4UMDA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
MNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
total genus 59
structure length 173
sequence length 173
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umdA00
1RMTA 5AI8A 4DWOA 3ESQA 3HLTA 1MH9A 3QLEA 3WKAA 1T5TA 4UM7A 2BDUA 2YJ6A 2IYEA 5AM5A 3OCVA 1Z5GA 3A1DA 3KOOA 3WGUA 4MUMA 3FPBA 3ZU6A 2GO7A 4HGOA 1RLTA 2WM8A 4Y2PA 3EF1A 3NAMA 4NAVA 1WZCA 2HDOA 1J8DA 3MC1A 2AMYA 2I54A 4YIKA 3D6JA 2YY6A 4YCLA 1RLMA 4BX2A 3L7YA 2WF6A 3L0BA 3ZTWA 3CZ4A 2B1RA 2I55A 5AKJA 3L8GA 1ZD3A 2B1QA 5AW2A 3ZVNA 2CFRA 4BEVA 3ED5A 2ZG6A 1RKUA 3I6BA 3QU7A 4IG4A 5AI5A 4L6CA 4JB3A 4GXTA 2G07A 3U7GA 3U7FB 5AK3A 1S8OA 2HOQA 1L8LA 1L6RA 3AR5A 1LTQA 2JAOA 4B6JA 1YS9A 1VJRA 2FEAA 5ALJA 1T9ZA 3WKBA 1YV9A 2FPXA 1XPJA 3UMCA 1SWVA 2W43A 3NANA 3WK7A 1TA0A 5ALEA 2OA0A 3ZVMA 4YCNA 3ZX5A 3PDWA 2B8JA 5AKHA 2PQ0A 4KX5A 2HI0A 2P69A 1RRCA 1RDFA 2FDRA 5A3SA 2ZBDA 3NUQA 3AR7A 3KZXA 5AVUA 2B0CA 2B8EA 3EF0A 5AICA 4HGQA 1KYTA 3QUCA 2R8XA 4C4RA 5T41A 4UU1A 2P27A 1TJ5A 1L7NA 3WKEA 2NO4A 5ALUA 4ZEWA 5AKKA 3KBBA 1Y8AA 4CF4A 1VJ5A 3AR6A 2P11A 2P9JA 3QUTA 2JAUA 1NRWA 2GHQA 3BA6A 1O08A 3A1EA 5ALOA 2GHTA 4J03A 2YMPA 3PCTA 1VFPA 2R8EA 5AI9A 4BKMA 5ALPA 5AKGA 5ALVA 2FPSA 3DAOA 2EAUA 1U7OA 2JARA 2AH5A 2FUCA 3U26A 4Y3UA 2ZBGA 3SLRA 3AR3A 4YCMA 2HO4A 3PGLA 4QJBA 2I34A 3ONNA 3WKCA 4EELA 3U7HB 3NIWA 3ZUPA 2R8YA 2FUEA 4RESA 2RARA 2C9MA 4MWOA 5AKEA 4BEWA 5AI6A 5AKYA 3MPOA 5ALNA 4CNQA 5AM0A 3OCWA 2RBKA 3EPRA 2AUTA 3GYGA 3U13A 4FE3A 2O9JA 3J7TA 3FGOA 3SKXA 5AKXA 1WR8A 1YNSA 3PGVA 4RETA 4EX7A 4UARA 2WHEA 1QQ7A 2JGAA 4AS2A 4HGNA 5IT4A 3I1YA 3IJ5A 2IOFA 5AW3A 4UW9A 3NALA 1O03A 3KD3A 3UMBA 2Q4RA 4UMDA 2ZXEA 4KYTA 2IOFK 3N8GA 2G80A 2NYVA 2OBBA 2C4NA 2G06A 3ZX4A 3N1UA 2HHLA 2ZBEA 3L1VA 4Y2XA 5AVSA 1Z4NA 3OCYA 1RQLA 4XQ0A 5AVVA 2CFSA 1WVIA 3L0CA 2G1AA 3N5KA 2HCFA 3F9RA 3A3YA 5AKLA 3KDPA 5ALQA 4KX3A 5IT0A 3OCUA 1NF2A 5AVZA 4EZEA 3R9KA 2BDEA 2IA5A 2G0AA 1Z4JA 2QYHA 5ALIA 5AK5A 3ESRA 1ZOLA 1YDFA 1Z4MA 3E81A 3OCXA 2MSNA 3QNMA 5AW0A 4EEKA 2NO5A 3M1YA 5ALWA 2DQSA 4L6AA 4BBJA 4CF3A 2WF5A 1RKQA 2OYCA 5ALHA 3W5DA 3QGMA 2HEGA 4F71A 4OD0A 3K1ZA 2HX1A 3NASA 3E58A 2VKQA 1T5SA 2WF9A 4HGRA 4FFDA 4H1WA 4Y2QA 3CNHA 4HAIA 1ZRNA 3E8MA 2BY4A 1SU4A 5AW5A 5AVXA 1PW5A 3WK4A 1Q92A 3RF6A 3B8EA 3FM9A 3EWIA 2FPUA 1LVHA 3SKYA 3L8HA 3ET5A 1Z4PX 3AR9A 4Y2VA 2YJ3A 3WK5A 1RKVA 5AIBA 5AM1A 4OCZA 5AVYA 3I76A 3L8FA 4NFLA 1Z5UA 4I9FA 1SWWA 2JAWA 1J97A 3MMZA 4YGYA 3W5CA 2Q4TA 2W4MA 4UM5A 3ZWKA 4XE5A 3IRUA 5ALZA 2IOHA 4YH1A 2G09A 3N28A 5AESA 4YIHA 1Q91A 2FPRA 3WKDA 4UMFA 2RAVA 3FPSA 5ALGA 1ZJJA 3E84A 3OTQA 3DV9A 4BX0A 5ALSA 2I7DA 2YJ5A 3ZI4A 1TE2A 3ZVLA 3N07A 3U7EB 1L7OA 2R8ZA 4UAVA 4AP9A 2D2VA 3FZQA 3R4CA 3B9RA 4GIBA 5ALKA 5AKZA 4DW8A 3WK8A 3QYPA 1QQ5A 2YN4A 4JDPA 4UU0A 1WPGA 3I28A 2MU1A 4J2TA 3WK9A 2FI1A 1N8NA 2C8KA 2OM6A 5AVRA 1RMYA 4O8CA 4UASA 1QYIA 3SHQA 3SMVA 4DFDA 1RQNA 2C8LA 1X42A 2WFAA 2B82A 4FYPA 3QUBA 5AI0A 2CFTA 5ALTA 5ALXA 1XP5A 4G63A 4AS3A 1Z4LA 4BNDA 4Y2SA 1Z88A 2ZOSA 1U7PA 5A3QA 1IWOA 2YFYA 1AQ6A 3OCZA 2WF8A 4C4TA 4ZEXA 3QU4A 5AW7A 1RPZA 5AK6A 5FP0A 1ZD4A 1YJ5A 4QQFA 5ALLA 4BNDB 1S2OA 5AW9A 1NNLA 4EX6A 3M9LA 2HF2A 2PR7A 4NABA 3ZTYA 5ALRA 4Y2TA 2O2XA 3VAYA 5AW8A 4IFTA 3KC2A 4OHFA 3SF0A 1CQZA 4NV0A 4Y2UA 1RMQA 2FPWA 2ZBFA 5ALYA 2EARA 3L1UA 3UMGA 3DNPA 5AW6A 4UAUA 2YMQA 1EK1A 1TJ3A 1K1EA 3AR8A 3B9BA 1JUDA 3NRJA 3ET4A 1ZD5A 3QU5A 3SD7A 2YJ4A 2HSZA 5ALDA 1U2TA 3R09A 3UM9A 1CR6A 5AK4A 2X4DA 4OFZA 1L7PA 3AR2A 3L8EA 3ZWDA 2I6XA 3IB6A 1ZRMA 4Y2JA 3A1CA 4KNVA 4NWIA 3W5AA 2Q5EA 4UMVA 5AHXA 4XOUA 2C88A 4EENA 5JJBA 5AM3A 3AR4A 4HYTA 3OPXA 2PKEA 4G9BA 5AM4A 2HF7A 3P96A 4ZEVA 1Z4OA 4E88A 2YMMA 1L8OA 1Z4QA 1Z4KA 1F5SA 2GFHA 4BX3A 4UMEA 1QH9A 2QLTA 3HYCA 4XPZA 5E0OA 5AVTA 4CF5A 1ZD2P 1YMQA 3BWVA 3QX7A 5IS2A 3L5KA 1TJ4A 2ODAA 3MN1A 5AM2A 1EK2A 3DDHA 4CE6A 4F72A 2WF7A 5AI4A 4C4SA 2CN1A 3QU2A 3S6JA 1QQ6A 4HGPA 2YBDA 5ALMA 2B30A 4BYGA 4KNWA 3L0YA 3QU9A 1FEZA 4L57A 2AGVA 4Y2RA 2EATA 4Y2YA 5AKIA 3RFUA 3QXGA 5A3RA 3WGVA 3ZW7A 1U2SA 2W11A 1U02A 4I9GA 2G08A 5AW1A 3FVVA 1XVIA 3QUQA 2I33A 2RB5A 1Z4IA 3TLMA 2YMLA 3WK6A 5AW4A 3U19A 4UATA 1L7MA 4KN8A 1RLOA 5AVWA 5AVQA 5ALFA 1RC8A 1N9KA 1ZS9A 5AIAA 4PNHA 4DCCA 3W5BA 2GMWA
chains in the Genus database with same CATH superfamily
