4UM8B

Crystal structure of alpha v beta 6
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
437
structure length
423
Chain Sequence
GCALGGTCEDCLLIGPQCAWCARCDTPANLLAKGCQLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDSKLAGIVCPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVTVNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Integrin Beta-Subunit Specificity for Latent Tgf-Beta
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords INTEGRIN ALPHA-V
total genus 101
structure length 423
sequence length 437
chains with identical sequence D
ec nomenclature
pdb deposition date 2014-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00362 Integrin_beta Integrin beta chain VWA domain
B PF07965 Integrin_B_tail Integrin beta tail domain
B PF07974 EGF_2 EGF-like domain
B PF08725 Integrin_b_cyt Integrin beta cytoplasmic domain
B PF17205 PSI_integrin Integrin plexin domain
B PF18372 I-EGF_1 Integrin beta epidermal growth factor like domain 1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 4um8B02
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 4um8B01
3.40.50.410 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold von Willebrand factor, type A domain 4um8B03
1UEXC 3EGDB 4CN8A 2VDLB 3NIFB 1LFAA 2I6QA 2VDMB 3HI6A 3EGDA 1CQPA 4WK2B 2VDNB 3VI4B 1JLMA 3HXQA 3PPYA 1U0OC 2NVOA 3K6SB 3EG9B 1TYEB 1JEQB 2ODPA 5HGJA 3TW0A 1CK4A 3TVYA 3OL2A 3F74A 1YVRA 2XWJI 3K72A 1JEYB 1M10A 5BV8A 1YUKA 3ZE0B 2UZYB 4WK4B 2XWBF 3BQNB 2VC2B 1M2OA 3K71B 1SHYB 4F1KA 5E6UB 3OL2B 1L5GB 3EFOB 3M6FA 5KYUA 4A0QA 2WW8A 3Q3GE 4NEHB 1PT6A 2QTVA 1Q0PA 3AL8B 1XUOA 1T0PA 1ZONA 2VDOB 3EGXA 3T3MB 4JDUA 5KYNA 4C2AA 3V4VB 4GZ8A 4WK0B 4UM8B 1IDN1 1ZOOA 1AUQA 4MMZB 1SSLA 1U8CB 1OLZA 5KYUB 3FCSA 3T3PB 1AO3A 3HXOA 5E6RA 3TCXB 5E6RB 2ODQA 2IUEA 3RAGA 5KYYB 3K6SA 4HQNA 3EG9A 4Z7OB 3IJEB 4DMUB 1QC5A 3ZDXB 1SQ0A 1ZOPA 5HJ2A 1M1XA 4MMXB 4O02A 4HQLA 5KYWA 1YVPA 3AL8A 4G1EB 4G1MA 3EH2A 4UM9D 1PD1A 2I6SA 3IBSA 2I91A 1MQ8B 1XDGA 2WINI 1L5GA 4Z7NB 1FE8A 3F78A 4HQFA 1N3YA 3EFOA 5E6UA 4G1EA 3VI3B 1M2VB 4WJKB 4NENB 3OKWA 1SHTX 2ICAA 2NUPA 3PPVA 4MMXA 4Z7QB 3PPXA 4HQOA 5KYXB 1MJNA 4F1JA 4C2BA 1PCXA 2XGGA 4PN7A 1OAKA 2NUPB 1ATZA 1T6BY 2P26A 1QC5B 4JX0A 2NUTB 4MMYA 1JEQA 3EOAI 1RRKA 3FCSB 4WFQA 3FCUB 4G1MB 5E6SB 3ZDZB 4HQKA 1U0NA 4O02B 2VDRB 1M1XB 3N2NA 1MQ9A 4C29A 2O7NA 3NVQA 4O3UB 5E6SA 3IJEA 1SHUX 1AOXA 1JV2A 3NIDB 2VDPB 5KYYA 4FX5A 3V4PB 3EH1A 1BHQ1 4O3TB 3ZQKA 1IDOA 1MHPA 4BJ3A 4UM9B 1RTKA 2NUTA 4MMZA 1U8CA 1QCYA 2VDKB 3GXBA 1MF7A 5KYXA 3ZE1B 2ADFA 1MQAA 1PD0A 1M2VA 2VDQB 1N9ZA 3NIGB 3EGXB 3E2MA 4M76B 4CN9A 2P28A 2X5NA 4IXDA 3OKYB 3ZDYB 4MMYB 3K71A 1FNSA 3BN3A 3BQMB 5KYWB 3ZE2B 4IHKA 4FWWA 3TXAA 1RD4A 3AL9A 1DZIA 3PPWA 3EOBI 1DGQA 1M1UA 2M32A 1NA5A 4CNBA 1V7PC 4XW2A 3K72B 5LN1A 4NENA 1BHO1 1RS0A 1XDDA 5HDBB 1JEYA 1IJKA 4K3JB 2B2XA 3QA3E 4IGIA 1JV2B 5ES4B 1IJBA 3AFCA
chains in the Genus database with same CATH superfamily
2YEZA 2J56A 1PZ5B 1AJ7H 1BS2A 1S8AA 1TQUA 4CT0A 3NGLA 4PJHB 4NOJA 4XIYA 4OLAA 5EWLB 1U8OA 2NTSP 1IG0A 4F3FA 4R8MA 1MCBA 1DT5A 1EU1A 3FG9A 2VW4A 3P0HA 2TRYA 3QIUC 2WPGA 3IP3A 2NY3C 1JUFA 3N55A 3CRW1 4L4YA 2YVQA 4RVOA 3BQUB 5A2LH 1HXKA 1SH7A 4JHBA 3OZTA 5ENWA 4I50F 2BSTA 4JRYE 4TRPH 1DFIA 4WW0A 4H20L 2O23A 3BEDA 1RJLA 5FOJA 3B8YA 4BRUA 5I0WA 5CU7A 1ANKA 1A76A 2EIHA 1Z36A 3QFGA 3VKHA 4GBMA 3SQDA 3AXTA 3QKSB 1G0NA 3RVDA 1IVYA 3WJ1A 2Y5EA 4PCKA 3EAFA 5ID1A 3QEMA 3RLFA 2GD6A 4KHXL 4E5UA 5LP6B 2HX8A 5J13C 5F9JB 2QG4A 1UDXA 4BRZA 4GQZA 3RUDA 2QQKH 2R1TA 4JAMB 4G6AD 3NM5A 2K7QA 4TMTA 2R751 5IP5A 2BERA 3EZ6A 2CL0X 1XI2A 4MINA 1R46A 3K81A 5KI6A 1GU0A 1FRNA 4JJEA 2JLBA 4LLYA 1KBOA 1MJGM 5AVZA 1WFUA 4B6FA 2C5DC 5DFVC 4GXUN 5ABZA 1OAZL 1G6VK 2GEVA 4EH1A 1VHQA 5C0NC 2P7TA 1YSCA 3LD9A 1VRVA 2R97A 4TL6A 2G76A 1JHAA 1X7QB 1QTRA 5DFTA 3NYWA 4QRFA 4IK7A 1L0XA 4FWTA 1VI6A 4KR0A 1H6TA 2CNWD 2ZU6A 3DMYA 1TC1A 3IPCA 2ZBPA 3LZ6A 1J8VA 3GPIA 4YAQA 2O0LA 4TSRA 2OY0A 2D4FA 2Q3CA 1PR6A 1L5NA 3QF7A 4JO1L 3CPLB 4DDWA 1N8ZA 2UXDB 1OI4A 4PZDA 1NUAA 4UTAH 4EHKA 2BNRE 3GDOA 4KXDA 1M71B 1VG8A 3TTSA 3I6YA 3EVZA 1PG5A 4XN1A 3MV7B 3CW9A 1T1YB 2IUSA 1IRIA 5HW0A 2XGJA 3I9OA 5TMDA 1AGNA 1XX9C 3S7GA 5C2BH 4AT6A 4TVPD 2W6ID 1D0VA 5TRTA 1XQXA 1YULA 4NQDB 3R3ZA 3ORFA 4AMXA 4BFXA 2Y1ZA 3CDZA 1S2DA 4OQTL 1YQVH 3T0AA 2GTWA 1RVV1 3NGBC 1NOIA 4GM1A 7YASA 3DGGA 3AGWA 4YNYA 4FSHA 4C03A 3ONFA 5I74C 4QHLB 1P2GA 2K87A 4NLHA 3UJHA 4D4KA 3T6QC 3ONWA 3OMIB 4RAUA 2L19A 1FL3A 3L4KA 1R9FA 1N8TA 1Q1NA 4CN4A 1Z34A 1QCZA 3NYIA 4Y6QA 1E5DA 3ILPA 3HG5A 5FKAB 1L6IA 2GM5A 1R15A 3OTTA 1SHYB 3MZTA 1HIMH 2J8UB 2QX7A 2I9LA 3WIHL 1QLRA 1XUOA 4Q9HA 4OCYH 1ZIOA 5ALTA 3MV7A 5J06A 2PX0A 3QTTA 3DQPA 1V45E 5E7FA 3OX3A 1E6WA 3GRBA 1WZCA 3P0YL 2FP4B 5LMUB 1KZQA 5E4IA 1BEUB 2WQSA 4BQIA 5AB2A 4NM8L 3BORA 5ILTL 3PQDA 4JR1A 2WA1A 4A6YH 4NNYB 2IYFA 4RV4A 5JJLA 2AEPH 1UD3A 4AWXA 1TTQB 1T1WB 2QN2A 3I1IA 5F0JB 5CLHA 3RZCB 2KL6A 5LCXA 1WLYA 2Q1SA 5B3NA 1ETA1 2BHFA 5FUXA 4AN0A 4EHFA 5KQSA 1X1EA 1RK7A 4P07A 2ZFUA 1W59A 2FY8A 3L02A 4KQ9A 1ZIAA 1XF9A 3MPUA 4IGEA 3PGMA 4Q9JA 3UBTA 4PV7A 2QN1A 5AOIA 1LSJA 