4UMEA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion and kdo molecule
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
HMNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
total genus 62
structure length 174
sequence length 174
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umeA00
3AR4A 5ALHA 2ZXEA 2YMQA 4EX7A 5AI4A 3QU2A 1T5TA 4UMFA 3U19A 2ZBFA 4Y2VA 4ZEXA 5AW2A 1L7OA 2YJ6A 1U2TA 2BDUA 3OCZA 3A3YA 2FUEA 5AKHA 2VKQA 2X4DA 4C4TA 3L8GA 3SD7A 3PDWA 2C8KA 3F9RA 1YNSA 4NWIA 5ALPA 5AKKA 1ZJJA 4L6AA 5AKGA 1ZD4A 3WKDA 5AM0A 1L7MA 4J03A 1RLTA 2GO7A 2I7DA 3A1DA 5AVXA 1RKUA 2Q4RA 4AP9A 4CF5A 3M1YA 1LTQA 4HGPA 3RF6A 3I76A 4BYGA 2GMWA 3NANA 5FP0A 2IA5A 1YV9A 3K1ZA 2C88A 2C9MA 4QJBA 2IOFK 3AR3A 4BKMA 2ZG6A 1O08A 4NFLA 3EPRA 3S6JA 3WKEA 2CFTA 3OCUA 5ALIA 3QLEA 5AK3A 5JJBA 4UU0A 2FUCA 1Q92A 2B8JA 4H1WA 3MN1A 1NRWA 3M9LA 4E88A 3NUQA 3DAOA 4YCMA 2IOHA 3MMZA 5AK4A 5ALEA 2NYVA 5AM2A 1T5SA 1YDFA 1RC8A 2IYEA 5ALGA 3U13A 3E8MA 3I6BA 2G80A 3L8HA 3A1CA 4UATA 1NNLA 4L57A 5AM3A 5AVZA 2P69A 1ZD5A 1Z4IA 3KOOA 4BX3A 1N8NA 1U7OA 5ALZA 3R9KA 5AVVA 5ALVA 1TJ5A 3I1YA 3L8EA 3DDHA 5AKJA 4AS3A 1ZD2P 4AS2A 4KNVA 4UU1A 2JAOA 1L7NA 2CFRA 5AI6A 2WFAA 3WK6A 4EENA 3QUTA 4BX0A 4KYTA 5ALRA 5ALLA 3A1EA 3NIWA 2CN1A 3ZVMA 3AR7A 1XP5A 3L5KA 1T9ZA 5ALOA 1RKQA 1U7PA 4DWOA 2OM6A 3P96A 3N1UA 4XPZA 1SWVA 1RMQA 3CZ4A 3ZX5A 4XQ0A 5AHXA 4IG4A 5AI9A 4I9FA 2C8LA 3U7FB 1WZCA 4JB3A 3SF0A 4YCLA 5AIAA 1VJRA 3VAYA 2HOQA 1MH9A 2CFSA 2YMPA 3MC1A 4DW8A 2ODAA 2YMMA 4Y2QA 5A3QA 3PCTA 3N28A 3QUBA 3SMVA 4DFDA 1QH9A 3UMCA 2OBBA 1Z5GA 2MSNA 2QLTA 1TJ4A 3UMBA 1IWOA 4BX2A 2WHEA 2G06A 5AW3A 2BY4A 4UMDA 2HDOA 3AR6A 1RQLA 3KZXA 2HSZA 4Y2UA 1N9KA 4UAUA 3WK9A 3HLTA 4HGRA 3QXGA 4Y2RA 4XE5A 3BWVA 5AKLA 4HGOA 2HHLA 1RKVA 2MU1A 4OHFA 3IRUA 4CNQA 1RQNA 3R09A 5ALQA 2ZOSA 3SLRA 2RBKA 1J8DA 3FPSA 1TE2A 5AW9A 4NABA 5IT0A 2O2XA 2EARA 4NV0A 2FPXA 3ED5A 3NALA 3L1VA 1O03A 2HF7A 2G0AA 4BEVA 