5G4KB 3R9XA 5GONA 3H16A 4IMJB 4MVXA 4CUZA 1N33B 3QLTA 1P4SA 2V9CA 3D5EA 1XTVA 3EA0A 3HCRA 4LGCA 3NWJA 3WMFA 3EQ7A 1QGAA 2QSUA 3GLGA 4MV3A 4QPZA 4YJ3B 1RQ2A 5CDHA 4WEOA 1S8AA 2PNJA 3SMQA 4OK3A 5IKOA 5KYYB 1YRLA 4PF1A 1AQJA 2NSJA 3AF1A 4DDVA 1SQ0A 2H1CA 3FDJA 1H2HA 4I55F 3ZTTA 4XWKA 4B2IA 1QRSA 2Z3VA 1EVKA 4TQ9A 1WEHA 4RTRA 1S2DA 1G60A 4OHXA 1R8XA 3FPGA 1YBMA 4GX2A 4PTYA 2PWYA 3QPDA 4L2IB 4IHJA 3A6FA 3GJQA 4EL0A 3LKBA 4ER7A 5FUXA 4CL8A 5D3KA 4FLFA 1YB4A 2XMCA 3NHZA 1NG9A 1PJTA 4HVAA 1JEEA 1W2WB 3CZ4A 4TVBA 5L3SB 2PUGA 1XK7A 3QOFA 1J20A 3WL3A 1IRXA 3GWZA 2HMYB 2JIZD 2KJQA 2J3JA 3SYRA 2A14A 1SCUB 4HOYA 5DNWA 2ECPA 5DKFA 4BVLA 4CV0A 3Q4GA 4BNLA 2VYVD 2QRVB 3M49A 1M1YB 2OV8A 3P8ZA 5CITA 4N40A 2D3TA 2WG0A 3IB3A 3WXMA 4BNZA 4JR2A 5I01A 4IG4A 3HJRA 3BK7A 3NDBB 1W4ZA 2AOUA 2B2CA 5H3HA 2ZRLA 1JSCA 3KQPA 3SHVA 1LC0A 2XIQA 1P4AA 3AV0B 5DBGA 1G17A 1MB0A 2LCFA 4QYTA 3M5CA 1L6RA 4QATA 3N59A 5H0IA 3V8RA 5LMZA 2QENA 4U00A 3LTEA 1VJRA 3DEFA 4U2DA 3USES 1GQRA 1EBFA 3I5UA 2BYTA 4BNMA 3BMCA 4HK4A 3CWZA 4Q03A 3T7IA 1O9GA 2RGCA 4JQSA 3UTCA 2XWJI 1HLPA 1BEUB 5A1JA 2CEKA 2V6MA 1M6VA 3OE7A 4K6CA 4NNOA 4CLRB 1S96A 3GHHA 5ES4B 1RYBA 3LKZA 3ONVA 1JBEA 2DUJA 4XFJA 3RRBA 5IT9A 5DW3A 3EFOB 2ECQA 3RS2A 3GPCA 4F1JA 4D0SA 1WV1A 2N3ZA 5I7RA 3R3WA 1HYHA 3ZWYA 2IHNA 4BJ1A 2C2HA 1YDHA 2V7EA 5JNUA 3PWTA 3ZGNA 1I4TD 1T6BY 4Z7NB 2VK2A 3M6FA 4A26A 1SHJA 5CYGA 1COZA 2H7XA 2IZZA 2R4QA 5KMGB 3T1YB 2DPLA 3DBVO 3OJXA 1JSZA 1GAEO 1SVUA 2ASEA 4O2BB 4AJ2A 3BXFA 3SJUA 3ZCVA 1T10A 3PFFA 4HNVA 5GJBA 4HFNA 3EGIA 2XGMA 2IELA 2YIMA 2RGDA 3P2KA 3IMCA 4UDYX 4HBGA 3S2FA 1NXQA 4LI3X 4TZKA 3CE6A 3VR6D 4C4RA 4CIBA 4DBLE 1GWNA 1Z2CA 2GX6A 2NO4A 2XE4A 5DGHA 1BWQA 1XLTC 2ZBVA 1II8B 1SOUA 2QZJA 1VSTA 3EXAA 4MINA 4CMIB 1G5IA 4D43A 5JWRA 1NMSA 5F12A 1JX6A 3FTEA 1FK8A 4NY1A 4G1VA 2PGJA 1X7HA 3GL9A 5KOHB 3NO4A 1RE1A 4BY9E 1LDYA 3BF8A 1Y6ZA 4II3A 4AJ4A 4ZI7F 2QRHA 3A1EA 5F1PA 1FFXB 1MDFA 4LRTB 2GASA 4CM4A 4DWWA 1KJ8A 1QH0A 3D6NB 2FFQA 4IHJF 2N46A 2UZIR 4DGQA 3QQPA 3WQHA 3MWYW 4ILEA 5IJXA 4B8YA 3HNPA 3OJ0A 1U1EA 3L82B 1EHYA 4N0DA 2FPSA 3LZ6A 1NI4B 2EAUA 2IE8A 2X9GA 4ZVSA 4BP8A 4TXNA 4DIDA 1DGQA 3IBYA 1Y8QB 4NS1A 4BLQA 3B6IA 3E53A 1A5BB 2G77B 4G1MB 5JJKA 1JIKA 1ZK0A 2QUIA 4G9GA 4KQGA 2HO4A 2FRVA 3TR5A 1CUFA 2HWKA 2HZ7A 4MMXB 1J0XO 1OXSC 2F4NA 5ENZA 1VIYA 3VR3A 4LJLA 3ZE9A 4E2FA 3W7BA 5H68A 4CKCB 4RESA 2DB3A 3S3TA 4NG5A 1CUIA 4FGKA 4MWOA 3GMSA 3O82A 3E82A 2IJGX 1Q6YA 3NAGA 4MYSA 1WZIA 3SJCA 5CCEA 3QPWA 2ORYA 4M0CA 3EPRA 3EY4A 3D5QA 2P3LA 1JMKC 4V0RA 5DTMA 1QV9A 4BZZA 4RD3A 1DWOA 1JWLA 4IDAA 2ECKA 4ZZ3A 5JJCA 1C3LA 2FZCA 1GILA 2HMTA 2AK3A 2HUNA 4IXDA 4E2ZA 4A2PA 2DWPA 5K7SA 4LHVA 4JIGA 4OH1A 5EE1A 1ABEA 2QZ9A 4HEJA 4K9LA 1SNYA 5C35A 3O1IC 2V7XA 1Y9JA 3UWOA 4XYBA 2EG5A 4REQB 2Z2JA 3EDQA 1DV2A 1MABB 4PU0A 2I7VA 2LTAA 3VU1A 4UUOA 4O02B 3NALA 2FLKA 4ARUA 3M9WA 3MJFA 5JROA 5KWVA 3DR5A 3MMSA 4FW9A 4KYTA 1SXHA 3L0PA 3D6AA 3C8ZA 4QGFA 1UBCA 2VRNA 3IQHX 1GPBA 1ONPA 4GX0A 1XVTA 1N2IA 3KJQA 5K3CA 4GI1A 2DC1A 3EYAA 2GN1A 1R2QA 1TF7A 3EIUA 4D9NA 1PQUA 2W8BA 3G8YA 2F8TA 4CRWB 2PT5A 2G0NA 3MCUA 4TYNA 4Y1FA 3O73A 4NBRA 3C6MA 3IUBA 1N5IA 5KTMA 5JAOA 2ZUEA 2QZ4A 1CQIA 1C9JA 1SH7A 1UDAA 3HUEA 4GM1A 4JY7A 3RIYA 4Z54A 2HJSA 4O3FA 1CJSA 4NYIQ 3HK2A 4TXJA 4WXYB 3RRMA 2CVFA 1G19A 1MOQA 1NATA 2R8OA 3PHGA 4IV8A 1DBVO 2C3YA 1CD5A 4M8SA 1RC0A 3FSEA 4S05A 5J3JA 3AFIA 4EVSA 3OQOA 4EGJA 4IFBA 1SPXA 4Z51A 3TEMA 2B1IA 5IUJC 3EWAA 4FFBB 1V7CA 1RZRD 1EESA 2RJ3A 1X15A 1ISPA 5T4BA 2BFEA 4QYSA 4U3JA 1CK4A 1E18A 4XLZA 3TZEA 4KSCA 1TZ2A 1Q0ZA 5B3JA 3GCDA 121PA 1NNI1 2GCGA 1VB5A 4WY5A 2XXAA 3INYA 3AVVA 2NGRA 4KQHA 2XRFA 2QG4A 1RKQA 1A7UA 1VYTA 4FMDB 2CW5A 3W5DA 4UVHA 1OIVA 1W88A 2C4VA 3KWLA 1E7SA 3O9ZA 4JMPA 4Y6SA 1UC8A 4BFYA 2HXSA 3KAJA 3OO1A 3MWFA 2AFIE 2EZ4A 1B0PA 1LRLA 4HWKA 4IDBA 4RDIA 1MJ5A 5FFFA 4OJKA 1UMBB 3W2GA 1NP6A 5KPJA 3ENWA 1V8BA 3QFCA 4IO1A 1PL8A 2ODQA 4AZ3A 3PA6A 3U3XA 4ZVQA 5AVXA 1PW5A 3GZNB 2ES4A 3G0IA 3B8EA 3LDFA 2WK1A 2HGSA 1X7ZB 1G42A 3A2LA 1JHDA 3BSSA 3MBOA 4MKGA 4EB8A 1ESNA 4YCBA 2ZUSA 2R87A 3E9CA 3H6GA 3L8HA 5A7HA 1Z4PX 2BMEA 4EQ6A 4OI4A 5EEHA 4LIPD 3RSQA 1D4FA 3CY6A 3SHWA 2P2YA 5E6UA 1A2BA 1NLZA 3EEYA 4DQVA 2H9AA 4OK6A 2UU9B 3VNVA 3N7UA 2AXPA 1FYVA 2P3QA 4BMNA 3H3JA 4W1RA 5HOQA 4BLOA 2A3NA 4LY0A 1CS0B 1VCHA 1VXOA 1DT3A 2RHJA 3VZDA 4EIWA 4S2EA 4UMFA 4YHHB 4D6XA 3E84A 7REQB 3DKKA 3LWZA 3UIEA 4GH5A 4F4JA 4EO7A 5J23A 1G5QA 1X7YB 4XVHA 4G86A 5FOTA 3ZPXA 5A2GA 3VNUA 3KV1A 2KPOA 2W2LD 1X1TA 1FRNA 1UM9A 3ZVLA 5JANA 3CEHA 3NH9A 2ZEJA 3TAHA 2RHGB 4ENTA 5G1PA 4EAAA 1EINA 2H17A 4XARA 3KVYA 4XD2A 3IEIA 3GUYA 5EMJA 3DMDA 1QCZA 2XY4A 3DONA 1EE1A 1WUHS 3V97A 5EJ8A 1Q0TA 1XZGA 4GUDA 5CRIA 3K9WA 4DW8A 2C7RA 2ECFA 1CF4A 3DBOB 4FGJA 1ECFA 1Y4AE 3LDGA 3VYSB 4JV5B 4MKXA 4BMSA 2YFHA 1VCIA 1ZG3A 2I5PO 3CWCA 5AHOA 3WLRA 4BZQA 3SS9X 3C3CA 5DGIA 1XCMA 2PIAA 1VKJA 4IQ8A 4KXXA 3A05A 4WZ6A 1DE0A 4UM8B 3MJ4A 4WNIA 4AX4A 4XPIA 5DNCA 1ZQ9A 1D2CA 1ZN9A 4OJQA 5CJ2A 3M4NA 1RQNA 4UHFA 2W6PA 1R3DA 2IWRA 4IOKA 4KI7A 1BJTA 1DUVG 3DMRA 1MB2A 1XLVA 2FPKA 2GPAA 5ILGA 1A1VA 3CCCA 2FUG6 4N12A 1SA0B 4RGVA 4KR2A 3R5KA 4MQFA 1ZAYA 2ZWMA 4CVNA 2GLXA 4E5VA 1ODCA 4MP3A 2J5RA 5BV0A 2DTEA 1GT6A 1TEHA 3JQ8B 4UJ5A 3AP1A 2IZ6A 3N0VA 4FHFA 1YQGA 3D8UA 4G63A 4IDQA 3BWDD 4IV0A 4PGMA 3KYDB 1OPXA 3JD1A 1FJGB 1ILWA 1QF9A 4RA9B 1FFWA 5IASA 5KQSA 4EFNA 4BLWA 1OC2A 1KETA 2OKGA 1U0EA 4KIJA 3LT2A 4MAMA 4IINA 4FYWA 4X92A 3W3AH 4AYWA 2DEUA 1L7BA 3X0DA 4HQKA 4QQFA 3VDQA 2MYNA 1FRFS 5DXAA 5SZIA 3RRNA 2JLYA 3JQFC 1UFKA 1K06A 3RVDA 4AK9A 3HUDA 4CV3A 4F0JA 3C3KA 3HVIA 3N8DA 1QHFA 3ETHA 4DA8A 5BNTA 2AI3A 3QWAA 5ALRA 1G8HA 1XEAA 2Y4OA 4QUIA 3UXHA 1LDEA 1U8EA 4B4OA 1KVQA 1YONA 5L9AA 3ZGVA 1G64A 3IEVA 1L9XA 4U8GA 1YZGA 5DK6A 4EARA 