4UMDA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
MNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
total genus 59
structure length 173
sequence length 173
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umdA00
1Z4JA 4BNDA 5ALFA 3ZWDA 1YDFA 2HCFA 3W5DA 1K1EA 2YN4A 3M9LA 1T9ZA 1WR8A 2HSZA 2ZG6A 3DAOA 1AQ6A 3QU7A 2G0AA 2P69A 2I34A 1FEZA 1RKUA 1L7NA 2YMLA 2PKEA 3L0CA 3RF6A 1IWOA 3E8MA 4XOUA 2ZBEA 3QNMA 5AM0A 3QUTA 3W5BA 4UU0A 2PR7A 2HHLA 2HF7A 4E88A 2ZBDA 2YJ4A 4CF3A 3L0BA 2BDEA 1RKVA 2VKQA 1Z4QA 3VAYA 3FZQA 3HYCA 3QLEA 2NO4A 3FPSA 3SKYA 2HI0A 4XQ0A 4Y2SA 4Y2XA 5ALNA 5AVWA 2WF6A 3QYPA 2O2XA 5AI9A 5ALKA 3E81A 4L6CA 2R8YA 3GYGA 3WKCA 5AKEA 1XVIA 1Z4PX 1LTQA 1CQZA 3P96A 5AM3A 3U26A 5FP0A 2OM6A 4KX5A 1RMYA 3KBBA 5AKKA 3AR7A 2FPSA 2GHQA 3QX7A 4HGOA 4IFTA 1S8OA 1J8DA 5AVXA 2G07A 2DQSA 3L1UA 1NF2A 2B82A 2P11A 1Q92A 2I33A 3AR2A 2B0CA 4UMDA 2JGAA 1S2OA 4L6AA 4UM5A 2YMMA 2G08A 4QQFA 3FGOA 5AW3A 1J97A 2QYHA 2FPRA 3I1YA 1VJ5A 3CNHA 4Y2QA 5AKYA 4EX6A 4MWOA 4OCZA 2WF5A 4NABA 3ZU6A 2QLTA 1N8NA 1ZRNA 4FFDA 2FPWA 2JAOA 2RB5A 3AR9A 4HGPA 4RETA 1Z4OA 2B8JA 4CE6A 5AKLA 5AW0A 5AESA 1SU4A 1O03A 1T5SA 5ALRA 1ZS9A 5AIAA 4KN8A 1RLOA 2GHTA 2GO7A 3FVVA 4DWOA 2JAUA 2IOHA 2FUCA 5AVVA 1Y8AA 4UAVA 2Q4RA 3FPBA 5ALDA 1RQNA 3OCZA 1QYIA 3PCTA 2FPUA 3R09A 2JAWA 4IG4A 5AKZA 4G9BA 1RLMA 1U2TA 3CZ4A 1U2SA 5JJBA 4EZEA 1QQ6A 5AI4A 4BX2A 4L57A 3PDWA 4UW9A 3OCUA 3ONNA 3ZVMA 1RKQA 3EF0A 1RPZA 4JB3A 1N9KA 4Y2JA 3ZX4A 3MC1A 4HGNA 4QJBA 3MMZA 1XPJA 1MH9A 3UMBA 4FE3A 1WZCA 2FPXA 1RLTA 1CR6A 2WM8A 3AR4A 5AI6A 3FM9A 3L8EA 2D2VA 1JUDA 1ZOLA 3WK7A 1QQ7A 1F5SA 3SF0A 5AK5A 1YNSA 2YBDA 4BEWA 3WK4A 4F72A 4UAUA 2WHEA 1YMQA 3L8FA 3SLRA 4BX0A 3MPOA 1PW5A 3EPRA 3W5CA 5AK6A 4JDPA 1RMQA 4UMVA 1RDFA 2C4NA 2YMPA 3OCYA 5A3SA 5AVYA 1VFPA 5AI8A 4H1WA 2EAUA 3NANA 3ESQA 4I9FA 4YIHA 5AW2A 3SD7A 3OCXA 4CF4A 1EK2A 3OCVA 2NO5A 5AVUA 3M1YA 3DDHA 1L8LA 3ZX5A 4O8CA 3TLMA 2GMWA 4AS2A 4Y2UA 3OCWA 4NV0A 2AUTA 3IB6A 3SKXA 4UASA 3ZWKA 4CF5A 4C4TA 4EX7A 4YCLA 5AVRA 1YJ5A 3WK9A 5AKXA 3U7FB 5IS2A 4BEVA 5ALOA 4C4RA 5AKJA 5AW8A 1Z88A 4KNWA 3L1VA 4FYPA 2FI1A 1WVIA 5ALZA 3L8HA 2CN1A 1Z4MA 1Z4KA 1RQLA 3ESRA 3KOOA 4NWIA 4UATA 1TJ4A 3U7HB 5T41A 4ZEWA 2B8EA 2AGVA 4YIKA 3AR6A 2ODAA 5AKIA 4KYTA 5AM4A 4HGQA 2I54A 2BDUA 1TE2A 1L8OA 4DFDA 3NIWA 2FDRA 2B30A 1RRCA 5AIBA 1L6RA 3WKAA 3ZUPA 4DW8A 4BKMA 4BX3A 3F9RA 4PNHA 1L7MA 3QUBA 2IYEA 3ET5A 1EK1A 2IOFK 2MSNA 2PQ0A 2YY6A 5AVSA 3QU9A 3OPXA 2C8LA 2G06A 2HOQA 1Z5UA 3I76A 3E84A 1VJRA 2B1QA 3L8GA 3N8GA 2C88A 2RARA 5AKHA 2G1AA 2FEAA 3N07A 2HF2A 2AH5A 5ALVA 3U7EB 1QH9A 2ZOSA 2YJ5A 3L0YA 3WK6A 4UMEA 3QU5A 5ALGA 3B8EA 2HO4A 3B9RA 1YV9A 3K1ZA 3L7YA 4Y2RA 4DCCA 1ZD4A 4Y2TA 5AKGA 3I6BA 4EELA 5A3QA 5ALMA 4Y2YA 4HAIA 3KZXA 3A1EA 2ZBGA 1Q91A 4UMFA 4Y2VA 2R8EA 2EATA 3J7TA 4NFLA 5AM2A 2NYVA 1U02A 1ZD3A 5ALLA 4ZEXA 4BNDB 4G63A 2WF7A 4Y3UA 5IT4A 3U19A 2I7DA 3SHQA 3ET4A 5ALIA 3EWIA 4GIBA 1ZD5A 1TA0A 5AHXA 4YCMA 4OHFA 2P9JA 5ALYA 5AM1A 5E0OA 3HLTA 3N5KA 5ALHA 3QU4A 1LVHA 3WK8A 3WKDA 1SWVA 4ZEVA 2CFSA 1ZRMA 4NAVA 2IA5A 5AW9A 2HX1A 2I6XA 3R4CA 5AVQA 4YGYA 4AS3A 3I28A 3IJ5A 2W11A 2WF8A 3NASA 3QGMA 5ALUA 5AVTA 5AW5A 3WKBA 4AP9A 3ED5A 4XE5A 2EARA 3EF1A 1Z5GA 2I55A 5AK4A 3NUQA 2FUEA 2R8ZA 3L5KA 3QUCA 4J03A 3S6JA 4RESA 2X4DA 3U13A 4CNQA 4Y2PA 4UU1A 5ALWA 2MU1A 4J2TA 2YFYA 3KDPA 3D6JA 3UMCA 1RC8A 1YS9A 2YMQA 4UARA 3ZVLA 3AR3A 1WPGA 4UM7A 3UMGA 3PGLA 3ZVNA 3E58A 3RFUA 2R8XA 2GFHA 5AW1A 2O9JA 1L7PA 3KD3A 3AR5A 3A3YA 2AMYA 1L7OA 3PGVA 2JARA 5ALXA 4YCNA 3B9BA 1Z4NA 4HYTA 3WGUA 1ZD2P 5IT0A 2HDOA 2Q5EA 5AI0A 2YJ6A 3N1UA 1XP5A 4OFZA 5ALTA 2W43A 4KX3A 1Z4LA 4OD0A 3UM9A 3SMVA 2P27A 2Q4TA 2ZXEA 3NAMA 3NALA 4KNVA 2BY4A 5AI5A 3ZW7A 4YH1A 4MUMA 3ZTYA 2C9MA 2C8KA 1ZJJA 1TJ3A 4B6JA 4XPZA 2OBBA 1RMTA 3QXGA 3IRUA 5ALQA 2IOFA 5A3RA 3R9KA 2G09A 3ZI4A 3WGVA 4BYGA 4HGRA 3A1CA 2HEGA 5AW7A 2CFRA 4GXTA 5ALEA 3WK5A 1U7OA 5ALPA 1NNLA 5AK3A 3QUQA 2OA0A 3AR8A 3U7GA 3W5AA 1SWWA 5ALSA 4EENA 5AVZA 2YJ3A 2ZBFA 1NRWA 1TJ5A 1KYTA 4C4SA 5ALJA 4I9GA 3BWVA 4F71A 3N28A 3A1DA 2WF9A 1X42A 4EEKA 2RAVA 1T5TA 5AW6A 5AW4A 5AM5A 2G80A 3MN1A 2B1RA 2WFAA 2CFTA 3DV9A 3QU2A 2OYCA 3ZTWA 1QQ5A 3OTQA 2W4MA 3WKEA 3KC2A 4BBJA 3DNPA 1U7PA 3NRJA 3BA6A 1O08A 5AICA 2RBKA 1Z4IA
chains in the Genus database with same CATH superfamily
