4UMDA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
b'MNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
total genus 59
structure length 173
sequence length 173
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umdA00
3R9KA 1L7PA 3MPOA 1RLMA 1RMYA 2RAVA 2GO7A 3UM9A 1S8OA 1WR8A 2IOFA 4FFDA 3PCTA 3D6JA 2NYVA 3ESRA 3MC1A 5ALRA 3NALA 4C4SA 3OTQA 1RKQA 2GFHA 2R8ZA 2QYHA 4Y3UA 1RQLA 5ALTA 3AR9A 4NFLA 2JAWA 2I6XA 3IJ5A 3OCUA 5E0OA 5JJBA 1KYTA 4J2TA 4UMDA 3ZX5A 2JAUA 4QJBA 3W5AA 3TLMA 4UU1A 2AH5A 3SLRA 4Y2SA 3AR5A 2ZBFA 5AKIA 4L57A 3OCXA 3B8EA 3IRUA 3L8FA 4JB3A 4H1WA 4KX5A 2HOQA 1Q91A 3WK4A 3U7HB 2MU1A 3I1YA 3AR8A 2OBBA 1WPGA 4BX3A 4YCNA 5AIAA 5AK6A 3AR2A 1PW5A 2PQ0A 4ZEXA 4UAUA 5ALXA 1N8NA 3NASA 4HGPA 1RMQA 1TJ4A 2HF2A 3ZTYA 5AM2A 1Z88A 2B8JA 3EF1A 4DFDA 4EX7A 2I34A 4Y2PA 4OHFA 3ZUPA 1TA0A 2R8YA 5ALQA 3L1UA 4GIBA 2G07A 5AVWA 3UMBA 2WFAA 2WHEA 2B8EA 1L7MA 1TJ5A 3HLTA 2C9MA 3BA6A 3QU5A 2C88A 1RRCA 4AP9A 4MWOA 5ALHA 2JGAA 3WKCA 2IOFK 2WF5A 3QUCA 2HF7A 3U13A 2P9JA 5ALOA 4KN8A 3AR3A 3W5DA 4NV0A 3NRJA 2EARA 2C4NA 2YMMA 5AM4A 1U2TA 3M1YA 2R8XA 4CNQA 2EAUA 3A1DA 4YH1A 1SWVA 1K1EA 2FPSA 2C8KA 2G0AA 4YGYA 3MMZA 5AICA 1Z4OA 1ZD2P 1ZS9A 4XQ0A 3L8HA 1WVIA 4G9BA 5AI9A 2G06A 5ALWA 3NANA 3E58A 3W5CA 1LTQA 1RKVA 3ZVNA 5AM3A 3OCYA 2BY4A 4DW8A 1QQ6A 5ALDA 4HGNA 4OD0A 5AW6A 4UW9A 1XP5A 2GMWA 4XPZA 5AKLA 4KX3A 3S6JA 1N9KA 4I9GA 1AQ6A 4BX2A 4EEKA 5AIBA 1J8DA 5AK3A 4GXTA 1RLTA 2WF9A 1CR6A 3SHQA 1SWWA 5AW9A 1YJ5A 3UMGA 4JDPA 2NO5A 1EK1A 1VJRA 2HCFA 4MUMA 2CFSA 2G80A 2ZG6A 4AS2A 5AM5A 2FPUA 4RESA 5IS2A 5A3RA 3L7YA 3R09A 3FM9A 5ALIA 5ALZA 4EZEA 1Z4KA 3A3YA 3F9RA 3KZXA 3U7FB 3U19A 4Y2RA 3U7GA 3N28A 3QLEA 2JARA 4Y2JA 4Y2VA 3ZX4A 4BX0A 3NUQA 5A3QA 2QLTA 1L8LA 1YDFA 3GYGA 3ONNA 3DAOA 2BDEA 4Y2XA 3QUBA 1TJ3A 3OPXA 1RKUA 3QU9A 3QNMA 2YBDA 3ED5A 1QYIA 5AKXA 5AKGA 3AR6A 1RLOA 1U7OA 3L0CA 5AKEA 5AVSA 4Y2UA 3QU4A 3OCVA 4Y2TA 4UAVA 2ZBGA 5AKYA 2B82A 3A1CA 3SKXA 2ZOSA 3W5BA 2FUCA 2W11A 4CF3A 5AW5A 4YIHA 2HSZA 5AM0A 3E8MA 3K1ZA 2HX1A 3FPBA 3RF6A 2GHTA 3ZWDA 2ODAA 5AVVA 3ZVLA 5ALFA 3DV9A 5ALEA 4YCMA 2CFRA 5AKKA 2W4MA 4EENA 2B1RA 3PGVA 2G08A 1WZCA 2G1AA 1U2SA 3VAYA 3KD3A 1Q92A 3MN1A 2I54A 3FGOA 2YJ5A 5AW8A 5AI4A 2GHQA 3KDPA 1MH9A 1Z5GA 4BBJA 4UATA 1JUDA 2P27A 1L8OA 4OCZA 3ZVMA 3ZW7A 2BDUA 1ZRMA 5AK4A 5AW0A 2FI1A 5AW7A 1Z5UA 1CQZA 2G09A 3KOOA 3QU7A 5AESA 2D2VA 2Q4TA 5IT4A 2I33A 1Z4NA 3NIWA 3R4CA 4HGRA 4QQFA 3SMVA 5AI0A 4BKMA 1T9ZA 2CFTA 5AI5A 4I9FA 1YV9A 4PNHA 3WKEA 3L0YA 3PGLA 3L0BA 3CNHA 1T5TA 2O9JA 3E81A 3EF0A 1QH9A 5T41A 1Y8AA 2I7DA 3ZTWA 2JAOA 2P69A 2AUTA 2YJ4A 5A3SA 1Z4QA 1ZD4A 3WK6A 3QGMA 5ALLA 4L6CA 1L7NA 4UMEA 1X42A 2RBKA 3SD7A 1RMTA 3N5KA 5IT0A 3I76A 5AKHA 1F5SA 2YMPA 1NRWA 5AKZA 4C4RA 2I55A 3BWVA 3ZWKA 1YMQA 1Z4MA 3RFUA 1U02A 5AVQA 5AW1A 2B1QA 3WGVA 4ZEWA 2Q5EA 4L6AA 5ALGA 2OA0A 1FEZA 2NO4A 2FDRA 2OM6A 2DQSA 1J97A 2HHLA 5AHXA 1O08A 2FEAA 2YN4A 3AR4A 1U7PA 3ZU6A 4XOUA 4CE6A 2X4DA 1VFPA 2AGVA 4Y2YA 5ALUA 4F72A 5AKJA 3OCZA 2FPWA 3WK8A 4AS3A 2WM8A 5ALMA 1XPJA 4DWOA 1L7OA 4BEWA 4G63A 4EX6A 2HI0A 3KC2A 4RETA 2ZBDA 5AW2A 2ZBEA 3SF0A 2PKEA 1Z4IA 4HGOA 4UM7A 3J7TA 3WKAA 2PR7A 3OCWA 5ALJA 4EELA 5AVXA 4UARA 3FZQA 1L6RA 4BYGA 4UMVA 2YJ6A 2YMQA 4CF5A 2B0CA 1ZD3A 2OYCA 3N1UA 3WKDA 1QQ7A 2IOHA 2RARA 4B6JA 1YS9A 3I28A 5AW3A 2FPXA 4KNVA 4DCCA 3P96A 2HDOA 1VJ5A 4XE5A 5AVYA 1Z4JA 2WF8A 3QYPA 5ALPA 4YIKA 4HYTA 2VKQA 4YCLA 4FE3A 2WF6A 3QXGA 2YJ3A 4OFZA 4HGQA 3DDHA 3WGUA 2W43A 4KNWA 5ALVA 4IFTA 1NNLA 2HO4A 3QUTA 4J03A 4NAVA 2CN1A 1ZRNA 2FPRA 4KYTA 3FPSA 3ZI4A 3L5KA 4F71A 4UASA 1ZOLA 5FP0A 2C8LA 4UM5A 3U26A 3L1VA 2O2XA 3NAMA 1TE2A 3I6BA 3QU2A 1RQNA 4UMFA 3U7EB 3A1EA 4FYPA 4E88A 2Q4RA 3L8EA 1XVIA 2EATA 3UMCA 3WKBA 1RC8A 1ZJJA 5ALNA 2MSNA 1SU4A 3IB6A 5AK5A 1LVHA 2B30A 5AM1A 3EPRA 3M9LA 3B9BA 5AI6A 5AVRA 2P11A 2WF7A 4BNDB 3N8GA 3ET4A 2HEGA 1EK2A 4UU0A 3DNPA 4HAIA 4BNDA 2YMLA 2R8EA 1ZD5A 3QX7A 1S2OA 1IWOA 3N07A 5ALYA 5AVUA 1RDFA 4C4TA 5AVTA 4O8CA 1T5SA 2AMYA 5ALKA 1Z4PX 3FVVA 2YY6A 5AVZA 4BEVA 3ET5A 4NWIA 3WK9A 3SKYA 3ESQA 4NABA 1YNSA 4Y2QA 4CF4A 2IYEA 5ALSA 5AI8A 5AW4A 3EWIA 2RB5A 2FUEA 3WK5A 1Z4LA 3B9RA 1RPZA 2IA5A 2ZXEA 1NF2A 3L8GA 4IG4A 3E84A 1QQ5A 3KBBA 4ZEVA 2YFYA 1O03A 3AR7A 3PDWA 3QUQA 3HYCA 3WK7A 3CZ4A
chains in the Genus database with same CATH superfamily
