4UMDA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with citrate
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
173
structure length
173
Chain Sequence
b'MNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
molecule tags Hydrolase
source organism Moraxella catarrhalis bc8
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
total genus 59
structure length 173
sequence length 173
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umdA00
1EK2A 5AK6A 2JAOA 4Y2VA 2JAWA 1Z4PX 4BYGA 2Q4TA 3SHQA 3PDWA 4AS2A 2CFSA 4G9BA 2FPWA 2P27A 5AVZA 4FFDA 2GMWA 4Y2QA 3WKAA 4UMFA 3I1YA 3SF0A 3NANA 4JDPA 4DW8A 2HSZA 2HF7A 4J03A 1YDFA 3OCUA 2WHEA 2FUEA 2B0CA 4Y2RA 1Z4IA 5AI4A 4NWIA 3DNPA 4KNWA 2JARA 3FZQA 2YJ3A 3WK8A 2YN4A 4Y2PA 3SMVA 2WF5A 3QGMA 4UAUA 5ALKA 3KD3A 5AIBA 5AKGA 4CE6A 2NO5A 2ZOSA 3PGLA 4BX3A 1O03A 1NRWA 2YMPA 3N07A 3DAOA 5AW8A 2HX1A 3B8EA 5AW1A 3WKEA 4HGPA 1RKVA 1XVIA 4YCNA 3L0CA 4GIBA 2G06A 5ALWA 2GO7A 2CN1A 4JB3A 4UM7A 3ZI4A 2YJ4A 2FPUA 3AR9A 4B6JA 2C8KA 3A1CA 3L1VA 3QU5A 3GYGA 3W5CA 4XQ0A 3AR2A 1AQ6A 4UAVA 4Y2JA 2PQ0A 1ZD2P 4OHFA 4YCMA 5JJBA 2O2XA 5IT0A 4UU0A 4ZEWA 3QU9A 3KC2A 4UATA 1QH9A 2I7DA 1TJ3A 2B1QA 1NF2A 5AW2A 4NV0A 3ONNA 2OA0A 2W4MA 2O9JA 3F9RA 3QUCA 4KX3A 3OTQA 3CNHA 4EELA 3NIWA 3MMZA 3BA6A 1RKQA 3VAYA 4G63A 2G0AA 1ZOLA 2I55A 2CFRA 1RPZA 2ZBFA 3W5DA 2IYEA 2BDEA 2B30A 3FPBA 5AVWA 1Z5UA 3UMGA 3WKDA 4Y2TA 2QYHA 5AKZA 3ZU6A 4EX6A 3U7EB 2ZBDA 3MN1A 4BBJA 2FEAA 1RMQA 5AW7A 4HGOA 4OFZA 5A3RA 4BNDB 3HLTA 1ZD4A 1J8DA 2ZBGA 2AH5A 5AM2A 3NRJA 3E8MA 3AR4A 1U2TA 2FI1A 4HGQA 1Z5GA 2YY6A 3WK9A 5AKXA 2W11A 1L8OA 3QU2A 5A3QA 3ESQA 1ZRNA 1TE2A 2P11A 4F71A 2HEGA 5AI9A 3R09A 3EWIA 5AW6A 1RLTA 4Y2YA 5ALZA 1TJ4A 1L7NA 1QYIA 2NYVA 2WFAA 1L7PA 3OCVA 2I54A 2CFTA 1QQ5A 2C4NA 5E0OA 2YJ5A 5IS2A 2NO4A 3WGVA 3OPXA 4E88A 2YFYA 5AM5A 1RC8A 2IOHA 1Z4KA 1T5TA 4QJBA 2BDUA 4FE3A 2W43A 3FGOA 2FDRA 3ED5A 5ALIA 2RAVA 5AK4A 3WKBA 1Z4MA 5AI6A 2EARA 3IB6A 3N5KA 2OBBA 1LTQA 2QLTA 5ALUA 3S6JA 3L8EA 4CF4A 2HO4A 3U13A 3I6BA 5ALFA 1ZRMA 4I9GA 4Y2UA 3UMCA 1XPJA 2P9JA 4HGRA 3U7GA 2YMQA 4BNDA 5ALHA 4ZEVA 3MC1A 2YMLA 3B9BA 5AVVA 2B8JA 3AR5A 1RMTA 3QNMA 4EENA 3U7HB 3J7TA 5A3SA 1L7MA 1NNLA 3OCZA 3L8FA 3WK6A 1RLMA 3L1UA 1ZD3A 4UASA 2YBDA 4DCCA 5AVRA 2I34A 1VFPA 3FPSA 3ZW7A 3W5BA 1FEZA 5AESA 5AI0A 2OYCA 4EZEA 3WK7A 3U26A 5AVTA 5AI5A 2Q4RA 4FYPA 4UARA 1L8LA 3KZXA 2WF7A 3QUTA 3ET4A 3ZUPA 4KN8A 3M9LA 3UM9A 3AR3A 1N8NA 3DDHA 2YMMA 4RESA 4MUMA 4EX7A 3DV9A 4YGYA 1T9ZA 2FPXA 2HDOA 3I76A 3BWVA 4NABA 2IOFA 1Q91A 3ZTYA 2GHQA 1RQLA 2I6XA 1RMYA 4AP9A 5ALSA 4F72A 3L8GA 5ALRA 5AVUA 3A3YA 5AVYA 2R8ZA 2HHLA 3N8GA 4XE5A 1RDFA 1QQ7A 3NUQA 2FPSA 1YS9A 2RBKA 1S2OA 2X4DA 3L7YA 3U19A 3RFUA 3ET5A 2JAUA 5AW4A 3K1ZA 3WKCA 5ALNA 5ALPA 1ZD5A 5ALOA 3IRUA 4NFLA 3PCTA 2PR7A 4ZEXA 3OCXA 4BEWA 3QUBA 1XP5A 4BKMA 2G07A 3PGVA 4J2TA 3WGUA 5AW9A 2IA5A 4Y2SA 1N9KA 3A1DA 2R8YA 4GXTA 4AS3A 2HCFA 3EF0A 1WVIA 4HAIA 2BY4A 1U02A 1VJRA 2RB5A 3FM9A 5ALTA 1Z4LA 5ALMA 3QYPA 2G09A 4UMEA 2HF2A 5ALVA 5AM3A 4C4RA 3P96A 3QX7A 2PKEA 2R8XA 3FVVA 3D6JA 3L8HA 5AKKA 2IOFK 1Z4NA 4I9FA 1RKUA 1U7PA 5AI8A 4UU1A 1Z4JA 5AM0A 5ALYA 5ALEA 3SKYA 1RLOA 1QQ6A 2GHTA 1YMQA 4YIHA 2G08A 4YH1A 3AR8A 4PNHA 2B8EA 5ALQA 3WK5A 2WF8A 1S8OA 5AVQA 3HYCA 5AHXA 2I33A 1TA0A 3RF6A 4YCLA 1CR6A 3E84A 1Z88A 4UMDA 5AIAA 3OCWA 4HGNA 5AM4A 1CQZA 1EK1A 3ZX4A 2C8LA 5AICA 3L0BA 1U7OA 4OD0A 5ALDA 4DWOA 2FPRA 2Q5EA 5AKJA 3R4CA 3ZX5A 2MU1A 1F5SA 5ALJA 4IFTA 2ZBEA 1LVHA 1T5SA 5T41A 4HYTA 4CF5A 4XPZA 2G80A 5AVSA 1WZCA 4C4TA 1J97A 3AR7A 3ZVNA 1SU4A 3QLEA 3U7FB 3I28A 3AR6A 4UMVA 5AKIA 5ALGA 3QU4A 1K1EA 4L6AA 2EATA 3EPRA 2AMYA 5IT4A 4Y3UA 3QUQA 1U2SA 2C9MA 2WF9A 1YV9A 4H1WA 4L57A 2HI0A 3ZVMA 1RRCA 1TJ5A 5AK3A 3MPOA 2B82A 3NASA 3KOOA 1L7OA 4KYTA 1L6RA 2AUTA 4BX2A 1YNSA 4L6CA 2HOQA 3SLRA 4O8CA 2VKQA 2RARA 2G1AA 4DFDA 4IG4A 4XOUA 2ZXEA 4KNVA 5AKHA 2AGVA 3KDPA 3OCYA 3ZWKA 1SWWA 5AK5A 1O08A 2ODAA 4UW9A 1IWOA 3A1EA 3R9KA 1KYTA 1ZS9A 2JGAA 5AVXA 3KBBA 3M1YA 3W5AA 4MWOA 3UMBA 5ALLA 4BX0A 1Z4OA 4EEKA 2WF6A 3IJ5A 3SKXA 1YJ5A 2ZG6A 3NAMA 2DQSA 4CNQA 4YIKA 2R8EA 2EAUA 1Z4QA 2D2VA 3N1UA 4C4SA 4CF3A 5AKLA 4RETA 3WK4A 1Y8AA 2P69A 3E81A 3N28A 1SWVA 5ALXA 5AM1A 4UM5A 1MH9A 1JUDA 3L0YA 3QU7A 4KX5A 2WM8A 2YJ6A 3B9RA 2MSNA 2GFHA 1WR8A 3E58A 3QXGA 5AW0A 4QQFA 3ESRA 3EF1A 1VJ5A 1X42A 3CZ4A 1WPGA 4OCZA 1ZJJA 3ZWDA 1PW5A 3NALA 1Q92A 2FUCA 5AW3A 3ZVLA 3TLMA 2C88A 4NAVA 5FP0A 3SD7A 5AW5A 4BEVA 2OM6A 5AKEA 3ZTWA 2B1RA 3L5KA 1RQNA 5AKYA 4Y2XA
chains in the Genus database with same CATH superfamily