1HBJA 2BKEA 3LUPA 3FNBA 1Y3IA 1HURA 1VKJA 3CPEA 4JKYA 3NHMA 1UK7A 4FTWA 3RC1A 3V3KA 1N9GA 3BWDD 4YRMA 1GSAA 3GROA 2A67A 4DDWA 2YN4A 1VIVA 1KXJA 3NJRA 4ARBA 3PC8A 3EIQA 4H4EA 3GBPA 1B6RA 4PV7A 4WOBA 4DYVA 5I4BA 2ZE8A 1P0IA 3A6JA 1CUHA 1JA9A 4BN0A 5JNSA 3AX6A 1TI7A 1FEZA 1K3TA 1DQPA 1XCJA 2NU7B 2HMVA 3IOMA 1CS0B 2QMHA 5FR1A 1VB3A 4CMGA 2NU8A 4OL9A 3O84A 3W3AA 3DV0B 1F4LA 5TB5A 2ZCJA 3QYAA 3H5OA 2HXYA 5HXAA 2QM3A 3TUJC 4HTFB 2H2FA 4FFNA 4ISCA 4MVJG 4UZEA 5FOVA 3A3NA 4UNNA 1B3RA 1E0KA 2XDWA 4YJKA 1RTKA 1KZ7B 2FSFA 4EUHA 1REQA 3IUJA 1E79A 2ZJZA 1XELA 4ILEA 2XTJA 3D8TA 3RK1A 5LKAA 3D0RA 4MI6A 4YI3A 2HI0A 4YXWA 4ZODA 1JSZA 3U4DA 4CQJA 1NR7A 1N9ZA 2HWKA 4QO7A 1GL9B 4KI7A 4Y2XA 1DQSA 1LBSA 3Q0IA 2B5WA 5H70A 5IABA 3D64A 4YONB 3B6KA 1WV0A 1M5RA 3K2EA 2FUG6 3H83A 3M8KA 4BFWA 5EYPA 1DKPA 4LI3X 1XTQA 4F93B 1H0KA 4ZCSA 1Z5VA 1CQZA 1LV7A 3L0ZA 5FBRB 4E5SA 3DAHA 3PX7A 3PUXA 4M36A 2YZGA 4U7GA 1RQ7A 3EX7C 3ND8A 5CP8A 3L6OO 4DB2A 4ZPJA 5BR1A 2HN9A 4B6EA 1RTTA 2G83A 3JVDA 2HDHA 1E5XA 4YJ2B 3PR2B 1PJQA 4IUBS 1TYBE 4MROA 1T2EA 1YASA 3GRUA 4NZYA 2P11A 4YVFA 4WJLA 4C7OB 4ITRC 1C9YA 2YTZA 4EJ0A 1XPRA 2AUNA 1B0AA 1BE1A 4Q66C 4B45A 2F59A 2AW5A 5E4JA 2ISQA 4UM5A 3UMSA 2ID4A 1MV5A 3AKDA 5LP6F 1YB2A 2N46A 3O4RA 3OQHA 1BYUA 1VJ5A 1CQIB 4Q4LA 3VQTA 4H9GA 2NYUA 3KLNA 4FNGA 4OJMX 3DLPX 4EO7A 4L50A 4NY1A 2ZWIA 3UK1A 1ZIDA 2A1UB 2BONA 5K3BA 3SJBA 1RKXA 5JROA 5FA8A 2ZW9A 1R5OA 1ZU5A 4KIUA 2I4RA 1C81A 3C3PA 3UMJA 2RB5A 1U0TA 2I6QA 1FE8A 1XKLA 1AXEA 3HCNA 2LIPA 5H82A 1M0TA 1DELA 4LJ6A 4RKRA 5ALRA 1MOZA 1CVIA 1UJNA 2O2JA 3FMPB 5CJ2A 2I65A 3FWZA 5DWVA 5CDYA 5K9ZA 2IH5A 1AS0A 2M1XA 2Q3HA 3EA0A 2H4YA 1W44A 4DAEA 5DP2A 4DCNA 5JYCA 4KQMA 1NLFA 1I30A 4HDKB 2R11A 2ILVA 3EAGA 5ITVA 3EPHA 3WSWA 2FSPA 5ICSA 2PBLA 1PNOA 4CHGA 1ZJWA 1DG9A 1R0WA 4Z54A 1U0EA 3DBHB 2FMKA 2O14A 1UJ6A 4DF3A 3U3MA 5G1PA 3KPYA 4V0NA 3O8QA 3DOFA 2A9PA 1YS1X 4P53A 3CVOA 3EEQA 4L4ZA 1CRQA 4M1QA 3M3DA 4DLTA 4LF8B 2IPLA 3ZCSA 4D0NA 1R50A 3OJWA 1HDCA 5CM2Z 1HDZA 5IK2A 3N0XA 1PV1A 3LK7A 4BZWA 2XUDA 2X5JO 1KH2A 2PH7A 3SZMA 1M0EA 5I48A 4O33A 3QEMA 5AJZA 1DIHA 1ZQ9A 4DADA 4ER3A 2Y27A 1W85B 1D6SA 1KKLA 4Y98A 3HB5X 5JARA 1X1DA 3RREA 3RS9A 4IFBA 4FDMA 4Z0HO 1C1DA 3WA6A 3RHSA 2AS0A 3HVHA 4JOBA 2B98A 3LA8A 2QMQA 4Y6LA 2DHDA 3R6WA 4GHWA 1MIHA 4NCXA 3IV9A 1EQAA 2WOOA 5DGCA 5FAXA 4DEXA 3E3OA 2ZVPX 4X66B 3AV3A 2Q0SA 2YW9A 3H1BA 3I0MA 3L4BC 2QDXA 4AQDA 4ZANA 4RACA 4O2AA 5C7LO 1DOZA 1I6LA 1RT9A 4N82A 1PEAA 1RYMA 2DY0A 4BWYA 3MPOA 2UXBB 4MXDA 2PWAA 3MILA 5D7BA 1U90A 4RKQA 1PL8A 3NHLA 1M54A 1Q5PA 1VLQA 3KSZO 4OSOA 4NOJA 4JDPA 1KYIA 4GLBA 1RRFA 1Y80A 2E6UX 2WUEA 3DZJA 3LL7A 5JW6A 2VHXA 1AZWA 4V0MA 1CUXA 2PM8A 1NXVA 4PSVA 1E2KA 2D5BA 2WJZB 4MRRA 2FRDA 4YAGA 3LZDA 4WXRA 1FMLA 3H5RA 4PYMA 1YI1A 4IKOA 4X64B 5DSZA 3AQIA 1IOWA 3WMGA 1V2GA 4HB4A 4ZZIA 4I55B 1YBMA 1KI3A 4HLUA 4YJ3B 3P94A 3SX4A 1MABB 3ANYB 3WSVA 3LLCA 2DLDA 4HBZA 5GJWC 3TMAA 5LWQA 4CCWA 2QMUA 3SC6A 5JIBA 3DZ8A 2SKEA 2ABWA 1E1QD 5GONF 1VL0A 2JFHA 4IVRA 4Q1VA 5DHAA 2D2EA 4DLSA 2I80A 2VZLA 3U17A 2H52A 2GEJA 4NULA 1EE2A 3VBEA 3PDJA 2DSNA 1YJ5A 3NOOA 1AUXA 5BW5A 1YJCA 3N74A 4HQOA 5CTJA 4OHOA 1TAHA 3VO2A 5K8TA 5DB4A 3UGQA 1Q16A 4MWEA 3QVLA 2YZNA 2GFQA 4IIYA 4QATA 5AXBA 4P22A 3UV3A 4C0SA 2ZR9A 1F0PA 4KOAA 1CV2A 1KHHA 1RYDA 1VI6A 2B5OA 5J1SB 1J56A 2DB3A 3H9GA 5HCNA 4GRAA 4D43A 3OA0A 4GBMA 1T15A 1E3DA 5D6NA 3JX9A 1T9CA 1WVIA 3L8HA 4GOJA 1VIYA 4F8EA 4MUXA 4CM5A 3GW8A 3UMRA 1KC1A 3KL2A 3N8HA 3B5JA 1IBKB 1KFCB 5F2EA 2VHCA 3VR5D 1PR4A 3FGPA 3WLPA 5LYJF 1Z75A 2OCLA 1L7VC 3FGNA 1XEFA 4JB0A 4B0OA 4RPIA 4BMCA 5IU6A 4H7PA 3HA7A 1DVRA 4II2A 2X14A 4XIJA 5AOBA 2IH4A 3VV3A 5A5GA 3C45A 3RSSA 4EYGA 2RGYA 3FYUA 4CL3A 1TE2A 2ZTLA 1NJGA 2GM9A 3SC2A 1XZIA 3WNCA 2GN0A 3O8CA 2XNJA 4I1OA 4FYJA 3S1AA 3ACCA 3ONDA 4DJJA 2GR9A 1KK0A 1PJ3A 1KZ4A 4PLGA 1LW7A 1U98A 3LJKA 4J91A 4R7TA 3SGLA 3PC6A 2HO5A 4QQNA 1SBNE 4Z1OA 4R8LA 1K5DA 4WY5A 3L7DA 5K6RA 4S24A 2W58A 3FJYA 4AP5A 3B20A 1IG3A 1RHRA 3IPXA 3BRSA 2IYEA 4MPDA 5D5QA 3OKAA 2WKQA 3SYKA 2JA2A 3LWZA 3AUUA 3TLGA 4A36A 3JD0A 4QWMA 3IAXA 4EDFA 3RSGA 5K0TA 2BMEA 4ND8A 3ST7A 3TL2A 1P9LA 1ONOA 5A71A 1YL6A 2ZS9A 3CKLA 2M6SA 3MFQA 5DTJA 3A36A 3TVYA 1H0SA 4ECEA 1HQKA 2C3MA 2G63A 1ZESA 5A4DA 2C88A 2RARA 3AB7A 5AKHA 1IOZA 1TTTA 5G4KB 4KACA 3U39A 3AYXB 2I0FA 3KRTA 4HMQA 4YRDA 1HE3A 2YCLA 4HDSB 3U7QB 3S8YA 2Q0XA 1UPTA 3HU5A 3RODA 1UMKA 1N0UA 3LW7A 4IP0A 1U0GA 1J99A 5IBRA 3IKVA 4TZKA 4ZRMA 1SKMA 2QJFA 3R4VA 2P2GA 3AF5A 2JEZA 1UINA 2AJCA 3BE5A 4ZQEA 1HKHA 1M7GA 2CJYA 2YFHA 1VP9A 3DYVA 3M3HA 3NX4A 4GVLA 4NZ9A 3U40A 5KTSA 2GF2A 2R66A 4B5LA 4B6SA 3B1FA 3LP8A 2AMFA 4KDFA 4MQLA 4YRAA 1QHHA 2DPLA 2VF2A 4JKIA 2NYVA 2XSZD 4EKDA 5A4KA 4MVJH 3QX8A 2AFHB 4XCVA 1X86B 3DOUA 4RQTA 3T7RA 4BNIA 1G4UR 3WJ7A 3FDZA 3F3KA 5E3HA 3ND9A 4E08A 1DAFA 1PSZA 3OTWA 1KBOA 1OBCA 2Z8XA 3QE3A 4X85A 1YFJA 2XMZA 5FUMA 2PIAA 2FMFA 1UMCA 1FS5A 3EZ7A 3UHJA 2VK1A 4IXMA 2V55B 2ORED 1LUAA 1PR9A 1P31A 4J7CA 5LA6F 5JDCA 4JLBA 3MELA 2HSGA 4QM7A 2Q49A 1QR6A 4UHDA 2NUBA 1UFQA 2A5GA 4QREA 5DRTA 4GZMA 4JBHA 4B1FA 2IEDA 1JW9B 2Y4NA 3AY3A 2PLNA 4GG1A 3WHIA 4HDMB 3DVAA 4LRQA 2XQKA 3WHPA 2V6FA 4X3PA 1KQPA 5IULC 5DNWA 1JI3A 1JDUA 4RTOA 1IMJA 3LT0A 3HP7A 5DN9A 4E2WA 2PYDA 4G1FA 4WVLA 5C34B 1L5LA 4JJ6A 5AHOA 4ADSG 2OZLA 5CIWA 3BGOS 1NASA 4OYLA 4RVGA 1LDGA 3O8OA 2A92A 1NDUA 4DARA 4KWIA 1T29A 2WUFA 1NU8A 1UT5A 1SXHA 2FH5B 5EZ6B 2JFOA 4BCCA 3GGJA 4H27A 4NEQA 2ESRA 2Y77A 4J7XA 5AK0A 1XTKA 2XUPA 3NASA 4H16A 5JJKA 4K6FA 4AP9A 1NMZA 1ZUHA 3CW9A 1JU9A 1U7WA 2OSVA 3I30X 4F2HA 4EHJA 4N76A 3M6LA 4CV0A 3QUCA 4D9EA 1HQDA 3LVBA 3F74A 3R0ZA 2WFZA 4HHEA 4K40A 3WLRA 4J43A 4I6GA 4CETA 2C8JA 4YRZA 1NP3A 4JROA 4IGIA 3PD0A 1T8SA 5DM0A 3E1KA 4PRKA 4WZBA 1XWWA 1YZHA 2GYUA 1YKGA 1NQXA 