3G82C 3WXBA 4E2ZA 2I6GA 3MJDA 4PXYA 2ONZA 4MR9B 2JANA 3ZHOA 2X0IA 3F6PA 4A0SA 3PTAA 4HZGA 3GZNA 4URZR 2PX4A 1XCJA 2R3SA 1QE3A 2OHIA 3GJZA 3NONA 1WG8A 2X2OA 3R5TA 3PI6A 2GS9A 3QOXA 2O8FB 2RMKA 5CFRA 1S3IA 1NMEA 2C3OA 4TTPA 1DOZA 1II9A 4N7RA 4RQUA 3H0CA 1AQNA 1QFZA 3OTQA 2QTTA 3V8BA 1KU6A 3DVAA 3T9FA 3HO1A 3RC9A 4R81A 1REQA 4YGXB 4IIJF 4E70A 2VUIB 3H7IA 3OT4A 2JAWA 1K7CA 2MR5A 4EFMA 3C6QA 4XX0A 3AWIA 4UMDA 2JAUA 3DULA 4XJTA 1MABB 2E4XA 4Y7CA 1ZCFA 2ID8A 1DAMA 2Y3IA 4R5HA 4MA5A 2HZ7A 4BLPA 1CDOA 2IJGX 4OQPA 4Z4GA 3BILA 2GNAA 1D0SA 2ZBFA 1XEXA 4R0NA 3RVQA 4QTUB 4EMSA 4HH1A 1MIOA 4F0JA 4HQNA 1TK9A 1B8VA 2HTFA 4Q7KA 3J80A 1VPEA 3KFXA 4WA8A 1Z06A 1KYQA 1UPBA 1CEQA 2D0PB 3JAWB 5HSGA 3H2ZA 4J43A 5AIAA 3SHVA 3AR2A 1LPMA 1NNI1 2YWJA 3NATA 1NV9A 2FPOA 1FLNA 3AONB 2WSYB 4QU9A 1TAQA 4BQFA 4RENA 5K8JB 1BX3A 3MXOA 3NWPA 4A4DA 1JFSA 4L28A 1KORA 2FUG6 5CJJA 5EZYA 1NJ8A 4PBTA 3L4EA 4G5XA 4GLJA 1JQEA 3FWPA 3JD1A 4KLNA 5CLLA 3SJUA 2JRCA 1YVRA 4MWCA 1HOXA 2MMGA 1IULA 2RGGA 5FUYA 1OMOA 4P8RA 1JR3D 1MOQA 4OU4A 1LSOA 2O0KA 4C21A 4LXIA 2FP3A 5EOVA 2I34A 3H6HA 4YONB 4A8HA 1E4YA 1O6CA 1YI1A 3OZBA 3EVDA 2QZ4A 4UPDA 5LZ8A 5F3DA 3DE0X 3DLHA 4KR2A 2ZTHA 1J2EA 4IG9A 4A73A 4RA6A 2Y1DA 4TM8A 1JG7A 1K68A 2RHCA 2YTZA 1P31A 1TJ5A 2WSSA 3L1JA 3OTGA 2Q6IA 3ZGXA 4D0RA 1CUHA 2GEJA 2YR0A 1RRCA 3JR7A 2ZT8A 3SWWA 3L92A 4WQMA 1WW3A 1LKZA 4HDKA 1A4XA 4DRXB 3GLGB 3ASZA 3TX6A 1P0MA 4MVJP 1O0SA 4WDRA 1WULS 1I7NA 1V3UA 5BV7A 5C7YA 5LLDA 4FNAA 2FMIA 2P2YA 3HXPA 4HX2A 4QBKA 1C0EA 4V0SA 3DV2A 3TLCA 1G5RA 1A5ZA 2HSJA 3FNIA 1EX9A 3TQSA 1XNRB 3DM9B 4JGBA 5DH9A 1H42A 1DEHA 2X5XA 4GBMA 2B4QA 3W2TA 4AWBA 2VJLA 4D79A 5EVCA 5JAIA 1MVNA 4P93A 3SEZA 5JAZA 5A5DA 4K0KB 1RXVA 2YHIA 2UU9B 2GBPA 3OQJA 1E62A 1RBQA 3FCXA 1RQXA 4BQNA 2Y9PB 5HKLA 1E8MA 4JP2A 1WLSA 3GEEA 3MCTA 3V4PB 2YZGA 5JWHA 2O6HA 4CTKA 1DJLA 1KYWA 1SCIA 3ANYB 3QMPA 1ZZGA 3DQZA 4NULA 1X7WB 3NT2A 4N65A 3D7KA 3WBJA 3W5CA 5FAXA 3TXAA 5LL6P 2BONA 4I66A 2Y1CA 4D3XA 3W3AD 3GEPA 3VV3A 1W5BA 3PJDA 4A1FA 4JLBA 2XCLA 3FCOA 1KFJB 3HWRA 5ALDA 5JAHA 1D0IA 621PA 2BJHA 3MVEA 3A26A 3AF4A 5T3UA 1K5DA 1DQNA 1VGRA 4W9NC 3PUHA 1PJCA 5CT6A 3MWFA 4PTYA 4NMLA 4QYXA 2RHBA 1E1RD 1UP4A 4ND5A 2O8BA 3PKJA 4A8JA 1JDTA 1QV9A 3IAS6 4JP8A 4IEIA 2HIGA 3MHPA 5HK9A 2JFZA 4DBVO 1HDYA 3EY4A 3ZW9A 5BUSA 1L8AA 2Q1XA 2JGDB 1V8BA 3RS2A 2VRWA 1ODFA 2Z5LA 3LFTA 3GCZA 1EHIA 2BTOA 1QO7A 3HB9A 4TWIA 4P5PA 4EGFA 4US2R 1OA1A 3HY6A 5KTNA 1CR1A 2V98A 2HIAA 3GRAA 1EK1A 1V1JA 3IKMB 2O8CB 3V5NA 2X14A 4M1KA 3IODA 3L1KA 2DQYA 3EFHA 2FQWA 4DJFC 2XH8A 5FKJA 4RMHA 1OOEA 2AKAB 2YN2A 1KXZA 2H1WA 2VYQA 3FVQA 4AS2A 4KQFA 2WJ3A 1E2GA 4PO8A 4PZAA 2DH6A 4H7PA 4M89A 2VIIA 5AQ1A 1FFXB 4JT8A 3S8EA 2AJCA 1XRMA 1Q0QA 4YACA 1W4AA 4Z8YA 5T6MA 3V97A 2VTBA 1YFJA 2HF8A 3AB7A 3RVNA 4AU1A 4REQB 4AUNA 5KYYB 2JARA 1WHTB 3B5IA 3EYAA 1N5MA 2JFWA 5T67A 4OB6A 5B2EA 4QU8A 3W1EA 1PNTA 3MGCA 1UC5B 2DSNA 2IBTA 3RYIB 2AC7A 3K71B 1EUDB 1LS1A 2YW2A 3RRFA 4PRKA 3KYCB 1CU1A 3ED5A 3NCTA 3KAQA 1IM8A 3EGDA 3HKEA 3L7IA 2HJ9A 4HYYA 1T1GA 4CT0A 1M1UA 1B2RA 2CZCA 3EZXA 5E1BA 1N7IA 5LKRA 1G5FA 3CSUA 3M4ZA 3UAGA 4B5LA 4X3CA 1CUWA 1M6NA 3K2IA 4YTEA 2H8KA 2OXIA 4RMNA 2XWBF 3FDXA 5NLLA 3QU4A 1XD2A 3K92A 4IIJA 1GGFA 2CV2A 5LSAA 3OE4A 4QGSA 4KKXB 5JUWA 4EYKA 5BN5B 3D0KA 3IAS1 2VP2A 3GD7A 4HUQA 1SR8A 3BHNA 4B32A 2RKOA 1IQPA 2PUJA 1XR3A 3UHPA 2ZT6A 3RYFB 3USES 1OAKA 4BO5A 4C3UA 3H86A 4DMGA 2OFPA 5GVSA 1GTRA 2YC4C 3G6KA 4WXRA 2A1UB 2W0MA 2H2IA 3MBIA 5LP6F 2VPIA 3E8MA 3AY7A 3T1QA 4HV4A 4E5NA 1Y1QA 3PFIA 1HQCA 4MKIA 1R4MA 1XTBA 4WXMA 3DEIA 3W4JA 1WWKA 4YUYA 6REQA 3L5OA 3RJZA 3U4IA 4BUCA 4GKKB 1Y8RA 4OHBA 3FYSA 3X0DA 3H2IA 4RM2A 3CUTA 5JNUA 2H2DA 4KJXA 2PJUA 2YV4A 3BMXA 1ISHA 4P4SA 4P2BA 4EGSA 1VHWA 1GV1A 3JTEA 3ZDFA 1TO2E 5H4GA 4GBJA 2HJWA 2Q27A 3G5TA 4Z8XA 1B6SA 4MKXA 4AJ4A 2YHBA 3OETA 1SCJA 1ZK4A 3S29A 3O8NA 4LDRA 1WPRA 1U2DA 2OAQ1 2O3SA 3CRRA 4G36A 4K6GA 3MN1A 4YMIA 5DX0A 5GM1A 1I2BA 2FEKA 2PUTA 3FGOA 3C3EA 4P3XA 3P19A 1AGRA 2R5FA 4NU6A 4M9UA 5KVQA 4FD2A 4CLXA 1MH9A 3TFWA 4TS1A 1V5FA 1OV6A 5G2OA 2GCOA 5IM4F 1KP3A 4B3HA 4RE5A 1A9XA 2EJBA 2AX3A 3CT6A 3URKA 1QF6A 1G18A 1L4BA 2D8AA 4WFIA 5J59A 1TDJA 4RDCA 2G09A 3T7CA 3TZQA 2P2ZA 4CL2A 2CLIB 2APJA 3D43A 4NH0A 1EB8A 2Q4TA 4OQDA 4HNVA 1AA6A 5E7QA 3FGNA 4IQFA 3OM1A 4FE7A 4M0UA 4QC2A 3RSQA 3WYGA 3NW9A 4YRKA 4TROA 2GYVA 5L3SA 3SMVA 5T57A 2CDNA 5LA6B 3HJGA 1TFUA 2PPVA 2V7EA 2BTQA 2F8LA 2VAPA 3GDOA 3PLRA 2BP7A 1DEOA 1HYBA 1UK9A 2ZYDA 2IS2A 1JDJA 2HN9A 1DBIA 3OMWA 5BORA 3MGAA 3DB2A 4OXQA 1I7DA 1H3EA 1W0KD 3R6LA 3L0YA 2ZB4A 5HJ2A 1GITA 1OIWA 1X7GA 4R05A 2X42A 1KOGA 3JYLA 1XK7A 3MWDB 4JEUA 1V3TA 1WXHA 1X7ZB 2AA3A 4YAOA 3HKDB 4K28A 2WIDA 4HADA 1XSEA 4BPRA 1MW8X 1SZDA 1E1CB 3AG6A 2NUAB 3AVPA 4PRZA 5D1NA 4BJ1A 1PLJA 2QYTA 2X15A 3IAUA 3NJRA 1J7KA 1EWRA 4I1SA 4TKUA 5FLYA 5C46F 4FLMA 3TRHA 2V58A 4BQOA 4GOOD 3CH4B 1N6LA 2DQ4A 1OWOA 4H6XA 2JLAA 1IK6A 1Z0KA 2C5BA 3ZI7A 3R9XB 4GGPA 1DBSA 2ID4A 1N78A 4KQ9A 4CG3A 4MUIA 5BQXA 2DFDA 2X1HA 4GLFA 1LJLA 4KGDA 4ZCSA 3CLRD 1BWRA 9ATCA 4NQRA 2AOUA 1KE1A 1V5GA 3OLYA 1N2IA 3V1LA 3TD9A 4LKOA 1YB7A 4FILA 4NE9A 4WCFB 1WMBA 3BB3A 1GT91 3VM6A 5HM8A 2BCGY 4L6AA 3BHJA 3CLHA 4GX5A 3WP1B 4DN6A 3A4YA 3I5AA 4EH1A 3TLYA 3WMEA 3FYTA 1OUMA 5AD1A 2PR2A 3W9YA 4H1VA 1HT2E 1HDXA 2IOQA 3EODA 3GLHB 3I9JA 1YRYE 4XR9A 4FM9A 1QH1A 5CVUA 4FGKA 4YBRA 3R76A 4D81A 4DJEC 5AHXA 1T6ZA 2QTCA 1HQYE 2BZGA 2WQZA 3GELA 4OMUA 3L41A 3FOCA 4DLXA 3F7TA 4XOUA 1K08A 5LD2B 5I7EA 4BFXA 1K8YB 2PO7A 5DTMA 2MSLA 1UPAA 4BPBA 1JLKA 4H4CA 1UINA 2JGKA 3WB1A 2DKFA 1XQ1A 2QVYX 4AMVA 3TLEA 4BMYA 4E5UA 5HR5A 2O8FA 1R4AA 3PE4A 3RI3A 1K6EA 2BEUA 5EE3A 5F4ZA 1YCFA 3EGVA 3UK0A 3LT4A 1ULHA 3Q8LA 1TM3E 4GOXA 3HXKA 4B09A 1BCRA 2F9MA 3O82A 5C5CA 3SIRA 2IP2A 5LXTB 2OXEA 