2ZRDA 2Q1EA 1DEHA 4OLVL 4MR9B 521PA 2V3DA 1MCJA 3CT4A 5AOZA 3JZIA 1RYEA 4IX9A 4HZIA 4P31A 3LT1A 2EH7H 5I1KL 2X1VA 3HNTH 1II9A 4HL6A 4RD0A 4Q21A 5F1KA 2NO9A 3X44A 3UC2A 4QARA 3TFKC 2V03A 1MRSA 3GCDA 4KWCA 3IJPA 4HDRA 5DIFA 3T5GA 1F3JB 4C4BA 5JTUA 2WWNA 1XA3A 4HC1L 4OM0L 1JFVA 4O1HA 1JFHA 2NNFA 4HJJL 4I9WE 3UFXB 4G0OA 4RACA 4UPEA 3MT0A 4MEJA 1G55A 3MLWH 4JB0A 3DT8A 5AM1A 4GXFA 5GS2H 5EO9B 4EZMA 3NVMB 2X6AA 5BY2A 3ESNA 2EADA 5EFIB 1U4OA 2R79A 3FT2B 3O21A 3U40A 5IVNA 1AJEA 4OD0A 5E2TL 4XQEA 2P5TB 3DAOA 3MNWB 3PNQA 1YDEA 2HA5A 1HFUA 5DVLA 4YC2C 1XGQB 4Q4AB 3DV9A 4QYTA 3P4MA 3TWOA 3BSGA 1KK1A 3SQOH 4OB6A 4DN4H 1U9KA 3GT7A 4IRJB 2IVZA 2HVKA 1AMOA 2WO3B 3I8SA 4OQXA 2PYEB 2R2EB 3ZGOA 4R01A 3HLAA 1NJGA 4ONHB 4BH7A 1ZK5A 1RSFA 1G7JA 3ZMNA 2VPIA 3O45A 4FSDA 4MNGE 1YZGA 2XTAA 5LFAA 1QQBA 5FEBA 2BFAA 4QT0A 4ZT5A 1FORL 4XQ9A 3RWEA 1DIAA 3Q5OA 4CNIB 3QENA 3BWAA 1NM9A 2R1YB 3OGCB 4JM2C 1X1SA 3DJYA 2HSJA 4DNPA 1VACB 3P3SA 2FL5B 1DRWA 4QJ5B 2P9JA 4QJ5A 2ICEA 3B12A 3O2DA 3O6FC 2FH5B 2V5TA 4MJ6A 2HMVA 4L8VA 3EEYA 2NAFA 3ER9A 2ESVA 2QT6A 1IBLB 3IK2A 3MD0A 4H7FA 3HJEA 1RM0A 3DCYA 5HXMA 2ENPA 3ZR6A 3VFMA 1GKYA 4TMWA 1H9VA 5GS2D 1BG6A 4C87A 3GZNA 1JB9A 4EG8A 3TQOA 1Q12A 2ISDA 2BNQE 2EDKA 1T3SA 2W1NA 5I9QC 1YC2A 2G5PA 1Y9AA 3Q4GA 3BX1A 3CISA 4HLNA 2GRAA 1C1XA 1GKKA 4AC2A 3O1JC 3TM4A 4K5NA 2QVYX 1YPZA 4HUJA 3BVVA 1YEKL 4B6PA 1BLIA 3NTXA 3P45A 3ATFA 4HP5A 4EPRA 3H04A 4KYUA 3DXAE 5B4MD 3JQ8A 4F9TA 4L28A 5IIEA 1SPBS 3B5HA 1OVGA 1WC7A 1VCBC 1RXIA 1SUEA 4DPMA 1MLCB 1TMCB 3AITA 1CQXA 2QJWA 4MJ4A 2GSMB 1XGYH 5C8YB 4MXWH 4P2QA 4UCQA 4OFYD 2FG5A 4Z95H 1E2MA 1EDQA 3EJTA 4P9HL 3LO5A 2V6IA 3G5LA 1TJHL 3DT6A 3GJQA 1ORHA 1ZHLB 1JFQL 2A4ZA 1HN1A 4NZTH 1M6EX 3BULA 3ILDA 3V9PA 5EBGA 2J2ZA 1GSKA 3EDEA 4BPBA 4L4XA 1NVXQ 3DONA 1MC5A 3JZDA 1OI2A 1M10A 4DGYH 1JN6B 1ICIA 3HCRA 1GH7A 3IFNL 4J0GA 1R3IH 1U91A 4Y2OA 1MWAB 1A8IA 1C5DB 4IS3A 2LLGA 2ZLBA 1Z37A 1RKUA 1HDRA 4Z0HO 5SY9A 3MJCA 4QFMA 4R05A 2YUZA 3C48A 4ABWA 3NSXA 4NC0B 3GJFB 1VF5C 5FYKL 2HJRA 4AM0Q 1QQDB 2PL9A 2QG9A 1VA5A 4LMAA 3VACA 5DJXB 1KH2A 5A2GA 3GLIA 3QF4B 1TQVA 1YEHL 2N1TE 1CI3M 2YL2A 5CD9A 3O94A 2ZJSH 4FNLH 2VYNA 4UAVA 1YL5A 1Z68A 1WIPA 4EE2A 2G08A 2X9XA 3QQPA 4G70B 3KPWA 4CMHB 1S9KC 1J0IA 4LEOB 4S1VA 4JRLA 1XRMA 1M6HA 3GV0A 3EOAA 4AMUA 4WAFA 4GS5A 2YMXH 2BIOA 3EPPA 1AGEB 3QJYA 1MT3A 3QPWA 2P67A 5EKDA 1IXRC 1G9SA 3CSUA 3CH1B 1BG1A 3TE7A 3O4IA 5DZPA 3NVDA 2XB9A 3OM9A 2WZCA 4C0AC 3FKQA 2QN7A 4U6YB 3DURB 4URWR 1PV2A 4LL1A 4ABTA 1K8ZB 4Y2RA 2FX2A 5JARA 3UPUA 4FL4C 5LB1A 1D7OA 4ZXFA 5C1BA 1XJCA 1KJWA 4C4YA 2DKUA 3EF1A 2MKWA 2DKOA 2Q5HA 4G8DA 2J3KA 2ZICA 2FXIA 4YSDA 5IN4A 1TQWA 2Z6AA 2Z5GA 3P0VH 4NHUA 4AMBA 1NBOA 3LW7A 4CODB 1SEBB 4EB0A 5I47A 5I9BA 3K74B 4FD3A 3ROGA 1JG3A 3HG1A 1LM8V 5F7YC 4RMBA 4XVQA 1LS6A 2JS7A 1EFLA 5DW0A 3HFFA 1T5HX 1XR9A 3WVNA 2AZTA 4ZZ1A 3G9XA 2VXUL 4TZ0A 5FYKE 1K7XB 1RJ9B 3HFML 1KAGA 3KEMA 2WB7A 1JIVA 2X14A 3IPBA 3FJOA 3H4VA 3PWVA 2OP4H 2VWQA 2ZIFA 3RPEA 2WFZA 1SO8A 1T2QH 1K72A 4B95C 1YDMA 4DUGD 2F6RA 4M7PA 5KVQA 5TE4H 5IJXA 1RXLA 3WGUB 4HAKA 1P73A 4RH1A 4WZ6A 4FZ3A 4RMNA 2W0SA 3SIKA 5J40A 5T6BA 4TLLB 1KOGA 2B6HA 4JYBA 4PD4J 4M1DL 1JGEA 4YLYA 2J43A 5TDPB 1MDTA 2E47A 2Y5TB 4ELKA 4XD2A 3LXAA 4E7PA 1GRWA 1ND5A 3IFLL 2CXTA 3IPXA 2P24B 3X13A 4AI7A 3U0WH 3SJZA 5JD4A 3O8XB 2NQ3A 2O4EA 5KZCB 4C4ZA 1GAXA 4WH0A 1C08B 3TEXA 3C98A 4K55A 4JC5A 1AO7E 1X7QA 3R23A 1IQDB 1H0SA 4PU0A 2X9YA 1CNMA 2G75A 1FFAA 3BP4A 4Q9QH 2Z1PA 4H13C 3AQZA 3MBKA 4G8BA 3FONA 1LO2L 3KPLA 4K3GA 4GGOA 4HUXA 1VFBB 4QHNB 4OCMC 4I1IA 3ZX1A 3MF4A 5AVXA 4W63A 1E90A 3LUJA 4P4KC 5TGBA 1H3TA 3KRTA 1TKRA 1VFOA 3RJMA 3IE4A 2C57A 4F9LA 3GQBA 1A22B 4LPTA 3PJFA 4WY7H 1HYSD 4M1YA 5J1AB 4DMRA 4G63A 1U9CA 2VXQA 4KK9C 1YUBA 1AZNA 4YA6A 1RUKL 4OLWH 3GLQA 4ZHQA 4W4OC 1TCAA 2WF7A 3HYCA 1CU1A 1CLOL 4DETA 5KWYC 3EIXA 2VWEE 4TMFA 1HNNA 3THYB 4AS2A 4X99B 2CF5A 3K0YA 1T2XA 1K3UB 3VXMD 3SCMD 4V0ME 4FFWA 4G9FB 4Z1PA 5GGUA 4TT3D 3UYOD 3AKCA 4L4UA 2ZE7A 4M7JH 4M1TA 2NO1A 4NRZB 3PWJA 2A9QA 3FHQA 1YUHA 1WZEA 1B26A 2HMTA 1JGLH 1J8QA 3H7LA 3T7RA 5KMGA 4NQSA 3W1VA 1DBBH 4WWOA 1TB4A 3WB0A 5L8VA 3N40P 1BS9A 4ZOCA 1UTDA 4BTVA 2R0KH 2MSKA 1RPNA 1L9OA 1WOMA 4Y2QA 1PI3A 2PVCA 1CTNA 3JSXA 4IV0A 4Y16D 3MV01 3FTQA 2O20A 1QP1A 3S36X 2OGWA 2A9KA 4CM1A 2BP0B 1IEHA 3TNJA 3OFKA 4BB0A 2GJ8A 4UBMA 3K6FA 3KQHA 2ZQ5A 2RCNA 2R9HC 3QA9A 2Q4EA 2O2JA 5E4OA 1S9WB 4M0CA 2VMJA 5HYSG 3T4YB 5K6TA 3WUWA 5GZOD 1VHJA 5DJ8B 4DLKA 4BXOB 2ZSWA 4N5DA 5CLGA 4MIEA 5ANME 4FXLA 3A6HA 2LU4A 4NAHA 3TLBA 3CFYA 3FNHA 2Q49A 4WJLA 1NINA 2MCAA 1LBIA 3NDYE 2VXUH 1YI0A 2NTVA 4JE4B 5AOBA 4R8WL 1B6TA 2YRWA 5JPCA 1PZAA 2WIKA 5TXGA 4FXPA 4MNQB 1FX0B 3U44A 4LE1A 3TG8A 3TIGA 1R34A 1XGKA 5F2NA 3MZ0A 5DBEX 3T54A 2BP3A 3RU8H 3A4EA 2PRZA 4QEDA 5IZ7A 3PL1A 4CQLB 4C1BA 4BQSA 4I9FA 2BXZA 4L29A 3NXKA 4CVNA 4D81A 2QTFA 2D0OB 4HH8A 2WQWA 3CFEA 5FLXA 1RUPH 2CU9A 4PAQA 4HRVA 1T3TA 1V9CA 1CCZA 2ZSEA 4MMXA 2ENWA 3P4OA 1MFEH 3TO4B 3HCWA 5D7JA 5DNYB 3FRPB 1ZGAA 5LP1A 3BD6A 4PCTA 3C2QA 4UMDA 1WMFA 4KQ4H 3RHFA 3LPLA 2GEDA 1O6GA 2YEZB 5A7BA 1PQWA 4YUWA 1U3HB 2YSSA 3E8MA 2XTLA 2WHVA 2VDNH 1V71A 3LZFH 4RGMC 