5AI5A 4BNDA 2JAWA 2NO4A 4OD0A 3SKYA 4CF3A 3QX7A 4QQFA 4Y2SA 1XPJA 3FM9A 2RARA 3ET5A 3B9BA 1KYTA 1L6RA 2P9JA 3OCYA 4UW9A 1ZRNA 1L8OA 1YMQA 1QQ5A 4KNWA 3WGUA 5AM5A 3ZU6A 1RLOA 1EK1A 4YCNA 4HAIA 3MPOA 5AI8A 4MUMA 5AW7A 5ALTA 3B9RA 2IOFA 2P27A 2HEGA 1U2SA 2WM8A 3PGVA 5ALYA 3SKXA 4UARA 2JARA 5AK5A 3WGVA 5ALUA 1PW5A 3WK8A 3L0BA 4DCCA 4JDPA 5AKZA 3W5BA 1S2OA 2AGVA 3PGLA 1Z4OA 2I6XA 5AK6A 2FPRA 2FI1A 1WR8A 3E84A 1ZOLA 4FE3A 3L0CA 1Z88A 1Z4LA 2W4MA 5AI0A 1FEZA 3DV9A 5ALSA 4KX5A 1Y8AA 4GIBA 1CQZA 5ALWA 4CE6A 3ET4A 4UMEA 5ALKA 4BNDB 3E58A 5AM4A 3DNPA 3ZWKA 2RB5A 3CNHA 4O8CA 1YS9A 2I33A 4L6CA 5AW6A 1RLMA 4HGQA 5ALDA 3L1UA 3U7EB 4RESA 3HYCA 4YGYA 3EF0A 2BDEA 3WKAA 3KD3A 4KN8A 2ZBDA 1ZD3A 3QU9A 3IB6A 3QU5A 2B0CA 2I54A 1XVIA 1U02A 2YJ3A 2DQSA 3B8EA 3QYPA 3NASA 2FPUA 3TLMA 3ZTWA 3FVVA 4B6JA 5ALXA 3QU4A 4UM5A 2ZBEA 2W43A 1QQ7A 2O9JA 5AKIA 4ZEWA 2YY6A 3OCWA 5AVTA 2QYHA 2WF7A 4C4RA 5AW0A 1Z4MA 1ZS9A 3WKCA 3W5CA 4Y2JA 3U7GA 5A3SA 2WF8A 3ZUPA 3ZVLA 5AVUA 1RDFA 4FFDA 4EX6A 3ZWDA 3AR9A 2YJ4A 4J2TA 3ZTYA 2YFYA 4Y3UA 4IFTA 3U26A 2YBDA 3AR2A 1AQ6A 4PNHA 4KX3A 5AVYA 1SU4A 1WPGA 2P11A 2G09A 2B8EA 4CF4A 5ALNA 3EWIA 1Q91A 4OCZA 4I9GA 3ONNA 5ALFA 4C4SA 5AESA 2I55A 3EF1A 2Q5EA 3W5DA 2EATA 5AVSA 2FPWA 2GHTA 3OCXA 3ZVNA 1TJ3A 5AKYA 3KBBA 4HYTA 3ESQA 5AVQA 2AUTA 2EAUA 5AVRA 2YN4A 3D6JA 3L7YA 3OPXA 4G63A 2OA0A 4YIHA 3FPBA 2R8ZA 4BBJA 2RAVA 2PQ0A 4XOUA 3SHQA 2Q4TA 4G9BA 3WK4A 2FPSA 2W11A 4UMVA 3UMGA 1VFPA 3I28A 3L8FA 2WF9A 1Z4QA 3WKBA 2FDRA 1F5SA 1LVHA 1WVIA 3NRJA 5AKEA 2R8XA 3ZX4A 3OTQA 3KC2A 4UASA 2PKEA 1Z5UA 3N5KA 4EZEA 2B82A 3RFUA 4F72A 3W5AA 4BEWA 4Y2YA 1TA0A 2FEAA 1QYIA 2PR7A 3QUCA 2B1QA 3J7TA 2I34A 3U7HB 1VJ5A 3IJ5A 5AVWA 1S8OA 3ESRA 2JAUA 2D2VA 4Y2XA 4Y2PA 5IT4A 3AR8A 4UM7A 5AW4A 4FYPA 1QQ6A 1J97A 1RPZA 3BA6A 3E81A 2YJ5A 2OYCA 2GFHA 3WK7A 3QU7A 2R8YA 3UM9A 2AH5A 2WF5A 3GYGA 1K1EA 4F71A 3FGOA 5AW5A 2HO4A 4YH1A 1EK2A 1Z4PX 5AW8A 2B30A 3ZW7A 2JGAA 2HCFA 