2C4HA 4B32A 2NO1A 4DVGA 3KAKA 3IAS6 3UAWA 3QYAA 2XNSA 1ZM4A 4A8JC 1V6AA 2IEGA 2XNKA 3RKUA 3LVBA 1WL8A 4DV1B 1X1EA 4L75A 2Q4TA 3G9UA 2QLLA 4BB9A 2WYUA 4BNMA 1PS9A 1SZJG 1S3SA 2EOAA 3UCEA 4AS2A 4ZJZA 5BWBA 2GZMA 3JCZA 2VG8A 5LMNB 3Q4GA 4L0DA 5CNKA 2Q1YA 5EG5A 1KVUA 2W2VA 4PHFA 1IQ0A 1KI4A 1GZ3A 3ENVA 3GZ4A 1V9SA 5AHKA 4BQNA 4AKGA 3VBEA 2BMWA 2V7QD 2H2IA 2WV9A 4TROA 1A9PA 5BNWA 4H3KB 3OEWA 5JU6A 2WKQA 1MQAA 1L4HA 1NN1A 2FUEA 2B0CA 1IQRA 1NPTO 2J5QA 5HRCA 3VPXA 3BWMA 3FMGA 2WKSA 5CVJA 2KLBA 4JC8A 2ENWA 2CLHB 5CFOA 2GBFA 1U4NA 2UZAA 3S2IA 1DEXA 1NVVQ 4BEJA 5K51A 1RYEA 1U0JA 1HF3A 2Q3DA 2WF5A 3A05A 4J9UE 3M2TA 3VR6A 4KNYA 2BCGY 4M9CA 4FXOA 2O3JA 4ZODA 3BEDA 1ZONA 4HN2A 2O2YA 5JAHA 1TVCA 2ODPA 2EG9A 1IHPA 1NVGA 2K2WA 1G7TA 1AKYA 4JELA 1WTCA 3N07A 4B3TB 4WW0A 3Q3EA 1VHJA 4IXTA 2CL0X 3DGEC 4B71A 5FLEX 1N5LA 3OIFA 1MABA 1MQ9A 1GRVA 1O8CA 2H4JA 2NVBA 1NXQA 2WE7A 4FYYA 3L0CA 4KSYA 5C4GB 3S27A 3RTBA 4W1SA 3R0IA 3ZV6A 5SICE 1TW3A 1JR6A 3DH0A 2ID8A 3WQQA 2HXYA 1DTSA 3R7DA 3HHEA 3UNXA 4I1UA 4AT1A 3E9EA 2WVGA 2YZ7A 1OAOC 1QZ3A 3B6JA 2FGJA 4TYNA 4OI0A 121PA 4B3DA 2DGDA 3D1JA 5DK6A 1O5TA 3L8MA 2P9TA 2DBQA 4P0TA 1C2YA 3GRZA 3BHIA 4AS1A 1S02A 4LXTA 2LCFA 2QJWA 1U1GA 2JFVA 4JN6B 3OHSX 2HN9A 2WYOA 2QW1A 3IQXA 1Y8QA 1NF2A 1Y8QB 1JAIA 1MB3A 1QYDA 3QK7A 3CKYA 3PHIA 1QE0A 3BBLA 1TVMA 1Z6XA 4MYCA 3U4CA 3G82C 3P0RA 4L73A 4U7WA 1FDOA 1E1NA 3OTQA 1MV8A 4B4VA 5I48A 4OTZA 3U7HB 4AZWA 2O5RA 2V3CC 2JI4A 3UIEA 3JS5A 3H5OA 1G6HA 2OBXA 1P17A 1TTQB 3SK0A 1BE1A 4K05A 3V1UA 4EMBA 1KJYA 2DXIA 2I2DA 3IIEA 2IPLA 3ZCUA 5F23A 3WAKA 2KQUA 2O20A 3BTOA 1XZ8A 2PKXA 3W5DA 2G9ZA 4LCEA 4BVKA 5SYAA 2OXIA 1ZJZA 3TRIA 2ZSJA 3AF0A 3CJQA 2XYRA 5GJCA 1KL7A 4Y6LA 2NADA 2Z4TA 1UINA 3ZHZA 5CTAA 5AKZA 4EX6A 1FUIA 1SGWA 1PR5A 3CX4A 3CZ9A 5EJFA 1BROA 1DKOA 3UB3A 5I5EA 1Q44A 3O21A 1I7PA 5JO0A 4PV7A 2NSDA 1BMFA 3IAM1 4L27A 5E7QA 5EMKA 1T6NA 2H92A 1H05A 3WB2A 2X77A 4Q16A 2IBSA 3K15A 1RWPA 4D26A 3CXUA 5A3RA 4ID9A 2HA6A 3E9ZA 4KVFA 4R9RA 3T15A 1QK5A 1YS1X 2FEPA 3BE6A 4GZ5A 2NUAA 1XMSA 4UDNA 2EIHA 4MUXA 2P2CA 2OQVA 4LS3A 4A27A 1GAQA 3JW8A 3COVA 2D62A 4K9MA 1NVAA 3RJ9A 3WQBA 3FN4A 3UK7A 1AH2A 2ZRNA 3CH5A 5JISA 1UMKA 3PQCA 4HJXA 3NHBA 4HO1X 4EG7A 2B69A 2NTYC 1TU0A 2JJ2A 4NP6A 2CYCA 1T0JB 4B2YA 4MKIA 4RTSA 2V8BA 3QLUC 3TR6A 1XWFA 3ZZNA 3DOJA 1FFGA 2PZLA 3H11A 3GJ3A 3SHOA 1ZI6A 4DPMA 1Z25A 4UAJA 3RSOA 1TJ4A 5ICGA 5IKMA 4FCVA 3SJ7A 4ESVA 5T3YA 2IH2A 1IPEA 3DC2A 1EX1A 2RMKA 2OO5A 3L01A 3U7RA 1DOAA 1J1UA 3ABQB 1KY2A 4RSGA 2DR3A 1NSFA 3R8XA 3BG5A 1JIQA 4AK9A 4ZU1X 3FIJA 4ZO9A 3SHWA 1H2RS 1JWAB 4KQFA 4UQPA 2CVQA 3R7AA 4YUZA 4EMTA 1QDLB 3LLSA 5DNUA 5I7RA 1P3JA 2P7IA 4NKRA 2F6RA 2H8GA 2YFYA 4KK4A 1YH3A 5HJ7A 2WFMA 1N5KA 2OGUA 3ENQA 5EIEA 3IESA 4ILEA 4ECAA 3FH0A 5C5CA 1ZH2A 3C1OA 2XT9A 3WMXA 4F97A 4ZHQF 2PSSA 1HDIA 2J0EA 3IT2A 4EUFA 4F6RA 5AK4A 3QIVA 3Q41A 2R5FA 3OIGA 4JBIA 2OZVA 4NU6A 2GF2A 4ZFNA 2DB3A 1NVUQ 3EZLA 1F51E 1UOOA 4KMOA 3HXQA 1HEYA 1YB5A 2WYVA 3MRVA 3OA2A 4TX1A 2D4HA 2CMKA 3EWAA 4WGGA 4XVRA 1ZUWA 3OPYA 3ANLA 2Q3FA 1VYVA 3ESBA 1G7SA 3LVQE 3C4VA 4NONA 4O1IA 3ZVKA 3RS0A 3H2JA 4WQMA 3G85A 2LCIA 2OAEA 2VO1A 1QHHB 1PNQA 4NOKA 4BNDA 5HZKA 3W6ZA 4RHEA 3KZOA 3GLTA 1UWVA 3OQHA 1Q21A 3UGQA 3AR5A 3T7SA 5DGXA 2DAPA 1W75A 5BMVF 5HOQA 2QGZA 4D5EA 4D97A 2ZJZA 3C5EA 5IK2D 2X8LA 3F97A 1IJBA 1FRQA 4YJGA 3RTAA 4CUZA 1BHJA 1V9LA 3A1VA 1WXGA 4POAA 4DRZA 4EECA 5JVDB 4WE3A 4F06A 4H7PA 3SXUA 4HVLA 1V7ZA 3OWXA 1UK8A 1DO8A 1D4OA 2CV0A 3RHSA 1ZD3A 1U4SA 2VOEA 2F3SA 3OUUA 4AN0A 1HURA 1UMDB 3DBIA 1T5OA 3DTTA 4IVPA 4CLHA 4BNHA 2IYXA 4OX9B 1B1CA 2VAXA 4HTAA 3VOSA 1P5JA 1YL7A 3KJXA 4BFYA 3BSSA 4YP9A 1SVMA 3V1KA 4OGWA 4QBGB 4DB4A 4R05A 5FBZA 1QPZA 1WM1A 3V5NA 3NTXA 1A88A 5K3AA 4FYPA 5BY2A 4WECA 4B6QA 4LZOA 2QM3A 3UGTA 2H2FA 2WF7A 3I83A 1HE3A 3NC1C 1RU3A 4LSWA 4RTNA 5EHNA 3NTUA 1E62A 4YMVA 1TIBA 3V7NA 1DRKA 2W9XA 3AUKA 3SSNA 1PNVA 1DRVA 3CS3A 3L02A 1BYIA 4JI6B 4IDFA 1JR3E 1GPBA 1LNQA 3DV9A 3KQWA 1KJNA 5CUQA 1YQ9A 1BC5A 1J2YA 5DM70 2VDOB 1IBSA 3P0FA 4MI1A 3TQHA 1VJCA 4B09A 1EK0A 2I6SA 1A9OA 1K86A 1PGNA 4JLDA 4F72A 4LQCA 3H8JA 2H11A 3T7DA 5MGNA 4YCCA 4E33A 1UP4A 4OL9A 4LZWA 2ANBA 4WXEA 4WY8A 2HHLA 2XVZA 3C1TA 4GXQA 3TUZC 3L07A 4OQPA 1DB3A 1N1GA 4TS4A 2YV2A 5KX5B 3LSTA 3R23A 3ZY3A 1XC7A 3FTQA 1S2OA 4FMCF 2ZB3A 5FBLB 3RASA 1V7QA 2ZREA 2OO3A 3A7DA 4WNIA 4O2BB 4QYTA 1CUFA 2DT8A 2JJYA 3USCS 4B6FA 3BD6A 4YPFA 1FU4A 3PHCA 3CUUA 4B8ZA 2CB9A 4LZPA 1WP9A 3E3NA 4OFBA 1KMQA 1TKRA 3E9QA 1P5RA 1SCDA 4BFCA 1RRGA 4WPGA 5DNDA 5JZ9A 5DLYA 3RRNA 3V4FA 4RQBA 5K3EA 1YAJA 3S7ZA 3VYRB 2FOLA 2IS6A 4JJ7A 1TTHA 4KOEC 3CV3A 2G07A 3GUVA 3V8RA 3SBDA 4D81A 3QXSA 3TRDA 2EERA 3AKCA 1U5BA 2QYSA 4LC9A 5HWSA 3WHKA 5JH7B 1Z0FA 2XNDD 2DBRA 3AKDA 3EF0A 1EUCB 2IYAA 4GLBA 1AURA 1TM5E 5C8YA 1SBYA 2OLEA 4RA9B 1KQOA 5CB8A 3CZQA 2DE0X 5B3LA 1K2VN 4HWGA 3RRYA 4BO4A 3H4VA 4MW7A 1DAOA 1PWXA 3IOCA 3OFJA 5EUQB 1V5GA 1P3Y1 5TDHA 2G09A 4FI3F 5C8VA 3LXRA 4CVNA 5LNK6 4LJ5A 3Q8XB 3CUVA 1O54A 4JBNA 5IVDA 3RUFA 2PKWA 3AINA 4H1VA 1TM2A 3VV3A 4OPMA 3T8YA 4CIWA 2BYTA 3JAWA 2CXQA 1E2EA 3N3AC 3PE4A 1LVUA 3NX4A 2C84A 3RFFA 2IIBA 4F38A 3K3PA 2IZOA 1EAYA 2XOKD 2AFHA 3Q9UA 1KMHA 3DV0B 2R1ZA 4HK4A 3AHDA 2DETA 3F6BX 4YH1A 1M83A 5CVEA 4CKWA 2AQHA 2V4UA 2W2MA 4I99A 1VMDA 5CLQA 2PJZA 5E1OA 3NGXA 2HRCA 3W3AD 4EI7A 3PUYA 3D0KA 4REOA 3IBFA 4XZ3A 5J2TF 1GNTA 1FXWF 4PYRA 4FKMA 4QDUA 4M9SA 4CM8A 2GM3A 2AXNA 2A30A 5K0JA 1NNEA 5ARDA 3CTPA 4HWRA 5JJKA 5EUBA 2W6MA 3KYBA 1TTTA 1W2WB 3IR7A 4PLGA 1QANA 2B78A 2WDPA 2EFYA 2H7CA 4FU0A 4WWHA 3VO2A 4FSXA 1U0EA 2E4AA 3Q1KA 1M54A 4JLOA 1G21E 