2IE8A 1XTIA 3HXLA 2FDRA 1MRCH 4MIKA 3QQ9D 2PR4L 4W81A 3EGXB 1H5NA 3Q05A 3IVAA 1GRCA 2ECOA 2B25A 4HJEA 3PDOA 2D3VA 4ZRGA 3DW1X 5JXHA 2D2FA 3RVUC 1X5GA 5L2KE 2IEIA 2YOFA 2Q7DA 4S10A 3LGAA 2IU3A 4LBEA 2GESA 1JZ7A 1M8FA 3ZVVA 3VMPA 2VNIA 1UXJA 5EC1A 4LSDA 4X4XB 1YZFA 3NU1A 4I6EA 4MQ7B 1YA4A 1Z18A 1E9PB 1BQ4A 2P77A 2XAAA 3I4FA 4X8MA 3WLIA 4BQOA 2CHWA 5JHDB 4RZQA 4M8QB 4RFVA 1FIGH 1HH4A 1YEJH 2PFSA 2G8LA 1ZN8A 1OMOA 2BNQD 4NQEB 4DZBA 1XGPA 3L1JA 2AEEA 1T0PA 4PJ5D 5ALNA 1KT2B 5JW4M 3ORRA 1DLFL 3PE9A 2H0FA 4Z4GA 3CBRA 1JWSB 3FSZA 5KS9E 3MT8A 3IILA 5IARA 1H93A 5AVTB 2W2LD 1J2YA 1P2BA 3KUKA 5ESRA 3FKSA 4GDMA 5D1QE 3V7FA 2PUBA 1GLGA 2Q3BA 4AX8A 3AACA 3CX5K 1PKOA 4EO5A 4D0BA 2VRCA 3VA7A 4Y16B 4NOKA 1OGAE 3IDYB 3K6DA 4ZNEA 1J00A 3SGKA 2PYFA 4H7JA 2WJYA 3EJRA 1YIOA 1Y7VA 2J6WA 3OB0K 1E0SA 2W2MA 1QCCA 1I1YA 3B7PA 3AAZB 4DQVA 3DYMA 5JPMB 4RK5A 2W8ZA 4XWGH 2A78A 1M56B 2DWTA 1Z0SA 1FFNA 2PKYX 3DZKA 2RHHA 5F76A 4M1DH 1DX4A 2GK7A 3SHFA 1KR5A 2ZJ6A 5T3ZH 3LHFA 1F58H 2JA1A 5AAMC 4LZZA 1RAMA 2HWUA 3AB0C 1GC1L 2JIRA 2Y0SA 2WBJA 2RHOA 4B5LA 2I2AA 5DBGA 4KNWA 3U3RA 4DBLC 3O0DA 4OVKA 2BWJA 2O4UX 1HDXA 1U2QA 2IDTA 6TAAA 1CGSH 2QT0A 4RMQA 3VO9A 1VBKA 3N2JA 3V1TC 1MJJB 4HUWA 3NMUF 4B4KA 3TN7A 3ZLQC 1OXMA 2J7PD 3IDUA 4X4YB 1JDBB 3D2LA 3WY3A 5C0CD 3PKJA 4DBZA 3G0DA 4C2AA 2IZ7A 1QOPB 4L6AA 4YT2A 3GGPA 5EJ6A 4YAOA 3S96B 1O57A 5CDFE 1NC2D 2VQSA 3CLTC 5HZKA 4AENB 1ZT1B 1MKFA 2Y93A 4FFMA 1NZDA 3F8TA 3LQ4A 4RTOA 4YMWA 3IT1A 3CVVA 1RIIA 1ZL2A 5BUAA 2DQSA 3QIBC 2Q5QA 5IT2L 2I7SA 4N8VA 5KHOC 3VC1A 2CBXA 2XYHA 2I7OA 5L3SB 1JGTA 3JR3A 3F5SA 2XUOA 4JFXA 5KOVC 5IBLC 4H2DA 3UYPB 1QEWB 4EY6A 1ZGHA 4TVPL 1CSEE 4UIMB 1HMYA 1XDZA 4V03A 1UEMA 4JHAL 3FUKA 1T22B 3T5BA 4YXWD 4J2HA 2WINB 4NCBA 3NSDA 1OW3B 3IPLA 4XQGA 2YO3A 4II7A 1U1GA 1T34A 3SJVB 2WQ6A 3O41B 1AGBA 2G09A 3DXXA 3MUGB 4G82A 2G9ZA 4HNGA 3O8DA 3FMGA 3W11D 4UTXA 1JZQA 4PR3A 3GJ0A 1WB4A 3BRFA 4XOUA 2Y07H 4NX0A 4IDBA 5AVWA 1F4WL 2J3JA 3TA4D 4TV9B 1Z9NA 3Q0TA 4YDSA 1KXVA 3N1PC 4KAQH 3M5PA 3L82B 2H7VA 3TJMA 3QOXA 3AVEA 2IVFA 5IBTH 4G9DA 1TJ3A 1HKUA 2RGGA 4X6FB 1LO0L 1T6VN 4X7FC 4HYYA 5E4FA 1IU9A 4R68A 1U95A 3KPRB 2W9EL 2F5AL 2WQ7A 2CJFA 3LX5A 1FFGA 4RFSB 4RFSA 4YCMA 3WKQA 2RIKA 4B6ZA 1EAYA 4KH1A 3V10A 1GGBL 1E1CB 3KFVA 1JIQA 5J7CC 5CP3H 3V1MA 3WXWL 1ZPUA 1SVOA 3VUFA 5CCJA 5E6SB 3ZTEA 4WNJA 1XQYA 4DUYB 5BZXA 1GCOA 3QRFM 3JVIA 5J12C 3M8OL 3GSVB 3P4NA 1XSEA 1CJCA 3A4VA 4UV4L 3CMCO 4G5ZH 1M34A 3OR6B 1KVTA 2MINB 3BO8B 2H6PB 4GC9A 1FP5A 4MKTA 2E89A 4A8HA 1KTKE 3DB2A 4JDZB 1JPGB 5KNCH 3QS2A 1SFHA 2WWWA 4DAEA 1EDBA 3QMMA 4ZFNA 1ZXBA 4OHKA 4KZPA 3HPRA 2EC9U 3PPEA 4TRJA 3CGTA 4H8WH 3W7VA 4BFEA 2CXGA 2H41A 3RR2A 4MMZC 3LEVL 1KYUA 2O7QA 3AU9A 4BTEA 3SBWC 3I5AA 1A14L 2YAMA 1NP6A 1NBYB 1S2IA 1POWA 4ARBA 3WZLA 5CR1A 1AD9B 4OTXL 1AGCB 3G6JF 1U8QA 1BKDR 3F74A 3I01M 4UHFA 3R7SA 1JEYB 5JMOA 4MJ2A 1U8TA 3K1AA 4FNOA 2Y2UA 2P41A 1QAMA 1JD7A 1UKSA 1MH9A 3SODB 3FYDA 1V3TA 1TAQA 3QR0A 4GAGH 2NYYC 3SKVA 2JIDA 4D0SA 3TH3T 5HILA 2VL5B 1JQEA 4DB2A 3VXMA 4GKNA 4Z77B 1UBOS 2WU3A 5INCA 4AIZA 4HQNA 1GGMA 2J1WA 3ZK8A 3GJ6A 3G6AB 1VJCA 2YWBA 3HDQA 3AETB 4FXKC 4J29A 1XZAA 4AL8L 2PYEE 1U8OB 2Z31C 1WZIA 4Z7QB 3I4LA 3Q3VA 2ZJ2A 2EJBA 4OF0A 2FDBP 3R3UA 3IMKA 3C14C 1J0CA 3GFVA 4AV4A 4YSQA 1L4IA 4B3GA 1THZA 1VHWA 1FORH 5I66B 5I6KA 2ZVJA 2PO6D 5KDOA 1IRAY 2PN5A 3DZCA 1OF2A 2TMGA 1HH9B 3CFDB 1U9YA 3STLB 5D00A 4ODHH 1NXQA 5C08B 2BONA 4JJGA 5A6VA 1D5BB 4X6CF 3L0ZA 4HNAA 4MMYB 4GDFA 1VLMA 4IQHA 4EVSA 1K89A 5L4JA 5BSGA 4KO4S 4LW8A 2QZ4A 4XMTA 2D8AA 4DYVA 5BW4A 4HTFA 1J7JA 5TEWA 4E2YA 3WJJA 3RFZA 2R6ZA 2Y2TA 3BKCH 1O96A 4R71A 4WTXA 1YS2X 5DYYA 4FYTA 2WT8A 4J4BA 1NP7A 2AS5M 3H65A 2HFTA 1TAHA 4MJIE 2VJXA 4AN1A 4DP7X 3NWPA 2C34A 3DX3A 1PJBA 1XZBA 3I0ZA 3UHOA 2CKBA 3DNFA 4N0FB 2O06A 3KWWA 1PJ4A 3PD0A 1GYCA 4EEZA 3PGCB 4ZTPL 2PGJA 3C6LD 1UZ6E 4Y88A 1TEYA 2P5EE 4LPYA 2ZT9C 5E6RB 2E85A 2XDAA 1B9ZA 3ZTNH 3T0IA 4GPBA 2Z08A 4YX2H 3HCCA 3L7IA 3QAQA 3SC2B 4YHNB 5FX2A 4Y89A 4C6HA 5I2IA 3GSQA 1QJCA 2XY4A 4DLYA 1ZTXL 1W35A 2VL7A 3BFWA 1OBHA 2QPFA 2IHJA 3D8NA 4MW9A 2H29A 1XYVA 2QD5A 2OS7A 1FIEA 3F8WA 2ODAA 1P33A 4BKSC 3FVWA 5IWLA 2D3WA 4NAJA 2O57A 4F9FA 1N5YH 1NTRA 2A6JB 2IIVA 3MV7E 1N7IA 2G77B 4K1LA 2COQA 4FQXA 3P9XA 1CUHA 4X8LA 4LJRA 3GXOA 1TLKA 2FWUA 2ZPKH 3TJEL 4N0FA 2GB4A 3CSYB 3O3EB 1U1FA 3MJSA 1X7GA 3PXUA 4CVXA 5BV2P 1BJ1H 1F4HA 1S78C 3QI9B 3I5XA 4DV4B 4D9RD 4S04A 1SYVA 5ADOH 1QIKA 5JT1A 4UVHA 5KAQG 4ZZ0A 4R2GD 5KWEA 4V1DB 2C5LA 3ULSA 3ZTJH 3RIAK 1BC5A 4OCRH 1XF4A 4XI5C 1VHLA 3SZUA 1JKFA 4W9MC 2OPHA 3TBWA 4LOAA 4FN5A 2EUVA 3VU3A 2VDML 4AYSA 1UEJA 3EN0A 2JKVA 3BKYL 3CHRA 1FH2A 5DIZA 1Q0QA 5E6ID 5CH3A 1GHFH 2OJZH 3MSPA 3O9WD 5DHMC 1E4EA 5LGJB 2VJNA 1Q72H 3UTPE 3H3PL 4PWFA 2APXA 1H22A 3IUQA 3PHCA 2AEWA 4DA9A 4JUAA 2KE5A 4K7PL 4LLVA 1RHHB 2FO1A 3FVVA 3LKSB 4L16A 3NORA 4NP9A 5J1SC 1M83A 3NFPA 1QHOA 1J06A 1BCRB 2GARA 2WYIA 3BIKB 1V5JA 3FQNA 5JPNA 3AW9A 3KPJA 4QWWA 1SXHA 2OV8A 1BIHA 4XOCA 1ZXQA 1LK3H 5CINL 3A2MA 3ULVF 3NIGB 2WILA 1WF3A 4LDCA 4HB4A 1HR0B 3ZLVA 3TTVA 3WWZA 2NYRA 4Q66C 4EHAA 2XTJB 3IVKA 4K3JB 2B2XA 1YEKH 2DWQA 4L2LA 2XWJA 5CGQB 4NICA 2H2PD 3W0WE 