1U8CB 3IEKA 2ZBFA 3RSLA 3QUSA 2ZE8A 4MP6A 2CHGA 3KEFA 2FRDA 2OLKA 3NGXA 2NX2A 4D5GA 3AVUA 2EBWA 3DZIA 2FGKA 2W2VA 5BURA 5AW6A 5ICMA 3SXUB 2AIRA 2IIVA 5HKBA 4IH4A 4CQJA 2FPOA 1WZ2A 4B3GA 3EC7A 3VV2A 1LVUA 3T5BA 1VSVA 4S0ZA 5F7ZA 3EAQA 3ZIAD 2GUWA 3RG8A 2WSSA 1MC1A 1NUTA 4JJ4A 3FCEA 3SD7A 1MLDA 3IE1A 2Z43A 4G09A 1RM3A 4XLTA 1ODKA 4C0BA 4H7HA 4JX9A 4YMGA 4FMBB 5AK4A 4QYIB 3IBFA 3T5PA 1P6UA 2CLMB 3FKQA 1DWPA 1SRQA 2BGTA 3CLTD 5SY6A 2R48A 3VC1A 3BN3A 2I2WA 1J0CA 4YJFA 3FFXA 3H05A 3HHPA 2PKRA 4JOBA 5C5IA 5AHXA 2QMQA 1T9KA 1UMDB 4BFUA 1TEXA 3I4CA 3FYHA 1U2DC 4FFVA 5A04A 3HCPA 2E4VA 4HDKA 2XB6A 5EXDA 2CNKA 3I92A 3B20A 4G9BA 4PZZA 1DKMA 5DNDA 4L1KA 2VXYA 1Z6QA 2QUZA 3GR6A 3WWOA 4ASUA 1YJBA 5DLPA 3Q6IA 2ZYWX 1B2RA 2V6IA 2DX7A 1T0BA 2R751 4M55A 3SYLA 1E0SA 1Z4KA 1F5SA 5E2IA 2GFHA 3UWDA 3ZXYA 1G3IA 1IB0A 4IJKA 2ZRFA 1QH9A 4TSRA 1NXXA 1XZBA 4GSKA 3SEQA 4YRSA 4UNSA 4RBNA 4JBGA 3T15A 3DTTA 1ATZA 2VN8A 3AUFA 2WWRA 4XVQA 4S1WA 4DR6B 4COOA 1EWQA 2C7OA 2VJYA 4CTMA 5ICCA 3ONWA 4JLWA 3LY9A 2C58A 1Y89A 1E6EA 3SDBA 1T4CA 3E1SA 1G2OA 2J46A 1QS0A 1E92A 2F43B 3L6EA 2WYIA 2CN1A 3H87A 4Y2HA 1XCGB 5GTDA 1ZM4A 1RWXA 1SVSA 1GPKA 1C1YA 2M1ZA 1KGSA 4ZVRA 2AQ8A 2PSEA 2R62A 3TKLA 5L4SA 2IZ0A 2FZGA 4TLCA 3Q8MA 1RPTA 1P1CA 2OBMA 4YT8A 4LXUA 5D6NA 4A2QA 1L4BA 1CE8A 1KEKA 3OT1B 1U9YA 4HLNA 4MICA 3OHMA 1PR6A 4UU7A 4Q3EA 2J59A 5HIAA 3TL3A 4ARIA 4QTUB 2VZ9A 3PG5A 5LYYA 2OO5A 1ONOA 2QXYA 1FTYA 4Y9RA 8ATCA 1NVFA 3MELA 4DJDC 4M7OA 3HXQA 4RA6A 1HYEA 4EG5A 3KYIB 2PL3A 4MLDA 1ITZA 3K5HA 3PFBA 3TLKA 5KYWB 5DEOA 4MYRA 5GGYA 2HFKA 2VQEB 1A5TA 2FX2A 3BTUA 2CCJA 3L8YA 4TYWA 2RB5A 5DHTA 1CNFA 5AJTA 5DYWA 4CG3A 3D4IA 1Z83A 2BW0A 3KFVA 1Z12A 5G4KA 3UMYA 4CN9A 1IY9A 1KIFA 4D8WA 1WUKS 1C9NA 1U3TA 2JEOA 4B3IA 1DJMA 1ZOSA 2G17A 2QPTA 5B36A 4QXMA 4L3WA 5FOVA 4YJ3A 2Y6VA 4LI0A 1U5CA 3QOXA 4TKLA 5AVQA 4JL5A 1E1LA 2R8BA 2ZKLA 5KYYA 2QX4A 2ZWPA 3DMTC 1UZUA 1R0LA 3F74A 1WA5A 3H5NA 4FGUA 4I14A 4P8RA 2WFLB 4WKOA 4DJJA 3ESQA 1E66A 5SV2A 3HLTA 4UHCA 4L78A 2V7WA 1GFIA 1MTZA 1Z0DA 3DPSA 4K9NA 5AK0A 2W7TA 4XFKA 4ENPA 5EJ5A 4UPVA 4LZZA 3ROKA 4ZJUA 5HM6A 1F14A 1MHPA 4JSTA 3BIFA 1T4BA 3E9DA 3PXAA 2K7ZA 1HE1C 3QNWA 4NU5A 4PTZA 2CMDA 3EVBA 3KOOA 4WLEA 1FW6A 4L2IA 3QEJA 1RC1A 4MWDA 1NFQA 1P1BA 3IDAA 1ZNXA 1FLDA 4RM2A 1T2AA 3QIAA 3RVSA 5J4HA 2HJHA 4NENB 3ZNQA 1RLTA 4YRAA 3GCXA 3SP1A 5L3SA 1JTFA 1D8TA 4YP7A 2QQGA 4NAHA 3UC5A 5IRCD 4XTRA 3IAXA 3KAPA 4K26A 3NORA 1JKJB 3NAQA 1KJQA 1T9GR 2F3PA 1BWRA 1M1YA 1W4AA 2QRVA 2ZAMA 4MVJF 2W6NA 4M87A 3FYDA 4N39A 5JWHA 2XHZA 3ND7A 3FPLA 2PZLA 4ZQIA 1E9AA 4DC9A 3N2EA 2O8CB 1KI6A 1K86A 4U2FA 5GV7A 2B1RA 1KRXA 3GRRA 3PCRB 4NMMA 4R16A 4EPTA 4B9AA 3OO0A 4L9RA 1IDOA 2VRBA 1AV6A 4OHYA 4H6XA 4AY5A 1RHJA 3NM6B 4IL5A 1UJNA 1WQ3A 1HF3A 5CH3A 4E46A 4LHYA 1V9SA 4IOJA 4WV3A 3QU7A 5PNTA 4AM8A 3UAVA 2DETA 2II6A 4Q1EA 2YJGA 3ROTA 4HS4A 2PNFA 2X9NA 1QYVA 3G49A 3T9DA 3PVCA 5JTUA 5I7SA 1J1UA 4CLRA 4FMCB 3QW4B 3PHJA 3B6MA 2P40A 1YL6A 2EIXA 1LBQA 3VPXA 2JAOA 4W7HA 3EFOA 1RQPA 1UXHA 4NPAA 2ORVA 1BQ4A 1Q1AA 1X1EA 2V8BA 2ZJBA 4FVTA 5BQOA 4I50F 4JHLA 2GJ9A 2VDUE 1SWVA 2AS0A 2BMDA 1WMFA 2PGIA 2WJ6A 3LCCA 1FYXA 3KJFA 1X1SA 3WLQA 5BWMA 1QE3A 1IN7A 3DZKA 2ZR7A 2F59A 2BM1A 2R47A 3U9SA 3ADCA 5LMCA 4BWFB 4U7DA 4TVSA 5ITWA 5KMGA 4TLDA 3PDWA 1M75A 1VHJA 4LBVA 4Q9KA 1Q1EA 1QO7A 1THZA 4O2BA 2P69A 2C2GA 1VRVA 1YDMA 2OFFA 3PTAA 4ND6A 1NVVR 2FP4B 2D3WA 2I22A 2XGOA 3DT8A 3PCXA 2MHCA 3TKAA 1XZMA 4YJ2F 4D8UA 3NVKI 3EBPA 4CLOB 4BCDA 3O03A 1B74A 2WC1A 3KUCA 4H2DA 1B0UA 4TV9B 2IDMA 2XA1A 1TA4A 2ZUTA 2AJBA 3UB2A 1II8A 3ROQA 4CMIA 4B35A 4Q7QA 4FFMA 1YJQA 3OI7A 4YECA 1YCFA 2OILA 1QNFA 2CF5A 2AOTB 1NUQA 2B5WA 4IX9A 4TQAA 2Z8YA 5D00A 5KOHA 4JBWA 3KKKA 4JJAA 1EFRA 3FB1A 2P5UA 5EHZA 5IXSA 4K5QA 1SXJD 2WRZA 3PNVA 1FFXA 3F97A 2C5LA 4H59A 3ZZ1A 4ND5A 2JJQA 3A4VA 3AIOA 4FGLA 2ESRA 5DHAA 5TQ2A 1WUJS 3DQPA 4HRXA 3SC3A 3T54A 1BCRB 4IS2A 4BVFA 3V4PB 1NONA 4F5ZA 1N5KA 1OFTA 2CXSA 3O4GA 2VQFB 5TT0A 2IHZA 1Z75A 1IZZA 1NI4A 2I62A 4H3HB 3NGMA 2PLRA 4QPNA 2IKSA 3T1VA 5JSQA 3G13A 2AV6A 4MCHA 3V9PA 4CT4B 3WWDA 1Y8QA 1SCJA 8GPBA 2N75A 4DARA 5C46F 4H35A 5COQA 2PVCA 2PRKA 3OZBA 3E15A 4RGQA 3AB3A 5DXFA 1VSUA 5BPHA 3NTOA 1JXAA 4H7KA 4RHTA 1SJ9A 2GNOA 2OD9A 4BFLA 1A9XB 2GEDA 4FM9A 1D6NA 4LDAA 1C3JA 1ONNA 4YP6A 1NULA 1GLNA 1H2XA 1NDUA 4ISCA 4ES6A 3DZHA 4P81A 2XIJA 4BC1A 5ARBA 2WAXA 1V5GA 3IBGA 4GRIA 2NSLA 3L4JA 3KUXA 1WJGA 2G7MC 3KR2A 5CM8B 2ACVA 3I09A 1EQ2A 4W8GA 2BWJA 3TZKA 2HHJA 1C7IA 2PXAA 4XOIA 1B3BA 3I8SA 4DBZA 2GERA 1NJ2A 3V1NA 1GQFA 1I0IA 2I4OA 5EHQA 3KG2A 4LJRA 1VIDA 3ICCA 1GZ5A 3RTCA 3QVSA 4G8BA 3QM1A 1QDUA 1Z62A 2B37A 2BSAA 2QLMA 3B9PA 3MWJA 4P3KA 3TTUA 3IAS1 4ZICA 3HE3A 3NBFA 3EUWA 3ZOKA 1T2CA 2MSDB 4KDFA 4RIFA 1Y5RA 3U13A 3VR6H 1MABA 1EXWA 4G0UA 1P5ZB 1E1NA 6CHYA 4C78A 3U7RA 1FFEA 3J7TA 2NTJA 3L46A 4RTQA 3LHKA 1O6CA 1YVUA 2IHYA 1W1WA 4WJZA 2IYPA 2QVZX 3A4MA 5HZHA 3GEHA 1GR1A 2VSFA 1BVHA 1GARA 1LU9A 3DTVB 3ZKAA 4BAZA 3CEJA 4ITUA 2WHEA 1KZGB 2J3QA 3WHLA 3JSXA 1GYPA 5I7EA 1W94A 2IZ1A 1DV1A 3KVVA 1FDRA 