3WLTA 5JAZA 3AVPA 1TXGA 3WRXA 3G0CA 5FWYB 1BE0A 1E1CA 5FOVA 2EQBA 3H5LA 4P80A 3WE7A 2CLDX 1DC8A 3F78A 1XTVA 2I4NA 3E22B 1ZI9A 3HSKA 1J09A 5LP6B 1E7WA 3CH4B 1PL0A 5T7BA 3TLEA 2FMTA 4PX2A 1DO2A 3QUQA 4PYOA 1XRNA 4XWKA 4L57A 1TRKA 2C5EA 1YUBA 4RTLA 1V8ZA 1LKZA 1X8XA 1BQ3A 2I5PO 4WA8A 5HMLA 1Y37A 1JHYA 4CYMA 1AX9A 4K6KA 4JMLA 2FR0A 3K5PA 3DVQX 1ORHA 2H1HA 4K9QA 3THSA 2AOUB 2EX4A 4EG4A 1CRWG 2P9YA 4YXFA 2QN1A 2BVNA 1ZVKA 1VHTA 5JCPA 1DBQA 3QM1A 4KWCA 2IV7A 3A2MA 3KDPA 1NYQA 4PPNA 1Z12A 2H2DA 4DE5A 2GESA 3LL7A 3THRA 4US2R 3SS8A 1II8A 1T5BA 4C08A 4HNQA 4L2IA 3HP4A 1XGKA 1QP8A 3ZGOA 2BGJA 2QTVA 3D4BA 4HQLA 1IBCA 2YN2A 2BM9A 2TSYB 4ZCLA 5TX7A 3FHOA 2YXLA 4YY3B 1OFHA 4RHUA 2C7RA 2ZE8A 4ZRNA 1G8JA 4ZU3A 2HV9A 1HV8A 1MENA 2GK7A 1E2GA 3PU6A 4YDSA 3C7TA 1AN9A 3PE6A 3M6LA 4G97A 1P0QA 3F3KA 5TQJA 3WB9A 3CZRA 2O8BA 4OB7A 1WDWB 4FFSA 4YMGA 3EN0A 2AVDA 3TJZA 4WT7A 1YJ5A 1QIEA 2W2KA 1RADA 3NAMA 1KK2A 1U0TA 4W1PA 4C7MA 4E46A 4E5PA 3FPKA 1E58A 3TTWA 4JC4A 4FNOA 1Q7CA 2VDMB 4NZMA 4M1ZA 1Y7TA 4YRNA 3W04A 2F8MA 2XKKA 3O1JC 3N1UA 2Z09A 3TTTA 3JZAA 1ZOPA 3A6DA 1SBIA 3E81A 4N7BA 4DM4A 4EYSA 1YQTA 1XL0A 4RANA 5JD6A 1FYVA 4YECA 1C4OA 4ZRMA 4BQOA 2XBLA 3HR7A 1UDRA 1PJAA 1H9AA 2FPLA 1CFJA 3UMJA 4JHLA 3QU7A 4KQWA 1OROA 2GK6A 1H9BA 4XKJA 1WUYA 5D51S 5GGYA 4D45A 5C5DA 4HH0A 2PFSA 3EBLA 3LUGA 1MX9A 4ER6A 4F56A 3DLPX 5JI2E 4B4DA 3H04A 3IIJA 4RA6B 3FPEA 4K9PA 1X42A 2D2IA 4MI6A 5IJZA 1A0OA 3D3JA 3CLHA 4L5YA 4CMIA 4ZKDA 5CEJA 3RUIA 2R1VA 4CM1A 1FUEA 2MIIA 2EZ4A 5IM4A 5IRCD 2OLKA 1CHNA 2WA1A 1KXZA 4IQ0A 3CH6A 2G7ZA 1OLXA 2W6ZA 5DYYA 2I7VA 2RC6A 3GQBA 4LZLA 4MWGA 2XF2A 1TEXA 3CJRA 2X58A 5DCYA 2CD7A 3IFSA 2J0SA 1JTFA 2DP4E 1WZ2A 5LMCA 1EK2A 3DE7X 4BUCA 5LDDC 1V16B 3TD9A 1D1QA 2Z83A 3JQBA 1TTPB 4Q12A 3WFJA 3T7TA 2F8TA 3TNFA 4G1CA 1T9BA 3ZE8A 2BUCA 1ZKDA 3DWIA 4PAWA 5I4KA 1L8QA 5KJ6A 2OXFA 1Q95A 4G0XA 3MHTA 2JRCA 3TOXA 3PDWA 1LJLA 4IZ6A 3GUUA 4O4HB 1OUMA 1LK0A 4YXWA 1MHPA 2VSNA 3B1KA 3KT3A 1FFEA 4GI2A 3OM1A 4LY9A 5IT5A 1XTTA 2CBZA 2XEDA 3GJ7A 3R77A 4LOKA 5H68A 3UWKA 4C6RA 4KQKA 4L5IA 4E5VA 4X63A 1KDOA 1E8NA 1Q3HA 3IMCA 4YACA 1PDWA 3FVRA 3PYLA 3KAQA 4XVQA 1MAUA 4MRSA 4QSHA 2C42A 3WGIA 5CK5A 1E2FA 4YONB 2X5JO 5FXMA 3TOVA 5JQGF 5KQLA 2HRZA 3BB3A 4MPPA 2JJ2D 2X5KO 3GT3A 2YINC 2VA8A 1XO1A 1UKEA 1UP6A 3GV0A 1YE5A 4M21A 4M1WA 2PVSA 4LXGA 3PG5A 1T0BA 5JJLA 4NMWA 5ALKA 3JR7A 4EGCB 2EL7A 3HDYA 1MOSA 3IMGA 2GHIA 2UDPA 3PQ4A 4S3MA 1T5LA 4IGFA 3THYB 5BR7A 3Q7SA 3TH5A 2IW1A 5EXXA 5C35A 1YBHA 2ECKA 2CHQA 3HACA 5D1HA 2JK0A 4M7PA 2O2EA 3TF5A 1T1IA 4OKIA 2CN1A 2XDQB 3D3EA 3KVVA 4ZZ1A 1QS0A 2VA9A 2MJLA 2QROA 4U9HS 4YGXB 4Z49A 5LZ8A 2A9VA 5AJHA 5HOEA 1BDBA 3GWZA 3KQPA 2KI5A 5AJYA 3HXOA 3TECE 3A1CA 3IUJA 4P4SA 4HP8A 4AJLA 4CLXA 1GSOA 4KDFA 4J0CA 1WCWA 4AL4A 1Y4UA 3CX6A 5IF3A 2A59A 2YZGA 3KETA 1EXNA 4UU0A 3GJ6A 4JLAA 1J5EB 4GEKA 3A6KA 4WFIA 3T6KA 3WDLA 1Y6QA 3MWLA 2IYYA 2DFKB 5JSFA 4RM3A 1TJ3A 2YWDA 3I8XA 3U60B 3W6OA 2OWDA 3E27A 2P9CA 1S2LA 2X40A 4ZAFA 1M0EA 2PGJA 4GOXA 3FZNA 4H18A 1H0KA 1KO4A 1XTPA 2FEXA 5DSTA 1BDMA 2E4UA 1K8ZB 4RK5A 3UN1A 1U9YA 3A4IA 2IDMA 5CW1A 4MVJP 5EEHA 3WLIA 1JHOA 1SHUX 4HXEB 5FQNA 4ABYA 4DDUA 1JE1A 1CYEA 1KFJB 5CT4A 2ECFA 1KKMA 3E7PA 4ZOCA 3D2AA 3UANA 1VJ1A 3B7PA 2G9RA 1NLFA 4DUYB 1FNDA 1JW9B 2OZKA 3KPVA 1AQYA 2F9MA 1IOLA 2H9AA 1QHIA 2O2CA 2FSHA 2W2QA 3E7DA 2OECA 3JY6A 3IUEA 4QPNA 3SJUA 3UWMA 4PGMA 4YX9A 3RC7A 1UDAA 5FTWA 3WS7A 2P9BA 3EX7C 2VTKA 3KYCB 5JV5A 2F7SA 1HQCA 2I80A 2XUDA 3GGSA 4DR3B 3FG9A 1R50A 3ICEA 1CQPA 1QRAA 4NG4A 4B33A 1M3SA 3FI9A 3KR2A 3F2IA 5HF5A 4NLLA 2NNWB 3I0NA 1XF9A 5K99A 2C2YA 3HZOA 1UFKA 2J9FB 2OO5C 3QKRB 4QPDA 3KSDO 4RJIA 4OK5A 3QVVA 1R37A 5SY9A 5F4BA 3DF7A 1R8QA 1PCXA 4B7ZA 1ZP6A 2WA2A 5DBIA 3I0MA 3RAEC 1YK1A 1RR6A 2SKEA 4NHOA 5IFLA 5LZ4A 4XPIB 1MG0A 2NXCA 3GG2A 2QLJA 1QXSA 4UTXA 1PGPA 2RHOA 4IDPA 1QGYA 1E2MA 2EKBA 3HDJA 2D8MA 4L9RA 2G63A 4YDHB 1N2OA 1M6NA 3AF1A 4N5DA 3LQ2A 3ASVA 4IDHA 4NBVA 1PL6A 2FW6A 1L5SA 3JSXA 1PEAA 2DMRA 1EEHA 3CVJA 3MLBA 5C8YB 1X7YA 3FUWA 4WY5A 4QM7A 2O5CA 3EXHB 3K20A 2H16A 2V45A 4G5HA 5IUNC 4JJFA 3SSAA 4DT1B 2JD1A 1WXDA 4KFRA 1OLOA 4R2KA 5DBEX 4CKCB 1NM5C 1AK2A 2HJRA 4BIMA 4IIGA 3ZGVA 3PX7A 3F0TA 1YS7A 2RGBA 4CQMB 1IN7A 2V3VA 2BI4A 3D4IA 3DDSA 4Y2GA 5BQFA 1W30A 2XWSA 1ZL2A 2RCYA 3EF3A 3ZU2A 2VBCA 4PHCA 2C9BA 1U9ZA 1ZU5A 2H18A 4FHZA 3THWB 5B4TA 1BGVA 1Q2UA 1M67A 2R87A 1VLJA 2W6IA 3UPDA 2REBA 1GTL1 2J4CA 2Z1DA 3OPXA 4HOYA 2X19A 4R8SA 3TS1A 1VFNA 4HAZA 1HE8B 2P5UA 1PT8A 5BYBA 3WLAA 3PE3A 4JYPA 3UO8B 3BXXA 4AJHA 4PNEA 1QHEA 1TAQA 1JJAA 2Y1CA 1E9AA 3DUFB 3IJRA 3QMVA 4JX8A 4R1PA 5C18A 2C3UA 5JTTA 3H2KA 4RM2A 3QKSB 2O5EA 4ETIA 3NG1A 4PS1A 2BFPA 3DCNA 5GZ1A 2Q27A 2G4LA 2TMKA 5IPFA 1KRWA 2PXHA 1X94A 1OREA 4MAFA 4QT0A 5BSRA 4Y1RB 1KK0A 2D3WA 1DAFA 2XCLA 1NVDA 2B7BA 5DNAA 4MV7A 4YDQA 3HRKA 5JSQA 1KJWA 1XALA 2DUUA 2QL9A 4NEQA 4UZSA 4XDZA 2P9JA 3MB8A 3C3MA 2J3JA 3W2FA 4M76B 4QD3A 4RXMA 2VPQA 4JOCA 2OCGA 5AR1A 2ZYRA 3LF2A 3STTA 1P5HA 4DDTA 4A8JB 4EENA 3EPJA 5B3KA 9MHTA 5K7SA 1W2HA 4E4YA 4B3MB 1ESDA 2EX0A 3NHRA 4RMHA 1N25A 