3IQWA 4V1CI 1V3QE 5AW2A 4FR0A 1HBJA 2EU8A 3QK7A 3C6XA 4RPGA 1WDKA 2G1UA 2TS1A 3JQCA 1A5AB 1AHNA 1ACJA 1JNYA 2KI5A 5JE8A 5JLAA 3ZWYA 1T91A 3AESB 2QRLA 3UYLA 2ZWMA 1XZLA 3VNUA 2R44A 3V2UA 5DHUA 2J45A 2PMCA 3NYIA 4G4GA 2HWWA 1S2NA 1N2OA 2E1RA 2OYCA 5JAMA 1ZSNA 1T26A 3IS3A 3VMMA 8ABPA 3DZFA 1OXXK 4FDVA 2Q1YA 3H9QA 2RARA 3KCNA 4J9UE 4YROA 3Q1LA 2C4TA 1SUPA 1G98A 4JITA 2O5RA 5G1OA 2A9QA 4DMCA 5EA2A 3V48A 4AJPA 8OHMA 3JSAA 3I42A 3LUPA 4V0KA 1KJJA 2PUVA 3HO8A 1RBZA 1V7ZA 4OATA 3DXXA 2BFEA 4PG7A 4K9QA 4WPGA 5LB2A 3SYTA 4MRMB 4XJXA 5KINB 1YBFA 1BKYA 1I0ZA 4BQIA 3ZOZA 2HC9A 1RXCA 3GA7A 4IBOA 3U7QB 4NXMB 1R8YA 3ZIUA 4MUXA 3F5QA 1LLQA 5EKUA 3SK0A 3U60B 2ZYRA 3C85A 1QZUA 2V6JA 2F1OA 3IQIX 1VYHA 5EUQB 1IM5A 5EJEA 2ZUBA 4OYHA 2XMCA 2PT5A 3IBTA 1U3TA 3HCCA 1T9DA 3TQOA 3T5DA 4EYQA 1M8GA 1ZH0A 5IH7A 3ZEAA 2PSFA 3VU0A 7YASA 1WF6A 1W6UA 5KNBH 4NAVA 3E5NA 4CL0A 5A6SB 1Q21A 1PDVA 2RH8A 3C7DB 1PZFA 4JVSB 4OU5A 4QXAA 2NUBA 1GSIA 3TB6A 2DYKA 3L1VA 2DUUA 1PQ4A 2JA1A 1H66A 1DIOB 3PIRA 2O8VA 4X60A 3RUCA 4D2IA 1ZUD1 1PT5A 3CKYA 2QTHA 2VVTA 4FFMA 5LP6A 3PQ7A 1JHRA 1YZLA 4ZU1X 2PWAA 2NTJA 4CQMA 5KU7A 5LLTA 1E0JA 6LDHA 1MA3A 2B7CA 2HJSA 4K87A 4W7IA 2R65A 1PQPA 2GR9A 2OENG 3B7GA 3CX6A 3GV0A 3HM2A 4E5YA 1NF3A 3DBRA 1UAGA 3CW9A 2X9GA 2NSLA 3FRHA 3AERB 4GZMA 4Z4EA 3RT9A 4QGBA 3PP8A 5ECGC 1NU6A 1LVUA 3JPYA 4NS1A 1I36A 4C89A 3RVJA 3TOCA 4XB1A 4CKYA 4BB5A 1ZD5A 1XN1A 1DBQA 2CK3D 3MOIA 2YFQA 2I1LA 4I6JA 4LJAA 1R12A 5ALYA 1WX1A 5KC9A 2PKXA 3A4LA 2PWBA 2XB9A 2RGNA 5IM4A 2Q5LA 1T5SA 5BWCA 2HA3A 2QN3A 3NXKA 1BXKA 1UKAA 5LZ4A 3DL4A 2YY6A 1TM1E 3G7UA 4RD2A 4HUTA 1J9EA 3K0KA 2UKDA 4W8GA 1V1RB 3G0BA 2YWRA 4Y2QA 1X7WA 2D5AA 4K9LA 1WJGA 1D2EA 1CRWG 3NQ41 1YASA 1MAHA 2FQQA 1O3YA 1FDTA 1QHSA 2DHQA 3M1AA 1COWA 3LXXA 4W5WA 4N6GA 1JQBA 1Y1LA 1IOWA 1PIWA 4KRFA 4UHCA 1R50A 4BP9A 4Y1EA 3AFHA 5E4TA 3U7IA 3CLUD 4K7JA 5GINE 1NBMA 2FW7A 1OIVA 2JIZD 4HJXA 4HPWA 1I4EB 5GJCA 2YFYA 5JRZA 4MVJE 1AKTA 5JXGA 1NE2A 1WMEA 3WDMA 3ADOA 1A7UA 5LQAA 2BFPA 3C70A 1JDNA 1M72A 5EQJB 3PJFA 1ZO8A 1IJEA 1RMYA 1UK7A 1XK6A 2PANA 2WJVA 3K30A 2CNBA 4HS9A 4M38A 5JFTA 4NBTA 2F4VB 1CD5A 1EUCA 3GEGA 1Q1ZA 2VDKB 1CUVA 4ZVLA 5B30A 1LI7A 1BDMA 2XKAA 1E9RA 1D7OA 2CSUA 4KLCA 1FTNA 2GZAA 4GHWA 1KU0A 4FVTA 4FNMA 3UJBA 4UVGA 1T1EA 3QXSA 2Q3MA 5DBOA 4BNVA 4QKQA 5HIMA 4D5EA 1BH6A 1J5PA 4MQFB 4CMHA 5K8IA 4IEFB 3TMAA 4L9WA 3NVKI 2F9LA 2ZIXB 4X54A 5E0OA 3SBOA 4MTCA 4CKCA 1WP4A 1K86A 1I7QB 3KXDA 1M1NA 2EXXA 3BRWD 3KLOA 4I3FA 4AJOA 2OCIA 3BMCB 3INTA 4UTRA 2G04A 1N2JA 2DFVA 4JI7B 4PG4A 3LBFA 5F2EA 3SFZA 1LD3A 4XVQA 4PLYA 1WHTA 1UXGA 3C5CA 4QVKA 2DBQA 4I1VA 3D1LA 3G85A 2BDTA 2H57A 4IDHA 1IHYA 5FL3A 1O8BA 1FFCA 5TPWB 2P2DA 4N7BA 2VKTA 3KYCA 2W6PA 1VZ2A 1F06A 1W8DA 2MSDB 4WKNA 2ZVQX 2OEPA 1X92A 2YFHA 2ZRIA 4HQFA 1SC9A 2PG3A 3TQIA 5B3LA 3EUWA 1N8NA 1B8OA 2VDNB 5DGXA 4PZPA 4KXLA 1AZSC 2UZ0A 4NECA 4NOLA 2F64A 3UGKA 2GEBA 2D00A 4FEEA 1PD0A 5KSZA 3GQBB 4IGFA 1TJPB 3E27A 2NZXA 2V7PA 4RWZA 1K89A 2AOXA 5L9AA 1CWUA 2DULA 2RHDA 1ZNQO 2MDTA 2PDAA 1FP7A 5HVNA 4POOA 4KMMA 3EG9A 4DIEA 1NOKA 4Q5IA 4A0QA 4YUVA 4GRIA 1PQWA 3ZUPA 4BFLA 1ADFA 1TA0A 3VSEA 3AJAA 4GIBA 2P2SA 3BXZA 1IM2A 2B8NA 1Z08A 5H59A 4WK2B 4XVHA 1IHXA 1CYDA 4XQGA 2ADFA 1ONNA 4D9EA 4DJTA 3RVLA 4Q39A 1GXSA 3T3PB 1GSOA 1NIPA 5F9FA 3LDAA 1ISGA 2F2TA 2GAJA 3B70A 2J0UA 3CHYA 1LC0A 4L5AA 2IWHA 4B83A 1QG6A 2ZE6A 4FONA 4QLOA 3BIXA 3CJQA 4MARA 4AZ0A 2VRCD 5IG2A 5K8UA 4O1MA 1QZZA 2VPPA 1KP2A 2OGUA 5SYAA 5EGNA 5ILOA 4R83A 4AMBA 3HUUA 2HF7A 2ZI7A 3DW3X 1QGZA 3JZIA 4CLOB 2BM1A 3HU3A 1RYNA 1WBJB 3LOUA 1RADA 3WYBA 1V71A 2GKOA 3IV7A 4FJ0A 5HMLA 1RACA 4YMTA 1T9GS 3OJXA 1NJ5A 2V7VA 3MXTA 4J8PA 4R8VA 1T9CA 2JH8A 3PKIA 2C0QA 2RIPA 1TF5A 3RYHA 4Q03A 4L4RA 2ZAOA 2Y71A 4IF6A 1DBVO 5EPUA 4QPNA 3AJDA 2PGXA 4Y98A 3VYSB 3OFNA 2FRDC 5K0CA 2W90A 1B0UA 2HO5A 2VDUE 4LZZA 1YMUA 3ZDDA 2GK6A 1BOFA 1IJFA 4XZ3A 4ZV9A 3FZEA 1XIVA 2A1IA 5M3BA 1MMFB 4R9UC 3C45A 3G88A 3PFFA 1DDGA 4H08A 1VL0A 1RKVA 1PVDA 5IEJA 4OLJA 4OXXA 3PENA 5F9MA 1V1MB 4JLOA 3K53A 4DW8A 3DC7A 2Y1XA 2POCA 4G2TA 1NBME 5AQEA 1PD1A 4AMYA 2FPMA 2UUCB 2IPNA 3DBLA 3DHEA 4FFSA 5AXAA 1YT5A 1L4LA 5J9FA 2GZ1A 2H29A 1U1DA 2A7XA 4JXKA 4XPZA 2BH2A 1G59A 1FA9A 2GPNA 1U4NA 5INTA 4C3OB 3PA6A 3BWMA 4N7JA 3WLIA 4B4KA 4IZ6A 2Q5JA 2IP1A 3BB1A 2WJYA 2BKEA 3PQ8A 4D9GA 5AIBA 1I3LA 2EZUA 3WNZA 3LQ1A 1P44A 2JFQA 2Q4OA 1BXGA 1KY4A 2B5VA 5B1EA 3RU9A 4I3GA 3KSDO 1L8QA 3H19A 3LTEA 5CMLA 2FFBA 1PZMA 2CNKA 2FLKA 3AUXA 5IK2A 2HCFA 1TTHA 3LQQA 2FZVA 4JU9A 1E9CA 2I2CA 1E2LA 3BXFA 1W4LA 3W79A 4LC0A 2DP4E 3SIWA 1DKRA 4ZI7B 4U6QA 1RI2A 5EHIA 4OAQA 4AY2A 1AV7A 1P7WA 3IFSA 4YAGA 3R3JA 4KKVA 3LQFA 3FSJX 3ROXA 1U3GA 1A8UA 2YWXA 3DZJA 3A3YA 3GJ0A 1E4EA 3KFLA 4LBZA 2VYND 2BMJA 3RUIA 1VMAA 1ZCZA 1WZUA 1NX6A 1O6BA 3W3AA 2Z4RA 2QUJA 4CEHB 4Y2JA 4WASA 1Q19A 1Q1NA 3IHTA 2JLQA 4AL4A 1XV5A 3OESA 4NATA 2EDAA 2OHHA 1Y5MA 1G7RA 2HJGA 4PHTA 1G7CA 3UUWA 1WSBA 1YR7A 2BDEA 3B2NA 3NHRA 4Q4AB 5A9TA 2H17A 3R7FA 4BVGA 3H7AA 3DV0A 3USZA 5D8DA 1MAUA 3ERCA 4PAQA 3AVWA 2QMYA 4HFJA 