2WUWE 3B3AA 1JAHA 2X8AA 4Z99A 1U0RA 1M5UA 2HC9A 4RLQA 1CJMA 3VC7A 4KHPB 4IJ6A 1FNBA 3X1JA 2YOGA 3LAWA 1JFTA 3GGJA 2QAGC 2JFOA 1OI7A 1X94A 4YRMA 1Z13A 5K45A 1R4NB 1JLMA 3FSJX 4CGZA 2VT3A 4HPJB 4D45A 1RXVA 2F9LA 3O74A 3QLUC 5L4NA 5FLXA 5B4TA 1EUQA 3K0FB 1UBUS 1WVIA 4FYHA 1F7UA 4FFBA 1SIBE 3M6VA 4LYGA 4EPWA 3EZGA 3T1HB 2QRNA 3F9RA 2EEZA 2DY0A 3LU1A 4RANA 3RFVA 1X86B 3M83A 3M6LA 4HL6A 4AF7A 4EFMA 9LDTA 1NF2A 2OESA 4U9HS 1TTTA 1MZVA 1Q44A 2C2YA 4XVCA 1Z4JA 2MT9A 4LDQA 3ZBQA 3GGDA 2QE6A 4MCJA 2AMFA 3S2SA 3HVHA 4B32A 4A3SA 1U8TA 1JLKA 4BL5A 1G2IA 3U5TA 1O6GA 4CTNA 1E9RA 4QVKA 4DR5B 2H1WA 1GOTA 4DEXA 1YC5A 4NK5A 1LX7A 1IOVA 2EU8A 3R3HA 2IQIA 1GTRA 5CFNA 2X1MA 3T7EA 1GZSA 1GA4A 2NYRA 2PN1A 2RHDA 4N7MA 3ZS8A 4RHFA 4CTOA 1DRJA 3UYKA 2F1HA 1KEEB 2CKDA 4B9EA 1KOLA 3IPRA 4WOBA 1CUJA 3ZU3A 3GZNA 3VO9A 3A1WA 4C01A 4DQLA 3BE4A 5G3YA 3DYVA 3E5MA 3KJXA 5LB4A 4B2YA 1T5SA 1AM4D 1FLNA 5I4CA 1Z33A 1GTVA 4K6FA 2H07A 4YMHA 1D3AA 4Q93A 3H18A 5EEGA 3D8HA 4HAIA 1TCCA 1KR2A 4R1UA 1DTSA 4JN6B 2JGMA 1H94A 2QTHA 4Q4JB 3WK4A 1JR3A 2IFTA 3K94A 3QOWA 4WERA 1KPIA 3A04A 1I1HA 5J2TB 1N2EA 4RSRA 3BAFA 5CDGA 1CS0A 3C1TA 1E3MA 1WXHA 3GEMA 4S1PA 2ZE5A 3QXCA 1SQSA 2IKQA 1YS4A 2WKRA 2XOKA 3BL5A 3CO5A 5EKDA 3TL2A 2FK8A 2DUMA 7REQA 1NMXA 2GD6A 4LV6A 4AMZA 4UFPA 5HNKA 1U3CA 1FCJA 3EXFB 5A5GA 1JHXA 1GKUB 1U3WA 1X7YA 1XMJA 3QVTA 2PMWB 1TUGA 3PPXA 5JS6A 2QXUA 3ZWKA 4L3VA 5CDYA 1ZGJA 1K6EA 3JPWA 3N28A 4EPYA 3RVMA 2HFJA 1THGA 2W2QA 4YRJA 3ZBPA 4UJ3A 3UJAA 1Z9BA 3CMMA 4MWGA 4DCTA 4Q6BA 3URKA 5ER6A 3OTQA 3KOYA 1L5QA 3THRA 4FGSA 4YUYA 1WMSA 1WD7A 1JTVA 2VAVA 1ZM2A 3EZYA 2P6OA 1MUUA 3D3WB 3TW8B 4DMCA 5EJ2A 3ZHYA 4BX0A 3ZJUA 5CW1A 3UMSA 4PC2A 1KVTA 1E79D 2NO1A 2QVLA 3DHWC 1YQQA 3LIIA 3N5CA 2UVPB 1XI2A 3H2GA 3DOHA 2W58A 2FVXA 3SYNA 3WSVA 4HNGA 5E7MA 4UZFA 4Z9XA 3ER8A 5KI6A 4B76A 2IS6A 4NEHB 2UUCB 1CULC 4TROA 2RFLA 4HXEB 1OWOA 7MDHA 1FBTA 2P41A 3DEIA 4KXNA 4HFRA 1IU9A 1I2MA 1QMPA 1SUEA 2HDWA 1K5HA 3D6TB 4DG9A 2J9RA 3EVZA 1SA0A 1MO6A 3TDKA 1O97C 1WNTA 1H6DA 2FI1A 1M3SA 1DAKA 1B23P 1QHXA 1XD8A 1A88A 4XJSA 3OUZA 2AJ8A 1QGZA 1SFRA 4BS9A 4YASA 2DVMA 3N7TA 2PYDA 1OIWA 2X2EA 4KBGA 4MWZA 5JO9A 3JQ8A 3RT7A 3RSFA 5EP3A 4D9CA 1I0ZA 5DGXA 3JQ9C 4OQZA 3NKFA 1KKMA 2A0YA 3KYDA 1UAGA 3AGQA 3H5TA 5GM1A 1FFCA 3BREA 4RA9A 3STUA 3WWYA 3R23A 4B3RB 1BFKA 2H18A 4JAVC 4H1UA 5EPEA 5T3UA 4HS9A 3S29A 4W5RA 3Q7TA 1WMEA 3ILYA 1D1TA 2XUJA 4FZRA 4LWPA 4OMFG 2V0CA 5DT9A 3IKTA 1FSGA 3QH4A 3R20A 2WB4A 4HJXA 4PICA 3W90A 1VRCA 2ZOSA 2HV9A 3SNHA 3WAKA 3BHMA 3ECSA 2EF0A 4P33A 3DWIA 4JKIA 4RXTA 4WLUA 1HTBA 1ZKMA 3CRMA 5FPPA 1X19A 2AQHA 2GYVA 1Z3CA 3KEQA 3TSZA 4E0BA 1RPZA 4A36A 1AQUA 2OD2A 3GPIA 1GZVA 4QFDA 1Z0ZA 2HY7A 2B4YA 2JIPA 2XX3A 5K3OA 4JLKA 3LPMA 1LC3A 4L0CA 4LOLA 1ZJZA 3EDMA 4IJUA 3EW9A 1CVRA 1B0AA 3DL2A 2AG6A 2VPQA 4KJZA 3SXUA 3TX2A 3AKCA 4FDUA 2D0PB 2B21A 3I1IA 5AXDA 1QIEA 4RJJA 3WL8A 4IFTA 3PKZA 5DM1A 1UBTS 1GNTA 4R7ZA 3SF0A 2ZSBA 4QSMA 4GRDA 1EIZA 2EFGA 4JYCA 3KQKA 2BD0A 1RI4A 2JFUA 5J1TB 2O06A 4Y2GA 4QYIA 1ZITA 1ZK1A 5C8YF 3LQKA 1GY8A 1V48A 1CR0A 4IYJA 4E30A 1DAFA 4CMCA 1FYWA 1N6HA 1FSZA 3AI7A 2C4UA 1NHGA 2CMHA 5ESRA 3DKPA 4L28A 1UMDA 5DZSA 4BWGA 1JJ7A 1QSGA 1EWVA 1M2OB 4WFJA 1Z25A 1JPVA 3JATB 1PGPA 2B3DA 3HDGA 2V1XA 3R09A 3GAMA 4FJ1A 3GFVA 2XADA 4E5YA 3FUXA 3VZSA 4CDRA 4FJ2A 2R44A 4ZDJA 2YN2A 3PT5A 3AUYA 5BW5A 1XDZA 2BGLA 4JX8A 3IB6A 1V2GA 1KXZA 1ZRMA 1VGQA 3EGXA 3GRZA 3PXUA 4GI5A 3EXHB 4X00A 2D59A 3CZRA 3IDQA 3VR4D 5KHLB 1YIDA 2C2KA 1H42A 2OLJA 4N03A 2QRPA 3KJNA 3UOWA 1EFCA 5P8WA 1XA4A 3ZZ0A 5A4IS 1K8RA 3RKSA 421PA 4F06A 3IEUA 1Z6XA 2OHOA 3KXPA 2DWQA 3OSZA 3B2QA 1MRZA 5B1YA 2ZZMA 2OCDA 3BXPA 4ZVMA 3V5NA 1XQWA 1MJGM 4C4PA 4RHYA 2F43A 2Q1XA 5AHKA 3S2UA 5BQPA 2PEYA 3RUPA 1KY4A 4DQDA 5I5EA 1SVNA 1NRXA 5IKPA 1PZGA 2XB4A 3I05A 1BSVA 3DYBA 5ADHA 5IS2A 1NGSA 3OT1A 2W5UA 2HQBA 1OROA 3SSNA 4XTCS 3HN7A 1KQGA 1JYSA 1WXWA 2BPOA 2P67A 3PKJA 2WT8A 1XRQA 3ITDA 4CLDA 2PL1A 2EJCA 4J1TC 3S6JA 1FDTA 2G1KA 2GF0A 2YWHA 3UUGA 3OM0A 3B9QA 1DBIA 3DAFA 1R8YA 4WBSA 2RH9B 3X2EA 5EZYF 3KZMA 5LLDA 5DTJA 4KR6A 2ISCA 4L8VA 3KKZA 1XHFA 3G7SA 1KS2A 4IGKA 5F76A 4B1FA 2Z6QA 3IL2A 1R0WA 4LZPA 4B4UA 4CMGA 2JFYA 3WMXA 2FCRA 4PSDA 4D25A 5E3IA 2ZSAA 1Z5OA 3IVMA 1RM0A 5A7GA 3LXXA 5JXGA 4ZO9A 2HA4A 1TQ6A 1WULS 1MGOA 1SHZA 2G08A 3OU6A 3RARA 3OU2A 3TYXA 1Z0KA 2OY0A 3PJGA 2XTAA 4JIMA 4Q7EA 4KFTA 5CVJA 1PNRA 1W47A 2WFLA 1G9SA 1UH5A 4URHA 4V0NA 3IUPA 3ANNA 1E61A 2IX9A 4CI9A 3VO8A 3VNQA 3FH0A 3H97A 4M86A 3REGA 1JU3A 1PWHA 4EY8A 4GGPA 1E94E 4IDNA 4R5HA 1QCYA 2XYGA 1J56A 1NBWB 4EG1A 1P4RA 1Q77A 3FTCA 4R9RA 4IIHA 4IYRA 3G1WA 1EJ0A 2J5KA 3QBDA 5DMXA 2NZYA 3UT5B 3L8ZA 2DRIA 4CGYA 4NENA 4E22A 3IYLW 5LYJF 2OORC 2R7MA 3RB8A 4ZYUA 1VHTA 3QE0A 1WW3A 2ZZKA 2IYWA 2WYUA 3K9QO 5E6RB 1A9SA 3ETDA 1UPBA 2WVHA 2XCLA 3JQAD 1A8HA 4H3SA 2IU3A 4NJMA 4MUMA 2R5WA 1L1QA 5DYGA 2AHRA 3K9LA 4RV4A 3PI6A 2XGJA 2EL7A 1FRQA 1VLLA 4ASUD 5DWQA 2MDTA 1J1IA 4C5CA 2V4MA 3UBTA 1WP9A 2GILA 3I8XA 4MLCA 3LCUA 4BQQA 4B3FX 2HHAA 1JHVA 3I42A 3MQFA 3Q8KA 2ONKA 