4U7GA 3ZHUA 3SQLA 3OESA 5FWXB 1DXHA 1HE4A 4R2JA 4ND5A 2XTMA 2R9VA 1ZD8A 1GNVA 1V5EA 1S2GA 3IO5A 3BMNB 2AHOA 2B3TA 3U3OA 1FSPA 4PX3A 4XSVA 4ZCRA 2TMDA 2HGSA 1EGQA 1P4JA 2J5KA 3JZFA 1F0PA 5AJXA 5FNZA 1A4XA 3L92A 1RWMA 2H52A 3FNEA 5DTMA 2WFZA 3OZFA 2BSQA 1NBOA 5H81A 2JKYA 4D9HA 4ARVA 1XU9A 3OSZA 1A9RA 3RYHA 2AYYA 1MGPA 5AVTA 4G0MA 2WWXA 5LQUA 2H1WA 3OF2A 1OIXA 1SK8A 1Y7IA 3K96A 3KZXA 3PENA 4H7IA 1UBSB 5A1TA 5CVUA 1DINA 3TQTA 5DGCA 4UEKA 1DC6A 5DMXA 4EKNB 3DT6A 3EQ7A 4ZAYA 4EA6A 3PNPA 3SC4A 3SX2A 4X7PA 4GWKA 5AXBA 3D3KA 3ELUA 2IYWA 3F8TA 2XUOA 3E5NA 2WZDA 3PPWA 1WW2A 1E5QA 1Q1EA 4PGHA 5JMTA 1JQLB 4I3FA 3FYUB 1QG2A 5CJPA 3TOCA 5DM0A 2QZ4A 5A9SA 4AM8A 1NXOA 2WV7A 2ZAGA 3AF4A 4GQAA 4U0KA 1YCHA 3FFAA 1K66A 3PFFA 2PZKA 3L6OO 1WNFA 3O3NB 3GP8A 1AHNA 2XMDA 1A27A 4J16C 5AVUA 3NRCA 4LDAA 5DEIA 3WGKA 1OIWA 4G0WA 1JLHA 3X1DA 3UMRA 2X0NA 1ULAA 4FGZA 3C48A 3RG2A 5D7BA 4QJIA 5PGMA 3DFKA 2AHRA 3X43A 4F11A 1RVV1 2H2HA 221PA 4LCJA 2VDWA 3M82A 1DFHA 5A7HA 4CTMA 1GQRA 1W1IA 4Z4CA 4N5IX 2GJ4A 1ZSVA 4RVOA 5NLLA 1WD5A 2W0MA 4PICA 3JQAB 3K1ZA 4X94A 2C99A 4OU5A 3CVVA 1E3SA 5K03A 4L07A 5ALPA 1QPGA 4HH3C 2VQ6A 4UAGA 2F3PA 1X8KA 4GXRA 1PV4A 1C41A 2PV7A 4OQXA 3ONVA 1L7XA 2HMTA 3K7EA 1GKUB 5FUWA 5GIOE 1UXIA 4YRSA 4MB2A 5G3ZA 4JBGA 5FL3A 1IHYA 1T3ZA 1T5HX 1E3IA 2CHGA 3P19A 2GBGA 4IDGA 3W4KA 1WVIA 2BGUA 3HA5A 4QBKA 2HEIA 1YQXA 4DPLA 5J4YA 1U9CA 2PD3A 5ER6A 2YNMC 5CT8A 2BH2A 3E3MA 1UL1X 3HYRA 4JHXA 2OESA 2BF7A 3ZQUA 3IULA 2RB5A 2FX2A 5TEWA 4XFKA 4ZYYA 2QU8A 6PFKA 2XR1A 1C1XA 1WUTA 3PFHA 1IK4A 4PAOA 1ZLXA 3MT0A 4WZAE 4PTZA 1K5PA 2M1ZA 2PX6A 4KO8A 4NMMA 4M1MA 1EDBA 1JEYB 2P4EA 3PL5A 4ZTUB 2ID9A 2BR4A 1BXGB 1I33A 4B0PA 3GJ8A 4CM5A 1IVYA 1ABEA 3DAYA 1OU0A 3C5VA 3QHAA 4W63A 2PNJA 1WZIA 3SKYA 4DIMA 10MHA 1QQ6A 1IAQA 3IVGA 4IFEA 1PLLA 3VNBA 4ENPA 3CRVA 3NOQA 3LGXA 4YP7A 1QFZA 1F4LA 2AWNA 5JNUA 2JFWA 3H9JA 1GAEO 1UC4B 1B7GO 2A9FA 3P2KA 4OHPA 5F5LA 5FAKA 2ZVDA 1QVWA 1ST2A 1VLQA 2ZVQX 3HXLA 3OFVA 5L51A 1ORWA 1QYVA 2Q4EA 4X6LA 4BATA 4CR7A 4KN6A 1M2NA 1DKRA 2ET6A 2ILVA 2R8PA 1W8DA 4MR9B 1KVTA 1RM0A 2DU8A 3TRJA 1GRCA 2NU8B 1RP7A 4DWOA 1JI3A 4CM9A 3DEAA 3R6DA 1F0YA 3BFKA 1NUPA 2I6UA 3EY9A 2AOXA 3L49A 3OZGA 4EYOA 4Q9LA 1JXQA 3QFTA 3G2MA 3VAAA 3OZTA 3AR7A 1VJGA 2RONA 1ZGJA 1SU4A 3UMFA 2LE0A 4XEHA 1L8XA 1Z3CA 1VSQA 4Z4EA 3COZA 1M1YE 4CLDA 5LDHA 3D3NA 1THGA 4WAUA 3JXEA 1J2UA 1BVUA 3T0FA 3A4TA 1RBZA 2FHSA 2NPFA 2DEUA 2QNIA 5CYPA 3ROTA 5L6LB 1OPXA 1WHSB 3BA1A 4V0KA 1EE9A 3GJSA 1HE2A 1LTKA 2I66A 4FR2A 4CLEA 3RC8A 4D3XA 2QVCA 3FROA 3JWEA 4JLNA 5CH8A 4PZUA 5CH3A 4L0MA 3TJMA 1TCUA 2AUTA 4BX2A 3E7FA 1YZFA 2QSZA 4ZVLA 1JIIA 3HMKA 2DLNA 2G1AA 3JQQA 4IJ6A 1CNEA 4L72A 2IZ6A 4JP1A 4ZQFA 1QF7A 3OZUA 4OHCA 4OGGA 2Y1EA 3CR3C 3LUFA 2VXBA 4XSGA 4BMZA 5H3CA 3OTOB 3QE9Y 4GMGA 2JLZA 2BFEA 2FSFA 3G0IA 3IELA 4MPDA 4AKEA 2NMVA 5AVYA 1BMTA 3VU9A 1P7VA 3IEIA 4URZR 3UH1A 5FOQA 1SVOA 5K3CA 1YI1A 1NJ2A 2PJRA 1HY3A 2XMZA 1ZC4A 4CLRB 5JASA 1ZH4A 2WU1A 2IBMA 2DFPA 2BHLA 2PN1A 4RFSB 5BOVA 3AO0B 1DVRA 1LTHR 3GFQA 1EFKA 4ND2A 5GV8A 1A76A 3SE0A 3WGHA 3M1YA 1CJBA 1Z68A 2IFTA 2RGYA 2OUKA 4BP9A 5KZMB 1T2AA 5JD5A 2GETA 4LEIA 5AUOB 4KBFA 2E6KA 4KXYA 1YWGO 4XR9A 1Z4OA 2A1UA 4RU1A 4Z0NA 4ENVA 2XCQA 1JIKA 5B5SA 4BFLA 3F98A 4RTPA 3EQ2A 5K8IA 5HJEA 3MQFA 4NU8X 3NFYA 1YZQA 4OBXA 1V3UA 2OMKA 3DM9B 1KC3A 4BO8A 1NYLA 4PNZA 3U5TA 1GL9B 1W4LA 2LDBA 3T06B 1H4TA 4DZTA 2UXBB 1A96A 1S2DA 4RXUA 5TPZA 3HK2A 4RSMA 3DYVA 2P6NA 2P2GA 3LMKA 1K92A 2GDJA 3SOPA 2WJIA 2WWGA 4PSDA 5D3MA 3WNDA 1N2CA 3MTBA 4YRJA 5CCXA 1OB5A 4L9WA 2APJA 1YCGA 5EQFA 3SZGA 2OP1A 4AIRA 4E5MA 3PNBA 3L79A 3CISA 3OZVA 5J23A 3X1XA 1OGJA 4DV2B 4YRRA 3EF1A 4Y0NA 1J99A 2H4XA 2OZLA 2Z6AA 1QFSA 2A0WA 2ZTVA 1X7ZB 1JLKA 1MO2A 5L4NA 2OVFA 2A5FA 2PS0A 3VNRA 1KK3A 4FW8A 5K4HA 2BUAA 1QIMA 3DO8A 4YAEA 3TLMA 3VISA 2DUMA 2O0JA 2WJHA 4KQXA 3TZBA 1E1KA 3DE5X 3RKSA 1VCNA 2FQWA 5AW5A 1AXGA 1JNXX 4WNAB 3ZVRA 3IAFA 1VE3A 4ZQGA 4D0NA 3FAKA 3TQRA 2B1RA 2NZJA 4XGQA 4ZOEA 1OX4A 1XD8A 5T4HA 3EBPA 1ZPDA 3VSDA 2B21A 4BKRA 4RK0A 1Y8ZA 1V48A 3IP9A 3LWZA 2EFEB 3MMSA 1FZQA 2JFBA 4Q3LA 3SC2B 4KWEA 5EMNA 4WK0B 1TLLA 5BSUA 3U1TA 3DKIA 1RPAA 3DKRA 3AVOA 3V6MA 4A0RA 3VSAA 4E7PA 3O74A 4PZ0A 3PXAA 2Y4NA 2I3DA 4HNGA 4BLUA 3SJBA 2FMKA 4WV3A 3V4LA 3SHQA 1QGAA 4BNUA 3SOZA 3TW6A 3VR6H 4CT4B 1EVYA 2JA1A 2IHNA 1LI7A 3PDCA 1GPNA 4QTZA 1ZK2A 4OQQA 4G9BA 4ECEA 1LPBB 2RH8A 4L3OA 3QOFA 1NAHA 1JEAA 1CJSA 13PKA 4JUIA 2XMPA 3OEEA 4H60A 1AXRA 3A6GA 5CNJA 3T3EA 1N5RA 2DULA 4Y67A 3NDBB 4DW8A 3ZIUA 4BKQA 3M89A 1ML3A 1BW9B 1P1FA 3PEFA 2ZR7A 4XQEA 1DUVG 1QHHA 3KB8A 5AHRA 5ADWA 2K87A 4MKFA 1BD3A 4E1AA 4P98A 4UPDA 1VP9A 4TOIA 4L15A 4BNZA 2AX4A 1HMYA 4H1UA 3RSGA 2BW0A 3GGPA 1H5QA 1TM4E 2JIBA 2WIJA 1MJ5A 3DEHA 4TQAA 1B2LA 3OT5A 3L0SA 1ZC3A 5DU2A 4TZ6A 2FSGA 3Q9SA 2CXTA 4G5GA 2AJ8A 2YN4A 5FPSA 2O7NA 3VTZA 1FJGB 1KQFA 2RG7A 2EJBA 4BMXA 1H6BA 2D06A 3TXXA 4Z1MA 3OBIA 4ZHQA 3D31A 3S8EA 2IUSA 5DYIA 5K6TA 5CLGA 3QKRA 1MDBA 4YRLA 4C88A 4B0OA 3FWNA 3NQ41 3TIIA 1WCIB 5CAEB 1KE1A 4N7MA 3FGZA 1RACA 4IAOA 2JKVA 2FPPA 3CPHA 5GVRA 2GF0A 