3Q2OA 3ML1A 3OE7D 3IAHA 3QFCA 5C7LO 1ZONA 1FK8A 5EWMA 2QLNA 4X1YA 1PEYA 5MDHA 3OC6A 1GKIA 2GFQA 1HOTA 1DUSA 4TRJA 4TWAA 2GZRA 5HZHA 2O5EA 5AKEA 3G3EA 2TSYB 1WA5A 4YRSA 3HNPA 3AUSA 2ES4A 3LOQA 5H83A 1IUPA 1S9HA 2EL7A 3A70A 4LHZA 3GJ4A 4O33A 5SZKB 3TDKA 4GT1A 3MWEA 5IBCA 1NI4B 2CKMA 3MRTA 1X1QA 3SLKA 2B98A 4MW4A 4KXWA 4P0QB 1I4WA 5GTDA 1Q1BA 1C29B 3T7SA 1K8RA 1XNGA 1ECGA 2A35A 3O91A 3H1PA 4Z7JA 3H5TA 4IIEA 5DLQC 5FTLA 1M7GA 3JQQA 3OHMA 1CJBA 1P45A 1PK7A 1QAOA 3I53A 4CUZA 2RI1A 5H3LA 4UEOA 5LFAA 4XYEA 3H2SA 3TRIA 2V7XA 3DC2A 3G7NA 2J3LA 3HGMA 3NCHA 4BV9A 2Z9BA 3RG2A 3LW7A 1G16A 1C7QA 2FF7A 2X8JA 1Q20A 2EVWX 3PFKA 2VBCA 3LDHA 4YQYA 1L5GB 1PT9A 4IKOA 1G7TA 3H5IA 4L5YA 5H7XA 2WG1A 4ZCIA 4LNUB 4X0EA 2AG8A 1ONSA 2EC5A 2VNJA 5CD9A 2VHYA 3DTVA 3ZQ6A 1BDHA 4I5EA 4OLAA 3JQBA 1C9KA 1L7XA 2HRBA 1G7SA 3TTYA 4WZBA 4J1TA 1U2GC 4DGQA 2HBYA 1EHCA 2IHYA 1TO6A 4CKBB 1HG1A 2AW5A 2WVGA 4QEKA 4DDUA 4XWYA 5DM70 1ZOIA 3IMCA 2PUCA 5HTOA 1GNQA 3EGXA 4MDYA 5AW0A 1BU5A 2CVZA 4OYLA 5ETJA 5J2TF 4QTTB 1JECA 1PFKA 4WOKA 1P5RA 4XYGA 2FMUA 3EOBI 2IEYA 4K9NA 4MO2A 1QRAA 3ZKAA 1HFEL 1KEWA 2FMHA 4GSLA 3UG7A 1FUKA 1AY0A 1XU4A 1MZVA 1EG2A 2HWXA 1UWCA 3CH7A 3HLYA 4XR4A 5IUKC 5KYKA 5SY6A 3P5BA 1UZMA 1OTYA 2ALJA 4PTZA 3VR2D 1BWPA 1JLSA 2Y66A 2XPCA 4K03A 2CNDA 2LCQA 4HB0A 3CNHA 4RKQA 4R0VA 3QEJA 1XVLA 2XOKA 3ANLA 2PT7A 4ZQCB 1KHTA 1ORTA 1TW3A 4NYIR 2RJOA 1LGYA 4JI1B 3O6VA 3VNBA 1YCGA 1VL5A 2QT0A 3LA6A 4HDRA 3R0ZA 2WJJA 1AGNA 1V6SA 3Q4GA 3W7VA 4WECA 1WLYA 1J1UA 4PSVA 3SG0A 4NYJQ 2XI4A 1A50B 1T1SA 2R60A 1XZHA 4RJJA 1PWEA 4WZZA 5FORA 2NACA 3PUXA 4TLEA 1TMGE 1CUSA 3FNQA 5DGCA 1ZBDA 1WL8A 1CQIB 4AJLA 4BAZA 4HN9A 3UFBA 1JWLA 3BH6A 1OX6A 3EZ2A 3GVHA 3OPYB 5F7JA 3WBFA 4Q4DA 1K7FB 3EXHB 3N05A 1JWBB 3QEMA 4LY6A 1U02A 3KPUA 1ZHHA 4NBRA 1YHZA 5LPNA 5IJXA 3D9QX 3ZE2B 2VH1A 4P3YA 4IJQA 3DH0A 1XCOA 3N2YA 2QSZA 1FEZA 3N2ZB 4UOQA 1GCOA 1RWXA 2NLOA 4Q3OA 1PS8A 1SBTA 2H52A 2QTFA 4R3UC 1LDBA 2RK6A 4KEAA 1JIQA 2DQSA 4DEVA 4KO4S 2IS1A 1OAAA 2CW5A 1K6JA 5F77A 1QOPB 2I22A 4B3XA 4KRYA 4C2BA 3FI0A 2C99A 2W6ID 2Z5GA 3NBMA 1FW6A 2GSWA 1Q11A 3ZU6A 3W77A 4G01B 3RWMB 1TK2A 4UZFA 5A4KA 3HFGA 1DG9A 4YB8A 2DF8A 1E20A 3FKSD 5JCXA 2WINI 1UM8A 1MQ8B 3AP1A 2CEAA 4E2WA 1PT7A 4IDFA 3VKUA 3PT9A 4G63A 2OBFA 3NHKA 5TF0A 2I76A 1ZIYA 5BRNA 1L7VC 1J8VA 2VUTA 3CLUC 2RJNA 3V8PA 1H8HA 1B2LA 2OYRA 4S1NA 3FNEA 5I5EA 5EJGA 4IH4A 2KMLA 1BWQA 5EPOA 1Z0FA 5ISMA 1UDXA 1OX5A 1OY1A 5I7UA 2OHVA 1E9DA 3IVGA 2CXTA 4KWTA 2BW0A 3C3CA 3FUUA 1BOOA 3D4BA 1M34B 2Q07A 4R9RA 1OXUA 2LDBA 3HCOA 4IOJA 3GJ8A 2BT4A 4LYYA 3RUFA 3P71T 5DK4A 5B4VA 1THGA 2BGGA 1G3MA 2H8GA 1XZGA 3D8SA 3TBHA 1HLDA 2QV7A 4RQTA 4A6DA 2I2FA 3H1BA 4KNVA 4NJOA 1AH2A 4WIAA 3Q6MA 5EHQA 3ICVA 1W96A 3ZPXA 2HY7A 2AIRA 3M70A 4R98A 3DFKA 2Z4SA 3GMDA 3MT8A 2QTLA 3ZNQA 4B6QA 2CLCX 2J32A 3AHEA 4FE3A 5F64A 3HMQA 2I8CA 3BE8A 2JHGA 2WFLB 4HGQA 5BN4B 4MKHA 4F5WA 3PDCA 5LMZA 4WZBE 5ALVA 1OH8A 4EHFA 4K9RA 1NNLA 1QDEA 1EVKA 4PC1A 4RV5A 3VPCA 4F97A 2LZ0A 5C80A 2BAGA 1RM5A 1WUKS 1M2VA 1R6UA 2M6SA 4I55F 3HP7A 1WDMA 2UZIR 1DMSA 5C4IA 4IJ6A 4B4DA 1XHFA 4GYYA 3IUPA 1EQAA 3HHEA 4JLWA 2RAUA 2BMVA 1H1DA 2IKQA 4G26A 5D84A 1R8QA 3A6PC 2XNCA 4JJIA 3JU3A 4YRLA 2NG1A 1HXHA 1CULC 1U7HA 2BBSA 3O2QB 2ILVA 4TL6A 5KVAA 1HKUA 1DHTA 1Z2AA 3KJGA 5L7WA 4AMGA 4EJMA 2BCJQ 1JHVA 3LT1A 4JQCA 4LCJA 1I5OA 9MHTA 1NONA 1PL0A 1ZLXA 2GAFA 3RUPA 4MW5A 4W6QA 1CETA 4TYMA 1NP7A 5AM1A 2GERA 5FUWA 2GBLC 4TUYB 4NR0A 1DJOA 3B9BA 2BLNA 3QG5A 4KB5A 2XNDD 1W4BA 4V0RA 2PTGA 1DOAA 4QOGA 3OJ0A 1R5OA 3UCEA 2B92A 1CY4A 3NHYA 5D85A 2XT0A 5A9RA 1PNQA 5BWMA 1G3QA 1P19A 4Z0TA 4M0EA 3C5VA 2RCNA 5CXUA 5FO0A 1W94A 4GW3A 4IGIA 3WRXA 2WB2A 2AS0A 1JFTA 2IVZA 3EZYA 4ALNA 3MJVA 3P9QA 4XYBA 3VJKA 2EBUA 5A02A 4PYMA 2DCUA 4RGVA 4BWGA 1B43A 4F2GA 1V6AA 1YKGA 4KBYA 5J2TA 1PGNA 4RF3A 1RKXA 2A8YA 4MTLA 1XLWA 1Z6AA 3SKYA 3VR6H 2V0GA 4YREA 1K7SN 1OGJA 3DZDA 5IKPA 1XRQA 1RT9A 3O7MA 3ZWOA 2GLTA 4NBLA 1R5JA 3SYMA 1H8ED 4LRSB 1TKCA 2BN4A 2IOYA 3I0MA 3LUJA 4B35A 4B8WA 5HGXA 1VYTA 1Z6YA 4M1YA 4TTQA 1R3UA 4GBGA 4L3WA 4QUEA 1P2VA 1V4VA 2QM7A 1HZZA 3FDZB 3W5VA 3OTIA 3DBHB 4JVNA 4KYIB 5JADA 1ZZEA 1E3LA 2IV7A 2OBNA 2EX0A 3ITEA 4ZAWA 4MLPA 2Q9CA 5KYXB 4QM6A 4RA9A 1UDRA 4LWPA 4NG4A 1JU4A 1CUUA 1SXHA 3FVRA 4U7WA 4CU2A 5D86A 1O6FA 5HZMA 2Q5OA 2J3JA 5GAJA 4DV3B 3IERA 1HNWB 1J56A 3AEXA 1T9KA 3VO1A 2RAVA 3AUFA 1T24A 3H99A 1I1OA 1JDBC 3ECSA 1VRCA 4CQLB 2AOWA 1UODA 1WR8A 4DSOA 3QJYA 3RU2A 2VDPB 1PEDA 4JBIA 3FSGA 3IIJA 1D2MA 2NADA 2N1BA 2R6JA 4MLCA 4RL6A 4ESOA 5K0BA 4EEXA 5KX5F 1RKQA 1X94A 2QAGA 4JKIA 1GVNB 3K6KA 1EXDA 2QL5A 1DBRA 4NOJA 4ZI7A 1OSNA 1Q7GA 3T0GA 4EL0A 4RCZA 4C4XA 1NI5A 3VPBA 4DUYB 5EEHA 4B81A 4ILKA 3MJSA 5CB4F 2V7BA 1HYEA 3FPLA 3QWFA 5ALHA 1U0RA 1YQDA 3KHTA 4V1CA 1TI7A 1XQ6A 2PVPA 3SLRA 4IILA 4FB5A 3W7AA 4QAJA 2HKIA 3RHTA 2AT1A 3SE7A 2OPBA 1EJ2A 3GGJA 4BKPA 1H1TA 4IJ5A 5J47A 5IMSA 1G64A 3L8CA 3T9DA 1DI0A 3H4IA 4I36A 1YRBA 3QUAA 2QJFA 1NXVA 3GLRA 3JVDA 3A6JA 3V32A 3AEQA 3I62A 1QHXA 1DELA 2PKRA 1U11A 3IVXA 4N0QA 3ICQB 1GZ3A 4HEJA 