;  2XNU A;  2BYQ A;  4B5D A;  4HFB A;  2VL0 A;  4ZZC A;  3U8N A;  4ZK1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...