4GPD1 4A2CA 4HDNB 1I3MA 1EJ6A 2RG1A 3U09A 1HM5A 4RZSA 5IAEA 4AD8A 3NAGA 1PX2A 4FIZA 4TYQA 4MIKA 4E03A 1A69A 4F2GA 1ZIPA 4QO7A 2JLRA 2TYSB 1WMEA 3PQEA 4KWTA 4ZI3A 2ZYDA 5HMMA 3UPTA 1KEVA 1RQRA 4C7JA 3PTAA 1JIXA 1G63A 2IIPA 3L4EA 1H1LB 2PA3A 2PMBA 3O4VA 1PQYA 3AVYA 3HI6A 5H9WA 5BYAA 3GUHA 3PNSA 1NZJA 4GLJA 4EYKA 4KHPB 2PRYA 1K5GA 4Q48A 3TX6A 4X7BA 3MJSA 4IM7A 1QG0A 3HU1A 2A5GA 4P2BA 3PWZA 1K8YB 4R0NA 4TKUB 1W5TA 2GZDA 2RGNA 4FN4A 2OORC 4OU4A 3DOCA 3HNRA 3QVGB 2YV5A 3EASA 2X8WA 4WKOA 5THQA 1NQTA 2OQRA 2Q3LA 2QF7A 4X1IA 1QZTA 3R7BA 1FRVA 4RBNA 3EGDA 3TSOA 5GWXA 1X80A 1YI8A 1WE2A 5CX1A 2B1JA 1I2CA 2W4MA 2QAIA 2MOKA 3F9RA 3JQ7B 4RZ3A 1MC1A 3JQ7A 3DMPA 4LYGA 2A9KA 1LS1A 2H4WA 1XE3A 2OV6A 2Y0PA 3TNYA 3BA6A 1RKQA 2FP3A 1BIFA 2VWHA 3IRVA 4KKXB 1N0WA 4EG5A 3KT8A 4FEGA 1OLSA 2QN7A 4M2LA 4P53A 3K70D 1MQ8B 1H2WA 1S1MA 2PO7A 4ZVVA 3RYFA 4AWXA 4LBWA 2FWMX 1G21B 2OHGA 1W36C 3E70C 5ICSA 1DEHA 3D4NA 3TXYA 1KJZA 2C4UA 3FKSA 2QZSA 1Z7YA 1KOLA 1Z2PX 4J4TA 2I29A 1GV1A 3A1TA 3QUSA 3O83A 1U0RA 4TMKA 3WKDA 1KIFA 2PZJA 1DIRA 1YBMA 3FWHA 3F5QA 4IUDS 2VAWA 5FPQA 3RS4A 4ZK2A 4GOJA 4ZCMA 2DHDA 4F3TA 4V0NA 4WZBA 4QO8A 4RA9A 4O33A 4ZYLA 1LPAB 1XV5A 2PGAA 2PH3A 5LA6F 4QGSA 3V1TC 2XITA 5EEGA 3WV5A 3IE2A 5C46F 3GLFA 2PO5A 3CVYA 1NMZA 3MS7A 4B6GA 2POCA 4Z7NB 3WJ7A 2Q45A 3NT5A 4KSCA 4JP5A 1DMRA 1SELA 1QWOA 4AYWA 2V7QA 4QKQA 1A5SB 3MOGA 2AN1A 3EJWA 2QK4A 2DWQA 3LKZA 3SIXA 4ETNA 4N49A 3UBTA 3O90A 5C7IO 1XJCA 5KNDA 3IKTA 2JFOA 5BUZA 1KMIY 1B6TA 5HE9A 3LTNC 1RHUA 3MJDA 1N4AA 4KR9A 2UU9B 2QD1A 3LS2A 1NAIA 2YV3A 3O8QA 4G4GA 1BKYA 2XXJA 4RKWA 3AG6A 3U2QA 1WVGA 3EGXA 2OMEA 4FHCA 1M8KA 1TE2A 3K32A 4M0MA 4MRPA 3R09A 4NPAA 1U7HA 3Q5DA 4CQMD 2JD2A 1GWNA 4GG1A 1M0WA 3ADPA 3ZJ5A 1GGKA 3ZXIA 4BFTA 1QAOA 5IDXA 3LLUA 4N5NA 1L7NA 1QYIA 4MH0R 1O6FA 2QAGC 1T4CA 2LTAA 3PUHA 1CK4A 4CU5A 4BZQA 3D4PA 2R86A 2ZI7A 4MQFB 5L3SB 2QTBA 2MMGA 2Q1SA 1ZK0A 2W58A 1SOMA 4BIIA 2DPMA 5EZYA 1TUEA 5TS3A 2ZI6A 3UJNA 3FX2A 3O9ZA 4EKYA 1G6Q1 1E0JA 3A9WA 3C14C 1D7AA 4DV5B 1WS6A 3I53A 1UPFA 3QVTA 2AMLA 5AM5A 2IOHA 5DFAA 2VDKB 5E2IA 5H83A 1JBKA 3OJCA 2XDQA 2I8AA 3F7MA 3AVQA 3UAXA 4LHVA 1WMSA 3ZS9A 1DG3A 3OLQA 2JAPA 1E7MA 2QMHA 2BOVA 5AI6A 1ZD1A 3BULA 1BO6A 2XA9A 1ZNZA 1TYAE 4JEIA 1TYCA 3FNRA 1OE0A 4KQ6A 2WU4A 1BGXT 2CXRA 3AB8A 4DJAA 3K0CC 5IARA 4N0PA 5DWQA 1U7ZA 1MVNA 4OVKA 2DLCX 1YQQA 1YJCA 3MWJA 4Y2UA 1GQFA 3URKA 1XPJA 4KQHA 4XM1A 1E2IA 5GAJA 2I6GA 3VUFA 1BWQA 2FR8A 4FNMA 1VA4A 1RHKA 2ST1A 5BR1A 1FC0A 2GRJA 2C4TA 2CV2A 3NM5A 3KJZA 5EMLA 3RNLA 1HDGO 1LZLA 2N47A 3AYZB 2HSDA 3LLMA 4FQ7A 4AUMA 5AVVA 2HUPA 4UBLA 1FYXA 5A3SA 1FFXB 4QFCA 1LPPA 4A03A 4F86A 3SN6A 4ZYWA 1H65A 2HNKA 2WDZA 3QLVC 4E5NA 3MCZA 3MWKA 4UREA 2JGDA 3IV6A 5A4AA 3LT4A 2ZW9A 1PR3A 3I05A 4MQEB 1P2DA 1T4DA 2WUGA 1KARA 1YDEA 4YI3A 3FPSA 4WLOA 3SR4A 3W5BA 1E6KA 1N77A 5FULA 3HHPA 3G6WA 4DT1A 1I1NA 4GECA 2QAGA 4NV1A 2A86A 1XZDA 3LU1A 4FCTA 1TUIA 3CLUD 3KNZA 4G4IA 4HX9A 1XCPA 3V4SA 4S2UA 1ZQ9A 3RQIA 2GM5A 4ENTA 1H42A 5G2OA 3OIYA 1LU9A 4PM4A 5GTDA 3DBLB 1XLTA 3M1IA 1VCOA 2IXAA 2Y1GA 3ZWVA 5KYXA 2FJUA 3HN7A 1EQAA 2HK9A 5DSXA 1I1QB 4CM9D 2JAXA 2ZB8A 3E8SA 2A4MA 3KKPA 1JT2A 2L18A 3ZDFA 3NRBA 4IEFB 3R8FA 1IZZA 2AOTA 4KQEA 3WL6A 3TW4A 1TAUA 4J7AA 2EBUA 5IULC 4LHWA 4D41A 4H7JA 3TUJC 1G8YA 2CLEB 3OZRA 3UKJA 5ICMA 4PE5B 3OPMA 3PHGA 1G59A 2JIRA 1Z82A 2IOFA 2EDAA 2VIIA 1Z06A 5J1SB 4O2AF 1ZUNA 3H1AA 1WABA 4Q01A 3KHUA 3R7LA 4CG1A 4ZVRA 3DO5A 4WBNF 2FLKA 4RLFA 4X9XA 4W1RA 3ZI7A 2IKQA 2NYUA 3OKFA 4KIGA 1P4AA 4NTZA 4BNGA 4ERXA 1GKIA 4Y6GB 3N2ZB 4YMLA 4FLFA 5KSYA 4Q3KA 3NXKA 4HVTA 4FFRA 4XA8A 3B6ZA 1EVJA 4YP0A 3EZGA 2E18A 5TNXA 1XZBA 5M29A 3F7TA 2C9ZA 3MIZA 2Z6UA 3RJ5A 1JEDA 3G8BA 3TZCA 3FMIA 3IRUA 1GPMA 4JKYA 3QLVA 4EO7A 4OA5A 1XRSB 3TQIA 4Q66C 3O4FA 1WHTB 2WJ6A 1P31A 5BWMA 1K7CA 5I7VA 2F9FA 1DBVO 2BLLA 4QUBA 4B45A 1QG4A 1G8AA 3WGUA 4P7KA 2CKDA 2XKJE 1DFGA 2JLVA 3CF4G 3Q3JB 2QLFA 1DBSA 3ADKA 4WKPA 2JGEA 4ALJA 4DBLC 1E2HA 3OMLA 2FKNA 3L6UA 1YTUA 1C4WA 3LM8A 5E8RA 2V5VA 4IUCS 2BM0A 9LDBA 1SPBS 4B7XA 2MYUA 4DLAA 4RK1A 5DIZA 3UUEA 4HFMA 5A0FA 3R7WB 3BE5A 3LSYA 2FSIA 2RHLA 3K92A 1COWD 3U17A 4EBFA 5CB4B 2HF2A 3GARA 1YU9A 4HRXA 5IZ4A 2EGHA 3G79A 4OA8A 1OA1A 2WM2A 4RVGA 2Q5HA 1NR1A 5DTJA 3PF9A 5LKAA 5M7EA 4WNAA 1NMXA 5K20A 4G1BA 5KSWB 3JRWA 2Z0MA 2W6JD 2Q6LA 1NATA 1XCGB 1C9YA 3KQUA 3F6CA 3KB2A 3GEIA 5AM0A 4Z1OA 2I71A 3KYDB 4ENRA 3DV0A 4JEMA 4LDNA 1RM4A 4WGFA 3FRHA 4M36A 2V7EA 1BWPA 2KHZA 3IPYA 3IP6A 3PC8A 4FZRA 4ESOA 5KB3A 5J2UF 4LK3A 4TN5A 5ALQA 3HSYA 3RVSA 3RIXA 3NKLA 1GUFA 3ASUA 2HJVA 4B3FX 2AUMA 3CZAA 1GGVA 4YJ3A 5K0SA 2WNIA 4I5GA 5FHQA 2VTBA 3NXSA 3R5JA 2E5WA 5AIAA 3N59A 4G0QA 4A1FA 5EP4A 1PG2A 5THXA 1YS2X 5EHIA 4N5MA 1HKHA 3NBZC 4K40A 3P9RA 4XUGB 4LPSA 3ZC3A 3M3PA 3ZIAA 3ZXUB 3L6RA 1XWIA 3T5BA 1OXSC 1YL6A 1V3TA 2BI8A 3ETEA 3MMXA 4G1EB 4L1KA 4BNIA 1TQ4A 3EXHC 1OU4A 1Q0ZA 2RK3A 1T0UA 1ZNXA 2WJPA 3E18A 4G41A 2G80A 2WSYB 1JQDA 2I8LA 2UVQA 4IXWA 3INGA 4N82A 3WY9A 4ZMRA 1XCBA 5JSYA 5ES4B 1UM9B 1MB0A 4G01B 3G9QA 3QYFA 4N9QA 5FWAA 4HKTA 4NZYA 5ECWA 5J4LA 2K7FA 3GJ5A 