1E40A 1SZCA 2VPZA 4LTMA 3QV2A 4ZAKD 5J5CA 4BINA 3RWCB 5CP7A 1DQKA 4P5SA 3MV11 2BR4A 2PL5A 2XUAA 3G79A 4RHEA 4U33A 4Y4HC 4LGRB 1UJ5A 1ZK2A 2A88A 1NVBA 1PW3A 2AJSH 4XPHH 3DEZA 3E23A 1WXDA 1TOXA 4XWTA 2H2WA 5D7LD 1LV7A 2J3SA 4A10A 4UNRA 1O9BA 2PLTA 1UZMA 3KWXA 5DK2A 4Z7OB 1NW6A 1R6UA 3MCUA 2EYSB 3WMFA 3TA3B 3CURA 4PJIE 4R3UC 3H97A 4MQFA 5G0UA 3VAYA 3LZDA 2QZ5A 4D0DA 4AQAA 3OJLA 1O5PA 1RXEA 4UHKA 4U6TA 1N5YL 2A9NH 4IKLA 1C3OA 1FYFA 3IEIA 4WFHE 4UHDA 1NT2A 1UKYA 4PTLA 3Q7PA 3RVSA 2TAAA 1NY6A 4YDIH 2BH9A 2HP4A 1UWYA 3Q8WA 3FH5A 2R0WL 4TUOA 2G67A 1MAMH 3D7LA 1D5CA 1UK6A 1E98A 4CKCA 2AV1B 5JSHA 2ZAYA 2IH2A 1KEWA 3TN0C 3ZK0A 5KBMA 1SC6A 3DDZX 3VGAC 3WV4A 4U2EA 3HVNA 3W5AA 2YC1B 2G9HB 3NDRA 1LO4L 3CVCA 1OUMA 1DVFD 1S7SB 1NXVA 1NUPA 3RGVB 1EJ2A 5HS4A 1ZJZA 3ARSA 4GMTH 2WK1A 3OJDB 4A5OA 2JLPA 5EPUA 3MJEA 5EI5A 5JNUA 3BWSA 1KMHB 3FCXA 4G1CA 2ZUXA 2CB0A 4J3TA 1SKYB 1FBIL 3QXXA 1SIWA 4MZ2A 1MUUA 3R1GL 3CXRA 4OGXL 5K05A 3SE3C 1SXBA 3RKDC 2P62A 3T4AA 4LHUD 4LPCA 2J7LA 2OTPA 4AKOA 3EW3B 5DQ9B 4OUUA 1Y0LB 3NJKA 3VOBA 4ZD6A 5ALSA 3L3OA 2ZZMA 4FYXA 4IRMA 2GKGA 2B9BA 2VDOH 2XICA 2YD8A 1T0BA 1DZ0A 3BHMA 4LDAA 4Q7QA 3W90A 3DXAB 1GZHB 2Q5EA 4P83A 5CLFA 3EIEA 2F8MA 1B73A 1T1XA 3LMJL 1ZS8B 2G9NA 4DZZA 3QUYC 5DLPA 1UBKS 3AK4A 2MPVA 3VFWB 4JCMA 3IKLA 3EXIB 1JK9A 1T35A 5I19H 3TB4A 2IY8A 4RCAA 1IC1A 3KPOA 3ZEIA 2Q2EB 3ZDCA 1M5RA 9MHTA 1O6SA 1P0FA 3TQTA 2BOVA 3K0WA 1NE7A 2ZJBA 3U1SL 1A04A 4IRXA 3P3YA 3NIFB 3D6NB 2HA1A 4X54A 4QVKA 4EKDA 1S2NA 4B6SA 2K6GA 3LZNA 2JFCA 2EDNA 4E42A 3C7CB 2CF6A 3HACA 3ZE0B 1Z5LB 4D2IA 2I3AA 5E6UB 4NZFA 4QBHA 3T9WA 5E0QA 5E8NB 1QRNB 3THSA 2R8EA 4D41A 2WNGA 3DO5A 4R5TA 2PZLA 1AO3A 4GI7A 5EBLB 3MSCA 3ZJ4A 3FTZA 3ITDA 2XUDA 2ZRMA 1I5RA 3KQPA 3I75B 3R7LA 5DBOA 3IJYB 3RRNA 3DQZA 3IFLH 4XPZA 3FZNA 3CRNA 3KWTA 3JYCA 2CDNA 3OLZA 1K8XB 4R8LA 1BGXH 4OY3A 5EORL 1JHLL 1PEWA 2EZTA 3T9BA 1IONA 3GJEA 3H05A 4QPCA 1YGPA 2JGJA 5ESAB 1T2DA 3N6VA 3B6MA 1R4XA 5TPWB 1WCV1 3BXOA 4EUEA 2E0IA 4B9IA 4KKPA 4X8JB 5HDLA 4PLYA 4WV3A 1QNLA 2XIQA 4XBGB 5K0SA 5DUBA 3VPAA 2IITA 1MNNA 4BRSA 4U6XA 5HHOE 2JJ8A 2A1UB 4P9MH 1NMAH 1JTVA 4N2MA 4HUNB 1VG0B 4O4JB 2AMJA 1EUDB 5K0CA 1NSTA 2GJ6D 1BQSA 3ONDA 2YHBA 2VLJE 2BPBA 4AIIA 3TSCA 3I2HA 4QSHA 3DDCA 2VAAA 3OKLA 2J6HA 1OARL 1MHCB 2VN5A 1W2GA 1G0DA 1WUNT 2OR3A 1JF5A 1RQ2A 5I7WA 3LH2L 3WN5C 4EUKA 2J44A 4GG1A 1FJ1A 2WD7B 3VSCA 3SPIA 4CGZA 3NK3A 5K93A 3BCUA 3U2QA 4ZK8A 3GN1A 4NGHH 1UJNA 2C3MA 5DD0H 4CCYA 4PVBA 2HXSA 4BFZA 3U60B 2HSGA 3TCLA 1BZYA 4OLUL 4TSFD 4TTVA 1JQKA 4K87A 2Q6VA 1M7IB 3GNTA 5HHQA 4H25B 4GRLD 4YGVB 1O4VA 3OTWA 4OFZA 2YBEA 5CVVA 3P77B 2OGZA 2VQDA 4BNGA 2Z95A 1NQVA 1RXUA 1YZ3A 1Z13A 4TV8F 5EOQL 2YD6A 4ESEA 3PL6A 4DWVA 1JCVA 1NDGB 3T6KA 4IVNA 4BNJA 1F90L 1CBUA 1CVRA 1TLMA 2BCKB 4P3CL 1EG2A 2OZ4A 3WKMH 1C4OA 2E37A 4F27A 3KTDA 2DTDA 1UDCA 3EZ9A 2DMGA 1F2XK 2O52A 2IPTH 4AT1A 2GCOB 2JCCB 4Q52A 1MQ8A 3IB6A 3ECQA 3NCCB 2B9VA 2J3IA 3AJ8A 4J0FA 2WYUA 2O8BB 5CRIA 4DSYA 3ZV7A 5JTTA 1S2EA 5CM9C 4HETA 4RY8A 4LP5A 5JCOA 1SCJA 1OHZA 2EW8A 1E62A 4BA8A 1F3DH 3MMXA 2P2CA 2M1KA 4B3SB 1D4FA 4KU4A 1C0EA 1X86B 1XWWA 4MJLA 3FQWA 4PJCA 4JPKH 7MDHA 1ABFA 4A2GA 1HFKA 5HJ5A 1FVCB 4V3BA 3TIIA 3P9YA 1IYZA 4B0PA 1P4RA 5L7YA 4JVOA 5GJVC 4OQEA 3NT0A 5FYJD 1PL0A 4AZ3A 2EJUA 3GMQA 5M29A 1DQJA 5M3BA 1GKUB 3QUKA 2JD2A 4HN9A 3TNNB 2C5EA 3S70A 4YRKA 3ZR5A 4FYVA 3MGOA 5TQ0B 3FU7A 5IAOA 2Z2IA 4P58A 1Z29A 3M49A 1I24A 4MYSA 3G5YB 4C3OB 2ZIXB 1FLNA 1IU1A 4P2YA 4YHIB 3SSGA 3M82A 3QEMB 4GEKA 3CXDL 4WY2A 3B2NA 2Y2WA 4Z1MD 3LNDA 3WRWA 2WBJB 1VKHA 4O4HF 1I2ZA 2FFQA 2WJZB 5DA0B 2JI8A 2QPLA 4UINL 3IOMA 1E99A 3CC5B 4Z5XA 5FW7A 1UD5A 5AKIA 1NFIB 4KWUA 1J49A 4L3ED 3T0VA 2BFDB 1YIDA 3D6VA 5DI8B 3OFSA 3E48A 1G8HA 4ONFL 3O6FB 1YCSA 3UIYA 1UQSB 4HMQA 4C06A 4FW9A 2K5UA 4FYPA 3RWJA 2GZDA 5ENWB 3L4BA 5EL0A 3EC1A 3WMPA 1DWPA 1KK2A 5AHOA 1EP2B 1Y7PA 4KZKA 3WS6A 1DX6A 3ZVLA 4Q6YA 2IHTA 4JP2A 2P6RA 2R69A 4GRMA 3T5MA 1UOQA 2AMFA 4C4OA 4U05A 3WO3B 2WY3B 5D1ZC 3NJFA 3Q1SH 3SJVE 3U3KA 1A3QA 1TJXA 5BVHB 5JNYA 2R1VB 1YZZA 1P75A 3CWCA 2R56L 1VSBA 3DMPA 3Q8LA 4KK6C 2X2IA 1MQAA 4D9EA 4TSBL 2NY6C 4CE6A 2AG1A 1HO3A 3ZWDA 1BU5A 4ZW5A 3DZBA 5DNDA 1ZNXA 2AJVL 2RCYA 4F6LA 2EJVA 1OM9A 1Y9EA 1JP5A 3S2EA 3MXTA 3PHGA 5KW9H 1T66C 4BO5A 1ES0B 5KOHA 1MVFA 2VL4A 3AR2A 4NEQA 4XE5B 3ARBA 4YAJA 4X6CA 3C12A 1R2QA 1R24A 2YAFA 1T9KA 4B47A 3GJRA 1WQ3A 2VDRL 1TTCA 1SOUA 4OMDA 4Q1DA 1A9TA 3FCCA 3INUH 3EOTL 2VZUA 3P2KA 4MUMA 2B1AH 3BSFA 5A3VA 2K6WA 1ZSDB 5J5VA 4MR8B 1TUBB 4X0KA 1XD2B 4YC2B 2ZAGA 4PX9A 4PHCA 1YVPA 1FTQA 2QVFB 1X15A 2GMWA 4CTOA 4ZVLA 4QO1B 3OBBA 4AO8A 3S27A 1U3TA 4C2BA 2J4DA 5EINA 4P3YA 1T6WA 1AR1D 4OREX 4BAUA 1N0LB 5J3HD 5CXPA 1HZHL 3NEYA 2G2RA 1SKMA 3PDIB 1T83A 5FDWB 3VXQB 2XIJA 4KPUA 1XTPA 5EKUA 1TCUA 3HRZB 3OM0A 5D3QA 1CY7A 2WXQA 4GXQA 4N0YL 3RJQB 1E4KA 3KTAA 4C55A 1Y8AA 4KDTA 4O2EA 4OGWA 5K6RA 1XPRA 4CF6A 5D01A 2G9KA 3OESA 5ERWA 4IWNA 4QIRA 5E8PA 1G7IA 3A6DA 2GUYA 2R7MA 4NPAA 3E61A 4R4JA 1T4WA 2OBGA 1DEEB 4XC3L 1BE0A 4I13B 1YBVA 4W9CC 5AVQA 4B5KA 5D7SL 2EE6A 1R5VB 1VCAA 1NCIA 4KXXA 2OG2A 2PWEA 3R0VA 4WN9A 4IJ5A 5CX4A 1C3JA 4F4DA 4M5ZH 2PHZA 4IRUB 1D9ZA 