2QA5A 1J8DA 3EMVA 2AMYA 2I54A 2PRYA 3A4NA 3MC1A 4NYMQ 4ZT4A 3UFBA 4ENWA 3M1IA 2HXYA 3K32A 2Q2WA 2EKBA 2IUTA 3DEKA 3KTAB 4MUXA 4U7JA 4O4JF 1LXCA 1RZ3A 3AB7A 1NMYA 4OHCA 5IWAB 4RJ2A 2YHIB 5GJWC 2QTWB 2WTAA 1NJ5A 4TM8A 5FLEX 3ZW9A 4F4HA 3NTLA 5KVSA 4KIFA 1TEVA 1GA1A 1KC3A 4UBKA 4LQ4A 5EQJB 2P6RA 3I4LA 5L95A 4G8CA 2HJVA 3A6DA 1MFPA 3LLSA 4RVFA 5L40A 4Z1MA 3C8HA 5M29A 1CUBA 1EGQA 1KFJB 4W6QA 5LLSA 3RRFA 2I7TA 4DM3A 3N0TA 2WNIA 2X22A 1Y5MA 3K70C 4RTNA 1YBFA 3J80A 5MFPA 4KO3S 1N6PA 4R1TA 3HCWA 3P26A 3BZBA 1USKA 4WZAB 2BF7A 3N70A 1Z73A 2H7YA 2FEAA 4BBZA 1CG6A 1GPWB 3O4VA 3STVA 4GT1A 2XKBA 3BRQA 1ZVVA 1XFDA 3FI0A 4YV2A 5A9SB 2OZKA 2FP4A 3DBRB 1E6MA 2O2HA 2VAXA 3HMKA 4JYMA 1JHMA 1T9BA 3NHUA 4N5DA 4MHOA 5A4JA 5CT8A 2I8AA 4CLOA 4M9XA 1I4EB 1TA0A 4JXKA 3PEWA 3WAJA 2D1FA 1RR6A 4JL6A 4TV9A 3NC1C 4FJ0A 1IUKA 2P9TA 2PT7A 5T67A 3ZX5A 3U44B 3W8FA 5CEFA 3CZQA 5F2KA 4KX5A 1HL7A 1PYGA 1ZOPA 2AOTA 4DILA 1G4HA 1NIPA 3T0FA 3LFHA 2WEKA 4LHWA 2ZXFA 1A04A 4N9QA 1K7XB 4ND3A 5TX7A 3UV3A 4JC4A 4KCGA 4QBGB 1RFGE 2YIJA 4E4TA 1KYTA 4RIHA 4EKEA 5BUQA 3S8MA 4GDFA 1BCRA 4MYUA 1Z45A 1OXTA 5FFNA 1WRBA 3CVJA 2FPMA 3GNQA 1DBPA 4G25A 4LJ8A 5FA5A 1V7PC 3ZCUA 1O94A 2WE8A 1J9GA 4MI1A 4F97A 1XCBA 2MYTA 1S02A 4Z9YA 1ZNQO 1X14A 1IHYA 3PP8A 4TLEA 4M0PA 5CFMA 4PIPA 4ANFA 3VQTA 3DD5A 3HVRA 3TXYA 4K6MA 4DYDA 5C8DA 1N6OA 1M7BA 3H8JA 1W73A 1MZPA 4FWIB 5CFZA 4OB6A 4CMEA 4ZEMA 3GARA 2CE7A 3QLUA 1N34B 3ORYA 1HQYE 3U7IA 2P9JA 2LBPA 1A9XA 5EAIA 2HRBA 1PRYA 1UANA 3GPDG 5ER9A 3IERA 1DO2A 2CFCA 1PNOA 5IAAA 4E2YA 1LGYA 2VTKA 4H3VA 4XSHA 1AT1A 3OFJA 3ZD9A 1R16A 3GNTA 5LIPA 2B8NA 1UDRA 5DOVA 5LZ5A 1W87A 1FNCA 2H1LA 1KJ9A 1BA3A 3QKRB 3ZY4A 4NPCA 1JHQA 4JLPA 4CBVA 4FMPA 3TEFA 1L3CA 2JFWA 5CM9C 4OLFA 2AH5A 5EJ4A 3KKNA 1E69A 2GRAA 3SZOA 3ZWCA 4J0JA 1R5JA 1ZP6A 3AFMA 2ZBGA 3H6HA 1LV8A 1GU7A 5BV2P 1A69A 3RFXA 5CLLA 3MG9A 3TR0A 2KBFA 3K16A 3WNVA 3DL4A 4LZLA 3EXG2 1EU1A 4YREA 1T8WA 1XXHE 4IQ4A 3N87A 2W48A 2WWXA 1BMFA 4QRIA 2CHFA 3HDQA 4YO7A 3LCJA 4DEYA 4JKOA 5M7EA 4JUBA 4R9UC 4Q12A 1HTTA 1ZO8A 1T5OA 4D8TA 4ND4A 1NZDA 2VS1A 2PX0A 1YJCA 3DTVA 3MPOA 3IGFA 2V45A 1SM4A 4PYKA 2VT6A 5HK8A 3WJ1A 2X58A 3L7KA 2DECA 3I9LA 2D2EA 3IIJA 2AUTA 4HDRA 4N0QA 4UD6A 3C7KA 2DJIA 2VEOA 4YQYA 2V7PA 3PFHA 1I4LD 5IAOA 2BTEA 4Y9TA 1G55A 1KP3A 1PZHA 2UXDB 3UK0A 5J43A 2IY9A 1Z26A 1ZUHA 1VE3A 3D2AA 3A3PA 3Q5DA 3RJZA 3DCNA 2NVBA 3EGDB 1XEWX 2PSHA 2EWWA 3Q0TA 4D3FA 5BVGB 4JJKA 1KOFA 2UVDA 2REXB 3BFKA 4HDOB 3IBCA 4QBHA 5TARA 5JH7B 2XZTA 1R4NA 1RWOA 3I83A 1AQIA 3DB2A 4MI9A 1II9A 3P9SA 2D4HA 1POWA 1QOZA 1N6LA 2C42A 3K0FA 3C1AA 3KD3A 3N8HA 4I08A 4P4LA 5D86A 4WGFA 1MIHA 3H19A 2RHMA 5FHQA 4EG6A 1TEZA 4C5AA 2GTHA 2R25B 2UAGA 5JI3E 1E8MA 1DOHA 1WS6A 3V32A 5IVHA 1SOAA 1XMXA 4KVGA 4RVGA 5E7QA 3ZDQA 5AVSA 2YY5A 3DQZA 4IP0A 3UY4A 1CEQA 2YRWA 2Y1LA 3HJHA 3K6RA 4OQQA 4QQRA 1TVEA 1UP6A 3Q15C 2GPNA 4LJKA 2JKZA 4PZAA 5C3UA 5THXA 5U9CA 4WK4B 4H31A 1G20B 2HGZA 4NU0A 1CTQA 3IAEA 1BFDA 4LBZA 1UOPA 5KB3A 1Z06A 2I2AA 4KIWA 2Q0QA 4UZEA 3LE8A 4FCWA 4QREA 5EXSA 3EQ2A 1DL5A 2J3KA 3DJYA 1JLRA 4CLHA 5ALIA 2NXWA 3MYRA 4LXYA 1KEEA 3MTBA 1SC3A 3WFJA 3N05A 1VE1A 3RG2A 2EYUA 3LW7A 3EEFA 4JR1A 4UCQA 3Q7PA 1IH8A 3GD5A 1ZHFA 3PEFA 3BICA 4F60A 3I1FA 4M54A 3D64A 2IEAA 1QU2A 2GBFA 1XVLA 1BKDR 3JQ9A 4NOLA 2RH5A 1VGRA 3ESXA 2ZJ8A 1YXMA 4PGHA 5IBRA 1HURA 2ANBA 2DWOA 3UNXA 3P9KA 4Q4JA 1TO6A 2QMZA 1D03A 2BI8A 4LDZA 1BX0A 2YKGA 3HL4A 1QFZA 5J2TA 1A77A 1UBLS 1XZJA 4FHZA 4D9JA 1FOEB 2SKEA 2G5CA 3GP3A 1PKEA 4OM7A 4ZVOA 3DZJA 1BCSB 3CU5A 3PUHA 3WRVA 4XYLA 1M2VB 4J0FA 3CW9A 1XZEA 5HE8A 4BBPA 4RTSA 3F73A 3EXFA 2OHXA 4AW9A 3O8LA 3TLBA 1B6SA 3V48A 4RAQA 4A8TA 2IDZA 5WRFA 4ACBA 5JXWA 4ZAWA 3ZW8A 4C0AC 5I4KA 2UUAB 3QZUA 3DE0X 3RJTA 3ET5A 1HZZC 1ZICA 1VZ3A 4AG6A 3RKRA 1E60A 3UT0A 2ZYSA 5IEBA 4GOND 1H8HD 4L8GA 1KMNA 3VHLB 1FTWA 4KLNA 4PC3A 5CFRA 1H0KA 3PQ8A 4PLPA 4UE2A 3D3WA 1FTGA 3TWOA 1XMQB 2HT1A 5FWDA 1NF8A 4OOEA 3IP8A 3JVUA 1ZC3A 2YXLA 1PNQA 1JA0A 2UVPA 2H6EA 3RVLA 1HMPA 3RC7A 4E94A 4CMAA 4N6NA 1A9QA 1UWVA 1QKIA 1LB1B 2I6SA 2QMEA 1FYEA 4NRDA 1UAAA 4BOYA 4M0UA 1MX3A 4MRVA 4RJLA 4OP1A 4ZXPA 3DZDA 3L84A 3LP5A 5EYPB 2MIIA 1PCXA 5B4VA 5JFOA 3OIVA 4JC8A 3COWA 1NNUA 1HT0A 1L7XA 2JFFA 3CZ5A 3KB8A 4IH9A 4L5AA 4NCHA 4PPYA 3WICA 1YZUA 4EW6A 4UAVA 1O6BA 1Y6RA 1ZNYA 4TKZA 1JALA 2NN3C 1NQVA 4PLZA 5BQ3A 2Z8YM 2QHXA 1S7CA 5ALKA 4A0FA 4NOMA 4MGHA 1MB3A 4FS3A 1KWGA 2YN4A 4JDPA 3Q2KA 5C4MA 3E5NA 1C7FA 3EW7A 3G85A 2QUBA 2CT8A 1I80A 1YE5A 4GBJA 3MGBA 4WZZA 3UWMA 1VL0A 3MUOA 1DO0A 1N75A 1RMYA 1YIOA 2XVMA 4PFQA 5IABA 4Z8XA 4J90A 3PQ7A 4IGFA 3VU9B 2VK8A 4MYHA 3FOEC 1PR9A 1GPUA 3DDWA 3C16C 5CYOA 3RADC 2QUAA 2GSWA 3BCHA 2B82A 2VP6A 3IOBA 3O31A 3IUQA 3VKVA 4PG4A 2A5GA 1B16A 2VJOA 1A2QA 4M1EA 3GRYA 5TQVA 2FSSA 4IM7A 1Q1NA 2QN1A 5H3LA 5BSTA 3BWEA 5IH3A 1VG8A 3W8EA 4MGYR 3KR1A 1E20A 1U7TA 2VA9A 1TM1E 3OOHA 4QGBA 3U7JA 5B2FA 2XQVA 1CXZA 4AS3A 5DRTA 4E07A 5HGXA 1USIA 2FUKA 4BTLA 3F9CA 3GEEA 2XTMA 3D7SA 4YPVA 3HYLA 1W1IA 2EBHX 2H4FA 5J2TF 2J9FB 4WAUA 5JR3A 1BVUA 4XWAA 3FVQA 1YZNA 