3C6MA 5AK6A 2D3WA 1E58A 4LA4A 5AVJA 1R0BA 1VIMA 4J4TA 1DUVG 2UZ1A 1P2FA 3BGSA 3UC9A 4RJTA 1KOFA 3PRJA 3HKBA 4GDMA 1QFXA 3TLKA 5T7BA 1N57A 2XDQA 3TXYA 1JVNA 1IZ7A 3PYXA 1IHOA 1K2VN 5TNXA 4H16A 2E9SA 4O1HA 5DOZA 4EGQA 3MJCA 1Q77A 1Z88A 4AAYA 4RTKA 2OUKA 3ZHQA 1CVLA 4N0EA 4JVMA 4XLZA 4FHDA 5C1DA 5A4JA 2PV7A 5E4JA 2HCTA 1KO7A 1K8ZB 5HF9A 2A0KA 2F3SA 1TQ6A 4FYMA 3ABIA 3RRNA 4D0NA 1GPLA 1O89A 2GAAA 2RK3A 3HKCB 3ZK8A 2QTNA 3MJFA 4UTZA 2DLDA 1Q7EA 2DR0A 4RM3A 2WUWE 2I2XB 3FUXA 3QWIA 3K70C 2NZWA 3UMRA 3JARA 4ICIA 1N8SA 4ZVSA 1LLFA 4BATA 2Y2UA 1UMCA 3L93A 1CQJB 1EK0A 1X7DA 1OKKA 3ZU5A 5CFPA 4XLTA 2JLBA 2QTBA 3ESAA 5HE8A 4BP8A 1CHDA 5KS2A 4G0WA 1UT8A 4MH0R 4Q00A 1RYZA 4QOIA 4KC0A 2VYVA 3ENZA 4TLAA 4FFOA 3QPWA 2O59A 1SUCA 1UANA 4IQ4A 1HTWA 4JLAA 3B5EA 5GJVC 3C41J 4PX2A 3P9ZA 6YASA 2DBVO 2OYSA 3NG1A 1XNQB 3P94A 1XTZA 4GZ5A 4RH0A 3UH0A 3ZXXA 1TIBA 3T0FA 1DDIA 3VHQA 1VKZA 3L6RA 4WN3A 4PWYA 3ELBA 4FOTA 5ELXA 2YMMA 3GRZA 3M1YA 4CNQA 5C2JB 1R0RE 4EYGA 4J4BA 4M0CA 3MM4A 1DXOA 3K0AB 5TQ2B 1SAYA 3FB1A 3Q5DA 3KQHA 2PNFA 1CEXA 4G0QA 1FP2A 3K0EA 4O08A 4F2PA 1BZYA 1LU9A 4H1HA 3TB4A 3GUYA 2AL7A 2G06A 1KY2A 1PR2A 5LZ2A 3E1KA 3S44A 1THZA 1H2RS 4CN9A 3BK2A 4NTZA 4F38A 2AZXA 3LT0A 1YCHA 1LFDB 2NSHA 4QLAA 5CK4A 1E1MA 2BMEA 4AUKA 2WDZA 3DXYA 3OLCX 5BMVB 1NKVA 4KV9A 1D8AA 1T5DX 4L72A 1C1XA 4Q3NA 3KNZA 3EA5A 5BN3A 2W2PA 1UFQA 3ABSB 3Q11A 4KYUA 3R7WB 4PSKA 4CGZA 1K6IA 1N32B 3KV3O 5FUVA 3P2OA 2BISA 4JUCA 5DTJA 5K3CA 2DFTA 4P7GA 1F0KA 5KEIA 5KYGA 4C87A 2XXAB 4OBWA 1U63A 3BTOA 2AMVA 4AKHA 5BVHA 2GN4A 3FVWA 5JQWA 1YRLA 5ICEA 3OMXA 3MB5A 2BEWB 3IEUA 1BJTA 3TUIC 1ZM7A 1VKHA 5JMPA 3GPCA 3M33A 2NO5A 3VTZA 2IYYA 4UBIA 4YJFB 5ITWA 2WK1A 3RG8A 1Q0SA 1I10A 1T34A 2GCEA 4Q3BA 4DNOA 2XMPA 3CINA 3FPHA 1J2TA 3NGMA 3Q2IA 4LVNA 4EY7A 3B3JA 13PKA 4P08A 4WLOA 3UG6A 1E2KA 1C1YA 1SUBA 3LIPA 1C9DB 2P6PA 4MVJM 3WLKX 3ZYZA 1BE1A 1AS0A 2M2IA 3NHBA 1YRAA 2A9OA 1W93A 2BRUA 3BHMA 2WWRA 2PLRA 1E2DA 4RY8A 4X9XA 3ES9A 4D9CA 2J87A 1Z5NA 3WVNA 4BBPA 4Y2RA 4V2IA 4V0QA 4Z6KA 2QLMA 3ZDZB 4B2PA 2MINA 2OV2A 5A3QA 4GDFA 1ZI6A 3F90A 2BH9A 3PZRA 4ITVA 4LF6B 4YY3B 1J00A 3BERA 3NAGA 2C77A 3UIEA 4XTCS 3M82A 2W5UA 1MPXA 1GL6A 1MFZA 1Z8NA 5I6DA 5FOVA 4F3NA 2UVPA 5JBNA 4MHTA 1GEGA 1YDEA 4N76A 3E18A 4N82A 4NJMA 1VLHA 2PK3A 3AJEA 2PH1A 1JHZA 3IDAA 4S1OA 3I9OA 3WQRA 2FTKE 3O8LA 2J3QA 2QB5A 3ETCA 3KJFA 5AXDA 4EWLA 1PX2A 2NO9A 5G0VA 5KX5A 3PEUA 1P39A 2HMYB 3U44A 1ESCA 4BRZA 3L79A 4QL3A 4UZEA 1JDSA 2BFWA 3MOGA 1WD5A 3A31A 3NTOA 3O2JA 2R7NA 3A4IA 3AFIA 2DPYA 4PLPA 3W5BA 2DBYA 5A5EA 1SQFA 3VBEA 1DC3A 2AEFA 4B7CA 1BCSB 3PFGA 5LYJB 4XEHA 1HRKA 3OUTA 1K7XB 1Z28A 3PI7A 1WNFA 2SKDA 4K9SA 3RF6A 5TS2A 3AX6A 5GMOA 1UM9A 2R87A 1T36B 2H4XA 5BSRA 3Q7SA 5IZCC 4UU8A 5ELMA 5FTJA 5GIPE 3AP3A 1N2BA 1HLGA 5IAOA 3NKVA 3MIZA 4HSEA 4MQEB 4C5CA 1DCTA 4I8IA 3O8RA 4KV7A 3R0IA 4UUAA 3WMFA 4TMZA 2CUTA 3I4FA 3MG9A 5E7JA 3AH8A 3CFYA 1MEJA 4FXPA 1MO5A 1NVDA 1FJGB 2AJBA 1RHUA 2Q21A 4X8MA 4ZRMA 4QEDA 4D8TA 3WLRA 4ZQEA 1A7KA 2PAAA 3IUSA 1WZNA 1Z5PA 2IYUA 3BMNB 2Q5QA 1UFRA 1EM6A 2YJ5A 2ZKIA 1DNPA 3BSFA 3DD5A 2AUMA 1GG2A 2ZXFA 4QOSA 4WVFA 3OZRA 2VJOA 4Q4HB 5B1SA 3UPDA 3UJ3X 2NVUA 1JHMA 1WB9A 2QU7A 5TPZA 1Y1TA 4BUJA 2DPHA 3TI7A 3QE2A 1JAHA 1LW6E 2FI1A 1J7JA 2BGJA 4YEDA 3WBBA 5TMBA 2CVOA 1XCLA 4D1YA 2JVIA 3LA8A 5AESA 5TT0A 4AN0A 1WRBA 1RCFA 2I33A 3ENKA 3RK1A 3F1KA 3BWXA 2NAPA 2B83A 1TO1E 5K2MA 3X1ZA 1SVUA 5BV8A 4QREA 2PXAA 2OO7A 1LJ8A 1CY6A 1UPTA 3SU8A 3ZBQA 3E70C 5CFOA 3N8HA 4I7EA 5CEFA 3L4KA 3PYLA 3RT7A 1KDVA 4I9FA 3K1TA 4GNRA 3ZDAA 3HCBA 2KLHA 4U2GA 1D4FA 3OJWA 1EEHA 2YOGA 3EEIA 2NU8A 4GKBA 2ZIGA 2XZPA 1SC6A 3FVTA 1T5TA 3UHJA 3I3OA 3TNFA 1M54A 1TGVA 4RDIA 5BSUA 1S01A 2YIDA 5ITSA 5JZSA 4WN9A 1I80A 1QPGA 4M0LA 3X2SA 3D8TA 3OJOA 3WAGA 4EFKA 2P77A 3RLFA 2I2BA 3DEZA 2PM8A 3A6KA 3MGGA 3ESBA 1VE7A 3OZ7A 3A11A 4PVCA 1RWMA 4M9ZA 5E2IA 3STUA 1PBNA 2QTWB 1U0OC 1U0FA 3QTLA 1U0BB 4DIFA 4MV5A 3HSKA 3RVKA 4IY1A 3I9V1 4R1MA 2AFVA 4FR5A 4GYWA 1FQKA 1U8AA 2QI9C 4H1TA 5TRTA 3WA7A 2VR1A 5AKZA 3GHYA 4B7UA 2BGWA 3D7NA 1HTTA 3EPJA 1W4RA 1MJGA 1QIFA 2BFFA 3BWVA 2PGIA 4D9NA 4DLBA 3RFUA 2VPYA 3ROKA 4FU0A 3SHTA 1GPAA 1BDJA 3WR5A 2GRUA 1M2KA 3ROMA 5JSFA 1BSVA 3A1UA 1TT7A 1A8HA 1MOZA 3DFMA 3KKLA 1RRMA 1WW8A 2IEIA 1T6YA 3PC7A 3P9RA 2X9VA 1V6CA 3RVRA 3W8RA 1XMJA 1JXQA 2OM6A 3F4BA 4X1IB 1ORWA 1WY7A 3B1FA 3MEQA 1OYOA 2XMZA 4OHOA 1SUEA 3AJ9A 4LI3X 4ZREA 3WHLA 4GRDA 2QTMA 4QHTA 4U63A 2I3DA 3HZHA 4HNHA 4PW0A 2J3KA 1TC2A 2X4DA 3STXA 3IE2A 4AZVA 3Q85A 2L42A 5IBRA 2EZ4A 3OQ1A 3DDZX 3IBCA 1GTVA 2C94A 4NBKA 2OECA 3PQ3A 4DKXA 4F8EA 2BGTA 3UA3A 2G8LA 4KO1S 4Q66C 4Q9AA 4YHBA 3KOXA 1K9VF 3U49A 4BLUA 2G4CA 1MRNA 2O1WA 5DW0A 1O87A 3DEFA 3E22A 1LPAB 4OHPA 3CEHA 1M6VB 2QGNA 3CRW1 4M8SA 4LDQA 4J2HA 1NX9A 1K92A 4JCOA 3I2IA 2ZBDA 5LM3A 4DB4A 3VR4A 5LZ9A 2CXQA 1J33A 2FKAA 4UU7A 4AJHA 1KC3A 2J5RA 4G5OA 4HTFB 4IZOA 4J16C 3VTAA 1ML4A 2RH5A 2VC2B 1YOVB 3LHIA 4QNMA 1U0LA 1SBCA 4R1QA 2POQX 1RM0A 4UMVA 2ZTUA 5E2BA 1TMKA 2W2VA 2WMNB 3E2MA 4TTSA 4REMA 2AW3A 4OLHA 1NQWA 