2JHAA 2DP4E 3VI3B 3H65A 4WZZA 2P6RA 4FCVA 1XCGB 3CEPB 3Q9LA 3WZMA 3S7ZA 5KWVA 1CD5A 2QUAA 4ILKA 3VDRA 4LZJA 5DM4A 1AKQA 1WDKA 1WPGA 4G0QA 2CFCA 4HO1X 4KLAA 3RRMA 4H7JA 4HUJA 3MWYW 2IZOA 3A32A 1LI4A 2CZGA 1L6IA 4JNKA 1WXQA 1BXGB 3K92A 4IYJA 5EZ5A 4E3WA 1FMFA 4ZD6A 4W82A 4NONA 3HADA 1XTUA 4KXYA 3L7OA 3PNLA 4M46A 1TW2A 1FTNA 1IWPB 1W4BA 2MR5A 2RHWA 4CL2A 4NEHB 4RWZA 4YCNA 3IAS1 1I2AA 5ANRB 5HIKA 1F8YA 4J0KA 1KZ1A 4WUTA 4EGCB 3OM9A 2DT5A 1OLUB 1UOEA 1P44A 4FEGA 2YJ6A 3N1UA 4KO8A 1KO5A 2IZ5A 3FVQA 3RTDA 3TR0A 1E2GA 3CUYA 1IN6A 1V3TA 4PBRA 3UG6A 2HY7A 5JPIA 3QXJA 2PZKA 1QNLA 4F2WA 1U4OA 1GKKA 1CUDA 4DRZA 4QULA 4NLLA 4MDFA 1EUDB 3EB9A 1UKCA 2JIPA 4G01B 2X9QA 4B6JA 2VT7A 5HGJA 4ER6A 2PUFA 3E23A 1TLTA 3O8LA 3TLAA 3A3KA 2P9QA 4WFIA 3BMNB 5IPFA 3W6PA 3ZWQA 4YUZA 1OX4B 5LJLA 2IVZA 3KSAC 1FLDA 1DKRA 2Q7XA 1SVMA 3F46A 1E1LA 1X1AA 1D2HA 1T2UA 2A9QA 1SEPA 2HEGA 2ZTSA 3BXHA 4NCIA 3RS4A 3T4UA 3PC8C 3UAYA 3WGLA 4E15A 3V4RA 4ZP1A 5FFMA 1GU7A 4GXTA 1Z0SA 1OFUX 3NFRA 1WKVA 4Z4HA 5IDQA 2JJ2A 2BOVA 4W1QA 3U3ZA 4GYYA 1JKMA 1IPEA 2FVXA 3MIIA 4Q3BA 2BFPA 4KP7A 5ALSA 3I9NA 1MJGA 5AJVB 3RTBA 5TLSA 4KL8S 4EY8A 4OH7A 3JV7A 4J3JA 4DUPA 4E5YA 3LL4A 4FHZA 2AEJA 1MB9A 2I2FA 3ESZA 4GM1A 5DT9A 3UUWA 5B7NA 1UJBA 2O8BB 4ZVVA 1QS0A 3UUGA 4F71A 2A9KA 2YXDA 1IOLA 1PR0A 2QN3A 3DEYX 3O0DA 4XM0A 4BCDA 1DG3A 2BSQA 1IWBB 1XHEA 2EGGA 2F64A 1Y42X 2QRLA 4ZMBA 2YWEA 4NZPA 1QB8A 4DLVA 2UYHA 4KE9A 3CPJB 1D03A 1WU7A 3EZNA 1CWUA 4X7BA 1NI5A 3OP4A 3TOXA 3HLYA 5EI5A 1ECLA 2O0HA 2IUYA 2QAJA 1XP8A 4KR6A 2QRVB 4CGZA 5FNVF 4I1IA 4OK5A 3J81A 2V3CC 4V0KA 3G9ZA 4Z51A 4EKYA 1NVKA 1WSBA 2PGOA 4M9UA 2FZKA 4YFYA 3ON5A 5CG2A 4GX1A 4CQLB 5MDHA 3U62A 4HNUA 3UT0A 3RCBA 1CF2O 2KBEA 4BNDA 5HUQA 4DLWA 5HQ3A 3GD5A 4IHJA 4OXYA 1H6CA 4PFQA 2QTNA 5ARDA 3HWX1 3T3DA 3DLAA 3VSCA 4FN5A 3BSYA 4NV3A 2ADMA 2YV1A 2WUVA 6LDHA 1PS8A 1JHRA 2AMJA 4IR7A 5GY7A 5ULLA 3GEGA 3TFQA 2VUHB 4Q3DA 4LS3A 1SD5A 2PXXA 3Q2OA 5I4CA 4DHEA 3SZOA 3HG7A 1JYSA 3OJLA 1AF7A 3NTOA 4K26A 4QDZA 4DABA 1IY0A 2OKGA 4MWBA 5JHGB 4D92A 5JAOA 1Q0QA 1RRMA 4ZWNA 3W5BA 4CTMA 2BBTA 2HRDA 2PR7A 2J59A 2PGIA 4M8KA 1RLIA 1JJVA 5EG5A 4WKGA 1ZVVA 5KEIA 1W0JA 4AWAA 1YJAA 5LUBA 1QDLB 2R6FA 4DIDA 2CEAA 2E48A 3CW8X 3R3SA 3O8NA 1I3CA 2JD0A 3PV0A 3FCAA 3R7WA 3FYSA 4DXAA 5JG7A 3U7IA 1I2MA 3ROFA 3K70C 1L0BA 3OE7D 4X8LA 2CV1A 2YZ7A 3FZQA 3Q3EA 5CX1B 1Q84A 1DRKA 1UXJA 3FPSA 3LU1A 5CDGA 4KRFA 2PZGA 2V9PA 3MJ4A 2G71A 4BQOA 4IXDA 3G3EA 1J20A 3DDZX 3MJFA 4MW7A 3CRVA 3KB6A 3KJQA 3HL4A 4GXNA 4W63A 1OGIA 1T3HA 1ABFA 1AUQA 4EG1A 2E1RA 2VNJA 3LOPA 5KTKA 1XWIA 3RQSA 3SVTA 4TROA 2CWWA 1ZVKA 3BB4A 3KTAB 3PNKA 3CZQA 4HAOA 1P1RA 3UKJA 7MDHA 3HB1A 1LTQA 5EZQA 3IVGA 2BP7A 2KBFA 4HH3C 3D8RA 3Q87B 1JZSA 3CNQS 4HAZA 3OG9A 4Y6SA 4QG7A 3SQDA 2EV9A 4CFZA 2AX3A 5FUWA 1JJIA 3L8ZA 3JSXA 3SKVA 2IYNA 2Q07A 3X44A 1GGHA 3KBBA 1X87A 4YK7A 1T1JA 3IQIX 3V2GA 3FVWA 3C4VA 4ALKA 1S8OA 3CWZA 4G23A 4BO8A 2JD1A 1YJQA 3REQA 5DX8A 5K5EA 3IKJA 1YVRA 2I33A 1BD4A 3DEZA 3KG2A 2H48A 2V3VA 3H16A 5K03A 3TZBA 3D4OA 4JSTA 4IDOA 4A5OA 1DV1A 1XMIA 4BV8A 1Z6ZA 3MTJA 1FNNA 4I5FA 4AM8A 5K8JB 2BHNA 2NPOA 1ZWLA 2ZJYA 3ENQA 2ZBPA 2VZ8A 2IPAB 2K6GA 3BCSA 4P80A 2G9ZA 5IDVA 1NXXA 2AK3A 3ZW9A 4AG5A 4JUAA 4Y2QA 4EG8A 1LPBB 3WNVA 1W4AA 1B16A 2IU6A 2NZUG 4JLNA 4D9MA 3ZGZA 2R65A 3T9DA 3C3YA 3GCWA 3KR9A 2O2SA 4RTSA 4IDDA 3RVOA 1HXHA 4PG8A 2IC5A 1E77A 4QFBA 2X0KA 4X95A 2WZBA 4JEHA 4KH1A 2VKTA 1EBBA 4N49A 3FNQA 4YI5A 4D9GA 4PTZA 1O03A 4MLPA 1X14A 1FYDA 5EPEA 3WLJA 1K7SN 3DLTA 3OQMA 2L0XA 4YQYA 1NXTA 4ZARA 4ARUA 3QXXA 2XI4A 2ZI7A 2QMYA 4MK4A 4YFVA 3I4LA 1X15A 4LVCA 2WG1A 1OQAA 1E5LA 1P7VA 2Z08A 3I9LA 3OLVA 4MPPA 5KREA 3L0IB 2PL5A 2IOQA 1HM5A 3G8YA 2BE7A 3HVUA 4NCHA 1FDTA 2HEIA 3QRWA 4JL6A 2CFIA 4MVJE 4NKRA 4DR1B 1W75A 2WG0A 3T5DA 1TLLA 3C98A 1WJGA 4IZOA 5LNK6 1D09A 1E6MA 2FRDC 1T3TA 4XUGB 4NDAA 3ZBTA 5KCZA 2Z2IA 4LE2A 3RAEC 3PU6A 1A4RA 4G9BA 1GNQA 1U2TA 1TAGA 2OMEA 2DHEA 4N6GA 2L2QA 1XRLA 4HLUC 2JFNA 3QIAA 2NQTA 1KR5A 3PDWA 3GEMA 4GPIB 1HC7A 4KIGA 4Q4HB 3C3XA 1MHTA 3UK2A 1EFAA 2UUPA 2XR1A 4PHHA 2CZQA 2II6A 4P54A 1C7IA 2D8AA 3W8NA 4PYQA 1T4MA 2GWHA 4MWSA 1PWHA 4JUDX 3PPIA 4CIYA 4CL0A 1FRQA 2F55A 1W47A 3B1WA 3QKTA 2ZJ5A 1PG0A 3FWHA 1ZGCA 3KJFA 3OZAA 2WSLA 3O4JA 3INRA 4DG8A 1U2PA 4URUR 1TVKB 1DTSA 4H35A 1UZAA 2ZI5A 4W4TA 4WDQA 3EQ8A 1NW8A 1CR6A 2RI1A 1MQSA 2QSZA 4OK3A 1L5KA 2ZIEA 2X1VA 4M9SA 1GCUA 5F78A 1R5NA 5E0KB 1E9EA 2REQB 2W0SA 4PG5A 4A0FA 2XVYA 3A25A 3FLEA 5EQDA 1U5BB 3SF0A 3UB2A 1GPJA 4J75A 4B6FA 2JKYA 3MGCA 3MCTA 2PRIA 4BKUA 1PZHA 4IFEA 2CHQA 4F5YA 1TUEA 4BJ3A 1EBFA 2JZCA 4U0KA 3JQ6A 3VNSA 3R3UA 3CG4A 2CJXA 3NHUA 1PX2A 4PVCA 5FBKA 3BD8A 2DT8A 4AZ3B 1ODKA 3VPHA 4L4UA 1X0XA 4MZDA 1RIIA 1Z22A 1T9GS 3HI4A 5J1TB 3KQNA 3FYUC 2NU7A 2J6BA 4LRTB 1RHKA 1CS0A 3NATA 3KVRA 3L43A 1NU6A 2O19A 1IZ0A 5DHPA 1NMEA 3DE2X 3FDFA 5F7JA 1XRSB 1WZIA 1DHRA 3GG2A 1BE8A 3DV0A 2W6PA 5EGNA 3RFXA 6CHYA 2QBYB 1UK6A 3FNEA 5CU7A 4HTFA 4QEZA 2BFNA 2PUHA 3AFHA 4YEDA 5AQ1A 3TUZC 2G70A 2BV3A 1DAGA 3AVPA 1JIXA 1XK7A 3OCWA 3LC7O 1PEKE 