2NPOA 3W9BA 3MRFB 3B2VH 3HC7A 3MGAA 4MXQC 3CMGA 2P0EA 3CN4A 1T1ZB 1T5IA 3BZUA 1MIHA 5JCZA 4JB8A 1C41A 5LAPA 4PJAA 2WWVD 5ELMA 3LS4H 3IETA 2H9AA 3E8UH 1WVIA 2IZ5A 2NZ9D 3DYOA 5JO5A 3PVCA 5GQBA 5GV8A 3T5WA 3PKIA 4NOBA 2JHGA 4LJ7A 4Z7QE 4P23C 2UUDH 3HZOA 1U7WA 3KBFA 2YWJA 1ZOPA 3ESOA 4D3XA 4K9QA 1UWEH 4GRLA 3LWBA 5C0GB 3H5OA 4NJ9L 3DRTB 2E2WA 4P4KB 1MFAH 1C3VA 1OARH 2JJ2D 4ZTZB 3CSTA 2OR8A 5D55A 1NJ6A 3ZV3A 3ZWVA 1JZ6A 1I7NA 1LDGA 4PC2A 4LKCA 3KYCA 1INEL 2ZZUT 2GAFA 1QHEA 2GF0A 4EECA 4UKDA 3NCBB 2UUOA 3AZUA 2VAPA 2ZM6B 3FHLA 1N4XH 4M1EA 4UAUA 1RPTA 4L8LA 2F8IA 4RL6A 1DADA 2NUAB 1V8BA 5BYAA 1M5TA 5EESA 4UZSA 1T21B 1RIFA 3F6EX 2BH2A 2F19H 2WKPA 3GIVA 4HCFA 2ALWA 4CKCB 5IKMA 2FH8A 4EW2A 1ZXXA 1JEYA 1LWOA 3E38A 4GO8A 1FO0A 1P5UA 2H32A 2QVMA 1T1XB 3OJ2C 1DR9A 1M74A 3UJJH 2CFTA 2HA2A 2POCA 3DIFB 1HKFA 4EQ3A 3QVJA 4PJXF 2H3KA 3VR1A 3F65A 4WESB 2BMVA 2VZ8A 5EWMA 3GKZA 4NZTL 1KO1A 2AE2A 2FPLA 5CUQA 2JE8A 4OJTA 1DXYA 1RWNA 2I76A 5MEOA 3AG3B 1AS2A 1A7BA 1L0QA 1VFMA 3I9AA 1VECA 4P7KA 3QO1B 2XD4A 3NKFA 5F1IB 2WR8A 4DOHB 2NX5B 1Y1LA 3DOUA 3H9SB 1NGXB 3QLTA 4DKDC 2IYUA 4D9QE 1G3MA 3NNSA 5KPJA 4M6OH 4PP2B 5KAPA 4LOJA 1T21A 3QCTL 1KPRA 1CR6A 2I6FA 2CJUH 5I17B 2NRDA 2JLCA 1V4NA 2WXJA 1CJBA 2DG2A 4GG8B 5B39G 3BN9C 1XBRA 4HPHA 4LDRA 3FRPG 2FWMX 3LC7O 3K91A 1JIKA 1CU4H 2Z64C 4TULH 1AOXA 3PU6A 4G0VA 3R5XA 4KY2A 1V3UA 4TKVA 2XVZA 1KAMA 3SDBA 3V32A 3VYPA 3IDIA 1HYQA 4ACAA 3PFCA 4ZFZA 4FGWA 1ZG3A 2E48A 4M53A 4P5TC 1T3GA 3NJ8A 2V7QD 3TZCA 5FS5A 2PO5A 1XU4A 3ZY6A 1F9EA 5ALZA 4NO0A 2ZUFA 3U16A 3E6HA 4MAYB 1E6CA 1TJYA 4R3SB 4YB8A 2CHVA 5DK0A 3GY0A 4KVGA 2HFJA 3GGWB 4PAMA 4JJAA 2QE6A 5PAZA 2JGIA 5EWIL 1KOJA 1KBGH 5FO1A 1IMHC 4PZ9A 3RTAA 3Q2CA 5CPFA 2FPGA 2I34A 2FL5A 4AXXA 3BI9X 1MVYA 1EKXA 3WJLC 4R7NB 2I3DA 2NY1B 5T4HA 3OF5A 4B3CA 1S01A 1ZHBA 3CTMA 2HPZA 2EXTA 4DAGL 1W6WA 3UC0H 3TRHA 3K8ZA 3DX9A 4HIIB 1EM6A 3SHSA 4EJ2A 5DM1A 1BBDH 5IYZA 1DEAA 2XAUA 3C3XA 3L18A 4US2R 5KNCD 1G8FA 2VNCA 2K1MA 3GSUA 4FFVD 5TPZD 5AZ2L 1FFXA 2EYQA 5E0KB 4V0QA 4UZEA 1N0XL 1FYWA 3AY6A 5JCJA 3RS8A 4NI5A 4QBTA 5B8CC 3IKKA 5CM2Z 1C5BL 1L9MA 4ENQA 1H2RS 3UAJD 2JFYA 2K6YA 2Q10A 1KEPA 2WUEA 2QN3A 1G9HA 2LAGB 4UQOA 4B76A 3L43A 1DCMA 1M42A 1KB5A 4NQEA 4DZBB 5IXJA 3UMNA 5CA0F 1ZWLA 1HK6A 3LKDA 4QOFA 5FWQA 4ECNA 4ZMQA 5L3RA 3MCWA 3IFOA 3E7FA 1Q0LA 3QFCA 1PQ4A 5EAIA 3VXOB 2ZXBA 1DDGA 5F6IC 2AXFB 3VC7A 2ZWLT 4NU8X 4AZ0A 2JZCA 4FFZH 2PMCA 2NZVG 1YACA 1EFXD 3NEJA 4MVJM 3NCTA 5MGNA 1T9CA 3OLDA 2GJRA 2OXTA 1M2WA 2DQGH 1QFSA 3A1TA 1T9GR 1YRLA 3FN9A 1ORIA 1KIFA 1ZKDA 2KS6A 1EXNA 1YEGL 3TJHC 1TE2A 2W65B 2OL3L 5JC1A 3MROA 5LNDA 4U6YA 4I08A 4AZSA 1TO5A 5CLTA 5KYUA 5MEND 2AZAA 5K39A 5ICFA 3GLGE 5FI3A 2YYYA 4J39A 1F5NA 1S3IA 1JNXX 4TNVK 2X6VA 5CP7B 5KTKA 5TIIA 5JORB 2VTBB 3QE5A 3ZWCA 4DKFL 2NSJA 4ENRA 4D99A 5JZ7D 1JVOA 4AU1A 1T66D 3EYVA 4PLZA 4ZDHB 3DDGA 3JWOC 1PGPA 4PGBA 3SDYH 3X3FL 3T95A 1VFPA 4P46A 1C14A 2QJOA 4LGYA 3WJMB 4JM2B 2V5AA 1BCSB 2J7KA 4UVIA 2L7JA 3N0WA 2VUYA 3DDOA 1WLSA 3HMXL 3WMQA 1MO2A 3ETTA 2HL6A 5JAHA 1FS5A 3QKSA 5G0TA 4Y1FA 2PM8A 3QVOA 4N0QA 3H1BA 5HYIA 2IOMA 4IU2B 2M6RA 3W7BA 1E8NA 1T1JA 4F71A 5B1IA 4D7BA 4K9SA 3LJ3A 4V1CI 2ZX5A 4Z3HA 1P60A 2DSTA 3C60D 3GP5A 2FW1A 3I30X 3ZWQA 1I7TB 4GP8B 4UZFA 3V0GA 4MDJA 1ZU4A 3KL2A 3W3AH 5C6TH 5DX1A 4IQ8A 4ZHSA 3JCZA 4HDSB 3REQB 1OH7A 4N8CL 1J0DA 1DKOA 4I0KA 3TPKA 3AW8A 2F1BA 2BE9A 3BJZA 1FRVA 5D2LB 2EV9A 3U0TB 3MIZA 2WWMC 3DJSA 4A6EA 5CFQA 1X9RA 1BXRA 4IDDA 5I4KA 4LKRA 1E42A 2XWSA 3LUBA 4EQZA 4IY1A 4ND4A 1J2RA 4PEVA 1C29B 3PEFA 2HH9A 4ZVNA 2NW2B 4Y4KA 3PC8A 3QEQD 4Z7UB 3L5WB 1QI5A 1T0MA 4O33A 2W9DH 2E7CA 2Q7YA 2P5YA 1O6TA 4D8VA 4LF7B 2GCEA 2CMRH 1QC5A 3FONB 3KPLB 4QNPF 3UT0A 4MAMA 1OE0A 2PZEA 4CVZB 4CUJA 3KJXA 5JY6A 3UK1A 5C4IA 4TQIA 2IU4A 1X38A 1U8PA 4NDMB 2CXXA 1K97A 4H17A 1EFPB 3SQWA 2FSUA 1D6SA 1V8PA 5AVUB 2QZSA 3ESPA 4KXYA 2V9TA 4FNGA 2LIVA 3S8GB 4OLEA 4JVMA 1NAMB 1MI5E 3TZVB 4F56A 2OR9H 4RNRB 4FP9A 4D94A 4LL9A 2VDPB 5DYOB 1EQAA 2DQCL 1UT2A 5I8ZA 2YC1A 4RIRA 1UH4A 3HWRA 4P3DA 1NI5A 4YCLA 2FRXA 3TO2A 2VM9A 4PJCE 5H70A 3EW7A 2WMNB 3E9TA 2GTWB 2BIHA 3NIFE 2N56A 2ZAHA 2ZVPX 1P7WA 3ZKND 3ABLB 1SRDA 3QXUA 1NW3A 3MRLA 1J8HD 3CBQA 1AQKL 3KHQA 1WAPA 2CWDA 4A73A 4ODVL 4YP1A 4HIJB 3UMBA 1JR6A 1NR5A 4MEBA 3NP4A 621PA 4UXJA 2CCWA 3ZTNL 1GZPB 4DGWC 1UBLS 3MGTB 3AY3A 4JI7B 2B83A 3JQDA 5GHWL 4ETQA 5DHXB 3PV0A 5EMYA 5E8OB 4DCNA 2VDOB 3RX5A 1CQJB 3QYPA 5EIIG 3EAGA 2XXBA 3REWB 1EHCA 3ULKA 2HYIC 5CHNA 3ICPA 3ZOAA 3FGPA 4OGKA 3TLCA 4Q7KA 4HOWA 1SQ0A 2NLJA 2EXXA 4NQED 3QE3A 2N7SA 3EVBA 2FJFA 2XUWA 1OIXA 1UXGA 3BVDB 4NQDD 1EUDA 1LSUA 3WGUA 4BXSV 4HYTB 4NZ9A 1G7TA 4ZK2A 3DGCR 3WLFA 1XZNA 1HDCA 1AD9A 1Y8QB 2YR0A 4IO0A 1C5DA 2F17A 2EE9A 1E2QA 4F58H 3LXUX 5MN4A 2QRHA 4RWHA 3VNRA 4TXHA 2AKEA 3VFPA 4EGSA 1N4DA 3A4LA 1YC5A 2YW9A 1A6AA 1U8HA 3HNRA 2FR4A 4M9PA 2NQDA 4J3JA 5JDIA 1ULHA 1YZKA 1DJNA 1ZH8A 1YS9A 1GDDA 1Q1AA 2CB9A 4OCSH 3EA4A 2YJLA 1R8JA 3MV8A 2DF3A 1QASA 4LZOA 3D4LA 2YMLA 2QRMA 2QRVB 3H11A 3WTVA 2CSUA 2OBLA 1ULUA 4MAAA 1VE1A 2LCIA 3SMQA 1OREA 1M3IA 5EIVA 4K9NA 4NY1A 4NCKA 5D6OA 3RFFA 2YD9A 3WIAA 4DSNA 2VL5A 1IVTA 4YCAA 4HUUB 3DDUA 1TQBC 