5D2CA 1RPNA 2E82A 1ONOA 3SM3A 3W5UA 4W7HA 3S29A 2QYOA 3HSSA 2B36A 1ULUA 4H16A 4LG1A 2IS4A 2WF9A 3I2GA 3ORHA 3OUTA 4IGAA 4YRCA 3P2OA 3ZDAA 1XK7A 4X54A 1GRQA 4DXAA 2C2ZA 5EC8A 4KO1S 4IR7A 4D6YA 1KEEB 1XZEA 2CT8A 5DCUA 4CKZA 3HZRA 2VKTA 2ZKIA 1N0HA 4X66B 1U28A 2QRUA 4FX5A 2L2QA 2J8ZA 3OQBA 3R3HA 4QPPA 3AUXA 2OPHA 4WD3A 4C7BA 4EGFA 4M88A 1XQWA 1K6EA 1ORVA 2RJ3A 3ZXYA 4Y6QA 1VPWA 3AJEA 4P7JA 3PQ8A 2P62A 3UJ8A 4AG3A 1M2OA 3FSGA 1AMOA 1Y9ZA 3EH1A 3WIEA 1E3MA 4TLMB 4NR0A 5EXSA 1PT6A 4ZVMA 2D7JA 2VBIA 4J0QA 1OKKA 3NWPA 3KOWA 3QI2A 3WIUA 1LX6A 3T9AA 1VCMA 4EYGA 4W5QA 1E9RA 1Y3IA 2WLTA 3IHLA 3WFIA 1BQEA 1DRJA 3HR4A 4OI1A 5A9SB 1ZGGA 2FRVA 3U7IA 1ZICA 2AWOA 1WNTA 4MGKR 1JQEA 1TFUA 2BGNA 2GTIA 4I1RA 3INNA 1FVOA 4O4LF 3ZHXA 1I6MA 4RELA 5BSGA 3TSWA 3KWMA 4G09A 4MQMA 3C3BA 4YQFA 2AD1A 2I2BA 3RADC 1QQAA 1U0NA 4XAQA 1CY8A 3PKIA 4M37A 2QPTA 1K06A 3OOHA 5CGZA 1GN9A 1IYZA 3SC6A 4Q9KA 2PKQO 5LQKA 3EIFA 3BKWA 3HCCA 4Y0AA 3I9JA 1KS9A 4I1SA 4INJA 4KPUA 3UYKA 3WYEA 3ZGYA 1TM7E 3O95A 4CNQA 5KWJA 3Q6IA 4JUAA 1VRVA 4BBZA 1EWQA 3RK1A 4C3VA 1PR1A 5HKAA 2OPBA 4MVJA 2D2VA 1IUPA 5F2EA 4BLPA 4P9NA 2AEFA 4MQUA 4YFVA 3RS3A 3T99A 3UQYS 3WK4A 2C29D 4A2QA 4DYHA 4YJGB 2NU7A 4YMTA 2CMHA 1CUAA 4JC0A 2X9NA 3HV0A 3KCNA 4YRFA 3QXJA 1S8AA 5FPYA 2IYOA 5J2UB 2OAGA 1HOXA 1PDOA 4N8DA 2HR1A 3AV0B 5GZ6A 2OM2A 2Y6VA 4AP6A 5K8LA 1RLUA 4IX1A 3UC5A 4D82A 2NN3C 4JLVA 2HBYA 3ORFA 3S2ZA 1A8HA 5JBNA 2XQGA 1KPIA 1VRCA 2YIDA 3KJFA 1WV1A 1E0DA 1JFSA 4M46A 3FNQA 2ERXA 4CM6A 4U2CA 3TZLA 1V45E 5B2FA 4D8TA 1NUTA 1XMOB 1W94A 1UC9A 3D8TA 4ZMBA 1AS3A 1RT9A 4R5MA 4F9GA 2KB0A 3E9YA 3Q2KA 3IPRA 4FMDB 1CUCA 1RXSA 3ASZA 2JIMA 2PGOA 4TXNA 5HM8A 3BJZA 1YJXA 4W6ZA 5LP6C 2BHTA 1Q12A 5JEEA 4NZPA 1PYGA 1TK3A 4QOJA 4FW9A 5BUSA 2VHZA 1BJRE 2L19A 1TC1A 3AMVA 2NAFA 3Q85A 2D1SA 5FH9A 1NVEA 4D0RA 1DKUA 1S89A 1I4DD 2M2IA 4HNTA 5J2UA 2QV0A 1IM8A 4YJ2F 4X44A 1THTA 1PUJA 2CFSA 2WINI 1CPYA 3HP1A 3L7DA 2AG0A 3NATA 1SOVA 3VR0A 2FMXA 3VX3A 5TT1A 1L5GB 5YASA 5JFOA 5MFZA 2E48A 3CB2A 4I8DA 4QBTA 1T1EA 4U4AA 3T7RA 2Q7DA 1YL5A 3PNQA 1F06A 1BKSB 3CCFA 4AJIA 4KV7A 1YNOA 3UG6A 3ZBTA 2P41A 4G5QA 4GRDA 4MW4A 2BMVA 2I7CA 4B76A 1DEAA 2B9VA 1GILA 1U6IA 4XWYA 1E2LA 1UBTS 3ZIAD 4NL4H 4N47A 3P71T 1E5XA 2Q29A 3EXFA 4II2A 4YQYA 3L7NA 1HORA 2GZ2A 3FPLA 3WK8A 2C2WA 3BCRA 1M66A 3NAQA 3RB8A 1NDHA 1P1BA 2UZ3A 3P9QA 1W88A 3VBCA 4LY3A 3QGMA 3HCFA 2CNBA 2BHSA 1XP8A 2B99A 2YUIA 2HH9A 1PS0A 2AEMA 2QTTA 2ZSEA 4V03A 1M6VA 1DCFA 1M76A 4HTFA 4CMBA 1WBDA 1Z0JA 3FOCA 5AW1A 2IDJA 3KUXA 3OU6A 1PJSA 4EQ6A 1Q0HA 3S5UA 4UU8A 2Q3CA 1TVKA 2GO7A 4AY4A 4UM7A 5TGTA 1QCYA 5JNLA 1FSSA 2GPBA 3M70A 1HTBA 2VPPA 3P9IA 4LJ7A 4WLVA 5KJCA 2ABWA 2QMQA 1X0XA 2CFCA 2R6R1 1XD9A 1Y9JA 2JLQA 4U7TB 4GDFA 4RYLA 4ZALA 2PLFA 1Y3CE 4BECA 1CS4C 3W9BA 1AQ6A 2VNAA 3M6UA 3O94A 1R8YA 2C94A 2HLDD 2NXJA 2BKEA 2G8LA 1A5ZA 1AZSC 5C7LO 1E3TA 5BV1A 1ADBA 3VO8A 2VATA 3RT1A 3MAGA 4QOEA 4JLBA 3EYWA 3L77A 3WRXC 4PZLA 2PUJA 3A70A 3EVEA 3GRVA 3MCAA 2BGGA 3VU0A 5GGXA 4Z53A 4E51A 3H9QA 1RXWA 2CVOA 4RTQA 5IM5A 2C2BA 2J07A 4O8ZA 1JXMA 1CF2O 3K1YA 1SXQA 4KX3A 2H1CA 4AURA 4REMA 4RVUA 4K26A 4WIAA 4KMRA 5BSWA 4N39A 2QG4A 2CVFA 4NOLA 3IIMA 3K0SA 4BZXA 4NMHA 1ZCJA 1ZOLA 1QV6A 3PFIA 3VVLA 2XTAA 3FYTA 3I61A 1H69A 1W9HA 3R3XA 3MJVA 2PSJA 4D79A 3S7TA 1UBGA 3HNPA 1YS6A 2VNHA 4NFHA 4TRRA 1PI3A 2G6TA 3DFFA 4FQ8A 3EIEA 4IH1A 3F74A 4ARCA 2XUJA 4UTRA 1SG6A 3OEHA 4QOFA 1KE2A 4AC9A 1IXSB 1ZGAA 4I2NA 4Q9NA 4RAOA 4BNNA 5AVWA 2B98A 4O29A 4MHSA 2D2FA 4EEZA 1FL9A 1WPXA 2B2CA 2Q3MA 4J0EA 4PG6A 3ZU6A 4A1OA 1ZM3A 3PJGA 2LXNA 1NUUA 4ZCPA 5KYUA 4IV8A 5GONB 5CCEA 2A67A 2VDQB 3H75A 1J0DA 1WIWA 2C9YA 1W581 2FEAA 1CF9A 3I9V1 4OFZA 3PC8C 1K8XB 2IF2A 1B8VA 2BGTA 3AHFA 2C00A 3JARB 4JYZA 1VOTA 2QPLA 2G77B 1DL5A 4KCGA 2ZBGA 1FYFA 2IPOA 2Q5LA 5CDHA 5KJ1A 1MAHA 3LC0A 3GAZA 2V98A 2FZVA 4IEEA 3H9CA 4GXNA 3IILA 2AMVA 1E3WB 1GJRA 3RG8A 2VLIA 5CJ2A 4DNXA 4BY9E 3CPJB 4O5OA 1ZUNB 3ADDA 4PAGA 2NV0A 4K7JA 5AKXA 1RIIA 5HR5A 4ZO8A 4C87A 3T5CA 3QWAA 2F2TA 3NJ4A 1FXWA 4UZFA 2BTQB 4FFBB 3IP5A 4GSLA 4RF4A 5JNTA 3O8OB 3PLAE 3IQDB 1PJ2A 3QH4A 1N6IA 2YCLA 5KDDA 3EWIA 1KC1A 4WN9A 3H9EO 2EQAA 3MJEA 4CUJA 1AVTA 2VRBA 1G4AE 1PK8A 3HPRA 2EWWA 1KQNA 1W47A 1GZ4A 1MW9X 2X9LA 4HY3A 4P81A 2R1VB 2G40A 5D1NA 5JYEA 3UT6A 1BDHA 1U63A 1SB8A 3AHEA 4G36A 3GG9A 3HBNA 3BXZA 4D56A 1WHTA 3MINA 4M8LA 1XHFA 3UA3A 3EIQA 5D00A 1DGQA 2YVQA 2GPYA 3UTDA 2H4FA 2Q49A 2WSSA 1UXKA 3P2MA 4KQIA 3ME5A 2J09A 4RMGA 4WJLA 3RYFB 3DVAA 2DFTA 4LRQA 2LIPA 4CQJA 1ZLYA 4OAOA 2XMGA 1BFKA 1W85A 2O14A 2YIVX 3WL8A 2H0QA 3V8BA 2FW0A 3RVMA 5LU8A 2QLTA 1OASA 3AERA 4RK6A 4LTDA 2BL4A 3EIHA 4MNTA 4PCLA 5PNTA 2PYDA 2QL7A 2FX5A 2R44A 2ZWOA 2P75A 3FCEA 4CV0A 4UE2A 1QGED 1XJWA 4ZJPA 4UHCA 5BVGA 4Q37A 5DM60 3PNOA 3UMCA 3WDSA 3HABA 3RTCA 4TQUS 1DAGA 3VVCA 1OHHD 5E6SB 5EWLB 1ONSA 1R0SA 4B3XA 5KNBA 4G89A 1USWA 1ACJA 2V6IA 4LRUA 4RA6A 1KBQA 3B9BA 1C2TA 1FU7A 3RRJA 4IP0A 3O5AA 2PV0A 3G8CA 4N1AA 1Q16A 1ZIYA 1JNYA 1YVUA 3OCZA 5EE5B 2PD6A 1P91A 2ATVA 2EKZA 2GN2A 1RZVA 4UNQA 2PWPA 5LD2B 1XU7A 4BDTA 2G1UA 4NY1A 4EI2A 