1Z4NA 4HGNA 3L0YA 2WF6A 5ALMA 5ALJA 2NO5A 4UAVA 1JUDA 5AW1A 2C4NA 4MWOA 1RMYA 3N07A 3NAMA 2HI0A 5A3RA 3QGMA 3OCVA 1L7PA 2G1AA 5AM1A 3R4CA 3KDPA 4OFZA 2G08A 4EELA 3AR5A 2HX1A 1X42A 1ZRMA 1NF2A 2YMLA 2AMYA 2ZBGA 4RETA 5T41A 2HF2A 1RMTA 3QNMA 4EEKA 3QUQA 2R8EA 5AKXA 5AICA 1Z4KA 3ZI4A 1L8LA 1RRCA 4NAVA 3FZQA 2B1RA 5IS2A 1Z4JA 2GHQA 4ZEVA 1CR6A 4GXTA 5AIBA 4Y2TA 5E0OA 3WK5A 3N8GA 1SWWA 1YJ5A 2G07A 4YIKA
chains in the Genus database with same CATH superfamily
4BO8A 5D5QA 3SHWA 3MCZA 2QLNA 5DK4A 2BI8A 4OHCA 2WYUA 4E5VA 1C0KA 3KR2A 3AEQB 4FN5A 3H3JA 4UZEA 4DARA 3PPXA 4E2XA 3SXJA 4DDWA 4D0SA 3AGQA 5H9VA 4HPXB 1PJ2A 3KNZA 4HS9A 1L7EA 1S8NA 3BEDA 3EY4A 4RTMA 1LXCA 1KJZA 1JU9A 2AQHA 5EFOA 3TTSA 1GZHB 3GA7A 5G2OA 3TJMA 2IEGA 1GYRA 3ILVA 3ZXIA 3CU5A 4DLKA 4ZMRA 4JNKA 4CR8A 4LNUA 1XZIA 5KO2A 2O2GA 3EPKA 4NCXA 5LFAA 3WLFA 1UDRA 5BN4B 1Y8QA 1HRKA 3K92A 1QRUA 3NIGB 1QWSA 1C0EA 1JH8A 3L7KA 1XT6A 2XSZD 2ZCVA 1KPHA 1BS9A 1LX6A 1ZD4A 4DZRA 4QJIA 5DNCA 1XG5A 3I9KA 1J7KA 2IZ0A 3UJ6A 3AESA 3K9BA 2ZITA 1N9GA 1DG9A 1VZ2A 3WR5A 2AZDA 1V7CA 3WGNA 4L2IA 3F71A 3WGLA 3BPSA 2J5BA 4H1TA 1I80A 4AXBA 1OFGA 2WEKA 2B2CA 4JJIA 4LE1A 3Q7SA 4DUPA 2GCOA 4TSKA 3ONFA 2SCUA 1ISPA 4N7JA 4BWGA 3D3NA 3ZLVA 1JF8A 4QJBA 3TAHA 3T8YA 2V3CC 2W9XA 2P9ZA 4I36A 4AJ4A 1Z12A 5LDHA 3BHJA 3BXPA 4HDAA 3SX0A 5TGDA 2JVIA 4UKDA 4X91A 3LLMA 3GXBA 3OHSX 4W9MC 5BYBA 2ZRFA 3K0SA 2CFTA 4G65A 4KE8A 2X1HA 3C1AA 3OEHD 1FYVA 5FI5A 4CG2A 1WF6A 3F2VA 3SJAA 3JAMA 5JCJA 4PHTA 2ENUA 2XCUA 4I6JA 4B6QA 2E4UA 4FM9A 3NKFA 3FPCA 2DM6A 1GNSA 3VTZA 1ABFA 1UBSB 3EQ8A 3MN1A 4JS0A 4RD2A 2P9YA 1U6JA 2YCBA 1G20A 1FOEB 1XU7A 2GAFA 1WPXA 2JASA 4OK6A 4ACAA 2E4XA 3G2NA 3HR4A 1BFDA 3MIIA 5BYJA 3PWKA 1QU3A 1VJ0A 2ANBA 2Q7DA 1YZUA 1RCFA 1ZIDA 3MJRA 4RXMA 2NVOA 4YDHB 1IIRA 1LTKA 2Q07A 2H7VA 1Z0SA 4EUKA 4JZYA 2DUUA 1V2GA 3PDIB 4QNMA 5F7OA 4CV1A 1Z29A 4HR7A 3KVYA 2JJ1D 3L0SA 4GZ6A 5KS2A 1ABBA 4R0NA 5BN5A 5JHHB 5D7NA 