4MCAA 5BV8A 3RGGA 1EERB 1NCAH 4P3PA 1DJPA 4X9YA 4JI2B 5F21A 3UQZA 1TADA 2CXHA 3ZDEA 2JGEA 4MB4A 1J99A 4W1PA 3WL3A 1FXWA 1Y3DE 3CLUC 5B7FA 4CQMA 4RMIA 5E95A 4KXAA 1KZ1A 3CM0A 2A74B 3ZT5A 2B6NA 2WKWA 3L3KA 2ONJA 3DKHA 3VWKC 2Z6UA 4AYFA 1DQDH 4CF5A 2G2PA 2QVCA 4RPJA 2PLAA 4L5IA 2FOXA 2IALA 1IRXA 2V65A 2R00C 1M0SA 4CVUA 2Q3EA 3VR6H 4UD6A 1N7ML 5C8XA 3O7WA 1JV5B 4FI3C 1UJCA 3G1TA 4ADSG 3HRZC 3EPJA 5BW7C 4CC0A 4PYKA 4II3A 5CCGE 2FLVA 2V3FA 2IDFA 3D2UD 3FCUB 3Q5DA 5FLKA 2FUG1 5A9RA 1MFPA 3AB7A 1G4MA 3VKWA 4HAFA 4I1OA 3FUCA 3RKPA 1BMTA 2YSSB 3S8WA 1K6QL 3P5BA 1D9KD 1W16A 3PGCA 3FPFA 4N2OA 3L0PA 3G7NA 1ID8A 2JFOA 1U2YA 1QIIA 3VX0A 3DB1A 2F2HA 1JKJA 5HPOA 2LGJA 1QB8A 4OSOA 2CH8A 4ZTEA 5A1TA 2QGNA 4QWWC 3MJ6A 3ZS8A 2GTZB 1ECJA 1M1YA 5DR5H 2CDRA 3IAUA 1JUFB 9LDBA 4LKXA 3ZR4B 1SHJA 5J4KA 4Q02A 5BO5A 3EXFB 1UHVA 3TWCH 5A0FA 1Z5VA 4XZ4A 4I9WD 2FO8A 4JLUA 5TQ0H 5DNEA 4KKLD 4P9ML 3F05A 4JO2H 2JCSA 4DLXA 3WSTA 2J4WH 4BUHA 1RQRA 3PDWA 4XXCA 3GFPA 2R6GA 2PUEA 1V7ML 2C1OA 5DCLA 4NKRA 1GOGA 1AB6A 1IBKB 3C8ZA 3NUKA 1MZZA 5IM4F 1Q2XA 3DPSA 4ZPTA 1FZTA 2Z8SA 4NU6A 1FL6B 2NTFA 2A83A 3B3IB 4ZMRA 2FW9A 1T5XA 4YRIA 3AB8A 1IQWH 4PN7A 3RIAF 2CK0L 5P21A 4W8GA 2IFGA 3GLFE 5EU4B 4J49A 3FAKA 5EERA 5DXWA 3G2PA 4S1RH 3CEHA 2WINA 3MLEA 2ZRJA 3VAEA 2JAOA 5FWAA 4R16A 1RXSA 1UUFA 4L5CA 3SHVA 3BWCA 3E82A 1P0SE 1YEDA 1SZDA 1BMQA 5ETJA 4LUCA 3NONA 1WZNA 2XG4B 4H0CA 5JPMA 1J1OH 1I8AA 4BV8A 4CLHA 5G1NA 5I71B 1ZOIA 4S1SL 3W0WD 2JFVA 1HZZA 4U2GA 1RU3A 3CNEA 4HK3N 2WE8A 4OJQA 3KQLA 2BV3A 4RVHA 1WEJL 4DN3L 3NO4A 4PJEE 3U46A 1T5TA 3QI7A 4AIOA 4ZT2A 5IJZA 3KZ8A 1WKBA 1YCFA 4EZLA 3DX7B 1DC7A 5CMAB 1G5RA 2PX2A 2ZOKB 5G4MA 2IRWA 2P8JA 4OJCA 2C82A 4FBMA 1NEZB 1RKVA 1H1LB 3BUIA 2IZ1A 3CCCA 3MS2A 4DJ5X 3F12B 1P7VA 3VQTA 1KFCB 1GNRA 4JBXA 5IXYA 4PWGA 4F5CE 5FYLH 4ZQHA 3C7KA 4X7RA 3ILHA 4LVEA 3NEXA 4JBGA 5ITSA 4WZBE 2WYOA 2DR2A 3KWUA 4F9LC 3OZ7A 2P43B 5KYUB 2PS0A 3AONB 3VJLA 2FT7A 3K53A 2JIXD 3KJZA 4TM8A 1LO2H 4XB6B 3T4AC 3PFQA 3H1PA 1Z47A 3FI9A 2CYCA 3BIWA 2CJXA 4O02B 4ZAKB 4P2RB 4HEQA 4EYEA 1XDWA 1PPIA 4NN6B 1FFBA 1KI6A 3RWFA 2O3RA 2VPPA 1S5IL 2P4QA 1RE0A 2IZOA 4M0EA 1AH2A 2HKHH 4O02H 5KSPA 3RC3A 3NHRA 1K98A 1HDZA 5EKSA 5T33L 1C50A 3POCA 2Y6TE 4APXA 5CNIA 3AFCA 2ZTVA 5L6MB 5T64A 1JDNA 2PP8A 5I9NA 2F3TA 5TE4L 2C3OA 5AVRA 5JBIA 4TPKA 4JDTL 1LDNA 1UEYA 15C8L 4CLRB 3ZD6A 3D8RA 1CR9H 1OSPL 5AI4A 3RYIA 2IV9A 4UPVA 1G2QA 4JXKA 5MERB 3DLAA 3LZRA 3M6MD 4B8WA 4P2QE 1YONA 2X19A 3C16C 1LF0A 2A94A 1FFQA 1MQKL 4ETNA 3VD5A 3ZE2F 5EG6C 5L7XH 1RMTA 1J21A 4G6FD 1KBWA 2QBYB 4NQRA 3NHLA 3NHWA 1F2VA 3BB1A 4WO4C 2P24A 3X13B 1ETJA 3L3HA 3OPUA 4Z0XA 5ID0A 3NASA 5JZMA 1AYRA 1AKTA 1JTTA 4OHBA 4EEKA 4G37A 5JDSA 3F2IA 3STWA 5KEIA 1MI5D 4RJJA 4NMLA 1KTJA 5E2VH 4UOEA 2VXVL 4RMWA 2A6IB 2DMKA 4Q56A 2HT3C 1ACYL 4XP6L 3NEEA 2LPMA 2PRIA 4NBTA 1J6UA 3HXTA 3WN6A 2UVDA 2DFPA 4FERA 4LFBB 1MHTA 1GZ7A 1FG2A 1XL4A 2QT9A 3MGGA 5F3FA 1NX9A 1ZEMA 4Y4KB 2GJZB 3P2IA 3OP4A 4TGLA 1AIPA 4TMKA 4YVNA 4PJ5A 4Y8AA 1GUBA 1MRDL 3OZRA 2JKIS 4Y2NA 2A67A 2C42A 1GGCH 1Y0LA 1M1UA 2DHRA 5H9WA 4DA0A 1L5QA 1P7BA 1LB1B 2EDHA 3RVQA 5T3ZE 1V6CA 3ROLB 1SQ6A 2ENSA 1L7AA 4UUJB 3IUYA 2KI5A 4ODXB 1U99A 5FUOL 4HEHA 4H4NA 2F7QA 3F9CA 3FN0H 1ZM3A 2IYSA 1YIAA 4YAKA 1SF5A 2Q76B 4X1IB 3OKYA 4TZKA 2DICA 4XWOA 3CDZB 3NABL 2W2TA 4A6YB 1SY6H 3MAWA 1NUTA 4B4OA 1A8QA 5IMOA 5BOPA 1YEHH 1H6EA 2H7XA 4TV9A 4X93A 6REQB 4MJIB 1WPXA 1J48A 3LY6A 3RBZA 3A9UA 1AGYA 3PS9A 4OR1A 4D56A 1XX6A 1JVBA 4Q7JB 2YGQA 4TLTA 1PEKE 1S7SA 4UOW0 4ZFGL 1PWHA 4LWOA 4U0KA 3L5WA 3CZSA 5DSXA 3EVEA 2BZ7A 1O5TA 1YMUA 2OX5B 4FLMA 5JUEL 1UYWL 2EIKB 1NF3A 5LBSA 5I0ZA 1SBBA 3INOA 1YB6A 3RQIA 3T4YA 1T1GA 4KJXA 3ROEA 3JBG7 3TM5A 2IQAB 5AL8A 3S36L 1XU7A 2IYWA 3H8SA 1USVA 4YJZL 1P0CA 1F6LL 4GW1B 1C5CL 4WI6A 3VFOB 4PPGA 2UUAB 1MNUH 4KAFA 5EU6A 4CMMB 2GQ0A 1HNYA 5AVZB 2PL3A 3G3EA 3D2AA 4HKJB 1QHYA 4PVCA 3MC0A 2IH5A 4M29A 1O9WA 4DGYL 1O95D 4BNVA 1OTYA 2CNDA 1ZT1A 2Z31D 2INGX 4BDVB 1XZKA 1K06A 3OETA 4HQQH 1R4MB 5SZJA 4P34A 4MQSB 1JT9A 2H1LA 3V8VA 3PAYA 1Z66A 3LQZB 5I9LA 2K6ZA 2D2EA 4ODTL 5K20A 4FB4A 3ZDYF 5DUPH 3OOJA 3PC7A 1W2WB 1DFBH 3BQ9A 1Q0PA 5IRCD 4ONGL 4F6RA 5C97A 4JDUA 5IHWA 5ABPA 2CL7X 4TQGA 3RIFK 5ESQA 2XCLA 3BSHA 2OK0L 2XCUA 2B16A 3NNNA 2GSWA 1BBJA 1FXWF 4WWKD 4V39A 3QHPA 4EAEA 4E13A 5B4UA 1H2YA 4K3DH 2IG2L 3NP3A 1FP2A 3NH7H 4EOWL 3V5KB 3ZZ0A 1NRWA 2DEXX 3TO4A 1R8QA 4NQEE 4OAQA 1WXWA 5D2NE 2H8GA 2A1WL 2WWTA 3CZQA 4POZC 1L9SA 2PBFA 3OJVC 5JASA 2B99A 1V8OA 2EX4A 4TV8A 3OIUA 4LRSB 1U2PA 3GFFA 2X0JA 2B2XL 1OZGA 4KNTA 4XRCA 2H1CA 3VMFA 1RCFA 3N3BC 5TX7A 5C18A 5HGHB 4P4UA 3E9ZA 1M2FA 3OTOB 1A4RA 1VL0A 1DBAH 2JLLA 1EX1A 3GWJA 4M87A 3UM9A 3SZKC 1WD7A 4FMFA 3W5UA 3W57A 1JEQB 5DLMH 2QHXA 1EWQA 1MFCL 1MHEA 3MRDB 2NTEA 4QT5A 2WJGA 4TLDA 1B15A 3EBGA 4CMIB 3DJFA 1QWNA 1COWA 5E03A 3S98A 5KS2A 2ZI6A 5E1BA 1I8MB 1HL9A 5CIPA 1XR9B 4XUEA 5K6AA 2A9ML 1IPEA 4ZO9A 2OMKA 2DLTA 3KSUA 5D3MB 2W00A 2YBGA 3LUCA 4E2FA 1MIOB 5JSQA 4D0NA 4R96A 4F97A 2O61B 1WBBA 3A3OA 1Z0KA 1NYTA 2XRAH 2Y1CA 4HVTA 2IOHA 5JV5A 3R09A 1QSEE 1G5QA 3G9QA 3HM9A 2X4UB 2WTOA 1CTQA 3HNTL 1G291 2IV7A 4ZSOB 3BFOA 2CZGA 4Y98A 