5DM4A 3WKDA 4ACAA 4Q1FA 3QPAA 4CF7A 2G25A 4QUKA 2HCJB 2R2GA 4NBVA 5AW3A 1FNNA 1Q7TA 2P75A 3L7CA 4QO7A 3RIXA 2XCUA 3UV3A 1UFKA 1DVRA 2D7CA 1H6BA 2D13A 3CT4A 3FZYA 5ECDA 2WF8A 3LFHA 3L7AA 3LJKA 3OQPA 5ALPA 4F8YA 2VP5A 4HYTA 5FPKA 5L4NA 5TEWA 5TMPA 2XUZA 1BC5A 3F67A 2WUFA 1W1IA 4HEA6 1O94C 5KSOA 4P83A 4INOA 3ZLVA 1QE0A 2VF7A 2QW0X 4PGAA 4KNWA 2WT8A 2IIPA 1VHJA 4F9FA 2X7HA 4QTYA 3H8JA 1HFKA 2AXPA 2OGWA 3QUTA 2Z1DA 4QUAA 3KEOA 1C9EA 2XUPA 3AO0B 4J91A 1XFDA 1ZRNA 2LWIA 3C4VA 3PXCX 3ZWAA 2G5PA 1Z6QA 5E3JA 1NDHA 2EX4A 3MTDA 4NS4A 2C8LA 5FP0A 4BTVA 3IOBA 6NULA 2JLXA 3F78A 4IJUA 4R0MA 3ZV6A 4UOZA 1ECLA 3GFVA 4N5MA 2P35A 4BV8A 3B1VA 1XEWY 3FFWA 2UYHA 4XM1A 1GUYA 1Z8HA 1SBZA 5KJ1A 1QUEA 5KZMB 1I24A 3PA8A 4GVXA 4BNLA 2PUFA 4TVSA 1Y7HA 1H9AA 2ZDGA 2ZRHA 1XZPA 3EMDA 4P81A 5DI9A 4LJ6A 4BZXA 2NTYC 4CNBA 3HXLA 4LPKA 4MLZA 1YK1A 4GMXA 3S8YA 3DKIA 4HCJA 2D4AA 3LQ4A 3IRVA 2LGJA 4LYJA 5C4GB 3CO0S 3V1KA 2BFNA 1DX9A 1T8UA 3C3BA 4MWDA 1JHQA 2QVLA 1QYCA 1XWIA 4IWYA 2Z8XA 4JXZA 1QXSA 4ZAFA 2A6PA 3ER6A 3O3CA 4JA2A 4CU5A 1AB6A 2GN2A 2P4HX 3TPZA 1QG2A 4GPD1 5TQ0A 3WHIA 1IWOA 4E51A 5IX8A 2QN6A 1JBQA 1H1LA 2JLRA 3K4QA 3TTVA 1EP9A 5AVTA 3D4LA 4Q12A 4G8DA 3ZIAD 1FFEA 3R3VA 3TH5A 1NNEA 3QNWA 3NDPA 4IKEA 5EXPA 2H92A 1IY9A 1QDLB 3UWSA 4NZNA 5U4QA 2HEIA 2NP6A 3MAGA 5HQTA 5CYFA 4BB9A 1M1ZA 1S3GA 1TRKA 1B3RA 4HEA1 1GZ5A 2IHVA 2KBFA 4QHYA 1CHNA 3DOOA 4J0HA 3O2SB 2V74B 1XD8A 4PZCA 5AI8A 2BEVA 3CRMA 4DPMA 3A9CA 2A58A 2IXTA 2AJDA 2XUAA 4EAAA 1JQJC 3OZUA 2XMBA 3FKQA 5FWXA 1DRJA 3PQ5A 4WKGA 4TYYA 3O93A 4Q9NA 3UT0A 3MERA 1ST2A 2WE7A 5JI2E 5E6UA 3FR8A 3MMXA 1U0JA 3EGOA 2AEEA 1QQ5A 3DPUA 2PV0A 4L3OA 4CFYA 3OICA 3NBYC 1D09A 2WHXA 4Q9LA 3W5JA 1RHQA 4Y9TA 1ZH4A 3FH0A 2P9HA 2X9QA 3OA0A 3PG5A 1W34A 3MNFA 3R9KA 1RI4A 4B31A 5C8VA 3PGA1 1R8JA 3MPOA 4GQAA 3BFVA 3G59A 4LMAA 3EAQA 4L6IA 2HBRA 3TBFA 3D59A 4MINA 3VVBA 3UTCA 1IN8A 1SNYA 5ERGB 4AF7A 4ZTUB 2HCRA 1M8PA 2IOFA 3VR3D 3FCEA 4FFDA 5FPPA 9LDBA 5KYTA 1BW9B 3O31A 3WMGA 1FZTA 1B0PA 1YL7A 3LP8A 1DOHA 3GEIA 5IARA 4CMKA 3PDUA 4NYMR 2XA1A 4JP3A 4NFLA 1J1ZA 2AD5A 3JWJA 4UNRA 3PC2A 2G6BA 2ZYSA 3LOPA 4O4JB 1IXYA 4URFA 5A4FS 4FEYA 3PR2B 2W6JD 2J9ZB 8MHTA 3AIKA 2DLNA 3CW2A 5A7HA 3DVRX 4Y2SA 3SJCA 1DPFA 2IIBA 5JPIA 3TW8B 4TN5A 3WMWA 3FJ1A 3MB8A 1VMDA 4C0LA 4NCBA 2QQEA 4QNNA 4BU0A 4UTPA 4GFDA 1NE7A 4OF4A 1H4TA 3GRYA 1AKEA 3RRMA 1Q1GA 1ZUIA 2ECKA 1A82A 1AU9A 2VDOB 2YZ7A 4M36A 3B3QA 1CJMA 2MU1A 1R6XA 2CUKA 1J23A 3GH3A 3OO1A 3UJ8A 4KAXA 3U7HB 2ZUUA 4PLHA 1RJFA 3FW1A 4BX3A 2Y4OA 1FXUA 1P7CA 4K5QA 2B20A 1OWLA 2HXSA 3IX7A 4P6VF 1QCDA 3EC1A 3NVDA 2ZTMA 1KRHA 1Z37A 4PR0A 4UAUA 3WZLA 2P6NA 2OLJA 3JCZA 2QMZA 2WSSD 5DCUA 5BRAA 2G0NA 3DMDA 2H1FA 3ZTYA 3CPHA 5EHZA 2XYGA 1UOPA 5IYZB 4BLSA 1VJ1A 5JNVA 2D1TA 4B6FA 1UDAA 2F7SA 3ZE0B 1KAMA 3E3OA 4JJ4A 4ZAGA 4D4KA 3CRZA 5K3DA 1DTWB 2IUUA 4MKRA 2OQVA 4EB3A 2Z3ZA 3ZZMA 2JGJA 5EPEA 3WLPA 2QK4A 3D3NA 1CZOA 1M2EA 2AR9A 4Z99A 1G20B 4CDNA 4G6ZA 2Q3EA 5KNDA 3UMYA 1WXXA 2PZJA 3PVCA 4W5RA 1MX5A 3STHA 4A15A 1CFZA 2D5CA 5DHQA 2ZTVA 1GDDA 2J07A 1Z0AA 2QM0A 3OY7A 2A86A 1R0CA 3P0IA 3UZUA 3HZZA 3L2OB 3FMOB 4JXXA 4I1YA 1GPWB 1KK2A 2C9BA 3FHOA 1OZGA 2J0SA 1NFFA 1UMDB 4G89A 4KQGA 1JEOA 4BMVA 4H2DA 4NYIQ 1ZEJA 5L7TA 1MLDA 4YO8A 4NMXB 3FJOA 1RM3A 2IV2X 3CYFA 1H2ZA 1WUTA 3LS2A 1AMUA 4Q05A 3ENNA 1BXRB 4M0DA 2XJ9A 4YK7A 3AY6A 4JLJA 4Q7QA 3GDGA 1NXWA 4M83A 4CMGA 4MDHA 1E79A 2AK2A 4WJKB 3VNQA 1BAPA 1NW3A 2H1IA 2VJDA 4MRSA 4QATA 4EJSB 1KRWA 5FDFA 3EEYA 4M0FA 4JGGA 2ZWAA 4DWWA 3A1DA 5ENVA 2XQKA 1E2BA 1L5FA 1E3WA 1B26A 3UPTA 4PHHA 2C54A 3TUZC 2QM3A 4C7OB 3AU8A 1NTOA 4WUTA 5G3ZA 4AY4A 2F48A 4EB8A 5KTRA 4XIYA 1MRSA 2ETXA 4K8RB 4PSDA 5A03A 1LSUA 2G36A 5BSVA 1TYAE 3X3HA 2C8JA 1PG0A 2JNWA 2XRZA 1I01A 2BY4A 2FLVA 3EZ9A 1N77A 4R54A 1C1HA 2XUKA 3L6CA 2AG0A 3WGNA 3HEBA 4PO9A 4KL8S 4EYEA 4KBGA 4FGJA 4Z7OB 3HYNA 4DV1B 1EPUA 2ORYA 4QFMA 5EGSA 1M9NA 2OFWA 1V5IA 4QZVA 1Q57A 2ATEA 1Z7BA 4MLDA 2QX6A 3TLAA 1NFRA 4BX2A 3Q0TA 4ER3A 4E4TA 1GGEA 5AJXA 3GLFB 5BT8A 4G1FA 4WW0A 3JQAD 4IIUA 2OD2A 4DUGD 4DVJA 1ZUNA 4DNPA 3JYPA 1QH0A 4BO1A 3HDTA 3UK7A 1SJ9A 4TS4A 3TRJA 3O4HA 4RD0A 5DHTA 3RS8A 4ZJYA 1EE1A 4CYMA 2R4QA 3HU2A 3TJMA 3ELYA 2IWRA 5I7FA 1FC0A 1YL6A 5D87A 2XECA 3EOAI 1KAHA 5FPTA 1K6MA 3ENVA 2DKNA 3FYUA 4KE9A 3NTUA 1BKDR 1WPXA 4G5HA 1XTTA 3BSYA 3R09A 3EXEA 4QU5A 4CLRA 1AN9A 2QJTA 3CF2A 4ID3A 4DQLA 4EPYA 2FDCA 2CCJA 2G76A 1FFBA 1USUA 1JAXA 1YNOA 5CH3A 3LVBA 5IEBA 4BMSA 1F14A 1CQPA 2JW5A 3QF4A 3KJHA 2IHZA 3DXZA 3IEXA 4TQUS 4D8VA 1E0AA 3G2HA 1M66A 1IZ8A 1ODSA 1P3Y1 1QGED 2YDXA 2IZ5A 3A4TA 3JD0A 3OLWA 4GPAA 3SGLA 5AJYA 1O5TA 3QKSA 3GIDA 3HSSA 1PL6A 4U9UA 1T3GA 4ESHA 1Z63A 3AEZA 1FNCA 2Z98A 3FMGA 5F1KA 1TM5E 1P5HA 221PA 4LVUA 4IW3B 3OKPA 1SZCA 1EUQA 2XWSA 4ONEA 4WUVA 1QRRA 3VFDA 4WACA 5AKXA 1GGMA 2Z0MA 3T15A 4CT4B 3SC2A 5F2NA 2I6UA 2WA1A 4FSXA 4Q9IA 2F4NA 3NYRA 3AFMA 1Q0LA 1TYZA 2E82A 3IEPA 4Z3DA 2ZSAA 4BEBA 4D8WA 3WWPA 4EHLA 1JYFA 1MDFA 1NVFA 1SK8A 4ARZB 2FFQA 5FUQA 1E5DA 2G1PA 3L01A 2PJRA 4H59A 1G63A 4KFCA 1LBEA 4E1VA 2E85A 2BKUA 