4W4TA 2KYRA 2NTEA 3L3BA 3IBSA 4BKOA 4DA0A 4F5YA 1YIDA 4UASA 4DCCA 1E60A 3L7KA 2G5PA 2AE2A 4HBZA 1KRHA 4PVCA 3I1IA 1E0SA 3MLAA 4FFWA 3DB1A 1DG9A 3DE0X 1G18A 2P6UA 2ZWVA 3KLMX 1E79A 1GNSA 3MQ4A 3B9QA 3NIBA 3QFHA 4GPTA 3CN9A 3PJRA 4DTCA 4EZEA 1KMCA 1O95D 3ANTA 3MNFA 3DXZA 2GBIA 3UWDA 3DC7A 4DRYA 3TG8A 2FFRA 2CK3D 2HWUA 1DHTA 1A9XA 4YRTA 1U0BB 1OZGA 1C50A 2X9QA 3MT9A 4I9UA 4GYYA 2E4ZA 4KWIA 4LV8B 4O2LA 1XPUA 4URFA 2HDHA 2QPAA 3OAAD 1PBTA 1AD2A 1OZAA 2Q6OA 5JW6A 1J2EA 2BFWA 3OBBA 3TW8B 3GFPA 4MUMA 4B85A 2BFCB 1QFMA 2MR6A 4EP1A 5FA6A 3TGLA 2IPMA 1G1AA 2W2TA 1KJ9A 2F1IA 2Y71A 2YWBA 2HM7A 4C0HA 4RGYA 2IU4A 3FCOA 5ENDA 1RWNA 1Z8HA 4FYJA 4WVFA 4L51A 5EE3A 5C0OE 3CJTA 1AU9A 2FETA 1PJQA 1NJGA 4JASB 5BXQC 4JJ6A 1PQ4A 3QW2A 3B85A 4Q1DA 4CKYA 3OE7A 4XI9A 2JFNA 4HNRA 4GZ3A 2Q62A 4HDQB 4JSTA 2Q3HA 4B44A 4URWR 3ZZ0A 3EIWA 4CKEB 1TZKA 3C41J 3NJRA 3IEXA 3RFUA 4LGCA 2P68A 2Q8PA 3H84A 5DT9A 3AETA 3LRPA 1N3LA 4DL9A 1R6XA 1M8JA 1WB4A 4KRXA 3CRZA 3TZHA 4YV0A 2P3LA 2LUOA 2QR3A 5JARA 2OD9A 3BGVA 4DLZA 5EZYB 1XAHA 2PT7A 1G3IA 4IDDA 3RLFA 4IMJB 4PNPA 4OMFG 4OUKX 1OLUB 4MYSA 5MF6A 1GP2A 2MSEB 3J81A 1IUOA 3RQSA 1UJ5A 4Z3OA 4UBIA 3NWBA 2XUZA 4K03A 3QVOA 3Q6MA 2O8CA 3WHPA 1FRNA 1GQQA 1RI3A 4OB8A 4M1KA 1MC5A 4JZKA 2EJWA 2BFBB 1NFQA 1YQGA 3GNTA 3D6AA 2QN2A 3W2TA 3TSCA 4BMCA 3Q72A 3O75A 3FM9A 1DARA 2J31A 5A71A 3QBDA 2X4IA 4NVRA 2Z04A 3F3MA 1P45A 3STUA 2GCEA 2YYZA 1POXA 3H97A 1L1EA 3NLLA 3KPJA 3U48A 5HQ3B 4QTTB 2R2AA 2J6IA 2DH5A 2FFJA 1E2JA 3G2QA 3ESZA 3JQ9C 1KDYA 2A9RA 4EFNA 2CF6A 3E1GA 4JX9A 4TMWA 4YAJA 3WA6A 1QVZA 1JECA 1E8DA 1PWHA 2WBLC 3E1SA 1JEQB 1KTVA 5ALEA 1TJNA 3SX4A 2XXAB 1CC1S 1OPRA 2C5HA 4QPCA 3UEOA 3EVZA 1PFQA 1FA9A 4TYWA 1QDUA 4I55A 1WUJS 4KRGA 4OP2A 2C1ZA 4ZQIA 4L16A 3QEAZ 3ZY2A 3SYLA 1IN1A 3BM5A 1NUQA 3W2GA 4BMPB 3K9FC 3IUQA 1VLVA 4JJEA 1YR6A 3OQJA 4XDYA 3WLOA 1SK9A 1E1QD 1VZ3A 2PRSA 2Y66A 2Q7XA 2WUDA 4DV0B 1RZRA 4Q82A 1SY7A 3OU2A 1CUIA 4JNKA 3EW7A 3BGWA 3TI7A 2YN0A 4UBKA 1NX9A 4NYMQ 4TQ9A 4L02A 3IAM6 3QXHA 4Q4JA 1L5QA 1Q0SA 2FPKA 3PX3A 1LVHA 2R3SA 3U3JA 3D0OA 1L5NA 3VUEA 5KYXB 3IT0A 3P7MA 4U6NA 2BZ1A 4XIJA 4AJ1A 4UUOA 2A2ZA 2WVHA 4JAVC 3QSYA 1E9CA 1GXSB 2REOA 2JIZA 2VYND 3NW9A 3HLKA 5LC1A 2HA5A 4TTQA 2DY0A 3HVJA 3FOFC 2DBYA 4UNNA 2DECA 1L7BA 2R8OA 1U5BB 1UKAA 1Y3DE 2AMYA 2JFZA 3CRQA 1WCXA 3L1KA 4MR7A 3S1LA 2HT6A 4MV1A 4H1WA 4DSTA 1ODTC 2FR8C 4URHA 3WISA 1DKPA 2G82A 1RRCA 2GEUA 3L1IA 3PZBA 4KVAA 1PSDA 4IOKA 5HKKA 1UXGA 3ABRB 5TV2A 2FWJA 3SQNA 3S28A 3IL2A 3NC0C 1D2NA 1L4YA 1NWCA 2PH1A 3WJ1A 4FZ3A 1WEKA 1E89A 2HQRA 2VRWA 3HXTA 4TMXA 3MJHA 1P2VA 1TVEA 1W4RA 2NUPA 4NK4A 4R3UC 2YWGA 5EMJA 5AJTA 1AQIA 4BV8A 1R5BA 1G5PA 5IHXA 4HDMA 1XLWA 2QTNA 5BSVA 5L8VA 5KYYB 4W9MC 2PK3A 4H3HB 4JI0B 2C20A 4QDJA 1RI5A 2QVZX 3UJPA 2OCXA 4TQGA 1NBAA 3LX8A 3ZWKA 1EH5A 5A3VA 3ENWA 4E07A 3AF2A 4HB0A 1E69A 3DFUA 1GU7A 4LDPA 1VMAA 4TUYB 4BBPA 1E20A 1OR8A 2HMYB 2JASA 3ES9A 3ZD9A 2K6GA 4XGRA 5DN9A 5K2OA 1N36B 3DUWA 2CFIA 1KO7A 3M83A 2TECE 3AEYA 4QQKA 1U2DC 1FFBA 5FQOA 4B48A 1Z5PA 4IZIA 4H3SA 4J0KA 4K8RB 4XIIA 5ALLA 3WRWA 4BVBA 2JHGA 3UG7A 3QQ5A 4PPGA 2M1XA 2JNWA 2O0LA 3RAGA 1IUNA 4ZAXA 5FI5A 4YP1A 1AUOA 4U2EA 2RHHA 3SVZA 4RDXA 1R18A 2QD3A 2ZG6A 4GQIA 3UOWA 2NACA 3L9XA 4R84A 4AMZA 4UM8B 4HC4A 5G0UA 1C7FA 1XNQB 3D6UA 4YIKA 3ZW8A 1F1BA 3L41A 3OX4A 4PF1A 1XIVA 2BSXA 4GBMA 4LSGA 5CX4A 2ZRGA 2V0NA 2QBYB 3LQ4A 4GZ6A 4RMJA 1DFIA 1SQSA 4UU7A 4C76A 3TOZA 5J47A 2VQDA 3GCXA 4C05A 3K16A 4BNTA 1N1MA 3C1AA 4QQRA 5JYCA 4LA4A 3ZV3A 4N65A 1JAHA 4OXIA 1RWKA 4P1ZA 1PG5A 5BSKA 1MGOA 1GO2A 4HUTA 1ZH0A 4WTOA 1YE3A 1P1JA 4NZNA 4NJMB 2FN3A 2ONKA 1MPTA 3L84A 3RIYA 3L0YA 3NEYA 1TQHA 2QMEA 4KX5A 3T7EA 4OB6A 1NIPA 3WYCA 1G5FA 2XQJA 1R9GA 3ZGNA 3SF8B 2GFHA 1WR8A 3E58A 2YHIB 4B6SA 4QQFA 3WGGA 3RI3A 4Q7QA 3BMOB 1IONA 5TPZD 5EXEA 3KJQA 4FWIB 4H15A 5C51B 4QJ4A 2YW9A 1LBIA 3S55A 3SC3A 4TVOA 2XI4A 3BWEA 3DDWA 4H31A 4MA0A 3T4XA 1PW5A 4HDRA 1CTQA 3R7SA 3CKKA 1SFRA 1TVKB 1UEXC 3H9GA 4IVQA 5FPPA 2C88A 1ZJWA 1ICEA 1Y4SA 2UYQA 4LF9B 4C7OB 1GTJ1 1LF0A 2GAAA 3ICQB 3BXEA 3GEHA 2JGJA 1J56A 1EFPA 1U3CA 2Z2YA 2P0AA 3E35A 4H1HA 2XMQA 3L5KA 5DEOA 5FTLA 1NU8A 2W6QA 5B58C 4KGXA 1ULBA 1RRFA 4GZLA 1Z0UA 1JDZA 4O3MA 2JEYA 1M5UA 3N2NA 4IPTA 1E59A 3PQFA 2FMUA 4MJXA 4RJLA 3VZDA 4JI1B 2IHJA 1V2HE 4KBYA 3QOXA 2GBPA 1J0EA 2VDPB 3WNVA 3H11B 3DEJA 5K8TA 2VXCA 1QO7A 2I3GA 3CRNA 3K0EA 1DP4A 4OH1A 1KI6B 1KZ9A 1ZVMA 1JDJA 5HXAA 3MRTA 3GRUA 4QRIA 1JPUA 2OV1A 1I8TA 2W6ID 1PR2A 2MR5A 3HS3A 3Q0EA 1I7SB 3MINB 1IBLB 4P5EA 2EXXA 2NVWA 3HQ4O 2J9FA 4MCAA 3BWXA 3DZDA 3L7BA 4HX2A 1E1MA 2GEFA 1NURA 2ES4A 3CU5A 2GN8A 4MRAA 4PC6A 4NE2A 3E9RA 3DVLA 2EJUA 2V6BA 1ZK1A 4ZVUA 4G5YA 4OEHA 1HYEA 1YACA 2I2AA 3OZAA 1RYYA 2J5RA 2DM6A 5CVDA 4K9OA 2GGSA 1OQAA 1A2OA 2IPXA 5A04A 5KI6A 5JFGA 4HS9A 3SZOA 4EW1A 4FDUA 3F47A 5BRAA 1GIAA 1I4TD 2WHXA 1JE0A 1XMJA 4YRPA 3SMVA 1WB9A 1QCZA 1X1CA 4K87A 1SVNA 3GMIA 3NBFA 2XY4A 2KLHA 4N8EA 5DT2A 3VYTB 5KHOC 3R6WA 4BGIA 5JWOA 2NO5A 4A82A 1VSUA 3ZK7A 3FHTA 3CINA 1XZAA 2EZTA 3JQRA 4M0UA 2D59A 2P9QA 4BO5A 3IR5A 1X1QA 2PIDA 1CY6A 2IITA 