3BREA 3KDAA 1VL8A 1ZD5A 4Q4LA 3SVTA 2XNCA 3AF5A 3JRXA 5K45A 1BOOA 4KOAA 3L8EA 2Q0QA 1JQ3A 2BRUA 3AZOA 3VSCA 5K6AC 4D9CA 3RKRA 2C7BA 3CN7A 2OXCA 2O6LA 4KNVA 3SLKA 2ZIZA 4YCJA 3RVNA 1GTSA 2XUAA 2FSPA 4EH1A 3DXXA 3OPNA 1W49A 2PPLA 5LBUA 1VPDA 1E7SA 2EX4A 3QUTA 3W3ZB 2PQ6A 1MV5A 1KKUA 1M6EX 1TKAA 2W00A 2XCLA 5FFNA 3GFPA 3LPAA 2Z9DA 1T8YA 4EUNA 3RSQA 3WIDA 3MCUA 1RKQA 4A8TA 1N2ZA 1W36B 4G5SA 4Q1DA 5H8WA 2TECE 3AWIA 4NVRA 3REQB 2Z5VA 3N6RA 3O8CA 3G5MA 1MX1A 1OFUX 2NVUA 3WY9A 2DHRA 2OCGA 3D3EA 1NZJA 3ZDZB 1U7HA 1K5DA 3BE5A 5H1YA 5J2TA 3DV2A 1R0KA 3TDMA 4S0ZA 2DWCA 3KPUA 3UOGA 1RJ9B 4LYJA 2BYTA 2XA9A 3FTPA 4NY1A 3ESCA 3FN4A 3CJTA 4FMCB 3ZOZA 3LF1A 2OECA 5DULA 4UFOA 3RK0A 1YVUA 4M86A 2PLAA 2BKUA 2WB2A 3IVGA 4B32A 1K6EA 1R4NA 4YV1A 1IN7A 1YUBA 4Q4HB 2OBBA 2QM8A 3B48A 4GP6A 3TOCA 4CUKA 3LT1A 2HIMA 4BFSA 1D9ZA 4PXSA 3WBFA 5L9AA 1KJIA 2R84A 1UDXA 2FDXA 3ETEA 4QTTB 1GGHA 5B2EA 1OI4A 5ITVA 4BXOB 1YRBA 3RYTC 4C2BA 3O73A 4QAJA 3UJ8A 2XDQA 4JJ7A 3WI7A 5LB4A 4RD6A 1N2CB 2DX7A 3HL0A 4V24A 1XEAA 5AJTA 4F4DA 4WHMA 4CL2A 1ZIXA 3RSGA 1Y42X 4B3BA 3BTSA 1YWGO 3QMPA 1W25A 2HT1A 1IPHA 3BWVA 1BMFD 1FQKA 2BZGA 5JECA 4GYJA 2PZJA 4O08A 5EXSA 1UC4B 5AWFC 2ZU0C 2VTVA 4P4SB 3IHWA 1W5BA 2CFOA 3K09C 1G21A 1U5BB 2Q4OA 1NG1A 1KJWA 2GBGA 3BQMB 5C2JB 1JR3D 2XCSB 3ASUA 4TRRA 4FLEA 2FPXA 3RVSA 3F8SA 4BIMA 4AI6A 4OB8A 3PWSA 2QIOA 2H06A 4JY7A 4MR8A 4YT4A 4YHBA 3COPA 2ZYGA 4YRBA 4OLAA 3FRHA 3LTEA 2CNKA 2JIBA 4HB0A 5AH0A 2G9UA 4OQMA 4Z53A 1DHTA 2GILA 3HKDB 1Q20A 2N42A 5H83A 5BPFA 4NJMA 4ZWNA 4HNRA 4P3KA 3QI7A 4KWCA 2KS6A 1CQIB 3NHLA 2YV5A 4GM1A 3FM9A 3EGXA 4IXDA 5TXGA 5CDSA 4KXNA 4Q9AA 3DZGA 3JVEA 1IAVA 5C35A 1QYDA 1ENOA 4G0NA 5EESA 5IT9A 2A5JA 3EC1A 3OCYA 1DMRA 4KIGA 2RC6A 5AVJA 2R6R1 3EVAA 1Z9BA 1QQ5A 4MI6A 1V26A 4KDCA 1PDOA 2V8BA 3RIXA 2D5LA 1EK1A 2QP4A 4MWGA 3ZDRA 4C6TA 1GPH1 1QHFA 2H7XA 3OEED 3W5SA 3RROA 3WGMA 4Y9SA 3STVA 4QM7A 5HXAA 1GTL1 3O26A 4NBTA 1EDEA 2B7LA 