3FF4A 2JDIA 5L51A 2PT6A 3IE0A 2H7XA 2H63A 3L4JA 5F73A 3PGMA 3CMMA 2Q4BA 5IDQA 5IJWA 4JKYA 4X6UA 4I50B 4LUCA 4BXOA 1GRCA 3K9LA 4AYXA 3E9QA 1YS2X 4JB8A 4ZQHA 3SX2A 4W8OA 2IUTA 3TIIA 2N9UA 1OPRA 3SQOA 5AW5A 4YIHA 2FZEA 2YYYA 3GJYA 3K1ZA 4OQZA 3Q3EA 2YWFA 3RASA 4P32A 2HREA 4O2AF 1IBLB 1KPHA 3AK4A 3SEQA 4OXKA 3RJ9A 3WSWA 5BMOA 3N2KB 5HX7A 4CL3A 2WD7B 3SS9X 1JH9A 4JR1A 4GVPA 4EI7A 1V4BA 5K6AA 2A0UA 4PWZA 5DMHA 4BNKA 4C06A 3O8OB 1C7IA 4PPYA 3OU2A 3G6WA 3ZS8A 1RIIA 4AJ1A 4C6HA 4ZCQA 4D3ZA 3THWB 2ZGVA 4JLPA 1K06A 1PR5A 1LXCA 1CLUA 1MO2A 1TL7C 3P0HA 4ZZ1A 4UCQA 3LNCA 2JG3A 1VHDA 1GFSA 1R6AA 3PNSA 2JI4A 1E9SA 4OJTA 4U2DA 4G0OA 2ATIA 2GHQA 5AW8A 5DWVA 5HIAA 2P0YA 1XMQB 1KSGA 4FOLA 4OCZA 3T5BA 1CZLA 4ZVMA 3LCJA 4RFSB 1I0IA 2FPLA 3TFQA 2XVMA 2UV8A 3VNVA 1X8JA 1VOTA 2R62A 2ZJ3A 3KOOA 3P2IA 3QVGA 3AY3A 4KE6A 4OI2A 5LWHA 4BUZA 5HFAA 4WK6A 5GZ1A 1MD9A 3AOEC 3L82B 3AETB 1X9HA 4YPOA 5FHQA 2ZSKA 3SDSA 4ZHSA 3ZHVA 1UBHS 3MTBA 5JBQA 4Q16A 1H2HA 1BG6A 5DGDA 4QUJA 5G0UA 2XKBA 3PNKA 3UJNA 3G2KA 1FFGA 1NBAA 1T6XA 2I4LA 3Q8XB 1QIHA 1NR1A 3A0RB 1DBWA 2G3YA 3NU1A 4KVAA 4MOWA 5FTNA 3WIUA 2DFNA 2EFEB 1A97A 3KDAA 4QBHA 3U0BA 1FRNA 3EWNA 4YAWA 5IJ9A 3ABQB 2UZAA 3A6DA 4J0CA 3IEMA 3M5PA 2I62A 2RH9B 3K15A 5JH7B 3C24A 1PGQA 4BJHB 5FEUA 3AEUB 1ZP6A 3RYTC 3AYXB 5FT9A 3DDSA 2XMRA 4UE2A 3K0SA 4OFWA 1ZIOA 4QA9A 1QTQA 4Q7EA 2Q6LA 1MA0A 5L7YA 1H4SA 3COSA 1SBQA 5KYWB 1NVBA 5KQPA 2H1LA 1JN0A 2FEPA 3I76A 1ZJ4A 3LZ6A 4BC0A 1WF3A 3HCEA 1JS1X 4RF5A 3WB2A 3ZVKA 3OQBA 2ZIWB 1VPLA 1UMKA 5IH3A 3FTPA 2IL1A 5BPFA 4LF5B 4UUQA 2K7FA 2VDWA 3OPYI 3O1LA 4IINA 2O07A 1N4DA 2YICA 1C5KA 3AEYA 3GGGA 4FFRA 2O7SA 4L08A 4Q3LA 4W5QA 2IBSA 4CMJA 4AJ9A 4UNNA 3TQRA 1A2QA 3NB0A 4GWLA 1DT5A 1I2MA 4NX2A 3IMFA 1J99A 2Y4NA 4C04A 4GZ3A 2PE5A 2QBYA 3EQZA 3UOGA 4PGFA 3UW1A 5JMOA 2Q49A 1IH8A 4GUAA 1PR4A 3T4XA 2H7VA 3IT3A 1KR2A 1CJSA 2PTHA 3KSMA 4H17A 1WUJS 1AG9A 1Q7CA 3OSUA 4GI1A 3JYNA 4INPA 1UQUA 3ACDA 3G0OA 1GU1A 2IP4A 2X6QA 2ZR7A 4C0AC 4TMTA 5CLJA 3QYJA 4F72A 1GGVA 3WK8A 3AF1A 2X5KO 3C97A 2O5VA 5E1MA 1X38A 1CBUA 3LLSA 4DIOA 3RO7A 5IUNC 1C3JA 4DWOA 5LIRA 4WLEA 1BW9A 1YACA 3NI2A 3A2NA 3BK7A 1ZGZA 1R5NA 3GFTA 4L5CA 5A71A 3RS5A 3RUAA 2GM5A 4DT1B 4YV1A 3HACA 2O52A 3DZGA 3IQEA 4HLQB 4E12A 3TX2A 2V4MA 2ZBEA 3CUSA 1GNPA 3KYDB 3DAHA 4N03A 5F98A 4INZA 1P6QA 3ISJA 4RFLA 2OE2A 4RIEA 3QXJA 4ZXPA 2TMDA 5BQOA 3MHTA 5KO2A 1OLSA 3WKAA 5ALJA 1JJBA 1Q0UA 3FTEA 2C5SA 3S3TA 2YJ6A 3PEWA 2C4MA 5G0WA 3K4HA 4RVGA 4MW0A 5DIFA 4Q3AA 4CKZA 2I67A 4D8UA 4AG6A 3O8QA 5JNWA 1O5OA 5I47A 1NQXA 4K81B 4L7VA 4LOIA 4Y1FA 1FRZA 2CL5A 3DE1X 3LCMA 3N86A 5KHAA 2A5JA 4Y67A 1KMHA 1FS4A 2HLHA 1TUEA 4OGFA 4PHCA 1KHHA 1MFPA 1A69A 2WYIA 3ZU3A 2NT4A 4R9SA 4GS5A 4F1JA 2VWPA 1NUSA 4K46A 3O4VA 2QA5A 1EWQA 1RCTE 4FLFA 4IYJA 1OXBB 1U1EA 3EXG2 1BGWA 5MN4A 2V54A 5ED0A 3ZCPA 2WIGA 2UUBB 4XGKA 4AD8A 4CQMD 1DE0A 4MV9A 5E95A 4ADSG 3FHTA 5IYZA 4CW7A 4IFTA 2WYVA 2B3TA 4JJEA 3KD2A 3PGXA 4WEQA 1UWVA 2P4EA 1PLLA 1V35A 2XUFA 1GPKA 2W2KA 3BIFA 1N6RA 4LZLA 5K0SA 2HHCA 1SZJG 4G0UA 2K6GA 2QTGA 4IIFA 3U3JA 1IJBA 1IQRA 1NT2A 1OIXA 2JFBA 1SMKA 2QL9A 3B6JA 3W6OA 4LRWA 4WT7A 2QTZA 1W75A 2HWUA 1JDVA 2QVXX 5F2KA 3AVVA 4D6YA 5E7MA 3PUVA 2Q4RA 1PJ3A 3I52A 2GTIA 4RIGA 2IW3A 3TFOA 3OA2A 1PEKE 2ZJ7A 1B3BA 1KYXA 3I23A 3L8DA 4O2AA 2MSNA 2VHWA 4I9HA 1KO1A 1PAUA 4BVAA 4DCPA 2QPAA 4RLFA 4EQ6B 2IYZA 1UK8A 1RSZA 4L22A 3FDIA 2ACKA 3VHXB 4C03A 3MFYA 2WA2A 8ADHA 3PWKA 5JZOA 4NQZA 3ZJVA 4ND6A 4V0NA 3FDJA 4RY0A 5DN6A 3GRVA 2WTNA 4CM4A 3ZU2A 1U3WA 2DWCA 4ATNA 3Q8MA 4L3VA 1JKJB 3R24A 5IC5A 4B33A 3T7IA 2TRSB 3GFSA 1RJ9B 4UHEA 4OQ4A 1XXHB 1COWD 5GOZA 4ZI2A 1N3BA 3VTFA 1S2OA 3K4PA 3BD8A 5AVUA 2V6MA 5DHAA 2DTXA 2ZS8A 3KAJA 1NBMD 4IO1A 2XYHA 2BGMA 1E6MA 2DUJA 2QXYA 3LUAA 2EW2A 4W63A 1VIVA 3L7LA 4HQ6A 2ODQA 1TX4B 1P8JA 4C7OA 1EGHA 1KI1A 3SXUA 4HRVA 3RRZA 1K63A 4FYWA 2J8ZA 2ZUVA 2O3RA 4KR9A 3BD9A 3MELA 3QH4A 4EUEA 3NVAA 5DKFA 1KIMA 1GUDA 1X1EA 4F92B 4RXTA 4FGWA 4AQ7A 4C3ZA 3EIXA 2ZJAA 4C43A 3I4LA 3U6BA 4PPGA 1DC7A 1OH7A 3TNDA 3ZDYB 1RPZA 1CW2B 2P40A 3H8WA 4IV5A 4ECAA 2ZXEA 5CRIA 1BD4A 4YP9A 4JFAA 4NONA 2RI0A 2VDVE 2XGGA 3B38A 4MNTA 1B15A 1TYEB 4YJ2B 4ZEVA 3CZMA 4PG8A 1SY7A 2VZ0A 3N6XA 5K3BA 5LBIA 3T5AA 5J3JA 3NDBB 1DKUA 3IR5A 5F5NA 5LQJA 3GLFA 1SQ5A 1P80A 3I1FA 4C01A 5F78A 1F1JA 2YVAA 4I2VA 5CM2Z 2VNAA 2F1KA 3FIUA 2VPXA 3OUUA 4LMBA 5JAPA 1EM8B 1U1CA 4L5IA 2A3NA 3SQLA 5FA6A 4MYHA 3EZFA 2DZDA 5D5HA 3GHHA 4O25A 1KJNA 3CN9A 3UM9A 1JW9B 2NOAA 3QQ5A 1EFDN 2Q8NA 2AX4A 1R15A 2Z6VA 3MBOA 4Q9JA 5FBRB 5FOTA 3QLUA 2GCPA 4KSCA 3I04A 1SCQA 5BYBA 1EDOA 5CDSA 1F1BA 2UVDA 1D2GA 2RE8A 4JZYA 2YNMA 4DMLA 4J0GA 3USCS 5HGJA 1NL3A 4D7AA 2XEXA 4MUFA 4E7OA 3H42B 5G1NA 3T4PA 3FYDA 3DUWA 1Q74A 3OHPA 3T34A 3PL5A 5MF6A 4ILEA 2FN7A 2FPIB 4ND7A 1A04A 4NJEB 4CM1A 4NU5A 1OI7A 1UPFA 1GY8A 1N7JA 1GSAA 1G8KA 3IC5A 4L57A 4MUBA 1J70A 4HH3C 4HLNA 1P6UA 3KTFA 1N2ZA 3B8EA 5LZ5A 4ZIRA 5C4MA 3KB2A 1ZH8A 3T5TA 2HQSA 1YFLA 3MQ4A 3NT4A 4H7FA 4DL9A 5CVVA 1TECE 1F38A 4N5LA 1PCXA 3T95A 5LQNA 2BHTA 2WYWA 1VCHA 1PN3A 