1RJLB 2PUFA 3AC0A 7TAAA 4Y9GA 2WZPA 5HP4A 1LI5A 4UDOA 3CZNA 5BV1A 1DRVA 3EIWA 4XCFL 2ZJYA 3U81A 1JG9A 2ZVQX 1K68A 3ROQA 4JM2F 2IDSA 1FYTB 1PBYA 4O3UB 2GXUA 1ZH0A 4ZKEA 4XMUA 3MCG1 3ETJA 4UDNA 5LP6C 2VNKA 2X4NB 1K5DA 3JT0A 3HWSA 1RCYA 1PYWB 3OQ1A 1QLJA 1H2AS 4OM0H 4J7UA 1ZEAH 5KYXA 2C7QA 3AO0B 4PV1C 4Z8FH 4YQEA 1XNQB 3U7FB 3QIUB 3U3DA 3FSGD 1T83C 3K0CA 2ICWJ 2K4WA 2DBVO 4DNFA 1X19A 4DFHA 2JCYA 2ZQKA 4YCBA 3IAXA 5K03A 2MCPH 1I3RB 5AB1A 5BNFA 1NNUA 1SU8A 3APCA 3T94A 3IVKB 4Z49A 5AM4A 4GSKA 1P4AA 2CDAA 1URZA 1ULVA 3KBPA 4DO5A 2Y67A 3PPYA 4FXGC 4JKPH 2GXSA 2EUXA 5D7JC 1PYDA 3SYAA 4OOFA 1OB1A 3BXNA 4HU2A 2GKOA 4L0DA 5JY1A 1JHZA 2RSLA 5INTA 1ISMA 1Q0XH 2WOJA 3KUCA 3UXFA 4G7VH 4WK0B 4RVBA 4WHYG 4GQBA 5SWSB 1B23P 3WXWH 4KROB 4RVNA 4NQDE 2W2KA 5ICSA 4GPVA 3QEQE 1P7QD 3SZ3A 3ZX5A 2FBJH 4LVCA 4A6YL 1XTQA 1FFNB 4PI0A 2NZXA 4KGZA 3EDOA 2H4JA 5JZ7C 1T2NA 3LKRB 4HATA 4P92A 3OB0H 1ZLWH 3J8F7 2OL3A 4OD2A 2YFOA 1GY8A 3V8QA 1OTXA 1FRFS 1NATA 4ZEXA 4HCRH 3CVUA 3AT9A 3K3PA 3N0VA 4WNSA 1V05A 2X4RB 5AQ0A 2B37A 4F4FA 4S0HA 5C08E 1D6EA 4I9UA 5LUBA 1V11A 2XTSA 4Q6IA 2Z7ZA 1YASA 3SFZA 2Z93B 1CHNA 2VHUA 4OB5L 1N9ZA 2BSBA 3MWYW 1T9AA 1UFOA 5KAMA 1L5ZA 3UZQB 3T0ED 3QDAA 3QG7L 4RWYL 3B2EA 2QVXX 3FQUB 3TFOA 1NA5A 1NAHA 4K7PY 3L0DA 4MNGB 3G2NA 3V7NA 5CHNB 5A2KH 4PJDB 5BXFA 4PJDA 3CX4A 3PQEA 3NJNA 3F6PA 4JCWA 2VT2A 1IC6A 3EYSH 2CK2A 3FQTA 3WFEL 1QFWH 3FGNA 6REQA 4YNYB 5DDIP 2I5YH 4IOSD 5C7OO 3H56A 2JB5H 1WPCA 4B2PA 3WYRA 3FRUB 3DYVA 4DTCA 3MJ4A 4MICA 2X4OB 2E1PA 2XQYA 3TX2A 4M7RA 4ZEMA 1TW3A 1TR7A 2D03L 3UK2A 3UAJC 4MRNA 3ZIAA 3COSA 5AH0A 3RSQA 4ARVA 3H5AA 2PLRA 4F9GA 3A3PA 2M83A 3FXAA 1CNFA 4MRVA 3EZ7A 3VXQA 2JAXA 1NLUA 4G6ML 4JJ8A 1CYWA 3AWFA 1XAKA 3C09B 4AYBA 3CX2A 4WLOA 3GXPA 1DBWA 4JUIA 2Z9DA 3BPNB 4W8OA 3V8PA 4B97A 3CE1A 4P38A 4O2BF 4V2CB 2AQSA 2PE5A 1MZPA 2O8FB 3L4YA 1WP4A 3D1VA 1FVDB 1FNGB 4LSVH 4E3ZA 4E0BA 4EJFA 1BLNB 4I3FA 3K94A 2C9YA 3FTNA 4P2RA 3UDWC 2QTAA 3Q6MA 1UC5B 4OK3A 2H3HA 2XIDA 3LRKA 2AJUL 1U4SA 2C20A 2L82A 3GH1A 2DDQH 1OF1A 3VG0H 2CVZA 1AQUA 3NP7A 4JLRB 1QUEA 3A0OA 3K6NA 1OT1A 3PUCA 4GE3A 1AHWB 4CQLA 1E1YA 2EDJA 1E1QA 4BBAA 4Z3OA 4JIMA 5IVZB 5EF2A 2FQDA 3FULA 3EDDA 2YZMA 2EDTA 2GHZA 2D5LA 5BYKA 4B3TB 1FRGH 3QH3A 1H6BA 2XQBH 4ZV7A 2Z0BA 4IRSC 3LRGA 2DY1A 3GUUA 3WDJA 2IHVA 1A5FL 3N39C 3ZZLA 4CNQA 1EEYB 3V4UH 4YHZL 3GMTA 4JUCA 1FFCA 3KU4A 4WRRA 2ZTBA 3MUOA 4ZS6D 1ZVSA 4TRPL 4DEWA 5ALRA 4XO9A 4EB8A 4QRRA 4BKMA 4IKNA 3C9NB 4ZU1X 3PGDA 1HQRA 3C08L 3PF2A 4J28A 4JDVA 5A16A 1J97A 3L8DA 4B4UA 1CICA 1QMGA 4Z0BH 1M76A 4P82A 5IWCA 3PV6B 4GW4B 5E56A 2XNCA 4ZSOA 1CCWA 3TCXA 1A3LH 1XF5B 2R9HD 2N7BA 2XWTA 3QEGH 3IP5A 5DWUL 4DLLA 3TLKA 4ZANA 2ZWPA 4IKOA 2F58L 3N87A 1GARA 3BIAX 4OO3A 4JRXE 4E9YA 3HZHA 1E4VA 3ANYB 1G1MA 5A9TA 2EINB 3OAUL 3FMFA 1FYEA 3F6YA 4CFYA 3LZCA 1YJCA 2FFHA 2HKAA 1JLHA 1WKVA 3RGVC 1NIBA 1WTLA 1XLTC 5DMJB 1OLXA 4AD8A 4H3SA 3T0EB 3WS3B 4FJZA 2HRLA 1XU9A 1N6NA 4A63A 1VYTA 3BP7A 2P69A 4V1CB 5ARCA 1ISFA 2IUUA 4WFED 4HGWB 4W6ZA 1RHKA 1ZHHA 2AW2A 5ER6A 3W2HA 5A4IS 3MG9A 5ENVA 2VW7A 1SYSB 2J88H 4J8QA 2AOUB 2UX7A 1YEJL 5TK2A 3OU6A 1OE3A 1NG9A 4I50A 1K8YB 3LZFL 3G8AA 3AFMA 1U0TA 4JJIA 1MZVA 3OA2A 5T1MB 1B16A 1GZHC 1JSCA 2WB4A 5KSBA 2CCLA 3UTDA 4DUVA 4JPWL 3SGEH 5IMOB 3KBBA 3RJDA 5EE0A 1WVGA 1TRKA 1VLXA 1ADGA 4WXYB 4AV0A 1H42A 5EZJB 3DO6A 1DCTA 1PV1A 1UFVA 4NOFA 4DNLA 2DHEA 1KERA 1G94A 4JJKA 3IMEA 3GJTA 4M1KA 2C5FA 1XEXB 1XEDA 2XYVA 2V17L 2AV7A 4ZQCB 2J73A 3UKDA 4BNUA 4FZ5A 4A7VA 4WJ5B 5C46F 3C7TA 1GGYA 3I12A 3G5YA 4JSTA 4PJHA 5AUNB 3LOPA 1NC1A 3O4FA 3WDSA 4PRPA 2IADA 3ZXYA 2OMTB 3V6LA 1AO0A 3FFDA 3BZEA 2XE6A 3LEYH 5C2BL 1MI5B 1GKLA 1BECA 2B0SH 2NUTA 3SQOA 1WXIA 3EF7A 1OCWH 3L6EA 4JAMA 4F6RB 4FN4A 2UYOA 3H9SD 2LFEA 4IXDA 1MB9A 5I18L 4XO8A 4PJCB 2F5AH 2W9EH 3IXQA 3H2BA 5K3FB 2DBJA 5KOIA 5B6JA 3D6AA 1UWGH 4TTDD 3T1FA 5FA3A 2YMQA 3QVTA 3OWEA 3EJYC 3ND8A 4QUKA 4PWKA 4OLZH 3E8VA 2W81C 3V8CA 3RK1A 1TNMA 4JL1A 5L2KD 1I6WA 5F73A 4BE4A 5TK4A 4XP9H 4XRCB 4KO8A 3CJQA 3EGEA 3H1GA 1SQSA 4KLCA 4NXNB 2C9QA 4XCEB 4HIXL 4IXMA 5IBPA 2ZB4A 1Y07A 2C96A 2NADA 3NGMA 4X7CC 5JW6A 5FECA 1A5AB 3EYAA 4IM7A 4GZ8A 5IYZF 2JLAA 1EUUA 3UYPA 1IBFA 5J3HC 3LNEA 4APQD 4HKXB 3C3KA 1EEQA 4RGNE 3OE4A 1LWNA 5JLZB 4CADA 4LV6A 3F01A 1UKEA 2XXMB 2GS9A 3BHIA 3HL4A 4HWTA 1U0RA 4G0ZA 2DP4E 4KMTH 3C85A 1SZPA 5SZHB 3KR1A 3NN8A 4IU3B 2J6IA 2AFIA 4OD3L 3OU7A 4CMBA 3QUMH 4B8YA 2XPGB 1UA6H 1WBJB 4DR4B 2QTEA 4R2GB 4Q7LA 1OY3B 5IKPA 5ECGC 1E2EA 3L7KA 3IU3B 3LS5H 4TRNA 4Z4EA 3EJQA 4O4HA 2WZ5A 4WI2A 1HHKB 3F85A 3JSAA 1YJDH 4ORGB 1O6FA 3O6LH 2WUCL 3GJ8A 3ND6A 3KQNA 2Y7OA 4K3VA 4XAWL 4YY3B 2DQEL 3GLUA 1Q2UA 3X1KA 4ER0A 1S78D 5JEDA 2WEKA 1R3UA 3CN7A 5IVKA 3L8GA 4ARSA 1EJOH 2NMVA 3ULUL 4G7YL 4I18B 1NIJA 1VOTA 4UTBH 5BMFH 3VB8A 2BTQB 3GFBA 3LF1A 2PGIA 4J90A 1JNHA 2IDZA 2MYPA 3NH6A 4GAFB 4FEYA 5EIBC 1E9DA 4NZZA 4BNTA 1IC5L 5GJTH 4EG7A 1Z7BA 4IVRA 2ZROA 4IMLB 1FMJA 4FZVA 4JQIA 1I7LA 4R1UA 3L84A 2WTEA 4RMUA 2W60A 1XMIA 3TZQA 3NHSA 1FSGA 1DTSA 1Z4IA 3VUEA 4DP0X 3RTQB 1RVFL 1VE6A 4KO5A 1NPDA 2HJVA 1P1KA 4ZDJA 4MZDA 3VOTA 3V6FA 2AUTA 2VDLH 3RRXA 3CVDA 3ZO9A 2PGDA 3RWBA 5IAJA 4HIHA 