4Z4GA 3ZJTA 4CI0B 1MA3A 1SUPA 2DCMA 2OQ2A 1E2MA 3C85A 3UB3A 2P4HX 3TN7A 2ZR0A 1XLUA 1N2JA 2XUGA 2YZNA 1OUMA 2V9ZA 3K0HA 4IDCA 2JZCA 3GJ7A 1AH2A 2W71A 1HC7A 3CGGA 2H5JA 1U0SY 1GNLA 2FPMA 4K86A 5KNBH 1P3JA 2FWJA 3KXIA 4X85A 4D81A 3N2ZB 4FB4A 3NR2A 3TW4A 4NL4H 4IH9A 4B4OA 3VKUA 4RPIA 5ALSA 4RGQA 1Y8AA 4PGAA 4DMHA 5ERGB 2H2HA 1AZTA 3FMPB 1E1CB 1EYZA 4YJGB 1Y37A 1FFWA 4BV2A 4H1VA 4K9SA 3ZOKA 1FCJA 4PLYA 2H8KA 4D44A 4DMKA 3U9SA 1A1SA 1MLDA 3PUVA 2PV7A 3GO4A 1YBVA 1P62B 2XE7A 4MV9A 1TA9A 1VB5A 3PYXA 1PGQA 4P22A 2ZRAA 3G79A 3F6RA 3DFIA 1CU1A 5A9SA 3KYJB 1BVYF 3EAQA 4ZPJA 4YYEA 4D4HA 1WUIS 1YDWA 3HYCA 4GOMD 2V3WA 4MP3A 4WOPA 4YGYA 4Y9RA 3HV2A 4MRMB 3T35A 2BDEA 2SBTA 4S2EA 2ZJ5A 4W63A 1KMNA 3OBIA 5BWBA 5IC4A 4UTVA 2CDRA 2ZI6A 4CEJB 1L5OA 3INYA 1TKRA 2IS1A 1NVMB 4YRAA 1AO3A 4CRWB 1YS7A 3T5DA 2JNWA 3N53A 4EG1A 3V80A 3CRZA 2CSXA 5ELXA 2H2GA 3CSSA 1NSFA 1PR5A 4HD8A 2CLKB 2X9QA 3LOQA 3MUEA 5DYNA 3UAWA 3O0DA 3Q7RA 2QYHA 4LPKA 5G40A 4ZKDA 4CMHA 3TJZA 2QX6A 1S1CA 2O8EB 1SXJC 2YJNA 2RBEA 4N9QA 3NIFB 2VZLA 1PGJA 3HJBA 3PEUA 2HMVA 1JMVA 3A58B 2VF5X 3HO1A 1IWBB 5IAAA 2Y6VA 2WJHA 2ISQA 1AGNA 5CR9A 4KAFA 4LNHA 1WXDA 1QV7A 4CODB 1GTZA 1EEHA 1L3CA 1WMFA 4OMFG 3INNA 1MW9X 4TSFD 1G1AA 2GKGA 3SYTA 4QGSA 2V7QA 4UHCA 3ZTYA 4GPD1 4RK1A 1DDGA 1EGAA 5LYYA 3W2TA 2WLTA 3Q8KA 3AR2A 5A7FA 3VR5H 2QM7A 1KP2A 2V4MA 1LJ8A 5C4MA 4D9EA 3I0MA 1NRIA 1QVAA 2PAAA 4IQ8A 4Z9YA 3NAQA 2C1EA 5JS2A 4F6CA 1BCSA 4DQKA 1HL3A 1ST2A 1SU4A 4TYMA 1STOA 1YVRA 4CT5A 3RB8A 1WNFA 5JH7B 1RJWA 4W6ZA 4IMJB 2FHSA 3DMGA 1VHWA 4XJVA 1G19A 2CE7A 3AHDA 2VJOA 3NGMA 4FN4A 4Z86A 1JXMA 5AJUA 1LLQA 2BM8A 4M0PA 3RPEA 4PG6A 4HZUA 4BE9A 1THZA 4OMCA 4RCYA 3R9XB 2CBXA 4X95A 4YT5A 4Z4HA 1QDLB 1TMYA 2QMUA 3HP7A 4KN8A 5IC5A 3CG4A 4FQ5A 2GAAA 3SEZA 5K01A 3RYCB 1C9DB 1QPGA 2XADA 2BEVB 2VDPB 2WSYB 1VA4A 2GHTA 2XH8A 3JRNA 4QHYA 3SQLA 2AMJA 3KQMA 4CIVA 2BKXA 2YWCA 2WUGA 3HACA 1NBOA 4KR6A 1UKAA 4DILA 4LHZA 4Q01A 