1ZJ6A 2R7KA 1W2GA 1CEQA 1ZBDA 3EYAA 3PT9A 3N7AA 1MPTA 1HNNA 2TMYA 1NV9A 4I9UA 3KJEA 3OPNA 3O93A 2PQMA 4HNAB 5KDOA 4N41A 5CLJA 2BM1A 5CEJA 4CF6A 3WIBA 1IN8A 1XDGA 3GFBA 1CFZA 1XZJA 1U8TA 2Q5OA 1W25A 1CY4A 2PIDA 3OZVA 1PJSA 1Y6RA 4HPXB 2BBSA 3NYQA 4PZDA 5I5EA 1N2JA 1M6HA 4PM4A 3DHNA 2CZCA 4BAZA 2ZJBA 4KR2A 1JRLA 3I61A 3GJXC 4IXNA 4JT8A 3Q0EA 3PKIA 4AZTA 2PGDA 5IH7A 1RI5A 1ZI6A 4J6FA 4UATA 2ZFUA 5F9MA 1QWOA 5AHKA 5CDFE 1XPUA 2W2KB 3G2OA 4B6QA 1V26A 2MMCA 5IKOA 1BDJA 3ADOA 3AI3A 3B85A 3O8RA 2OK8A 1HPLA 1OREA 4PAOA 4F5EA 1CYEA 1PJBA 5EY5B 3TGWA 4YJ2A 1PBTA 3NPAA 3WGGA 3W8DA 4R9RA 1FVHA 2ZRDA 5KIAA 3W3AD 1DKLA 2ZWAA 2OD2A 2JJ1A 3SFTA 3TLJA 4DLNA 3W5SA 1R0YA 4C7OA 4N8SA 4TQUS 4B76A 4EMUA 1LBTA 2HADA 4Y2HA 2ZXUA 4JQSA 1WD5A 1TO6A 1FFXB 4H15A 5LXTF 3ROGA 1WB9A 3NDPA 2NIPA 2I22A 2GJ9A 3H5WA 4UCWA 4QFDA 3W5VA 3G0HA 1BE0A 3GJZA 2WWVD 1CQIA 2DETA 1SQGA 3IUQA 2AR9A 1AOXA 2P9CA 5EKXA 3R3VA 1HGXA 1PD0A 2A1UA 4HVLA 2QENA 3R0XA 3AESB 1UDCA 5A1TA 2H85A 3AZPA 4NQRA 3THWB 5JC1A 3F6YA 1B0ZA 3BRQA 5LZ8A 4YNBA 1NIPA 5JDCC 1Y6QA 3C8UA 1H66A 1I1QB 2J3JA 2YY6A 3ZV6A 2V96A 1BDBA 1JLKA 1EGMB 1QJCA 3GAMA 3NORA 4L8WB 3RSQA 1VG8A 2P9BA 4HWSA 4F86A 4XUEA 3L82B 1C4OA 2VJAA 3VR1A 3VNRA 1O54A 2H1VA 4XDGA 5JAQA 3KM0A 5A7GA 4KQ9A 1N8TA 2AC4A 2IYAA 1CEXA 2JVKA 2XF8A 4KQ2A 5P8WA 3V8RA 4EHLA 4ZOAA 1A2OA 4C29A 1BS2A 2VYFA 1E2EA 2D00A 4HDKA 2FFJA 1FMJA 1ZXXA 3EVTA 1TYZA 4XASA 3Q5GA 1WPXA 1TOAA 3GMTA 4M76B 3DLHA 1FXUA 4P31A 2PFGA 3B9RA 4L07A 1NUSA 4PGHA 4ZVOA 1M0WA 2XCLA 2RGUA 2QS9A 3DBHA 4UM8B 4X6UA 3SICE 3V4ZA 3K0KA 4G5GA 4P6VF 5ICMA 2C9BA 4DCCA 1ILWA 2QUHA 3I6BA 4CIXA 2JGRA 2OKCA 4WA8A 3AHEA 3INGA 3TNFA 4TXHA 1N5KA 2XDYA 3CLTD 4JEMA 4A91A 1KRHA 1H2FA 1UBFA 1WXIA 3WYNA 3H0EA 4ZGWA 1NX6A 4LVNA 3DUFB 3SBXA 3UJ8A 4INJA 3LAWA 4TPKA 3FNRA 4LI0A 3OSUA 1L4BA 2COUA 2XWPA 4FXPA 1NN5A 2QQGA 3H4TA 3OLYA 4PAWA 3VKWA 1LF0A 3FRHA 1KPHA 1GCIA 3ISJA 2X0NA 4LQCA 5T5QA 4YJGB 1W85A 1CNFA 2R8RA 3BMQB 3K70D 2JL1A 2QIPA 2C95A 3P0EA 3ET4A 3S8MA 2QNRA 1UPXA 4QUBA 3RWOA 4G0WA 3GWZA 3NCHA 4CEJB 4I2NA 4CG1A 1T6NA 4TRJA 4UUBA 1UJ4A 1MOPA 3ECAA 1TA0A 1Z13A 2L82A 2XB4A 1K97A 4CM8B 5CA0F 2C78A 1PZFA 4LRUA 2OFOA 3WQRA 1MJ5A 1SH7A 3HKCB 2QN7A 4CODB 1H2AS 2W2VA 4GUAA 4BX8A 1KR2A 1JLHA 1EK6A 2COKA 3MPUA 3N0TA 1GAWA 2PWPA 1G18A 3ZOKA 4C4XA 4EHAA 3ILXA 3ADCA 1H05A 1LVHA 1Z3IX 2PCLA 4D25A 4ZKDA 1SWVA 1W46A 4GEGA 1P91A 4J8PA 2OVBA 3ZQKA 1GHTA 3DMRA 4CT4B 5L3SB 3OAAD 2IHUA 3BEOA 1RXYA 1IQUA 5SY9A 4TL6A 1YVDA 5AHWA 4ENWA 2HK9A 5KVAA 1JJFA 4ONEA 3BFJA 3EDMA 4WLFA 4EATA 1IAQA 3V8VA 5AVQA 4XX0B 1W5AA 4AO6A 1W76A 3N5CA 1RACA 1G3QA 5FULA 3S0JA 5AVTA 1E9AA 1P2UA 3CLRC 4R01A 3MWEB 3EXFB 2XUZA 4AXBA 4BNGA 2ZJ3A 3DXFA 5B6JA 5KU1A 4I55A 1JG6A 1YT5A 3MVEA 1AHHA 1HZZA 2C7BA 4YJ3A 3WYFA 1MABA 1VMEA 4S1VA 5BNZA 3UC9A 1JILA 1Q17A 3JYLA 4GSYA 3RK0A 1X7DA 2IW1A 2V5VA 8AT1A 3LYUA 1T1IA 1TPZA 3G85A 3KDPA 2NSLA 3D6JA 3LNCA 3QYFA 4GR5A 3UMCA 5BY2A 3PYMA 2WW8A 3OLXA 3I39X 3WOHA 3ZU5A 1GGFA 2F67A 1I3KA 4GOOD 4D3YA 2DC1A 4IEFB 3AR3A 4BNWA 2IYPA 1BJKA 3MHPA 1Y34E 4X7MA 4BUZA 5FOSA 4DXDA 2HA6A 1P0MA 4LW8A 4ZC1A 2DFVA 3BGVA 3PNVA 1ULTA 2AK2A 2O59A 3HDYA 3H9UA 2OXEA 4QG3A 5JZVA 5IM4F 2DTDA 3FUCA 4B79A 4Q1DA 4TVOA 1N2CE 4PLPA 4Q5IA 3HGTA 1B6TA 3PICA 4DTCA 2Q45A 2PZJA 2XVAA 3R0JA 1ESZA 2FQWA 3JQBC 1I7LA 2HIGA 3QVSA 1KAGA 2P6NA 2OAGA 3KV1A 3LLUA 2JA1A 2OCGA 4MA5A 4NESA 2QU8A 4E2FA 1G55A 1BDIA 1A95A 2QE7A 2V74B 2JEYA 3QKSB 4P0PB 4OD0A 3FR7A 2WSYB 3FKQA 1DOAA 4OYHA 4AWBA 2D7DA 1R9JA 2HCRA 2OHIA 1U94A 2P3LA 2QSYA 2JASA 2PHZA 1C3JA 2PT6A 4U7HA 4XPIB 1H8EA 4IWNA 1DDGA 5T8KA 4DANA 2HD4A 2PRZA 4RTJA 4TXNA 3UWKA 4F9FA 3IMCA 1X7XB 4RGYA 3MW8A 1U81A 2OCPA 4D8YA 1N2EA 4AF7A 3KDAA 2PD6A 3KUXA 3IVCA 4Q7JB 2C31A 2ZVQX 2PVSA 4J1TA 1FFSA 2C4TA 3AY7A 5CDUA 5AJYA 4D57A 4YRNA 3BGWA 3CRZA 4XIFA 3LVQE 2P78A 4FWBA 4B34A 5A4IS 2W5UA 4KFTA 3IKTA 3K5WA 1M1XB 4XVHA 1H6AA 1POWA 3LPCA 1W5SA 3LHDA 1RQPA 4MRPA 3C1TA 4GH5A 4GUDA 3KXKA 4KITB 4BS9A 3MRSA 4QODA 4BC1A 5GGYA 1PGJA 2OCDA 3TTYA 3NEAA 4BLQA 5BWBA 1AB5A 5LC1A 2B8WA 5FWYB 4DQVA 1F17A 3OESA 4EKNB 3KSBC 1VMAA 5I01A 4BQPA 4UU8A 1XK6A 3QNUA 5G4KA 2NU9B 2FMUA 3UHPA 3NHZA 4RCVA 3N28A 4H4DA 3KAJA 4HDSA 4KW7A 3U7QA 5MHTA 1RADA 5ECGC 2VNAA 2ZJ4A 2FZEA 4Q82A 4G36A 2GXAA 4K9DA 4R40A 1NM5A 5KJ6A 1V5EA 3ICOA 1M74A 3A0UA 1AN0A 2Q5QA 4BMPB 4RF4A 4EY6A 1O95A 5IN4A 4BPBA 4AWXA 1DEOA 3ZDFA 3NBUA 5BN3A 3DE5X 2OB2A 1Y7PA 1Z4IA 3ABQB 3E1SA 5I7OA 1PR1A 5DGXA 2F1IA 1GUZA 3RJ5A 3IC5A 4A2WA 2AFHA 3QY9A 1PV4A 4FFMA 2R1UA 2RGCA 2X9LA 3CFYA 4M9XA 2VRNA 2JCXA 3OMLA 4HB0A 2IYWA 1EA7A 4NMLA 5DFAA 2FWBA 2V7QD 4RTPA 3L1IA 2WTXA 3OOHA 3SNKA 2I99A 1FZQA 4BQQA 4OP1A 4EW6A 4Y6GB 1OHHA 4DR6B 1AQ6A 4C0WA 1LLDA 3UKDA 4YUXA 2IYZA 1RKUA 4K9RA 3AV0B 2NOAA 3GJYA 4DREA 1JAXA 1J5EB 4E0BA 1B8NA 5HK9A 3VR5H 3ID6C 5BSWA 1A7UA 2E9SA 3EFOB 1GPNA 5ICGA 1VXOA 4HDMA 4AZ0B 1ODSA 3B1XA 4DIKA 1UEIA 5BYAA 3Q9UA 2FPKA 3E22B 3M4JA 3DDWA 4QOHA 1QRDA 4WKOA 4E88A 4X62B 3LQQA 2OFPA 4JUFA 5J4HA 2YRWA 4A6EA 4NG4A 1JDBB 1G2QA 2C5FA 2O2IA 