3PC8A 3FGPA 2DBVO 1GPMA 4M21A 2N0SA 5TS3A 3ICQB 1QOQB 4R81A 2J9ZB 3PSHA 2XW6A 1N3BA 1R0RE 3BSYA 3FXAA 5FP0A 4BP1A 3MS4A 4L85A 1Q22A 3WADA 5K6AA 4O25A 1S2OA 4GMFA 4BVEA 1J90A 3AHJA 2YYZA 2VAPA 3GGOA 3O9MA 3RTGA 2C7PA 1D9XA 1GYQA 3RLFA 3OP4A 3QWFA 4KN9S 3C24A 1XDUA 1AX9A 2H8GA 4NI5A 2G88A 1YA8A 2VG8A 4O4HB 4OHFA 3FN4A 2H4WA 2ZIFA 2ZQ5A 1VG9B 4XIJA 4AUEA 4NV0A 4I4CA 4ZJPA 1QLHA 3P0EA 2IBMA 1YB2A 5CVUA 2PZJA 3E27A 1M2OA 1FFGA 1VIVA 3GMDA 1K08A 1ZNZA 2NO6A 2Q5FA 2F3QA 3IJEB 3JATA 5KU7A 1NE2A 3IRVA 1UJMA 1ZJ6A 1AA9A 2I76A 2D0IA 1CNEA 1G5HA 2JCYA 4F5WA 3Q7QA 3ZR4B 1JUDA 1T24A 1ZKDA 2FSHA 4O1MA 4OIMA 4YRLA 1EUDB 1XALA 1GFSA 3EXHA 4H4EA 5JDIC 5JYDA 4LTDA 2Q9UA 1U2TA 2JIQA 1OLXB 3SYMA 1X3LA 1XF9A 1G2QA 2CBZA 4TWIA 1UFQA 2CMFA 2X6RA 1XTQA 2XNHA 5HF6A 1L7PA 1V6AA 2G4LA 2FSGA 2TECE 4NDNE 3OCJA 5FBVB 4YMIA 1RYHA 3PNLA 4NBVA 5I9BA 5JVDB 3TVTA 4QDOA 4G97A 3RVRA 2WSMA 1WZEA 2XNDA 3EQ9A 3I2FA 1AK9A 4KNVA 2JASA 4G67A 4MB6A 1CEEA 3KXIA 1H1LB 2WTMA 3T3GA 4YYEA 1V41E 1GQYA 3V1TC 4PLVA 3GGCA 2XXJA 4HYTA 1JIUA 1W4CA 3TF5A 3ETLA 1E2MA 3B3FA 3HDYA 5HCNA 3HDTA 2DQYA 3CUYA 1J4AA 2NPIA 2YMMA 5L3RA 3UT6A 4BFCA 2AG5A 3WI7A 3PQ3A 2YVUA 1M34B 4M9CA 4Z6KA 5BMOA 1VJ1A 3LGXA 2FWPA 5C7LO 3MUFA 4AZSA 3A6PC 2FSPA 2DULA 3BTVA 3HYCA 4KPGA 2X77A 1L5ZA 1AUPA 1T2NA 4JLNA 4XPZA 5A1TA 2CXRA 2F3TA 4I0WB 5AVTA 4QM6A 1VSQA 4QUAA 2ZU6A 4LE0A 1TK3A 3DFKA 4X6YA 1YMQA 3B5IA 1PGQA 1V1MB 4B3HA 3HXOA 4EW3A 1WU7A 3QX8A 1XIVA 3VR5A 2BUBA 3TKYA 4JU8A 1EK2A 5K0LA 5AVJA 4HYQA 2FN3A 1CUWA 4ZALA 1LF5A 2GN0A 3MFYA 2VJAA 3CB2A 2RCNA 5A3VA 1RPJA 3AZOA 3Q3HA 2IYQA 3KLNA 1E6CA 3QU2A 4TN1A 3DKIA 1T0HB 3H9GA 3DLIA 3AM3A 5HSGA 1QJ4A 1HRKA 2CY0A 1CY0A 3QU9A 4DR1B 1DRVA 1MCZA 4TS1A 1RXWA 3AM1A 1NKTA 4I4NA 4F5YA 3CFYA 2OGSA 4LC9A 4QD3A 4XD7A 2HTFA 4JYPA 1GA6A 2COEA 1CIJA 2X8WA 4ZTBA 2K2WA 3QF4B 4X8LA 1UBKS 5CGQB 2XZOA 1SG9A 2EQAA 2P6NA 1JVSA 3IT1A 3UYLA 3TFQA 5HF5A 5K0GA 5KWJA 3EN0A 3LBIA 4D4JA 4Q3AA 4LQLA 4JBYA 4K9SA 1NVDA 3AXSA 5IHXA 1KE1A 5EJ7A 1BN6A 3VR4H 2W2OA 3EB9A 2F2TA 1L5GB 2X1LA 2YMLA 3R6DA 2X8BA 2FE1A 2ZYDA 1UODA 4R2KA 3UT5A 4Q7KA 1ACJA 3W1VA 1XNGA 3ZDZB 5I7HA 5K4GA 5KJCA 3J7AC 3B13B 1PDWA 1I7NA 3GU3A 4Q1AA 2P5TB 2O2SA 2H4HA 1SR8A 3ZDEA 5DNUA 5E6RA 3FA2A 5LKRA 3MEQA 4HPWA 5D7NA 4Z3OA 3U0VA 1U9IA 3AEUA 4RPHA 1SXGA 3GZJA 4KLZA 4BEJA 4J76A 1GNVA 3KR0A 5KHAA 2XNSA 1AZLA 1PGOA 3C4QA 3G88A 1IHDA 3BRWD 5IBQA 4LRQA 1OXBB 5K03A 1EM8B 1G4UR 3SHFA 3USCS 1BDIA 1JAXA 1UOEA 5D84A 3IIMA 3DVQX 2VUHB 3HNOA 4JJIA 1N25A 3MRVA 3ZNOA 2I3GA 5CFQA 1MQAA 2I1LA 3I58A 1PV4A 2IE0A 3SN6A 1QV6A 5FXMA 2WNSA 1WHSB 3SFTA 4QDTA 2R96A 2CMGA 3KTAA 4NARA 1RTKA 5BYKA 5TEWA 2Q4EA 1WQ4A 3ORQA 4G01B 2DPYA 2UKDA 3VI3B 4EJFA 1SB8A 5EERA 2W6QA 2XSZD 4MOWA 4HSEA 3DVLA 4UDNA 1K63A 3CRW1 3D1JA 4FT2A 1VL2A 1WZNA 3BWMA 1E2IA 1P33A 3IOYA 1AO3A 3OURA 4FYXA 4YCLA 1RLMA 2QM3A 2OAEA 3L0BA 4P83A 4GW3A 4QUEA 2QU7A 4N7RA 3FD8A 3BMQA 2GAAA 3OTHA 4R1SA 1JGTA 1F0KA 2DLDA 3IAS6 4LXTA 4NH0A 4V3CA 5EWMA 1GR0A 3TQOA 3UHPA 2KB0A 2ODBA 1TMOA 2AYXA 1AXGA 4WZAA 3UBMA 4LYYA 5JS8A 1KEPA 2BEUB 5TT1A 1K98A 2LD4A 4NF2A 3OKPA 2XYPA 1PLLA 4F8YA 5K5EA 1R0YA 1ZU4A 2GEKA 2WMYA 2X1HA 4MV6A 4K9RA 4OK5A 2QKYA 4KLRA 3S68A 5BNFA 2PL9A 3L6OO 3DBRA 1D1PA 4W9RA 5SICE 1JW9B 1HDCA 1JPUA 1P19A 5G2OA 1PJRA 5JALA 4B7UA 3T99A 1KAMA 2LDXA 4F3TA 1OZFA 4Y6LA 4Q9JA 1E0KA 1JAZA 1QTRA 5FTNA 2FNAA 4C30A 3VTFA 4M1SA 4P2BA 3GIDA 1RJGA 4XLLA 4PG8A 3T1OA 5K09A 4LGYA 3U44A 3KDAA 3H1EA 1TUIA 1H1DA 3GJ3A 1R5BA 2BMVA 5JQGB 1OPRA 1R0KA 4L5IA 2CLHB 4AZWA 4D26A 4YRIA 2AMJA 2M98A 3L7OA 2CLCX 4A2CA 3MGGA 3AKDA 3KKOA 2VJDA 1I36A 3IQFA 3OPYI 4O8ZA 1H2BA 4CV1A 1HGXA 5DPMA 2JHGA 2OA0A 5BYJA 3FOZA 4RMNA 3KAQA 2R8RA 4RZXA 3CNOA 1ODSA 4R2WA 4GOJA 3VPGA 2GO1A 4A8PA 1DPGA 4NJOA 3KWMA 2QF7A 4K3VA 1T8UA 1D6MA 2JBWA 3FETA 3OM9A 5D1NA 1SUBA 2VZEA 5IDVA 3AR7A 1KP9A 4GKVA 2Q49A 3PT9A 5ICSA 2B0CA 4FU0A 4EJSB 1QIDA 1KYQA 4X7BA 2XUQA 1JKXA 1D2EA 1RBMA 2JW5A 2NW6A 1S2LA 5A3JA 4QEKA 1A7AA 2PU7A 4L07A 4YMVA 3RYHB 2C1XA 3PUXA 2D5LA 3WOHA 4MVJE 1L5MA 4B84A 1C29B 4GWKA 4F1WA 3GBSA 4AIIA 4CM5A 1ZEJA 4J91A 1MENA 3I2JA 3OZAA 4TMZA 5B7PA 1K5PA 3FCAA 4N6GA 4L22A 1TLFA 2GRUA 3AG5A 3K9GA 1KBOA 5IWCA 2V7QA 2BDTA 3U3RA 3RWMB 3QKRA 4YLYA 1ZGZA 4Q47A 3NIBA 5EZ5A 2V7VA 2DLNA 2B98A 2OKCA 3PA8A 1P44A 1MJFA 3JR7A 3LQ1A 2BBSA 2LKCA 4QA9A 5THQA 3UMFA 4V0MA 1XTUA 1EFKA 2BZSA 5HXAA 1KF0A 3A06A 3FTPA 1T0UA 3JQEA 4QTTB 4D3DA 4JI7B 2WT9A 2QTRA 4YACA 1IJBA 4CM9D 1QPZA 3BXHA 2ODEA 2A6PA 3H5IA 1FMFA 4YV7A 4PZ0A 2GS9A 1NVAA 4I7EA 4LPSA 3LUGA 1WPXA 4RVSA 1CERA 3U3OA 4EI9A 1DZ3A 4R05A 5K0JA 3SE0A 4ZGBA 5CDUA 3GFBA 1BXKA 2WSLA 1NFFA 4RTMA 3AF5A 3LECA 4QX6A 5F7XA 2BGJA 3RSGA 3N58A 5DLQC 1W0CA 1RU3A 3HXPA 3TIFA 3CLRD 4C4XA 2Z6UA 4YI3A 3GJ8A 1U2RA 4B3XA 2AJLI 3AEZA 4D4KA 1U0BB 2F9MA 4FLMA 1GKIA 3OHPA 4R54A 4ZVTA 3X1WA 2OOSA 5KO2A 1FDOA 3U7HB 3NPMA 4TXLA 1Z6TA 1L4UA 1H05A 1E7MA 3EGDA 1DWQA 4MPDA 5JCJA 1JVBA 1RJEA 1GEGA 1UKCA 2MSKA 1RXYA 3G8DA 4WZBB 1PEKE 5AI6A 1G38A 3AERB 2G9ZA 3NP7A 5JH7A 2C00A 1SKYB 3JRNA 1E32A 