3K0SA 4NMHA 4CDNA 4NCDA 5A0VA 2FZGA 3BE4A 5IJDC 3ZYOA 2OUKA 1QZZA 2ZCUA 5IG7A 4ER5A 4KK5C 3ZL4H 1E9PA 4X7PA 1VMEA 1J5HA 4UQEA 4QLRA 3V5NA 1QORA 2DQUH 4L4RA 5BZWA 1JZHA 4D74A 1AKNA 4CLRA 3SSMA 1J2JA 2CCGA 4DV2B 1DLFH 4C7XA 5TQ0L 3ZGNA 2ITDB 4RLSA 2VKWA 2BOLA 5IB4A 2RK6A 5A4DA 4UU8A 1MCCA 2Z7YA 4KYIB 3D25B 3UCRA 5DR5L 3MJRA 1MCWW 2ZULA 3I9MA 4WW2A 4QQRA 5CO1A 1KCBA 1E6JL 1ZTXE 3GHEH 4I1NB 1WW3A 2BWDA 2UXCB 5KNDH 1QSFE 3GNML 5BO1L 5D96B 4YJ3F 3QUHA 2RAUA 1XRSB 2ZE6A 4C7JA 2FEJA 3F7QA 1P18A 1P3Y1 3UEQA 5F9HA 2JXMA 1U41A 1H1DA 3S4SA 2DH2A 4O2AA 3B8EA 1CZ8H 4Y19A 4JPVL 4IEIA 3T71A 4FFBA 5BRAA 1O6ZA 1LE9A 3DMMB 1CS0B 4QPJC 3PK0A 4RDQG 1G9XA 4C4RA 4OQFA 4QKQA 3HKEA 1CUIA 3QC5X 4KQFA 3WXVL 1I2MA 1NDMA 3G08A 3ZHOA 5LOVB 3L3DA 2F43B 1PL7A 3QYCA 4KTTE 3ZL4L 1MUJB 1TD9A 4UUPA 4WNYA 4QICA 2O8CA 2I6UA 4POAA 3HDYA 2GIXA 5B7NA 2FLWA 3HZVB 1EGJL 3QR2A 1OAKL 4Q1BA 4B2YA 1RADA 2JA2A 2YPKA 1E6JH 3GMMB 1FYDA 1OAQH 2ASVA 1WIOA 3GH3A 4G0YA 1AOHA 1BXUA 3X2EA 3GRFA 4RZCB 4FABL 3VXRB 1MCKA 4O25A 1NHWA 4TS9A 3HN5A 4Q6IB 2EVIA 2GNAA 3W38A 3CZUB 3SIWA 1Z82A 3TSAA 3SE7A 1BBJB 4ICIA 1EK1A 5EP4A 4JFHD 2FQYA 1BGXT 3P19A 5F7DA 2R15A 4FW8A 4NV3A 4FYSA 2M2IA 4D96A 1VLJA 4NQCD 2H7YA 1ZSNA 3NAZA 4YBHA 4YC7A 4H1LG 3EZLA 1WEHA 5F3HA 5GS0L 1RI2A 5L6LB 4BX8A 4H8QA 1DCFA 4E2OA 1RRVA 3T2OA 3BDBA 4NI3A 2WTRA 1TF4A 1FP4A 1I9IH 1M54A 4KMSA 4S1WA 3IE2A 2VDLL 4B74A 3RL2B 3KVPA 5HTSA 1D5ZA 5F1IA 3FTGA 2I4LA 3WIHA 5FWNA 4DL9A 1C16A 4WOCA 1YYML 5F1KC 4KDWA 3ZWOA 3CT6A 1V8FA 3ELBA 3WKCA 3O6VA 3ECBB 4WZBB 5H35B 1FZMA 2UZIH 5JMWA 4RV5A 2YPVH 4O5LH 3SQMA 1KIAA 4JREC 1KQFA 5DJCB 2NIPA 3EXEB 4AJHA 3ALPA 1N8SA 2RGUA 5BUGA 1IZ9A 1AO7D 1KN2H 1S46A 4H0IA 4QD2E 4Z7VA 3G0HA 4G0QA 4OL9A 3O4VA 2EE0A 2WO2B 4U1MA 4XBPB 2P9YA 2CO4A 4A2WA 4LNRA 1KQOA 2KPNA 2FQGA 5BV7A 3RVMA 3U3ZA 1E7SA 5E8NA 1AMNA 3CZ9A 4GSDL 3U3OA 4FYIA 3QLUA 3Q1KA 1DJHA 3I83A 4B3EA 5KS9B 2XZZA 1W36D 5TE9A 3G5MA 2ZJ3A 4KXQA 1HGXA 3IVRA 2HIAA 2MPAH 2BCMA 4X4XA 2R4RH 5I5JA 1KYVA 2PUVA 1T13A 4YIQB 1OWPA 1RLBA 1Y9ZA 3QVAA 3T3NA 2SCUA 1KYOK 5K39B 3BHJA 3TVYA 4GI8A 4IWYA 3CFNA 1PNOA 3NSYA 2OTCA 3DVAA 3GA0A 1L8XA 3HRPA 1U92A 3WHLA 1P4LA 3PUZA 4JFQB 5EU5B 3HKCA 2C5BA 2MSLA 4FTVB 1F8YA 2H1OA 3S28A 1EB9A 1ZVVA 4JXJA 4PJIB 5SY4A 2BC4B 4JD5A 2TRHA 3KH4A 2MYNA 1EAPB 3GUTA 1QVAA 2PFGA 2WSSD 3U13A 1G7HB 4H3VA 5E9DB 2OR9L 2VR6A 2ZYVX 1DBIA 2NAPA 3ZW8A 1A8ZA 5L7TA 1I8MA 5EHQA 3TCNA 1IY2A 1HSBA 5L2JB 3OKDA 1IEBA 2KS0A 3MRSA 3ARBC 4BIIA 1V3QE 3TN0D 3EIOA 3CVHA 1VPVA 3RIEA 1U1EA 1JKMA 4O4IB 4PHFA 4BMVA 2A77H 1EE9A 1AYOA 4X63A 3CLHA 2KQUA 2AF2A 2YQBA 5D96C 1IEAA 2RCSH 2QTVB 2ZJ8A 3NAMA 1YXMA 1IY8A 1GSMA 3UA3A 5BUSA 3CCHB 4BZQA 1KENH 1BN6A 1J2EA 2O1EA 4WFHD 1RHMA 2JQAA 3FBKA 2OL4A 2E7LC 4OHUA 1WF6A 3L6UA 2F55A 1XMSA 3FU0A 5HI3D 1XC7A 1WXXA 1NPJA 2QJRA 1Q9WB 3ZZMA 3BPOC 3SS9X 4NIMA 1ZJYA 4WASA 1IC7L 3CSBA 5EJ7A 3CMOH 2EZ0D 2ZQZA 1A6UL 2AOTA 2BI8A 1GPLA 1OAXL 4NZNA 5BPHA 4DJAA 1VEPA 1GRQA 1PSZA 3N2ZB 4JI0B 5CSZB 5E1OA 2K8QA 3MBED 4ZC1A 1NGPH 5IB5B 3T8MA 3UAFA 4YPFA 2RD0A 2B4CC 3AUAA 4CKWB 1U8MA 1Z1WA 1RLWA 4RAOA 2WW8A 5EPEA 3L1EA 4X7EC 1Y3BE 2JBHA 4IIGA 5K0ZA 1IAII 2Y2VA 1BZ9A 2CYBA 2E7BA 4BATA 1QKZL 1UFQA 3VMMA 4BBJA 1B0ZA 1TITA 3VDAA 4KKBD 1L8OA 2ZSDA 2NY2C 1SXZA 1DARA 4BGEA 4LVOB 4HDSA 3KD4A 2TSBA 2B1QA 1TD1A 3F78A 4AX4A 1P2CA 3VH2A 4WJKB 2IZZA 3QHAA 4YCDA 4ETWA 1F06A 3V6OC 4G86A 2W2KB 3R7WB 3WO1A 4QA9A 2KYIA 4Y7DA 2HMSA 3PXBA 1WCIA 1ND0B 1P4GA 1GDTA 5LQMA 5BXFB 3JYNA 1PDKA 3ZDZE 2AV6A 4NZRL 4C47A 4L50A 3A6CL 3GD7A 1OL0A 3CHYA 4EKIA 1EK6A 2H2DA 3V1KA 1VFNA 1YK1A 4JFWA 2Q45A 2D9QB 6FABL 1CW2B 3TIDA 1TMGE 4JLVA 4PJDE 4RFOH 2V9QA 1NDTA 2OMNA 5BMVF 5DS8B 3DTVA 3EBLA 4CWAA 1MJ8H 4AFNA 3WK6A 4Q0XH 3OF6A 1WDKA 1UEXC 3TEJA 2G88A 4UQDA 4XLLA 1NW8A 2G1PA 1QRNE 2V2XA 1TEHA 1KAOA 3VFNA 1Y0BA 3E84A 1PCSA 5JOQA 2DQIH 4HH0A 5FD8A 4G9DB 1BV8A 1I1QB 2P75A 3T7AA 3RYCB 2QY6A 4P1ZA 1H6DA 3QM1A 1Z5HA 4G5QA 2CL5A 1ZI9A 3GSRB 3VSEA 3WGGA 2HXYA 4XI5D 1Y89A 4KFMA 1ONOA 1IXSB 2Z2JA 1HXMA 2EIBA 1J9QA 4O4YL 4GFTB 4BFIB 4CIBA 3I62A 3QFJB 3ES6A 2YHIB 3FRUA 1ULZA 3PCTA 1BVRA 3IJYA 1NFAA 4Q74A 1QO0D 2E55A 2QNBA 5IULC 4LRTB 3O1IC 3G0IA 1OU4A 4LZAA 4BP8A 4KR6A 4GF5A 4WNQB 3QPQC 5JXJA 2AJUH 1TVEA 1EVJA 4JFFB 3M5CA 3LT4A 2JB9A 3QJFA 5IBUB 1Q11A 2IZ0A 4BJ3A 2DQDH 3BIOA 2VWHA 5IT0A 4GG6F 2PZFA 4BQNA 3HKFA 1CULC 4YFLI 1UKTA 3OC8A 3B9DA 1KSRA 1D5XA 5IQNA 4XWAA 3RYIB 4QPDA 5K0LA 2POQX 5LP6F 2F53A 1COBA 1TM3E 1PJAA 1TZCA 3JASB 2ZPAA 4PBTA 2ED8A 4L22A 1RQ5A 4WDIB 5LXVA 3TN0A 3V4PH 2X4TB 3ZL1A 5AJXA 3LT5A 4JJOA 1FB5A 3SFVA 3UBXA 3MRFA 3BSZL 5FKAA 2YYSA 3UT5B 4L76A 4KXZH 2W2QA 3UW1A 4H31A 4CL8A 3AEUB 2IPXA 1LPBB 4WV1C 1OZHA 2YNMA 2DFNA 3VWJB 2E4ZA 4B87A 4D02A 1UASA 2VO8A 4YK4B 2Q7YB 3DGEC 1Z26A 2AXQA 2CDBA 2VJYA 4BO8A 1PNTA 4JY4A 2AI0H 2DW5A 3NPSB 1S7XA 3H75A 5ERWB 3IAPA 3MI6A 1ST3A 4B9EA 4CKZA 1QGYA 5GGQL 4MUKA 4BBZA 3QX8A 3HNSH 4JX0A 3RYHA 4CC1A 1DTEA 4MWFA 4RUKA 1FUEA 1KWGA 4YAGA 3B8HA 3F5DA 2BM3A 4K1XA 4N7RA 4JFTA 2Y3IA 2ZXGA 1EWTA 3RVKA 1B42A 1V43A 1OTSD 4DIBA 2UY7A 2BNRD 5EOTB 3LKNA 5DJDA 4NH4A 5EGNA 4TS4A 4HBCL 1PZMA 3KLNA 3TQIA 2BFWA 2BP5M 3HBZA 4Q89A 2QP3A