3HV2A 3PFIA 1DDOA 5FJIA 2PZ8A 4V3CA 1DINA 3K32A 4YAKA 2DAPA 5I7FA 3PCRB 3VAYA 4CIVA 2GTPA 2Y66A 3FTDA 2Y0BA 4JBYA 4U2BA 5CXXA 4AJOA 3C3DA 3H3FA 4NENB 5B58T 4B5KA 4BB9A 5JS1A 1TT7A 1U8CB 2X4GA 4Y2SA 4WVFA 5KSOA 3E48A 2JVJA 3X1MA 4QXAA 3F90A 3H19A 4M8LA 4BKPA 2Q8PA 5JAMA 2D7JA 5BWMA 2RIPA 1E1CB 4TT3A 3OF3A 4MTLA 3WGYA 2RGEA 2V8OA 4EIWA 3U1TA 3MJRA 5IKMA 1KVRA 1C0EA 4GOKA 2WTBA 3R7SA 5C46F 3A6HA 4G9EA 2Z43A 4K9OA 3S4YA 3ZCUA 4D9NA 1NQAO 1OXUA 4M9QA 1R18A 4EA6A 2YS6A 4HGOA 3QX7A 1G42A 2PZEA 1WM1A 1YR7A 2YQZA 1WMFA 4LYEA 2G07A 5B4VA 5CVEA 2FN8A 3DDSA 4M1KA 1BXGA 2VJDA 3VYSB 3IGFA 3O9ZA 2JGAA 2FLVA 2EJVA 4M1OA 2YQ4A 1ZLYA 5IC5A 3ZE0B 5C4MA 2W6ID 3EH1A 3PLAE 2O0LA 1Q0HA 1KK1A 1OROA 2XGSA 3CNHA 3V7FA 3L8DA 4C2BA 4DNPA 1AXRA 1OLUA 3OPYI 3KEOA 1G60A 1LK0A 4MWOA 4B6PA 4NABA 1E98A 3CLUD 5TGZA 2A3NA 3I23A 2GPBA 3EC2A 4DLAA 2FW7A 4URWR 1PRYA 2H9YA 1LC3A 2HRBA 3RIYA 2C3UA 1JA0A 1E69A 3IEUA 1LZKA 5J5AA 2DUJA 4EJ6A 4F85A 3ER8A 1GAEO 1Z0JA 1EUDA 3FSJX 3HDGA 3MCZA 4FMCB 1KI1A 1OH6A 2AI2A 3P9SA 2AJLI 3LVFO 3COSA 2XXBA 2R47A 3BMNA 2C57A 3GGOA 2ZRIA 1OX4A 2GRUA 1NPDA 2D8MA 3ONFA 1BAPA 1UP7A 2MYTA 5CVCA 1GG8A 3OD1A 5IUNC 1WNTA 4GAEA 3LH5A 1HORA 4MW4A 3PXEA 4UFNA 1E3MA 1THMA 3KJGA 3R8CA 3LGSA 1YJ8A 3VU9B 3O1IC 5JJCA 1FS4A 2CC2A 5IJ0B 3LOUA 1Q3KA 4P32A 3UUFA 1R0LA 4IOKA 1KL7A 3GL9A 4RPHA 2OECA 4TWRA 3QOWA 2Q9CA 1KJIA 3T4XA 2HU8A 2QTFA 2PYZA 1LSOA 3JZFA 3QHPA 3URKA 2J4FA 2VWQA 5M2QA 2O8BA 1XZFA 5TV2A 2JZNA 1WBBA 2PBRA 1SURA 1WKCA 4UHFA 3TSOA 1KYWA 4U5XA 3J81k 3HJBA 2Z9DA 1FRNA 1NVWQ 3F9CA 3JRXA 1QGAA 4H3KB 4CMHA 2FR1A 4YAJA 2WQ7A 2R5NA 3ZNPA 3MC1A 4BXOB 4GL4A 2GAJA 4MVJI 2JCGA 1YNOA 1NXWA 3UMBA 4LQLA 1BG6A 3ZCTA 4I8IA 1QYDA 4GOLD 3I8OA 2QRVA 1T5DX 1YB4A 1XZDA 1ADYA 3M5DA 1JUDA 4PVDA 3B6MA 4LPKA 3AYZB 4QU5A 1F5SA 3VZPA 4CQLA 5JATA 4PO1A 3AXTA 1PP4A 3ESXA 1FFDA 4QOSA 3GCZA 2O0MA 5IT9A 1L5HB 1X3SA 3TW8B 3AEXA 1IXRC 5JDIC 3ROTA 1FQKA 3E4DA 1UFRA 3PLRA 1E2NA 1SD2A 1I24A 4UHBA 4WRRA 4LJRA 2VJBA 4PG7A 1OWMA 4IQFA 3RSZA 2J3KA 3VJKA 1E92A 1GZ4A 3A1UA 4B3XA 1Z8DA 4A8JB 1EFVB 3EPPA 4Y0NA 2AR0A 2W37A 3LY9A 5H1YA 5HZHA 1LLFA 3KJZA 2P6MA 3GT0A 3R0VA 2I87A 4XVRA 1K4MA 4JJ7A 4XW2A 2Z2XA 2QOEA 1XVLA 1UBSB 3U31A 1SCNE 3UAVA 1FJGB 3NI2A 2OOSA 3ZLUA 2FN4A 3RT1A 4BGEA 1E2BA 2LE0A 1CR4A 1SVSA 4LHYA 3UIEA 1JYFA 1QHYA 2PT7A 3VZQA 4LDZA 4XGNA 3OOSA 4IDQA 5CJJA 2IPNA 2VHTA 4G67A 1JBKA 3ZCPA 4GI7A 3TSCA 5L3VA 4RDHA 3TXXA 4FLEA 4K2AA 1H4SA 2XCUA 2ZB2A 4IBOA 2X2OA 1JALA 3WRXA 1N5DA 2H29A 5CX1A 3SSOA 4CV3A 1LRKA 3KEQA 2IHZA 1OC2A 2ZTHA 4J90A 5FWXB 4AJEA 3SQWA 3MHTA 5C8DA 2WICA 3JSAA 4RY2A 1NULA 1OLXB 1VE1A 3B1ZA 1IZ7A 2EEPA 3PFKA 1TD1A 1M34B 1R15A 3V1NA 4XD7D 3RU2A 4E5PA 4BJHB 5HHTA 2FWNA 1Y48E 1SZCA 3KTAA 4CMJA 1M3SA 3OIWA 2Q3CA 2I9KA 1NUUA 3KQWA 3T7CA 3LDAA 2QT0A 4EPXA 3OQNA 1E5QA 5K20A 1HYEA 3I04A 4TM8A 1DXQA 3OZTA 2DX7A 3D1LA 1W4LA 1IQPA 1MJFA 2WJVA 1R5JA 3LIIA 1XRMA 4L0MA 4P1ZA 3ZZNA 1JDSA 2OENG 5DI9A 1DAPA 3B2NA 1BHQ1 3R40A 1H2WA 1UPCA 1P80A 1GNRA 4HQRA 1AMOA 4B17A 1LPNA 1P5ZB 4N8DA 3RDPA 2ZSBA 4C1BA 5A2GA 1L6RA 3SVZA 3EG9B 4RYLA 1CUVA 3WFIA 1OKKA 2IEBA 1EFHA 4UHJA 4E6EA 4LNUB 3KQVA 4YCBA 3JQCA 1XQXA 2BJVA 5JD3A 5LYYA 2EC5A 1WP4A 5H9WA 3NOVA 1DBVO 4FJ0A 4GX5A 2K5UA 2ZBQA 2XWSA 4ZV7A 2W6JD 3P2IA 4D74A 3NBZC 9ATCA 4BZXA 5BN4B 4JVOA 4R1UA 3RFFA 3GO4A 4FHEA 3GZNB 3UMFA 4DMCA 4EFLA 4ND5A 1N8KA 1U7ZA 2PXHA 3V3TA 1ZI8A 5SY6A 2RGDA 2C8LA 1ADFA 4JHXA 3CQ9A 1OGJA 1Z5UA 4BZZA 1KQFA 1Z5NA 3DW3X 2B1QA 4O4LB 3AHFA 1U4NA 4XJTA 2KE5A 2UZ4A 1BU5A 2QM8A 3HO6A 4HYYA 4AJIA 1TK2A 3VXKA 4M2LA 3UMVA 5EMHA 5ALVA 5JCJD 4FHFA 5KYYB 4RULA 1WUYA 5PGMA 5BT9A 2X13A 1XYVA 2GI4A 1OXMA 3NTUA 4D79A 3HJNA 4GSKA 2HO4A 2AHOA 4HEA6 3RHZA 5EOVA 5IDYA 1TECE 1J33A 1AGPA 1VJCA 3BWYA 2PXAA 3P32A 1QV7A 1U7DA 3KCQA 4TL9A 3CURA 2OWEA 4MHSA 4AY5A 2UUAB 4V03A 4D3XA 2YXPX 1TQ2A 2V6MA 3DT9A 1KIFA 3KXLA 5FBVB 2IH2A 4CKYA 4CM4B 1CUEA 1Q91A 1ZXLA 2Q9AA 3BH6A 3C6QA 1SK8A 1TIPA 1RP1A 1ZJ4A 2E3JA 2E4UA 1Y5LA 2CUZA 2PSHA 5TRTA 3UJ3X 2AOUB 5DBOA 3GHHA 4Q4HA 5KMGA 1TADA 1U02A 1Y9JA 2CKDA 2F3UA 3AEYA 1Q0UA 2AD5A 2JGEA 4K8RB 1QVRA 1ACJA 4F3KA 2NYRA 1TYAE 1W5FA 1NOJA 2BHRA 4D97A 3K2IA 4B8ZA 3UTCA 5KNLA 3AFOA 2EU8A 2I3GA 5MF6A 3H8SA 5JCXA 3SM3A 1TVKA 2FW9A 3HDHA 4M0CA 4ID9A 1A1SA 3IIIA 3SEQA 1PR2A 3L0PA 5L3RA 2Y3IA 3GCDA 2EZTA 2REQA 4JBNA 2WWRA 2VR1A 4XTRA 1AHPA 4MUHA 1U5BA 3B6ZA 5ALYA 1VPDA 1U5CA 4CEHB 5H8WA 3HLTA 2BFMA 2CHFA 1E3TA 5K3FB 3PHCA 1TM3E 1OPRA 2QVZX 3M0EA 3HZHA 3NNDA 2BGTA 4QUDA 1JYEA 3EGWA 2I5PO 1QZXA 2ARKA 2JFPA 3RU3A 4BNNA 1WOYA 2PGLA 5BR7A 2OQRA 4ACAA 4AZ3A 1SFRA 3PJRA 4WV3A 5F5NA 1C9JA 2WWHA 3GLIE 2CVZA 4E1AA 4YCJA 1SIBE 2ATVA 1SKYE 2FP4B 1Z68A 2JDID 4O29A 1DKMA 3WKBA 1IVNA 2Y6UA 2Y4OA 3AJ8A 3ED5A 4B46A 2QTWB 1ESEA 2QBYA 1WF3A 3ZDXB 4NL4H 4OHUA 5I4IA 1JIUA 1XALA 4RPGA 1J4AA 2VXYA 3K7EA 4LRSB 1L7DA 4YRLA 2EL7A 3TD2A 5K4HA 2DWCA 4RESA 5JFTA 1YS6A 2R6JA 4GECA 4J1TC 5EKDA 4FYVA 1GR0A 5BQ3A 3IT3A 3OUZA 5CT9A 5DNVA 5C81A 2NTYC 4FPXA 1VPWA 2PNFA 4O1MA 3V8BA 1K5PA 3VPAA 1R8QA 2XF2A 4AUMA 1RQRA 