2WJVA 2FWMX 3ND6A 4K9OA 3RVPA 4M0EA 4DPLA 3OLQA 4GWGA 1I4DD 5JD6A 1CU1A 3R76A 4JGBA 2VUTA 5LQAA 3FGOA 4PYMA 3SKXA 4QHSA 2DHEA 3OEEA 5FUVA 1ZONA 8MHTA 1LW6E 3GUHA 4J0HA 1IVSA 4XSVA 3PGVA 3I9V1 2WOOA 3OTOB 1ZR4A 2BMJA 2VQ6A 1V7ZA 5L8VA 4PS0A 4G41A 1QONA 3H5LA 3NYRA 3PUJA 4FKBA 1TO2E 5CX1B 5CA0F 1HSOA 4KXWA 4QU0A 1Q1BA 2OK7A 1D2NA 4DLUA 5GZ3A 1CVLA 1JXQA 1BMTA 1PL6A 3FYCA 3NI2A 4GNRA 3DHYA 3TE6A 3VFDA 3HXLA 3UB3A 3WL5A 1JXOA 1Z16A 4B3JA 1G20A 1W44A 2CC2A 3LCMA 2EQBA 3FYSA 4JLMA 2BM0A 3QTBA 4U6NA 3C98A 4UBMA 3QFHA 4MS1B 2M6SA 4Y6RA 2ZBEA 3GHYA 1KFCB 3UGTA 1Z5ZA 2VWHA 1NAIA 1NM5C 2XUFA 3HJCA 3V1LA 1IEVA 1M1YE 1MAVA 2RD2A 1JEDA 4FSXA 1XT6A 1G41A 2HJGA 2ZT6A 1Z18A 4K03A 4QFBA 4HG2A 2FQQA 5HG0A 5HIJA 3MZ0A 4K1LA 4KX3A 5EA2A 1GN9A 1CUAA 1O95C 5IT0A 3I73A 2E4YA 1YB1A 4R8LA 2B2NA 4B3SB 1M0SA 4EUKA 1N2GA 1M2HA 1PFWA 1SCIA 2OSBA 3ESRA 2HNBA 4FX2A 1L9KA 3DT6A 3A1TA 3A9UA 1Y3CE 3DHVA 4C22A 3I9JA 4CLEA 2GNPA 3WGOA 2OCPA 2CVOA 2RG1A 3HSYA 4XIGS 2WSIA 2XWQA 1W36B 5F9FA 4P4SB 1P9WA 4QOFA 4OQYA 2SCUB 3UB4A 4OBXA 1BCSA 2WJZB 2ZITA 1Z82A 3UJHA 1IBLB 1M2VA 1RAIA 3KPYA 1EGVB 2ODPA 4EHIA 1F1JA 3DG9A 4ZOAA 2O3QA 3MT0A 4OXNA 5ALHA 3V7YA 1NURA 2FP3A 2N47A 5ADUS 1FS4A 2HX1A 3AYZB 2ON6A 4E2WA 4MJ3A 1XDWA 4R1LA 3I61A 1IB6A 1E1QD 2BFOA 3GJZA 3HVJA 2VJMA 5LZ7A 5AT1A 3RS5A 4B2PA 4BFSA 4AJ1A 5C5DA 3ECCA 4BFWA 4A0QA 4ZMSA 3H04A 1J8QA 3NOXA 2X6QA 3JQGB 5LNK1 4KG7A 1H5UA 3LC7O 2QU8A 5EE9A 3RYFA 4RVDA 4X1YB 4F4UA 3EWIA 3N8NA 1P2BA 3L01A 5F5NA 3SLKA 1XQXA 3NHRA 1ZGBA 2FJUA 1RKVA 5AM1A 1U98A 1J97A 1WKVA 1T5DX 4FFWA 4F1KA 3GBVA 3PHHA 4IEIA 3MYYA 4E6EA 1OREA 3EASA 3OAAA 3S81A 3IESA 3D1LA 1E2GA 3JD0A 5LQKA 2FZ5A 5EYPA 2QR5A 4KIUA 2X0EA 3H5VA 3RS0A 3R7BA 4Z2AA 4TWRA 1BFUA 4WCDA 3UOAB 1FNMA 5C8VA 3BWYA 1G1AA 1WCWA 3MD0A 3RIXA 3TRJA 4DCGA 5AWFC 4DY6A 5D85A 5LA6F 1EFLA 1XZPA 2ALJA 3KL4A 4YAOA 1LY1A 3RYCB 4CIXA 5CEEA 4DOMA 3K0AB 1I2AA 3P7MA 5ALSA 4EDHA 2V7GA 4WPGA 2JJ2D 4OA8A 2FY8A 1K4MA 3GJSA 1YB6A 4ISBA 1H6AA 3DULA 1OHHD 3G23A 1EHIA 4IVRA 1MEEA 1GUYA 2NWQA 3DJFA 4NFHA 4S35A 2GXAA 1JFLA 3H8WA 1HDEA 2Z09A 3E35A 3L0SA 3IQDB 3OQVA 3VU9A 3FBWA 3TDMA 1EUCB 4XDGA 3TOSA 4OAOA 2IXGA 3ACDA 3BJMA 3RR2A 4G5SA 2MU1A 3EVCA 4J2TA 5IYZB 3IMEA 2IXEA 3IQIX 2AW5A 3F7MA 1KI4A 4KBFA 1B7GO 5JBIA 3E7FA 2QTLA 3DUFB 1U4OA 4LN1A 2G1JA 3DB1A 1DEAA 3MSCA 4DXDA 3SHQA 4JI3B 1B0ZA 2WILA 1L8AA 4BNXA 4L95C 1O0CA 3M70A 3VR1A 2A67A 1FUEA 1PJCA 1XHEA 2VYNA 2ZRQA 2DBRA 4K88A 4D97A 1ZA1A 3FSGD 2DAPA 2J9FA 1JSRA 3C7DB 3IDOA 4RORA 3NONA 2ZJ6A 3FB4A 2WJ3A 3GG9A 4IUCS 2DTDA 5FWXB 2OB2A 1KMCA 3B6KA 4S3MA 4TMFA 3W7AA 1Q1QA 1ADYA 2P6MA 1P9NA 1NQXA 2Y05A 3FWZA 1RLUA 4ESEA 1DKQA 2DR0A 1QZXA 3H42B 3LPDA 4ND7A 3ILSA 5A3QA 3UAZA 4BB6A 3F7NA 4JVOA 1ETHA 3UJ7A 4AX8A 3F3MA 5A0FA 3TOCA 4OJMX 5EHNA 1YK1A 1KYWA 5KKAA 3TNFA 4D46A 4O4HA 1BC5A 5AOVA 3ZWOA 1P1IA 2Q3CA 4R9VA 4RD4A 5LU8A 1YJ5A 3HBLA 1CJBA 1JA1A 3ASZA 2Z30A 2A8YA 1JG1A 1O97D 1XQYA 3FY4A 3LQ4A 4GOMD 4HYYA 3S1LA 3M9XA 1WO8A 5LDHA 5LWQA 2CBXA 2PV7A 1JPJA 5FD8A 1NIJA 1DCFA 1EUDA 1G8JA 1RAAA 3NB0A 4HLDA 4E1VA 1RMQA 1GU0A 3GG2A 4JLDA 4ALJA 1Q1GA 2H16A 2ZPAA 4JASB 3UMGA 1DO8A 3KHUA 3HZOA 4JVMA 4WA7A 1OLXA 5ECDA 4AC9A 5FOWA 1ECBA 4AN0A 2MSCB 4F6CA 1SC1A 2QS9A 1XDSA 3CNBA 5L6MB 4R9NA 4UAUA 3QSYA 2VRCD 4AJEA 1E0DA 4URUR 3UK1A 3G2PA 4LJYA 2QIPA 1SBQA 1FXWF 5JVDA 3VSEA 1ZD5A 4Q1CA 1Q16A 1JG3A 1Q17A 2XJ9A 5D7BA 3SPXA 1I7DA 4M9SA 1AUOA 1H1LA 2YJ4A 1E5VA 2HSZA 2CJFA 3F3KA 3TXXA 1CX9B 2SKCA 1CR6A 4FHEA 5F1KA 2EJBA 3U61B 2REOA 3S5JA 3VSAA 4RHUA 2ZIWB 3D31A 1A4RA 1Z5NA 2NSHA 4BV3A 1SVIA 2BKLA 1M34A 3FX2A 1MN6A 3JARB 1QH1B 1L4YA 1ZVQA 1Q57A 1VJTA 5DGDA 4JJEA 2PCJA 3L49A 2AE1A 2GBGA 3I0MA 5JJLA 1G21B 4L75A 3V2UA 4GLBA 3A37A 3WYDA 3R9IA 3LSTA 2AZDA 2QT9A 4CU2A 1V1MA 1YQUA 1Y7TA 5FAXA 1HFKA 2PS9A 1PKXA 2D4AA 4E88A 2O1SA 1NWCA 4IXNA 3ZHTA 3K0HA 3ZV4A 1EGMB 1VMAA 4L4RA 4UMEA 4JBLA 1IAQA 5DYYA 3SC4A 3IKLA 2DFTA 4EHDA 3EZ2A 3P9RA 5SY4A 4G2NA 3SICE 1ST3A 3UG7A 1ST2A 3ASYA 2PFSA 3L7LA 1XZCA 4YMWA 1DB3A 2JANA 5E0OA 4D5EA 3QEBZ 1CPYA 1MVNA 4HB3A 3CUVA 2XVZA 3GUCA 3QV2A 1V9CA 1WNFA 2QUJA 2YIVX 3THOA 1MVLA 4CU5A 4ZTUB 2PPLA 5CBKA 3AI3A 2OK8A 3QE3A 5H5JA 2NTYC 3ZXSA 4BO5A 3HI4A 3M6MD 4G0ZA 5DCLA 1DVRA 2RAUA 5DLDA 1N1MA 1P80A 1RHMA 2ZI3A 3NVMB 1FSPA 2WF7A 1PT5A 5FNVA 3QF4A 3RTAA 3IQZA 2VNSA 1DIAA 4QHTA 5BSUA 2R6DA 1SHUX 1OGJA 3COPA 2KMLA 1Q2XA 4MS3B 1DINA 4JJ8A 2IUUA 4PINA 1CQWA 5HFAA 2GESA 3IT3A 5KNLA 2D7CA 3CPHA 1JR4A 4RK1A 2HPAA 1B6GA 3FZGA 5AKIA 2F8SA 2RHWA 4UHKA 3LUHA 3W6ZA 4GPBA 1ATIA 1P0MA 2I1WA 1U9ZA 2WW8A 3TEJA 1UXKA 1X13A 4EF6A 2NMVA 1MX5A 3R7DA 6REQB 4C7OB 1DDOA 1YVRA 2QTMA 5I7FA 3ROFA 2X3FA 1IONA 1S3GA 4V24A 2V97A 5B1EA 3FVVA 3K6KA 1JG2A 4IOMA 4W4TA 2WWHA 3CF2A 3GNLA 2H1SA 3S40A 2LXNA 1GQ2A 3TVDA 5BSWA 5KSZA 1Y4SA 3HWWA 1GYRA 3O94A 1DCTA 3ER9A 3W2TA 1KEWA 5FL7D 3ZIUA 1UDBA 1F0PA 2WJAA 4I5GA 1QIJA 4PGFA 4F9GA 3P9PA 4P58A 1EM8A 3FUUA 4TTRA 1ODIA 2Z0MA 2QORA 3TRIA 2HAEA 3AILA 1QIKA 4IDOA 4Q3NA 3R77A 3UKDA 3A9CA 3N0RA 5C2JB 1TYEB 1WHSA 3RRZA 1H0RA 2HLPA 1E2KA 