1VGQA 1N9GB 3L7YA 3ZZMA 1CEYA 1DXOA 1HFJA 2GJKA 2HZBA 1TNDA 2EX0A 1WLSA 2OL4A 4IYRA 1XZCA 4RM2A 4RJKA 4CMIA 4RCVA 5I45A 4XOUA 4YDRA 3HUUA 4CKBB 5FUQA 1BQ4A 1KAOA 5EQFA 3ZIAD 3CF4G 3UJ7A 4ABYA 5IXJA 1JU4A 3AEQA 2PFGA 4IOJA 3ZY3A 3PITA 1VJCA 3GRZA 2RE8A 1HMPA 3OA2A 1SCQA 4UVEA 1BXGA 1KVRA 3I28A 3OF2A 4M89A 4R8LA 1CUUA 1TRKA 1DPFA 3MB8A 5I5GA 2CDBA 3BDIA 4TXMA 5BR7A 3H8WA 5KTPA 3GP3A 2HNAA 4CLRA 1JZSA 2NU9A 2I71A 1LDYA 1USIA 1HZZA 3L1JA 1J5XA 4JU8A 4V0NA 4CQLB 5EZSA 2ZM5A 1CUGA 1XDGA 3QX8A 4LZNA 4RHYA 4UASA 1TM3E 2LVBA 4FJ0A 2H2FA 5DX8A 3HP4A 4RY8A 2GKOA 1G9SA 3AZQA 3ESBA 2W2LA 2YYZA 4O2AB 1A5SB 1O8BA 2WJJA 4C14A 3CS3A 3JZMA 5SZHB 2D06A 3DOUA 1YKGA 3I52A 4NQZA 2WKRA 3ZEAA 3PR1A 4ND2A 3SZLA 2JFBA 2I34A 3OJXA 2DLCX 3EIOA 4P0TA 3PR3A 4KR0A 2POQX 4WBNA 2IVFA 5DN6D 3SY8A 1A71A 2Q8PA 4OHXA 3HU1A 2EZTA 1CS0B 1JLLA 2C9CA 3A6LA 2ZPAA 2XA2A 3EUFA 3H9EO 5EHNA 4GXQA 4UUQA 4RE6A 1DPGA 2ZYWX 5DT9A 4D9IA 4AMVA 5B3JC 4AX8A 1PNQA 5C8YA 1FTYA 1VSUA 2WSIA 4UM7A 4A82A 4YJ2A 1DRUA 1FDOA 1FQOA 4PHGA 3ADOA 4ADSG 3VGPA 4DXAA 5DI3B 2OZEA 1BDHA 1QOPB 2XTZA 5EWLA 4DIEA 3PJRA 1UMKA 4QUIA 1BXRB 2G7ZA 1M7HA 1V11A 3HCNA 2IDMA 3I0NA 2JRCA 3EE6A 3EGWA 3UF0A 1E89A 1H2RS 2A1TS 2OB2A 3R7LA 1LWNA 3PQ3A 4GOJA 1GGJA 1W96A 3VV2A 3WISA 1E0AA 1M1XB 5T5QA 4RLHA 3TR6A 1VLVA 3LQYA 3P9CA 3KELA 2NO5A 4RQAA 3UOWA 4L85A 2I3BA 2AVNA 2E5LB 2ZK7A 3P97A 3ES9A 4RADA 1L7XA 4PO1A 1NC3A 3RM3A 5K7SA 2Y99A 2G1AA 4GDFA 1DFIA 3DTYA 3IEPA 3WX0A 4I4TB 2GPAA 1NOIA 3USCS 1Y3AA 3IE1A 3S1SA 3OQNA 2AMYA 2AOUA 3GWGA 2XY4A 4TN5A 5LZ4A 3JZIA 1LSJA 4WGFA 4ZVTA 3RU7A 3QOXA 4JC5A 2H16A 4C3UA 1Z0KA 2IUTA 4G4IA 1JPJA 1TO2E 5F33A 1VMDA 2WD7A 3ESYA 2AQIA 3GEPA 3O82A 4LWZA 5DWDA 4XYGA 3K0AA 4ARAA 4HDSB 4NAVA 3DHNA 1Z2AA 2B1RA 2BRUC 5EFZA 1UBEA 1M2OA 4EB3A 4KQ9A 3A31A 1MH1A 1Y5IA 3KBOA 4B82A 4GWKA 1UXOA 1Z7EA 2FRVA 3WK5A 1GU7A 1PNVA 3D0RA 2P7HA 3HQ4O 3LQ1A 2NPFA 4IAOA 3EC2A 4S0XA 2XKKA 1SZJG 2BEUA 3AJ9A 