1ETHA 2UUOA 3IMFA 4HNAA 2ZSUA 2YHSA 4AAYA 3GMDA 3EDOA 5KWIA 1UP6A 4MR8B 2OTCA 1V11B 3HGQA 3QFRA 4KB5A 3RFUA 3JAMA 4XQEA 2EBUA 6ABPA 1HLGA 2KLHA 1E8NA 1N25A 3C16C 4MQ6A 3PLNA 4BMNA 2BWJA 3JQRA 3WBJA 621PA 1PKXA 4UUNA 2WAXA 2EXXA 1P19A 3AOEA 2RJ3A 3FHCB 3IHWA 3NGLA 4M7OA 1A77A 4YPOA 4OQLA 2EJUA 2KYRA 5BSGA 3I6ZA 2I3ZA 5YASA 1ZD2P 1H22A 2J3QA 3S2IA 3MJSA 3JCZA 2QU7A 1NM5C 1RPAA 2PD3A 2W2KA 4MWZA 2VDJA 1GG5A 4PO9A 2VNSA 3RSOA 4XI9A 2BH2A 2Q4OA 3LM8A 3EIOA 4Z0PA 1N2ZA 1I36A 5FOQA 4LRYA 3KTOA 4AURA 1O95C 4UCFA 3ECSA 4BECA 4XX1A 2PX8A 1K3UB 4R9NA 3HY6A 3QTTA 3CA8A 1TJ3A 5JNUA 4RCYA 2WFLB 4OHZA 4FW9A 3BZUA 4W1SA 5GZ3A 1FFXA 1YR1A 4WDRA 1NVUQ 3E5NA 2HR1A 4HV4A 1KDOA 2EHDA 3EG5A 2C5EA 1IM2A 3ZI4A 4LRXA 3ZKAA 3U1BA 4IZIA 4ZVRA 4EUFA 5AW7A 1XNJA 5FDFA 1JQ3A 1Y9EA 1CE8B 1BFUA 3AESA 1Q3HA 3FAZA 3INTA 4QUIA 3OKCA 1E9DA 3GRPA 3JZMA 4HRAA 4MULA 3DZDA 1P2VA 2VOJA 3GVIA 4GMGA 3CVYA 4H0FA 3AJDA 5CIQA 1KP9A 2OHGA 1BGWA 3W5AA 3AR8A 4D8TA 1ZIOA 2WD8A 3UYKA 3MT9A 1PDWA 1XWFA 4GS5A 5EE1A 2H2GA 3WLOA 4KRGA 4ABYA 1NR5A 5DNUA 2VSFA 2PZFA 1C80A 3P7MA 1SU8A 1J07A 1MX1A 2E1PA 4J0EA 1A9PA 4FW8A 4OIMA 4QHYA 1EUYA 3ITEA 3M7IA 4OHVA 4EUEA 1A2BA 3Q3CA 3PF8A 1N0HA 3BWBA 4RIGA 2O8NA 4AJJA 2XKJE 1E4EB 2P30A 1FDUA 3B38A 3E9EA 4JU9A 2FJPA 2QGNA 3DVLA 2DUWA 3IPLA 3EODA 3R3ZA 4OBWA 3TR6A 1RHQA 2DCUA 3HU3A 3MN1A 4JVNA 4AKTA 2L69A 4S0ZA 1GPKA 3KOWA 2JG3A 2DEUA 2W2MA 4S1NA 3QU2A 5CH3A 3ZTWA 1UPUA 1SELA 1U3DA 2H2WA 1GL3A 3OTQA 3DEKA 2JH3A 4HDQB 4F84A 4JBLA 2Q6LA 2IXDA 1AQJA 1DFHA 1FDVA 1ZW1A 1B74A 1W36B 3DUFA 3UJ6A 3UH0A 3W9BA 2WIBA 3FUVA 4HNVA 4D6YA 3VTAA 3EQ9A 1QIEA 1RPTA 4EGAA 4K6CA 4U63A 5I9IA 3OIVA 1P8JA 3PRJA 1INLA 2FB9A 2IITA 3ANLA 4RJ2A 3W5DA 4E70A 4YJGA 3BMQA 5CNKA 4C06A 1WR8A 4D44A 5EIHA 4EFMA 1DHTA 3WOVA 4RY0A 5L7TA 1O96B 3HJRA 2JF0A 3MIZA 1M7HA 2CXUA 2YZ2A 1IB6A 2GEFA 2HM7A 3AI7A 3NC1C 3PE6A 4CEJA 9LDTA 2QTLA 1LLUA 4ND6A 4CM8A 3GRKA 4LX8A 4QGHA 1NT4A 5EUMA 1BDHA 3NU1A 1Z6QA 4G41A 2PUDA 3HKCA 4QDTA 1BN6A 2FJUA 4QKQA 3VZBA 1U0BB 1QRAA 3M70A 3P2YA 2NVUB 5JH7B 2YJ4A 2Q5CA 3G0GA 3A1VA 4CNBA 1RLJA 3LQRA 3RO7A 3D6HA 3W3AH 5L3SA 1IM5A 1WMDA 1GLGA 2YBEA 3BZBA 4L85A 4S12A 2P67A 1NVVQ 2REXB 2JPDA 2NO4A 4XX0A 3SR3A 2BFCB 2AF3C 1VCHA 4OGGA 1N6OA 3GRVA 4B4VA 3FOCA 1X1BA 3MWJA 1DAHA 4HNQA 1YAHA 4ATNA 5I7VA 2PZAA 3MWEA 2WF6A 3EXFA 1U2GC 1OTXA 4TWIA 3WZ2A 1OW3B 1SOVA 2JHCA 3LBNA 3ZY3A 1MW8X 4PF1A 3M83A 2DZDA 2XGMA 3QOXA 4YJ3F 1VL5A 5LYJA 3SS9X 5JXHA 3ABZA 1Z4PX 2ZROA 2PSEA 2PUEA 4I4CA 5B1IA 3U26A 1W49A 2C4HA 2C1XA 5BXQC 1VZ2A 4M0MA 4BVLA 4KXXA 4QXQA 2SBTA 1N5IA 5K3CA 4E14A 4DA6A 4B6GA 3ZN2A 4YYZA 1WAMA 1P9WA 1M6YA 2R97A 4Q3NA 4LHSA 3LCMA 1V4BA 2AC7A 4UCXA 5JSHA 3BCHA 3C8HA 3I2GA 2H11A 2ZPAA 1UH5A 1VL2A 4N3AA 2BR5A 4HZGA 4RHYA 1LTHR 1TM7E 1FQWA 1O9HA 4R2JA 4MJ3A 2YMMA 4KV7A 2G08A 4ETIA 1A5TA 4MW6A 4Q7LA 4KV9A 3RIHA 4WBNB 1XTTA 1VRVA 5JWOA 1KAQA 1RHMA 4KO2S 2FLKA 3C4QA 4RV9A 3DFKA 2J33A 3OI7A 1EP1B 1U7UA 1BH6A 1EWVA 2RHGB 2RGWA 2ZS7A 3HN6A 4WLVA 3ZS8A 4J4BA 1KRWA 1ZJ5A 4DT1B 3HBLA 1E32A 2WYHA 4EHFA 5CLGA 2JLYA 1E7MA 3QKSA 2X1LA 1WQ1R 1BX1A 4EVIA 5AW0A 5GVRA 4YRJA 2HHHB 1I3MA 2FY8A 4KTVE 4Y2GA 3H18A 3UJAA 3IMEA 1NATA 2FW6A 3TLXA 3IAFA 4IFIA 4XPIA 2QZPA 3K4QA 2VHVA 1HLFA 4CDRA 1EB8A 5EHZA 2FDXA 2YOHA 3GC6A 4XIYA 1BHO1 4U0JA 4R98A 3RASA 1KARA 1X7XA 4EY5A 3D5TA 3A2MA 2IY7A 3VSEA 3HR4A 1E1YA 3KLOA 3FVVA 5B6PA 4XIIA 1V7PC 3TRHA 5LZ4A 4ZTUB 3CRNA 2VRWA 3QLTA 1RC0A 2ZCVA 4OP3A 4UU7A 2M98A 1C8VB 4KXWA 3VR6D 2NVWA 3IEKA 3W8RA 5J3JA 2Q6KA 1IQRA 3KQYA 1VKRA 3KUUA 3CWCA 4HFNA 4ALNA 4ZGGA 3RS8A 4UVIA 5KKAA 3FVTA 1N7IA 2FPUA 4O3MA 2K87A 3IBCA 1I0IA 4NE2A 5BSVA 2XOXA 3KZNA 4R1QA 1Q57A 3TTVA 5LOVB 4F97A 2BTEA 1KDPA 2VCEA 1RLMA 4KQWA 2ZBRA 1DDIA 3TCKA 5JJBA 3VO9A 2C99A 5FWYA 3OBBA 2IXGA 4LZNA 5ED0A 3C97A 3PPXA 2NU9A 3CO5A 1LDNA 3U09A 4J2OA 5BSRA 2D1RA 1SXJB 4JYMA 4B82A 4EZBA 3KZOA 4UHHA 3R6GA 5JUWA 4N9QA 1W88B 4ZCRA 2C2ZA 4I14A 3WRXC 2Z95A 1U2DA 1W0CA 1BMFD 2A3RA 2FZCA 3ETDA 4HGNA 1OFGA 5KTTA 4MMZB 4KLNA 3V1UA 4H2DA 4D8UA 4OMFG 2R6GA 2OQIA 1BQ3A 4FCTA 4A3SA 3KQOA 2C1ZA 2WM8A 1QO0A 1UKVY 2CVOA 3FM9A 2XPCA 2HXSA 5DBGA 3SXPA 2V7XA 3AIMA 4ALLA 1PK7A 4C4AA 2XCTB 2GOYA 1UBKS 2P9EA 3MAGA 3GFPA 4BBZA 3EUEA 4JK3A 5CFQA 1USKA 2WHEA 4IKPA 3STWA 4XYBA 2OBNA 2JNWA 3MLBA 1JKJB 1LNZA 3TD6A 3KFLA 2ONZA 1UBCA 3KWJA 8ADHA 5AJHA 1N36B 2ZEJA 1ZGHA 1JQJC 3EASA 3JU3A 1Q7GA 3ESAA 1U4SA 4YP5A 4F3TA 4G0OA 1QF9A 4BO1A 5CT4A 1JSLA 3EFOA 4LISA 2NO1A 1QO7A 4AZ0A 2XNDD 1WUTA 4OLJA 2RH9B 1DXOA 4HNGA 1FUUA 5AVUA 1GG9A 3E22A 2H54A 2QUBA 4AC9A 3T7EA 2O8CB 3ZX5A 1XROA 1V35A 3LDUA 4RD2A 1N7HA 3WXMA 1GCOA 1W0KA 2GMWA 2PQ2A 3ZG6A 2XOEA 3GJ6A 2HL6A 2X3UA 4AS2A 4MLCA 1DX4A 5G53C 2AUTA 3UTDA 4GLLA 1QYXA 2AOXA 2NV2B 4KZKA 3ZWKA 3L6BA 1JT9A 4KMOA 5DYIA 5DTEA 4EX7A 1XCMA 4YCLA 3VH2A 2HPHA 5AVRA 3DFIA 1YAJA 2GTHA 3GJ8A 3AO0B 3NJ8A 4NENA 4V0SA 3IDQA 3R6DA 1MU0A 1UJCA 2WUWE 3FFAA 4GBGA 4PAQA 4S2UA 5F2KA 4IUYA 4I4LA 1GPDG 3U7FB 2GBCA 4KJXA 1S8FA 1J9GA 3AGPA 4KZPA 5ECDA 1TZCA 2I2XB 2TYSB 1U8XX 1CUWA 3BA1A 