3ACBA 3VKGA 2XXBA 3CUVA 4ALMA 4N0DA 1A5TA 4P4GA 4KR3A 1Y4AE 3ZJTA 1JFFB 2B4AA 1Q0ZA 3GGSA 1NMYA 3K9CA 4ZAVA 5HP4A 5EUCA 3N2LA 4GWGA 2IUYA 1IN4A 2QP4A 2GD0A 4CDRA 1Y4SA 2CDAA 4JHXA 5EWJA 4HZUA 1IHUA 3D3KA 3L4SO 4H60A 2F1HA 3W1WA 4ARZA 4ETMA 2JIQA 4ZC1A 3FOZA 3UBTA 5REQB 3TLZA 1M2FA 4G4SO 1IPHA 3UK1A 2J48A 5DFAA 4CETA 1SKBA 2XQGA 4I8DA 2VXBA 1AUQA 1QV6A 3IQZA 2W42A 1ZLYA 3GI1A 1EXWA 2Q3DA 4GL4A 5C34B 4H3VA 2ZCJA 4JAVC 1PJ8A 1MKYA 1ZNZA 3LUHA 3G0IA 2B7LA 4H6WA 1N3YA 3K0CC 4DCNA 3NUGA 2HGZA 3NHUA 1KZ6A 3U1TA 4ARIA 4Z4IA 1SRQA 4ND4A 1GGHA 3PHGA 4YUZA 4YMLA 4GECA 1TLTA 2VPWA 2WHEA 4Z0NA 4KQHA 3PRKE 4KGZA 3SHOA 3JVUA 4AM8A 2OZEA 2Y0DA 4EVSA 4FS8A 4PSCA 3BK1A 4LZAA 5BV2P 4HB3A 3N2KA 1V11B 2BBTA 1JEEA 1P7PA 2PU5A 3OFND 3Q7QA 4KODA 1FUYB 3BEOA 4MWOA 4ODIA 3T1OA 1SHKA 2RI6A 3H18A 3IR7A 2Q7OE 2EHDA 1C7EA 3U31A 4OQXA 2EQ5A 4GR4A 1S89A 2GBCA 3FFTA 3H2BA 4LGVA 3L0ZA 3GNTA 2PLAA 2FQYA 2IDKA 1GKYA 2ZAGA 4IV8A 5ALOA 2N75A 2ZJZA 3FD8A 2OZLB 4TL8A 5K0ZA 4GQBA 5BSEA 1S7CA 2R9VA 3OX2A 1U2DC 2UZ4A 3SHFA 1EA7A 1H0RA 2H7YA 2H1OA 1ODKA 1V16A 5KYUB 2XRMA 4UVHA 3VKHA 1IONA 3OAAA 3ST7A 4QJ3A 1XAJA 3LXRA 4ALLA 3RANA 5DYYA 5HQJA 2NWQA 4M9XA 3IMKA 4YVFA 3ETLA 3D7LA 5M04A 4DJJA 4PSUA 1FRQA 5HRCA 1WMFA 1C8LA 3PB3A 4OKNA 1EX6A 3LBHA 4U00A 3T1HB 1SA0B 3ND7A 4CKXA 5B6JA 2WU8A 4RVUA 3T99A 4D3SA 1T9HA 1WZIA 3MCUA 2ZR0A 2VHUA 1LTQA 1ZITA 1C2YA 4XUDA 3RIMA 1WHSA 3VPGA 421PA 1TJNA 3AV3A 3FIJA 4WK0B 2DFPA 3EDMA 3K8QA 1TRHA 3GPBA 3JASA 3A2LA 4D41A 4FZVA 3MOSA 4MGYR 1KE2A 1K4KA 1O95D 1ZK1A 2WOOA 4LQ4A 1XZJA 1U2PA 3EIQA 2Q3CA 1WDLA 2GMWA 1TEHA 2W2QA 3EC2A 3HBNA 3JQRA 1P18A 4YAEA 1E3IA 2HK9A 4EGJA 1J9ZA 4MGHA 1CJKC 2DWQA 1JDBB 2AFIB 3N0RA 2YWEA 4OFBA 4RSGA 5FPQA 1YI8A 2SCUA 1MJGM 5EJ7A 5C51B 4TM7A 2OPHA 1J8DA 3A7DA 1MT0A 4HDAA 1J2UA 1XB2A 4M21A 2GSDA 3A9RA 2E3JA 2MIIA 4JDPA 1BIFA 3D7RA 1H3NA 2BKVA 2C97A 1AUPA 3NIBA 2O7QA 5CFZA 4WNAB 3A8TA 3OPMA 1UAYA 1FTGA 3C3KA 4HAUA 3U0VA 1SCNE 1AM4D 3N2NA 2CFSA 3IAXA 4BJ5A 1E5XA 1PJ2A 3A6GA 3UXMA 3PL1A 1HL3A 4LYAA 5IS2A 4NBSA 2YJGA 1JT9A 1L2TA 4I1IA 1A9PA 1GU7A 1TZCA 3GBVA 4LXUA 4CV3A 3NOOA 1G3IA 5B7NA 1UWKA 1Y8CA 4HKTA 2A5YB 2I6FA 3H17A 3AW9A 3TG2A 1FDWA 5CW1A 1MVLA 1S7GA 5DLEA 3LMKA 3U7GA 3BBLA 1VJ0A 3RODA 8AT1A 3PD0A 1AZTA 3HA2A 4BO8A 1V9CA 1YDFA 3U4HA 2QN7A 1FDSA 1PHPA 5FOSA 3D64A 1G5IA 3QUBA 5T64A 5LU9A 1NJ2A 4UNPA 3TG8A 3E53A 2RKWA 2N47A 3GQVA 1ZGJA 1RAHA 2YBDA 4UBOA 2JIDA 3KTAB 5B12A 1QYIA 3JQDA 4MR7B 3IULA 4BQPA 2BFDA 2QNBA 4A0FA 4AMUA 3RYCB 1YZUA 4HNRA 2RHLA 1CJUC 3JD4A 4X1OA 2ADMA 3C15C 3QQPA 5BV1A 1E2NA 3M5DA 1ZIPA 2GN8A 2Z08A 3GR6A 3TDMA 4V02A 3W05A 4IIHA 3RUHA 5C7OO 1SCBA 2W2TA 2KJQA 1EHYA 3O8BA 3OCVA 3DDCA 4B2IA 4HNTA 2OBLA 3K70B 1EFAA 2EP7A 4HFRA 5CLFA 1H4VB 2G9ZA 2H59A 2IU4A 3SKXA 1NYRA 2WIBA 3ZLUA 4D4LA 5KC8A 5KPJA 4D44A 2ZJ4A 4ZDWA 2OC4A 3V4ZA 1GLNA 5B1HA 1DXQA 1KAQA 1T29A 4FCCA 3DP7A 2X4GA 2XJ4A 4EDFA 1QWOA 4KN5A 4WLNA 3TSZA 1LPPA 1Y7IA 3ACCA 3QW2A 5JG7A 5TEVA 4EP1A 4ZYVA 5ICCA 5JVDF 3ZCXA 4RTOA 3NIGB 4ARVA 5FPYA 2ODAA 1XAHA 3LPLA 5HFJA 3IMGA 4BJ3A 4CL8A 3D3WB 3ZVLA 4TTVA 4BMNA 3FPKA 3C8DA 3LVQE 3VYWA 3L0SA 3D4NA 1X8XA 3BL5A 4PC2A 4DIBA 3NM4A 5HOQA 2Z6AA 2B1RA 3VH4A 3ISTA 1QIJA 2G08A 3PGVA 4BTEA 2G1AA 1U2SA 5HUJA 5KWIA 5J4LA 3SFTA 2DWOA 1AKMA 2ZPTX 2YWCA 2X1MA 2Z30A 5T4HA 4ZV4A 1GPJA 1GYRA 3ZJUA 3RABA 3W8EA 2OXFA 4R8LA 3ZXSA 2ZM5A 2Q3HA 3MMNA 3MUFA 1G66A 4F21A 1CT9A 2Y9MB 5IVDA 1TZJA 2XOKD 4WI1A 3P52A 3HJHA 5HF6A 1XMSA 2WJ4A 1LLCA 1NRXA 4G1MB 4I5FA 3I8SA 1EWYA 3KOZA 3OZCA 3VPAA 4DIMA 3IP6A 1Z4NA 1KY3A 1QIGA 4JH0A 3TD6A 5BUCA 3WLMA 4TX1A 4Z9XA 2HSEA 4ZKEA 1SXGA 2GZ2A 3EQ8A 2D1QA 2VDLB 3KL4A 5G4KA 5LP6C 4B3FX 4Z3KA 1EWKA 1P75A 1VIDA 3A6HA 4KOEC 3D2LA 3H2KA 3EYWA 1JEAA 3H1AA 4GPBA 3O94A 1TU0A 2BKLA 5C1PA 4M9QA 5LOVF 4L7QA 2YJNA 4IHQA 4ZK6A 2YS6A 3KPVA 5J63A 3RKRA 4I4NA 4F06A 2FE4A 4NV1A 3R6TA 4JBGA 7ADHA 2I9KA 4M0MA 4RSMA 3QY9A 3W34A 1HX7A 2F43B 5L4SA 2R6HA 2QN2A 5DASA 5UKDA 3SHWA 4NYMQ 4H15A 3VOBA 3TZBA 1PR1A 2QX4A 1RMTA 1KI6A 2R1TA 4LK2A 5DNUA 1E66A 3CKLA 1GQFA 2AFHB 1WO8A 5CVJA 1RAAA 2OCGA 1WEHA 4LSWA 3WXMA 2XTZA 4E22A 5IT0A 2Z2ZA 3NH6A 5CAEB 5JDIA 5JZVA 4K1LA 2B99A 4JC8A 2YIMA 4J0EA 1YVEI 3O9MA 5EC8A 3UCFA 1WCIA 1KQNA 1QFMA 4ZAZA 3WDSA 2X5JO 1TAHA 5KOJB 4GMDA 1QNLA 2WKQA 3DJFA 5KOHA 3DTNA 1UOEA 5JCJD 4JV5B 1GAJA 1VBNA 3Q3GE 1O7JA 1L7EA 1F48A 1C0LA 3QX9A 2MCFA 3U6KA 2PUGA 1ID8A 1JG2A 2CLKB 4JYZA 5FJIA 1CXZA 1RWPA 4II3A 5J2UB 1ZN7A 2NO4A 1F8FA 3GCWA 5B58C 1NJ6A 4TVOA 3KIPA 5IJ0A 1HO3A 2PZKA 4QJ5A 1UT6A 2GYUA 3K2BA 3MTEA 1JKIA 3GFBA 1XA4A 4NK4A 3ORHA 5JNLA 2LUOA 3ND8A 3NT5A 3K0FA 5CLGA 3IHKA 1W7AA 3WSVA 1PSZA 1T0BA 3EFOA 3T9EA 4TKZA 2HMSA 2BFBA 3AU9A 1NW4A 2QQGA 2WM8A 1BQEA 1M1XB 1A8IA 2FP4B 4DIUA 4EMUA 3TNLA 3ZH2A 5K03A 4PQEA 3R44A 16PKA 4OHRA 4AVYA 1TKBA 3QLJA 1YB2A 1RYDA 4FXOA 1V9SA 3GMSA 3IP5A 3KZ1E 1KFKB 3GLVA 4ZWNA 4H35A 5F76A 1SCKA 4R01A 1HKHA 3CA8A 1KDRA 5HPYB 2C84A 3O0DA 3DCJA 2NXJA 2PMDA 3JZMA 4LY3A 2Y1EA 5G3YA 1P1JA 4EELA 1YDMA 1N33B 5JATA 1I6KA 2HFKA 1MX9A 1YA8A 3QKRA 3RH0A