2GPJA 3DXFA 1RRGA 2HYDA 4ZVNA 1FFDA 5L3ZA 5A71A 1VQ1A 3SZ3A 2ZB3A 4ZYXA 5L53A 1UPFA 1GUFA 4LOJA 4G0VA 3ZGLA 4HYEA 1K2VN 1J42A 1HDZA 4QT4A 3AXTA 4M3NA 1IQ0A 1SHLA 3VZBA 5J5AA 1D6JA 2C3UA 2WE7A 3G0CA 3MWKA 3UMJA 3W2IA 4CCSA 2R68A 4LY6A 1QB7A 1OLOA 3ND8A 2QT0A 3PQ5A 4YVFA 2BHNA 4LA4A 3U40A 2CXUA 1MA3A 2WDZA 4C9BA 3GRVA 2NU7B 5E2BA 3EPLA 3KSBC 2BEUA 1NYQA 1YU6A 2C9BA 4OFWA 4JI6B 1Q5PA 2DFDA 2VJBA 5D5PA 4D6PA 5BVHA 4YDQA 1RRFA 2W0SA 3MBIA 4FR5A 1YIAA 3U37A 5MDHA 2J6BA 4MYDA 3ZJVA 4E08A 1DI0A 2OEPA 4BLRA 3L8GA 3IDSA 2HBQA 4CQNA 4HUTA 3VKWA 2OV2A 4HEQA 5LOVB 5EE3A 4FUTA 2QY9A 1H0SA 1CIVA 5MHTA 1IJEA 2X19A 4YRTA 4C1BA 1PJBA 3MTJA 1TZMA 1IBSA 4LGMA 3K8YA 4HH4A 4O2RA 4ARCA 3KQHA 1OB5A 1J99A 3KSRA 5IXJA 5KU1A 1T29A 1DHTA 1RVV1 2B61A 3IAM1 1X9GA 2E82A 4ZO8A 3VKGA 4OHBA 3VXKA 3IBTA 2YDXA 2PKQP 2OZLB 4RADA 3H1AA 3AVQA 3E05A 4BMCA 4X8OA 4GR4A 1NU8A 3R7LA 3Q2IA 4WN9B 2NUPB 1XPJA 4C3ZA 5FPKA 1JJIA 2OLEA 3CX3A 4E4YA 4UUAA 4W9MC 1XDDA 2X42A 2X15A 2YXEA 4G5YA 4TOIA 1EAYA 1ARZA 1JKIA 1VHWA 1WM1A 3HI6A 3N3BC 3CBQA 4W99A 2AKYA 3WWPA 4CJXA 4EJSA 4YCNA 3H5RA 2HM7A 1C1DB 1BWSA 1K5GA 3U3KA 5IBCA 2C82A 1KTVA 3KELA 4EWLA 1X0XA 4OKNA 1CKEA 1U28A 3OLYA 1Q7RA 3QE4A 5CT9A 5KYVA 3AONB 3RYHA 2HK8A 3OZIA 4LJ4A 4PLGA 2ZBDA 4WCFC 4BMYA 1RABA 1JQDA 2K87A 4JFRA 2VSNA 2X4GA 3W7VA 3KZXA 1IQUA 1TI7A 4HNAB 4MARA 1RJWA 2QN2A 1UPCA 4HGQA 3CE9A 4K9QA 4LNHA 3RVBA 4A6XA 1FVOA 2ZYIA 1JDZA 3PWSA 2QE7D 4AZTA 2HH9A 3LZCA 1VPTA 5HZMA 2X6TA 3N7AA 1EDDA 1G1MA 1NUUA 1F60A 3K70D 2QTBA 3D4BA 1MOZA 3A6GA 1HNXB 1GCIA 2Y0BA 1FF9A 1JLHA 2ACKA 5K3FB 1R15A 4BVKA 5TRTA 3GVXA 3PQCA 4YXWD 1LSUA 1AGRA 1V4BA 1W5TA 3EZXA 3L05A 2O1WA 3NBMA 4IGEA 2QLBA 4NG4A 5CX4A 4ZCQA 3UQZA 1O77A 2C9DA 2G72A 3QE9Y 3ZYCA 4YCCA 1KMHB 3GUZA 5A9RA 5BVGA 3K9FC 3EHDA 2JI6A 1HNWB 2XVAA 2WQZA 2OUKA 1ZY2A 2JAUA 4LJ9A 2ET6A 4BIMA 2XQFA 2FSIA 4DNOA 1UDWA 1J2TA 2OFOA 1ZWKA 3AT1A 3LUJA 1NUSA 1XEWY 1CWUA 2ASVA 2PH5A 3GZTB 4BZPA 1YU9A 5EPOA 5FBQB 2Q1UA 1B8UA 2IYFA 1MRNA 3PCTA 3PGMA 4OGLA 4WXEA 1M0WA 4UTVA 1XNHA 2JVKA 2EJUA 2XRMA 3LQRA 3M0EA 4DA0A 5ALPA 4Z7QB 2ACEA 3IO3A 3GJRA 5ALVA 4HB0A 1JDPA 1TLTA 3W05A 3I5YA 2HJWA 4W5JA 1KSJA 3AW9A 1ZD9A 2CLOB 3ELDA 4QPPA 4ETIA 1MNAA 1TM4E 1K6MA 1M54A 3RIGA 3V8MA 1IM5A 1BH2A 4HT3B 2DQKA 3TSOA 1RYEA 2X8JB 3AERA 3P0RA 2BE9A 4K87A 4WHMA 3PX3A 1FFBA 3E5HA 4KZPA 5IARA 5JQGF 1N57A 4D82A 1VPEA 1SG0A 3JWJA 3BH7A 2GSDA 4UCXA 2L42A 4TMKA 4MVJI 4DR2B 2I2FA 5AJWA 5DBHX 1A0OA 1COWD 5HM8A 2RARA 1DBQA 3BEOA 4NV3A 3WLSA 3ZU4A 2Z4TA 4HFMA 2PKYX 2X0KA 3OCWA 4BQEA 5CX1A 1XYVA 4N48A 1FP1D 2HLDD 4IHKA 2X1VA 1N5MA 1NT2A 2HKIA 1Z17A 4KMMA 3EY9A 4QXAA 1TJYA 5TC4A 4AT1A 1NY5A 1JH8A 1GSAA 1XLWA 4OFBA 5FPTA 5HWSA 1DMRA 1FVXA 3N2IA 1BHQ1 4ENVA 4QUGA 3U4IA 4RMHA 4UARA 4TMXA 4W7SA 4JI1B 1HEYA 3CJRA 1AD2A 1OXUA 3L6BA 4LJSA 3GPLA 4O1IA 2JEZA 2QBYB 2C3PA 3IUSA 4PAOA 2Q29A 3WA7A 4Q9NA 3CEMA 1XPOA 2DM6A 3NETA 4FBMA 5HGJA 4MUAA 2P78A 5C3MA 2G06A 3ZX4A 2ZBQA 4NLLA 5JC8A 3U6BA 3EXEB 3EQ8A 4P08A 5LBTA 5KKCA 1DLJA 3FTQA 1IC6A 4DNPA 5L45A 1DJLA 3OEWA 3N5KA 2ID8A 4OREX 5JBQA 2PS1A 1PGJA 4E51A 1CZRA 2A1IA 2V4UA 2YJZA 3AF6A 1ULZA 4P4SA 2P9CA 1J5PA 2XE8A 1JG7A 4V02A 4WXPA 4LOIA 2PK3A 4YPOA 2GAFA 3QVVA 3KXDA 3W6PA 1XZ8A 3X1YA 2ZGVA 4ZODA 5IN5A 1ML3A 3DS8A 2Y9MB 3TMYA 4CKYA 1E2EA 3NP9A 2H1OA 4GMXA 4N5IX 4M38A 5EHGA 2ZATA 3HYNA 3KZKA 3IT0A 1ODLA 1N0VC 4BKRA 4DADA 2WTUA 2JI7A 3A3OA 3KSDO 5JISA 1WKCA 3NHJA 3L4SO 1HOTA 4B3CA 5JMWA 2MTBA 2PQ2A 4XYMA 3OP1A 1DKUA 4UTOA 3JQGA 3UHAA 1VLMA 5J40A 2A4MA 3WNZA 5HS6A 3ZWMA 2FETA 3SBEA 2HEGA 5J2UF 4X1YA 2VBGA 1KI9A 2TRSB 1XVAA 1YS6A 1C9MA 1P75A 3CH6A 5E2AA 3SU8A 4CG1A 4NPHA 1YZLA 1YGPA 3CNHA 3PI7A 3D5TA 2VK1A 1T0PA 3E8MA 2RK3A 2BY4A 4JGGA 1SU4A 5TJ9A 3V8VA 1PL0A 2B92A 3PICA 4L5YA 1AB5A 1XRJA 2WVGA 4YJHB 1SKBA 1NBEA 2XNJA 1VFNA 3F2IA 1NBAA 3AWIA 3C6YA 3OF2A 2OV6A 1YL7A 3GMTA 4YCAA 3SKYA 1KK0A 4UQLA 3VJMA 3WK5A 1EFDN 4M60A 1VSBA 4JWTA 3CT6A 4J9VA 4NHOA 3K0SA 4KE7A 1Z5UA 3QSGA 3SZGA 2OP0A 1CDDA 3HQ4O 3RYCA 1ZAKA 3RBZA 1TX4B 2V3VA 4U2KA 5DFAA 4NMLA 3K0AA 3AHGA 1ORVA 4DMMA 2VJKA 4JUAA 2CK3A 3FPJA 3EZLA 1FUIA 4C4AA 1JDSA 1ETUA 3S99A 1W35A 2PRJA 5DU2A 2IOHA 5AESA 3KM0A 3OPQA 2CLDX 3BGOS 1OLSB 5D87A 1Q91A 1G16A 1QRAA 1E7WA 2YXPX 3FPSA 2P1RA 3QVUA 4WXRA 4XXHA 4AMGA 2A5FA 4KQEA 3P97A 2P1ZA 3F5SA 3D6FA 5NLLA 3WYBA 1BXZA 1NDQA 1I5EA 3DPIA 2C9OA 1EUCA 3QX9A 1EFHA 5JZSA 1O8BA 1UADA 1N32B 4TWBA 4MYTA 2YJ5A 3TIVA 5DNVA 4JZKA 5G1NA 2ODWA 5IYZA 3FWHA 3L7NA 3L40A 1PT7A 1L5HB 3IC5A 3DUFA 1JHYA 3ZBUA 1RIFA 5I51A 2O2ZA 4IPTA 2IH2A 2YQ5A 3CNEA 2C3OA 3LX5A 4ARVA 1JEJA 3L7AA 2E21A 4ZDWA 3WLPA 4DM4A 1I3KA 5DLYA 3I28A 1VLVA 1KK3A 2V9ZA 1XAJA 2QL6A 1N8NA 5GM2A 3ZY3A 4DUYB 4M22A 1SB9A 3HCCA 5FWXA 4ZIRB 1NBME 1A9TA 3N74A 2AVNA 4UASA 2PWBA 2QAJA 4RF5A 2ZRAA 1FFYA 1SK9A 1WB4A 4GSLA 4OQDA 4BNTA 1YFJA 2OR3A 3FRJA 8OHMA 3TD9A 5BSEA 1W93A 4ZRNA 3LVRE 3WDMA 2XYVA 3N2NA 4L4UA 5DTQA 2E89A 3TW0A 4U7FA 5K8JB 1BE0A 3TLAA 4INJA 5L4LA 1YK0A 3BL6A 1DEXA 1O9HA 3OFVA 4GOLD 3K20A 4Q1VA 1NX6A 5CLHA 4PVDA 3OUUA <