2ZANA 1YUMA 4HPWA 4L8VA 4L4RA 4NBNA 4P93A 3TH5A 2OGZA 1VGRA 3FF1A 1N3BA 3DB1A 4M0DA 1E1CA 1CZUA 2BVNA 1JMVA 2EKPA 5FUXA 5KVCA 3D31A 1F14A 4P08A 3ODPA 1D0SA 4JVLA 2OFFA 4CYMA 1CY0A 1TJ4A 1QUFA 3E9ZA 5KTPA 1MOSA 4DC9A 3TF5A 4NC9A 1JZQA 1NDQA 4QYTA 4XR4A 5BVGB 3N2ZB 3AR6A 2ODAA 4PZ9A 1E63A 2BMWA 3M6VA 3KT6A 1WCXA 4O4JF 4C2AA 2EQ5A 1RWNA 1ZMRA 3ZJYA 2NPIA 4MIKA 5G1OA 5DMHA 1PLKA 1L5ZA 2MSKA 2JJQA 1VGVA 1GPWB 3E7PA 3HJUA 4DFDA 2O5VA 3OKFA 4FOPA 1UKBA 1Y5MA 1FUIA 2JLBA 1O1YA 4IGAA 4MVJP 1WBJB 3NNSA 1WWKA 5DNDA 1UPBA 4BU0A 4TX1A 4BJ1A 1J0EA 4TKLA 1JWLA 3R3XA 4WJKB 3X1WA 4ARVA 2QN6A 4C88A 5DBEX 4EI8A 5IAJA 1YVPA 1J49A 2PV7A 1ZGZA 1QMPA 2KQUA 3B1VA 3RTAA 4LGYA 2XB2A 1F4VA 1EDOA 1AK2A 2KMLA 4MKRA 4WOKA 3FCYA 4UOZA 1L7QA 2Q50A 1N5RA 4PE5B 1V7CA 1KZYC 1N75A 4HTAA 5JR3A 2PSJA 4G2NA 4LGMA 3VV2A 3FMOB 1AGYA 2R6R1 4XLZA 1CLUA 2WZCA 1G0OA 2HBRA 3FIUA 1SPXA 1ESDA 1ZEMA 1GQQA 1EVLA 1XV5A 2VLIA 3ZD9A 1DP4A 1WHTB 2J9ZB 3RS7A 2FFAA 1VOTA 2G1AA 3G17A 5TX7A 2WPDA 4ZT6A 4AJKA 4DMLA 1QOZA 1UODA 1NKVA 2IXFA 5FX2A 3L0YA 4PS0A 2H5EA 3WK6A 4H0NA 4U7JA 4QL3A 1Z6YA 3K72B 3OZWA 3JQGB 4JQOA 2B4TO 4WKCA 2W70A 1TT5B 1KY2A 3YASA 3VU9A 5EP2A 4L0CA 2FMTA 1AUPA 3QYJA 3NR2A 5JVDF 3A6PC 2VQ6A 5IJ0A 4I4TB 1UAGA 3P19A 3DLCA 2DG2A 3AETB 1Z45A 3PQ3A 1MO4A 1NY5A 3SDBA 4CTOA 2ATCA 4BU1A 4X3OA 3I9JA 3PQ2A 5ADWA 3A1EA 4FKBA 4NARA 4V0QA 4NNJA 4IGKA 5DCWA 2FF7A 2PMWB 3QFFA 4WNCA 3LY7A 4RL6A 2R7AA 1S2MA 5AM2A 1C2YA 3CH7A 2Z57A 5LZ5A 5F7OA 5CPBA 1PJTA 3ZK7A 3JQAB 1QB7A 3F6CA 2ECPA 1O0BA 1AX9A 4GZ6A 3ZDDA 2ROQA 2C2KA 1Q50A 1IHDA 5F52A 1BCRB 1RHJA 2C4VA 3PGMA 2R8OA 2IYFA 1SUEA 5E3JA 5BV1A 1RVDA 2I7DA 2XQJA 4BXOA 1J2EA 3ORYA 2H3EA 1OAAA 1WL8A 3AB8A 4PONA 5ALIA 1FP1D 1ZAYA 2P3QA 3ZY4A 2H0AA 1QG6A 3FROA 5DASA 5A02A 2X42A 5KSPA 1J7JA 1E9CA 3QLUA 4GKVA 4DNFA 1CDDA 5DCLA 5EMJA 5HRAA 1EXVA 4LHWA 4AZVA 1KNXA 3K5HA 1NNI1 2J09A 1JDJA 3X3HA 1FQJA 2CKMA 1YONA 2E4YA 3QBEA 3AOEC 4HWOA 4KIWA 1FP4B 2ZSIA 3OJEA 1MA3A 2O4CA 4WCVA 5GAJA 3AINA 3SJ7A 4DYDA 3G6KA 1V8DA 2XOKA 4JI5B 1L5HA 3TW8A 4GI3A 4HJXA 4IIXA 1RNLA 1XQWA 3AU8A 4P7JA 4R68A 3THRA 5C1OA 4JUBA 3H9BA 4HFMA 4BMZA 1XNGA 4X1OA 4A2QA 1W8IA 1MD9A 5JXWA 1HOTA 2QVBA 4A8JA 1EFVA 3MWLA 4HNTA 1V3QE 3PJEA 2V7UA 2IY8A 2IUEA 5BMVB 2C4KA 5BRJA 3KXDA 1RLUA 3TX2A 3USCS 4URYR 1TJPB 1WNFA 1EFDN 1W5EA 3H5TA 3LPDA 3OQVA 4P4GA 3PXGA 3U48A 1DIBA 1HDXA 4KVFA 3ZGYA 1LJ8A 1P6QA 3G2NA 3T99A 3DD5A 3KYDB 5F73A 1IXZA 2F1RA 2BE9A 2YV4A 3JQ8B 5ESWA 1V8FA 2RHMA 4UU1A 1K2WA 3ZD7A 4MWGA 4G0VA 4ZYXA 1ZO8A 2Y05A 3IDSA 1DEKA 3I37X 3NHFA 3KKZA 1ECJA 3PXBA 4GX0A 4XUCA 2FSGA 3P9XA 3C6MA 5CCDA 2R60A 4IXWA 4BL5A 3EDQA 4MKZA 4OUDB 4ZJUA 3DFMA 2XA1A 5FWXA 2AZXA 2B6HA 2HNBA 4MW9A 1GKUB 4W5RA 3G89A 1QFXA 4GICA 4MMYB 3NJ4A 3DCJA 3N6VA 1GWNA 1OLXA 3BICA 4ZI7F 1M34A 1YIDA 3ZJ4A 2OC9A 1VZ3A 2QHXA 3UMYA 2PANA 2O9JA 4AIIA 4BUJA 3DH0A 1WSWA 3STHA 1QIFA 2P79A 2B7CA 1CRPA 5DLEA 2GYVA 5DSXA 1OX5A 3FDJA 5LKRA 1A04A 1WCIB 3TLBA 3Q8WA 4TLDA 3D7NA 2PCJA 2IOYA 4PQEA 4YJHB 3LOQA 421PA 2LTAA 3MLEA 4RQBA 1GL7A 4YMLA 2ZM6B 3TRIA 4OFZA 4OFXA 2BMFA 2CBXA 2Q8NA 3W34A 1NC1A 4DG5A 3EZLA 1R0KA 2HBQA 4C04A 2ZRCA 3I9V6 3OY2A 3P71T 1T0IA 2GT1A 1U9ZA 4IJ5A 4BQIA 1JSRA 2VHQA 3I9KA 1SZPA 1DIOB 3EG9A 2VRBA 2ZI6A 1CZKA 2IYXA 1B6GA 3Q6IA 1JSCA 1K6IA 3EJWA 4UPDA 1XKTA 3EIWA 4LNUA 4FB4A 2AXNA 4NVRA 4RZHA 4ENTA 5MN6A 4D4JA 1J25A 4UDOA 1SIUA 2RKOA 1Y9AA 2EFJA 4ND2A 5H4GA 5D5HA 5IVDA 1ZK2A 1JAYA 2HTFA 2NNWB 4K9SA 1F9AA 1Z7BA 1GUYA 4N7JA 3CU5A 1YWGO 1Z0UA 4IDCA 5BN4A 2Q7OE 1Q0LA 4FGZA 3GZNA 3HR8A 1QQBA 2Q8QA 1SOAA 2CSUA 2FPLA 1IJFA 4G0XA 1JE1A 4I7EA 4AO8A 4E3ZA 3VYRB 3B2EA 2E49A 4AKIA 2GD0A 1N2SA 4FEYA 1PK9A 2O7VA 1PN3A 1XQ9A 2OGSA 1KYTA 4JL5A 4MB0A 2J85A 2P40A 3TOSA 4O4LA 1CB0A 4NNOA 3GLHB 3TPZA 3UAXA 5A9SB 2P4QA 1V3UA 1OXBB 3OIUA 4TZTA 5KYYA 1F38A 1XDSA 2PTGA 4L08A 1II8B 4B3SB 2ZE7A 3Q8XB 1WX1A 4FYIA 3LP5A 4OYRA 4E5NA 3QVVA 4L7VA 3JZAA 3GZ4A 5K45A 1WDTA 1FA9A 1Z7WA 4FDVA 5AW4A 3RUPA 1WSDA 2NTEA 3HL0A 2J41A 3R74A 3VGJA 4OJYA 3U1VA 2OYCA 1V6CA 1UXIA 2RH5A 4NHOA 3DBLB 3GPBA 3GA0A 1RXSA 2FQQA 3OE5A 3T52A 3OE1A 4CM4A 1TEXA 4XARA 2WHXA 2AOUA 1QO9A 3I6MA 4GNRA 3R24A 5HM6A 1VA4A 5HOEA 3CX7A 1Z4JA 3ONVA 5JO9A 3LPLA 3ELYA 2JLUA 2J5RA 5KQGA 4UNQA 2QR3A 2RMKA 3LFTA 2ZE6A 3Q88A 5IFKA 3K5IA 3TZQA 1YZLA 4RV5A 1PFKA 3UAOA 3NYWA 2H63A 1D04A 1R6UA 2GPYA 1ML4A 1SG9A 3W2GA 3IJRA 2C97A 2ONKA 3JZDA 3UW3A 2V5UA 2X7XA 3WL8A 2JAXA 2XRYA 3Q6MA 4U2KA 4DL9A 1NKTA 3DMTC 1QG0A 3KTFA 1XZMA 2QVGA 5E1OA 4QYMA 4LXHA 4U9UA 2H9AA 2R9VA 5HFAA 1CJVC 1PJAA 4FX5A 2XWBF 5TQ2B 4DXHA 1FDSA 3DQZA 4CEHA 2VQSA 1U8YA 3SQLA 4HRVA 5K3FA 1LSUA 3IR6A 4FBLA 1JP7A 5CPFA 4K6HA 4ENPA 1IONA 3L77A 2V0NA 4I5DA 3L0BA 3IOYA 4YUVA 4QTYA 3P9KA 2WJJA 1OBHA 4ON9A 5IVKA 1T2AA 5B5SA 4BO2A 2ZYTX 1CYDA 1FYFA 2LPMA 3UWDA 1COWD 2X0RA 3KPUA 1VG0B 2AV6A 4ZREA 2E6KA 3RC7A 3ANSA 7ABPA 1YMUA 2FP4A 1RE1A 1X8LA 5C1IA 5EUCA 1VXRA 1J0DA 3SZ3A 2V4UA 1VIAA 4LHZA 2H7CA 4W1PA 3MJCA 5AI9A 5IJZA 1EAMA 2ISSD 3LPAA 2HH9A 3F2VA 4F5WA 4HMPA 5K8IA 4Q19A 2VP9A 3NTXA 5IHXA 3HKBB 