2NZVG 4GR5A 1T29A 2D7CA 1ILEA 1DOHA 3AP3A 4NYIQ 1CIVA 2CL7X 2XIQA 2YMQA 5C31A 2LCQA 3U9TA 5LD2C 2NN3C 3U2QA 5DXFA 3W3AD 4EX7A 2QU8A 5E3HA 4PS0A 2X7HA 2C2WA 2ZSDA 4TX1A 5HKKD 2BBOA 3LKZA 1BJRE 3L8YA 4Y2VA 4EG4A 1U3UA 1KH1A 1H0HA 1M2OB 2GZ2A 2HGZA 4MARA 4WLVA 3U3OA 3UJDA 1I8TA 3Q8XB 4TYQA 2FP4A 4HDOB 3MILA 5GZ6A 5KYYB 1DO0A 1G21B 2YVQA 1E8DA 1HFWA 2LCIA 3COSA 3RSLA 1IJFA 2EU8A 1N7HA 1E0JA 2F3UA 3NTRA 4UBLA 4BFYA 1GZ4A 4L5YA 3T99A 5LMZA 1ID8A 1NBWB 2JLZA 1R3UA 2HWYA 2GM9A 1WP4A 4F06A 2VDUE 3KHUA 3IQXA 4E94A 5KIAA 1ZQ1A 1NR7A 1LS6A 3A9SA 5J3JA 3EWSA 1ZJYA 3ZI7A 2Z1DA 3EGDA 4WESB 3UIEA 3VPHA 5AXAA 5A2QA 1W9HA 3OD1A 4I4TA 1IJEA 1Z83A 1ZNYA 1F60A 3O9MA 3AP1A 4F97A 3D6AA 4RA9A 1Y6FA 5CBPA 1PZFA 4D4GA 2G88A 2O2HA 2OLJA 1QIDA 2VJAA 3PFBA 1K89A 2HCJB 5BSMA 1MG0A 3SHVA 1X9IA 3GZ4A 1UDAA 1C9MA 1G3RA 4FLMA 1N2CA 4OOFA 3F6EX 3TTXA 3DOOA 3U4QA 3FFWA 5DM70 4IHJF 3KLOA 2X0JA 5B3KA 1YT5A 3PEYA 3P2MA 2X8JA 4MUNA 4WLNA 1EZZA 1O08A 4S12A 3WQQA 4CGYA 3NWBA 3DEKA 1YZTA 4RGBA 3N2NA 2VK4A 3PWZA 4M9UA 3LY8A 4WNIA 5KDOA 2QWXA 2VI5A 1L5VA 1M9NA 2BTOA 4FFBA 4KLRA 5EPUA 3QLEA 3ZDCA 4IIJF 3KWMA 3KT8A 5C5EA 4GWGA 3K3PA 2OHHA 3UNXA 2Q9AA 1FXSA 4PHCA 4MXDA 1VBFA 4HWKA 3L7DA 4BV9A 3ZWMA 1CB0A 2FXVA 3ZD9A 4YRQA 2YV3A 2GRAA 2J0UA 2P2GA 2QRNA 4QUJA 4OXXA 1SKYE 1NKSA 3I42A 1XELA 2IOYA 3TX2A 2IHUA 1K4YA 1PJ4A 4FEEA 3CF4A 4PVDA 1E77A 3VR3A 4BC0A 5BW5A 1BQ3A 2IL1A 1IQ0A 1PYOA 3QJYA 4MS4A 1KZ6A 3OAAA 3R7SA 2X41A 4N4AA 2E4VA 3VDRA 1BEUB 1GLVA 5IBCA 3D0KA 4LDNA 2E89A 4F7WA 2QJWA 1BG6A 3K5IA 1WNTA 3VGJA 3ZV7A 3KHTA 4ZI7B 1AQNA 4AICA 4TTIA 3DR3A 4V1CI 1GTG1 2XB6A 4UFNA 5IM4F 1ND6A 4DDMA 5CK5A 4V1CA 5I7OA 5DTRA 1WY5A 3T1HB 3U7JA 2DPHA 2GEFA 2LGJA 2CLCX 3I3OA 1YI1A 2XVMA 1FDTA 2Z6VA 3C3JA 4NENA 4Z99A 2LWIA 3QY0A 5SYMA 4UUNA 1U3DA 3L0ZA 5BT9A 4KHPB 4HXFB 1HGXA 2K2WA 2V98A 3I3SR 1OFVA 4ZAWA 3MAJA 2Y1GA 1OIXA 2PYDA 4GBMA 4PTZA 3GA0A 1BXRA 1T9ZA 2VPQA 1MRSA 5IKOA 5CVTA 1VDMA 