4GRIA 3IEMA 1SRQA 2XWPA 1TLTA 2DZDA 1IAVA 1Q7EA 2BFEB 1RQ2A 2Q4BA 1X7XB 3AEUB 4AJOA 1NOKA 3AR9A 5C80A 4AY3A 4B6JA 3GFVA 3MLEA 3PB3A 1WB6A 4MVCA 5IKOA 1KZHA 4GX1A 1I7LA 1VMKA 2ZR9A 2JLSA 2C5FA 1NUSA 1ZNQO 3AR2A 3FUVA 4JQCA 1R0XA 3NV9A 4YWJA 4ML3A 3O8BA 3OZXA 4ZZ2A 4FZ5A 1X14A 3JATA 1QR6A 3CX7A 1HC7A 1P1RA 1RAAA 3FMPB 2D8AA 2PH5A 2FZ4A 3KZKA 4YRQA 1HNNA 4EAAA 3CT4A 2NWQA 3AV3A 3A2NA 5H1YA 2AA3A 4XLZA 4P3PA 1M6HA 3MJFA 3ZQJA 2B1QA 4YRDA 4UNSA 4Z4FA 3HDGA 1E0AA 1NRXA 3KKLA 5NULA 4A6DA 3OEHD 4KE9A 4WMLA 3WLHA 2AG6A 1HDCA 2IYQA 1SZPA 2H29A 4LXQA 1XLVA 2BC9A 4CDNA 4KL8S 4ZXFA 4S04A 4BJ1A 4DQLA 4QU9A 4FSDA 1L5LA 2WHRA 4J3FA 1OFUX 1IRXA 1XNGA 1NULA 1J22A 5IVIA 3RUHA 5A5FA 3STVA 1GTSA 4ZGGA 2M6KA 2WT9A 2BMEA 2ZIWB 1YOBA 2OV3A 4I81A 1BCSB 2P9FA 4O3FA 2XA2A 4FOLA 4CR8A 1R8JA 4JBXA 5ELMA 2O48X 2Z1MA 3HDTA 1VLHA 2AC7A 1I5EA 1Z5UA 2JCGA 3GD7A 1K9SA 2WTBA 1Y7PA 1K97A 4Y2TA 5J43A 1HL3A 1JA9A 4LF7B 2L82A 5JQGA 4ND8B 4DLRA 4BMNA 3WNCA 4L8WB 3RVBA 1SKYB 4XJTA 5DRYA 3C7CB 1EWVA 5K9ZA 2QAJA 4QDTA 2RHWA 1RNLA 3D3WB 4TRMA 1A9TA 1NMYA 2RBEA 1D4ZA 4B7UA 1US8A 3WZMA 1O97C 1PRYA 3R24A 1W34A 3H5VA 1J8DA 1A8SA 2ZUUA 3EC2A 3ILXA 3QE0A 4ZOLA 3KOXA 4DREA 3M5DA 4HGQA 1JKMA 4XIFA 5DH9A 2VJPA 1KSHA 3O2JA 4Q3BA 3U62A 4TMFA 3U40A 1QP0A 1D2GA 3E61A 1YHZA 2I6QA 4P3KA 4RWEA 3UB2A 3ITNA 2AL7A 1VPLA 4F3YA 4OMCA 3R6TA 1KAOA 4MRRA 1H6DA 4UEOA 4EATA 1BHQ1 5K0GA 2REQA 5E2AA 3QKTA 5IU6A 3Q5EA 2Q41A 3H18A 3BGDA 4WDQA 5FA8A 3VTFA 3GN2A 3VZCA 1C8VB 1VKZA 2O19A 1KVQA 4C7KA 3OQVA 4DIKA 3FYSA 3G2JA 1AB6A 1FRZA 1FTNA 5EIOA 3VZRA 1Q6YA 3QRWA 2XNCA 3FHLA 2JGIA 4IIUA 1VG8A 2LD4A 3TXAA 4LJ8A 4OBBA 1FFXA 3JD0A 5IZCC 5JDCA 4WOJA 1PZXA 1GNPA 3USES 3T1NA 5JSZB 1UKVY 4DBZA 4UDXX 4WXHA 3SI7A 4G3XA 2PR2A 4LJSA 5BWLA 5JQWA 3WGTA 1X74A 4A2PA 3KTOA 2J5XA 1YBVA 1NNUA 3DQPA 4RJKA 3IDOA 2HHJA 2UZIR 4GUAA 5FHRA 4FE3A 2R11A 2GK3A 3FTPA 2GBCA 3HXPA 1C0PA 2A6PA 3H9BA 5J4VA 5KS2A 4DABA 3C43A 4F45A 5F3WB 4Q3EA 1IEQA 2WSLA 1SMKA 4JSYA 4DEYA 4OG2A 5FOTA 5IK2A 3AF5A 1UT5A 3PK0A 4XUEA 3SXPA 2C1EA 5AXDA 1H6AA 3EVAA 3GPBA 4FBMA 2QUJA 1T91A 2QTFA 2FCRA 3MGKA 1YO6A 3OQOA 4IBOA 3A7EA 1ZSNA 3LLVA 3N7TA 4YVFA 1K0UA 1DJOA 3M4JA 3VNQA 4XIYA 1M6VB 1WG8A 3JD4A 4QE3A 2QMYA 1Q1AA 2QLBA 1W59A 4I4TA 4JA2A 4CCAA 4MSUA 3Q87B 3NHYA 4X65B 3AILA 1YFLA 1OXTA 2H1IA 2P1RA 2X1HA 4HDRB 3K8OE 1C30B 1WXWA 1T8RA 2GWHA 1K0FA 1W76A 3JQAD 3P9KA 1V39A 1SC4A 2XIJA 3NBYC 3R3JA 1R0KA 3TIXB 1A71A 3LP5A 1XRQA 2JJQA 3H1BA 1VLLA 1RLMA 2PAAA 2ZVJA 3NONA 4WEQA 1Z15A 4RPJA 1NDUA 2YV1A 2AF3C 4GQBA 1NP3A 5BWOA 3IXLA 2DPYA 2X0DA 2O5VA 4I55F 4ZREA 3TUIC 3ZW7A 2IHTA 2GCIA 5BPFA 4P5PA 4OF4A 4KE7A 1FE8A 4RKRA 3ZD8A 5C8XA 2JGFA 3CBQA 3AKEA 1DAIA 1OWMA 3OG9A 4GI3A 1G8SA 3BQMB 5IT9A 2NXNA 1HGXA 3KU1A 2XGSA 5BN4B 4H9GA 1T9AA 3IMEA 4CMEC 2O4UX 3QUTA 1AM4D 1JG7A 3OSUA 5FO1A 2CHFA 4F4HA 3WADA 2WAYA 4HPXB 2GAIA 4LIPD 2NU8A 3QVXA 1C0KA 4OREX 4GT1A 3NH9A 3ZU5A 2A5LA 2VYNA 1BX1A 4AYTA 4PO9A 3ZUGA 5C7YA 2FPGA 5MHTA 2WJZB 4BLVA 5D86A 1CY1A 1QHXA 2GHQA 4XB2A 3LWDA 4ZICA 5DPMA 2VP9A 4HQ6A 3PA8A 1T36B 2XRFA 1NW6A 2HPZA 4QELA 3R44A 3HMQA 2NXWA 3D9QX 1KAQA 1N9GA 2XSZA 4K9DA 2BJHA 3AOEA 2MSCB 4Y1RA 4CQMA 4EUSA 1LLQA 2O8EB 3A06A 2Q5QA 4I50F 5EINA 1QQ7A 2QX4A 1K8QA 5B1DA 3K9CA 3FVTA 4FFNA 5JAIA 2Z6QA 3GRPA 1CR2A 3KUUA 4KQ9A 4UBJA 3W9UA 2BISA 4AFNA 5EWLA 4UHDA 3WHIA 3AP1A 4R98A 2TRSB 4HYYA 2ZU0C 1M1YB 3G2OA 2IY9A 3AH8A 3DE3X 1C3EA 2RAPA 1C9EA 3PFWO 2QN3A 2PS1A 3W5VA 3CEMA 3Q8LA 3RIMA 2DTEA 4ZO7A 1KA9H 4HFJA 1LCIA 1BKDR 1X2BA 2FN8A 3I2HA 4H59A 3C6YA 2PXAA 3JQDA 2A94A 2FQ1A 1IHUA 1NFFA 1XCLA 3LPAA 1FW8A 3ZBQA 1I4WA 2JCBA 3MVEA 3T5GA 1XCMA 2QRVB 5JAOA 4HVCA 2QRVA 3MCUA 3ANMA 4XLLA 3L0IB 4CCSA 1CZOA 3K9GA 2WUVA 5HGJA 5JS6A 1P5ZB 1IHDA 2FZLA 3ELYA 2ZB4A 1RTKA 1UCFA 1WY7A 1A2KC 3I8OA 1BXZA 1Y9DA 3EQZA 3IEKA 4LJLA 4N6GA 4IXNA 5FPKA 4G0NA 3DDUA 3L7AA 1KH2A 2PBZA 3KKNA 4C4RA 2RGXA 2X1VA 4TWZA 6NULA 3DPSA 5C4IA 5HZGA 1JR4A 1MJGM 1NM5A 3FVVA 5JAMA 3PXXA 1IN8A 3TM4A 4EK9A 1KAHA 16PKA 2FZEA 3LDHA 1GZHB 1SVUA 2HBRA 4XQCA 3K6SB 3IAHA 4TSRA 1JG3A 5H80A 5ULLA 3BFXA 4DWJA 3IVRA 4QQ8A 5LR6A 3N05A 1OTHA 1YZ3A 2A9QA 4PGAA 4PXAA 4ZC1A 4JQOA 3RTEA 5D7NA 3V00A 4L0CA 1JTEA 1K89A 1QO9A 1EGVB 4N40A 4WESA 4BC0A 1KPGA 3VGJA 1G9XA 2ENUA 4DHWA 4ZIRB 2IHVA 2B8EA 3WK5A 1SIWA 2LBPA 3I52A 3O73A 2J6HA 2ZRIA 4HUQB 4KZPA 4RHFA 5EQDA 3V2IA 3GP5A 4EJ2A 1AHPA 2G76A 5JXIA 3NHUA 4E5UA 3UK0A 3RF6A 1G64A 3FSEA 1CR6A 1GGEA 1E3EA 1Y82A 4ZI7A 3OCWA 3HJAA 1HMPA 4EIWA 1YB1A 4GLOA 3V8EA 5EP2A 3GVHA 4WBNB 3AM4A 4QICA 5DXFA 3L0BA 4QUEA 2O6HA 5AYVA 2PUBA 2R7AA 4WLEA 1QWSA 2FPRA 2ORIA 3V4VB 3E9NA 3ZX5A 1O5OA 1GDTA 4MTCA 1DAKA 1L5VA 2XYQA 3L93A 3P0HA 5AVKA 1P44A 2CDCA 2W2PA 3V8PA 3A3KA 2D0DA 3QFSA 3E03A 4HLCA 4EPWA 5CRIA 3RS5A 4J1NA 1DWOA 2PSHA 2Q2QA 4J7UA 4P5DA 3LDFA 2WU8A 4RD6A 4Y1FA 3UMSA 4BFZA 4V1CA 2W90A 3WYNA 3EPPA 3FJOA 4X24A 3G7NA 5CNMA 1HT0A 3IEVA 5GADl 1MO3A 3U39A 1AA9A 4EH1A 1U5CA 5B7QA 1V2GA 2R2GA 5CA0F 3TQFA 3I2YX 3G5MA 4FYMA 1RLIA 1EP2B 1CZNA 1VLMA 3E4DA 1ZK3A 2K4MA 4H77A 3ZDXB 2R7KA 4KPYA 1D4FA 5DXJA 2DUWA