2OOKA 4HQLA 4DQLA 2QD4A 2GZSA 4PX9A 4TMVA 5DU2A 5HX7A 1O0CA 4AZWA 3EXAA 4QVIA 1QMGA 1T36B 1ESNA 3OLQA 1NVVR 3RT7A 1DXHA 3VX4A 1OA0A 2W2XA 4TWAA 1KOGA 1EGQA 1L4FA 2G1JA 1THTA 3MYRA 3LXMA 3I4CA 2IBTA 4IX9A 1GM5A 3ICEA 1P1IA 2F8MA 3P4YA 4MI3A 2F7SA 4IDFA 4MR8A 5LVAA 1V11A 2C77A 2QPOA 4U2DA 1V9CA 4PRLA 5DYGA 2B82A 2ZDHA 4LXUA 3FPHA 5I9TA 3R5JA 2AL7A 4JHLA 5FI0B 3KPVA 6REQB 4RD4A 4MKFA 1B2LA 1NRIA 1BNCA 1V7ZA 4G4JA 1R6BX 4S1OA 5EE9A 3V1YA 5BV8A 4IJMA 3FGOA 2OD9A 4B43A 3UBTA 3MQ4A 3L05A 1X7ZB 1QHFA 2I4OA 3VR3D 2VATA 1U2DC 1Z0ZA 3UK6A 4X7PA 2OHFA 3KQTA 1AGXA 2CK3A 1C8LA 2WNSA 5IH3A 4AYXA 1N8NA 3ICQB 1ZRNA 2UZIR 3UO8B 1XI2A 2R84A 1H9CA 5CURA 5KSZA 2XYRA 5B30A 2ORWA 3DWFA 3WO0A 2CDAA 5CB8A 3KB2A 4NBUA 1HFWA 1TCBA 2YJNA 1ZR4A 1AQUA 1DARA 1H2HA 5AW2A 1GZHB 2YDYA 4GPD1 1XMJA 3GJ5A 2WFLA 1DPGA 1EP9A 5CXSA 1T8YA 4DCUA 5CTAA 2GHTA 2YIMA 4FS8A 1DT3A 3DMPA 3WP1B 4FEEA 4UNRA 3LPMA 2ZRLA 1OFHA 3TR5A 3U9LA 5GIPE 3D5QA 3ZWMA 3MTBA 3GPIA 4UAVA 2J3MA 1J1ZA 4RM3A 3MCWA 4E2YA 3H6KA 4P3PA 5IWCA 5FD8A 3VTFA 1JB9A 5WRFA 3W04A 4Z99A 3HCEA 1Q1QA 4P7BA 4H1TA 1NVAA 4HLNA 5DLQC 3QOFA 4IIVA 2XECA 4CHTA 1KI2A 2HDNB 2FFRA 5BW8A 1Y6FA 2C42A 1NXQA 1ZNZA 4EVSA 1G16A 1NJFA 3HR7A 2O2GA 3AJEA 4QOJA 4RO0A 4S1WA 5BV7A 1HT1E 2C0PA 5A1JA 2NQ8A 5LQRA 3KAKA 2OO5A 3R5TA 4FKZA 4RV4A 2J31A 1MP0A 3ANNA 1IRXA 1JDBC 3K9CA 4L9AA 3T3EA 1QONA 1S5PA 1E4EA 3EF0A 4EA8A 1O7JA 5DYTA 5E95A 5B1DA 2PA3A 1KHTA 4P36A 3E3NA 2XLBA 4KXFB 1XMOB 4DNOA 3DP7A 3B3JA 3BIJA 4LYAA 5ECWA 4ZKEA 3UQYS 4F3NA 1DU4A 2PT9A 4DY4A 1E8MA 3RJZA 1GD1O 3N05A 4G5SA 3HDTA 1DWPA 3KHTA 2QNBA 3NRBA 1ISMA 4GOND 3L8EA 2QTAA 1WLSA 1U9YA 2ODNA 2WY2D 1XAIA 3HZOA 1KK2A 3WQQA 3DPSA 4PG4A 5EEHA 2X23A 5E1MA 4QLAA 4DR4B 2VN8A 4MUYA 4N8EA 1YMQA 3T7TA 1W94A 1QP8A 3ENWA 3L8FA 2OBFA 1ODTC 2ETXA 2HRCA 3N3AC 4A2CA 3W9YA 1Q0ZA 4DNQA 1ODFA 1MC5A 3IEMA 2Y1OA 3HUDA 1JQDA 3M6AA 3TRKA 1TKBA 5IFLA 3EUWA 2A5YB 1EJ2A 1KO1A 3GCGA 3ICWA 4R05A 1O96A 3FYDA 1A8QA 3NT4A 2IP1A 3PGKA 3P45A 1O94A 1B0PA 3KAQA 3QITA 3H5LA 4R2LA 4F11A 2WWIA 4OXKA 2YWXA 4ZO8A 2VLBA 3U61B 1N2GA 2IYRA 3CUUA 1IHPA 1NVDA 2I1QA 1V96A 4W5WA 4LFAB 2HDWA 3SK0A 4R9SA 3RUFA 4WZBE 4F3YA 1T5OA 2RKBA 2NVUA 4YRPA 1CUJA 2GJAA 5JH7A 1N77A 2N9UA 1JIQA 1GNLA 4KO4S 1KEUA 1NXOA 2QLMA 2X86A 2ZYHA 5G0TA 3WADA 4IH4A 1EUQA 2V8BA 1JE0A 2CLCX 1Q6ZA 3P9PA 1L4UA 2NPFA 2C29D 2YX1A 1QIMA 3K71B 1A9SA 2BFCA 4FSXA 3FKSD 5IWAB 1YZYA 2XHEA 2GK3A 4X6LA 4C22A 3IOEA 3IT2A 3ZWAA 4M22A 1ZK1A 2GVNA 2ATEA 3PSAA 2J87A 4I46A 2RI6A 1ECGA 3VPFA 1DKNA 3LUDA 3PUYA 1QFYA 2J30A 3CIFA 4G0PA 2HJGA 1RZRA 1T4GA 1NL3A 3LQFA 4Q9NA 3GFOA 1SBHA 3UHFA 4BFLA 3VX3A 1HFJA 4PAGA 4Q6BA 4OKIA 2E18A 2RC5A 2OHJA 4K03A 1HG1A 1RYFA 1GQRA 1W4RA 2A2ZA 2ZVJA 4MKGA 1XE3A 1E3JA 3OJXA 4QT4A 2NG1A 2PVPA 5HIMA 2RCNA 4JWKA 3IS3A 3G8CA 1FU8A 4I36A 2CBZA 4N6OA 1V5FA 3IIJA 2GRJA 1PSDA 4XDZA 2OXFA 2EIXA 3E9DA 4A1FA 4CM9A 2OE2A 2A84A 4ZT3A 4GP7A 4HAUA 2AF4C 3IQGX 4JOQA 4AJNA 1P9RA 4NS1A 4OHWA 1NYTA 5H3CA 3LUGA 3D7SA 2JLXA 4PXYA 4YDHB 4GLFA 3K3PA 3R3HA 4KXVA 1BX0A 1PCXA 4FUTA 3MXOA 3UFBA 3WKAA 4D3FA 5K4GA 4Q3AA 4H17A 2YCBA 3HFRA 3ND7A 4WBNA 2HSJA 5ESDA 2X19A 4LOAA 2VTBB 5EKSA 3QUBA 4QYSA 4EHIA 4DT1A 1MEJA 4HQ0A 1DO8A 1NBOA 4GL2A 5HTKA 1G6Q1 3R2JA 3SIPA 4U9HS 4CZ2A 2JIBA 2XB9A 1VPVA 2C58A 1GYRA 4KBGA 5LMUB 3TI9A 4EB8A 1E0SA 2F4VB 1Q7TA 1P0PA 5FRDA 4CDGA 4X93A 4U2FA 5L51A 2PH3A 3I76A 3M6UA 2EDAA 2ZDGA 3N2KB 3O1HB 2V98A 3R9IA 3TNDA 5B64A 2QM0A 2E82A 3CRQA 3H75A 3WA7A 2HA2A 4QPDA 4ZVSA 3OFND 4L1KA 3TCXB 1R4ZA 3GOHA 1TX4B 1A50B 1HOXA 1Y4UA 2HJSA 3NNNA 1QH0A 1F0KA 5CT8A 3EMDA 3UA4A 1D4OA 4NU6A 4P2BA 3NTVA 4ECAA 3BKXA 1RWOA 3RVJA 4L7QA 1OBFO 1YCDA 3WV4A 4IDEA 3L7YA 4AUEA 4WXEA 1P5HA 4EGJA 5D51S 2GBFA 4YUYA 3E9QA 5FF9A 5LOVA 5TEVA 1Z6AA 1KU0A 1YQQA 3C74A 2V97A 3O74A 4RLFA 4EUSA 5BUQA 3COWA 4TRNA 4IS2A 1S4QA 3LYHA 3O90A 1SXJA 2I62A 4GYWA 5JCPA 3K8OE 1S89A 2J07A 1W88A 3RTEA 4BASA 3U19A 1I5RA 2VBGA 3DHYA 4OO3A 1PWZA 4CKEB 5EE0A 3VZDA 3IQXA 4AB1A 3MGGA 3WYDA 5KOYA 3CY6A 3NHWA 3NVAA 1YBVA 1OOEA 4HWPA 5E3IA 3RBVA 4KE6A 4C07A 2D13A 1BXKA 3DVQX 2SICE 2D1SA 4CKXA 1EXDA 5MGBA 1DCTA 2E4WA 1ISJA 4ARSA 4BLTA 2YY5A 4YT2A 3U16A 1PSWA 3IALA 3CSDA 3PXXA 5AM1A 2I8AA 1LEHA 2PWBA 5DLPA 4ESVA 5IG2A 1CG6A 1SGWA 3N5KA 4KGDA 5TT1A 1IJBA 2E5FA 1GUFA 1JS1X 1JKJA 2OXIA 3I73A 4EB3A 3ADBA 1R27A 2XZOA 3AF3A 1DSSG 4KKXB 3EY4A 3I2JA 4RANA 3OC0A 3ZHQA 4OOEA 1E6EA 2HX1A 1GV1A 3I34X 3PSHA 5IZCA 1H1LB 1WZ2A 1A5BB 4TMKA 5CVJA 4E46A 1WQ3A 4YGYA 3LQ4A 3OQIB 3M3PA 2JC3A 3IKMB 1LPOA 3V00A 4OSPA 5M3BA 4ZV9A 4Q02A 3K16A 3WI7A 1DIGA 5AK4A 1AKVA 1E8DA 1E7QA 1LU9A 3P26A 2AYXA 4Y9TA 2PQ6A 5KQRA 1Z2NX 2Q2OA 1FNDA 3DOHA 2ZT7A 4J7UA 1IYZA 1XJ5A 2ZIFA 2V7PA 3NTLA 3S27A 3WLHA 2O8CA 1LS1A 2RIRA 1JHPA 5C32A 5DW0A 4TV9F 2ZSKA 2PUBA 4WK2B 4RDIA 3WNBA 4DUYB 4AP6A 3EISA 3DB2A 4BLVA 1A2KC 1W19A 2XUGA 3VAZA 4B74A 1OVMA 4UAJA 1OWOA 2B8TA 1IBRA 4UQLA 5KQSA 3V8MA 2GAAA 3E61A 3I4FA 3KU4A 1AZSC 1SXIA 3NHRA 3PQFA 1TEHA 3UMGA 1EAYA 1USIA 5KX5F 2AJBA 3K1AB 3P0HA 1KMHB 3MMSA 1LCIA 2R5WA 1L4GA <