8OHMA 5KQPA 2XYHA 5U9CA 3I5UA 2PTHA 3PDHA 3AESB 3H0CA 3NHUA 2PH7A 1IQPA 4DT1B 5AI9A 3LY7A 2A5LA 3D7MA 2RSLA 2PYIA 3GRPA 5EQJB 1T5BA 1XNHA 1IUOA 1J70A 4ZCMA 5CA0F 5KNBA 1D8AA 1E6MA 4J6FA 1JYSA 3OM1A 3IAS6 3QVVA 4PBRA 1VJRA 3C2QA 5C52B 1Y8ZA 1KRWA 1G2PA 3O8QB 4MAFA 5D3KA 2ODAA 3KSZO 1D2EA 2V6MA 2DWOA 3E1GA 1PYDA 3NEPX 4ETIA 5A3QA 1X7ZB 1DUSA 3GDFA 4NV1A 2M98A 5CVDA 3SMVA 4D3YA 3GJ5A 2EFJA 2E6UX 2HREA 4JP3A 4QQRA 1KJYA 2D0OB 2NXJA 2ZSAA 3CUEF 3KJXA 4V0KA 3DDWA 3RK4A 3ZWCA 4RF4A 3UBTA 4JBYA 1S01A 1WXWA 1GR1A 1W8IA 2A5FA 3KEFA 3DKVA 1ECPA 1VLJA 2WHEA 1IOWA 4IUCS 4JGGA 1I4TD 1YQTA 2QLJA 4NU0A 4PZZA 5AW3A 4QRDA 3N8NA 1EINA 4IOLA 1HR0B 3C3BA 1W8DA 2X0DA 2G3YA 4RHTA 4N8DA 1A8IA 4KLCA 4OPMA 3VBEA 4WASA 4NU5A 3GF4A 4NIMA 3UC9A 4O4HF 5TGTA 1T5IA 1SBTA 2REXB 2H29A 3WRXC 4AQDA 1JDPA 5ARDA 2CNWA 1O54A 2GNOA 2R4TA 3QKRB 2VHUA 2HTEA 2Z1NA 1K8RA 4REQB 2Z3WA 3DTVB 3SYMA 1D0VA 4ROTA 1SKBA 1GGNA 4MV5A 3RHZA 4C3OB 4M60A 1NLYA 2BGRA 1QGDA 2H2IA 2VNHA 4CN8A 1F6WA 5CFOA 1G8SA 3TQRA 4ANFA 3D1VA 4G37A 4XFJA 1K92A 4O6VA 2J59A 3RSOA 5JYCA 2ZETA 1V1RB 5KYWB 1H3EA 2Q1TA 3AEYA 3KQTA 4FINA 4C5AA 5EE5B 2KMLA 4CIWA 2F9FA 2P68A 1LB1B 3KB8A 1QYVA 2JAWA 4ZT6A 2Q3LA 1BC5A 3MFQA 3MNFA 1XNQB 4GD3Q 2FMTA 4H6VA 3I34X 5LXTA 3EF3A 3TXAA 4KQJA 2QUBA 4A91A 4RA6A 1KDTA 2X2EA 2X14A 2D1SA 1SH7A 3DQPA 3UW3A 4U1RA 4C30A 4HNTA 3FJ1A 1RRVA 1P2SA 4KUGA 4U9HS 4B8YA 2C03A 3EN0A 5M2QA 3R3ZA 3TKAA 3BJEA 1EIZA 1E2BA 1GGEA 4BNZA 1SU7A 2FJ0A 3I8SA 3FHCB 1B7GO 4V3CA 1BYUA 3WG9A 3HVUA 3G85A 2EHJA 4B6SA 3O4FA 4G8DA 3CRMA 2HN9A 4X97A 2FG7C 3GUYA 3UN1A 1XJCA 4IIVA 3V4LA 1RPJA 1RQ2A 2O1WA 1JECA 3I92A 2NW6A 1HURA 2ZBUA 2VSFA 3ZDXB 3M6VA 4Z1OA 4EBBA 1CUHA 3SC6A 1YZYA 1MBZA 4QT4A 1MJNA 2FW7A 3E4DA 4UARA 3OTOB 3Q72A 5CB8A 3AFHA 1NUTA 1WQ4A 3EIQA 3H1AA 5BORA 4F9TA 5HF5A 4WDRA 1L4NA 2CW5A 1DXQA 4RMHA 5AMXA 1LPPA 3HMKA 1CE8A 2FG5A 4XM0A 1L4YA 3SHOA 3DBRA 3HZHA 4CKEA 3RABA 1K0UA 3ZV5A 1E1LA 2PU5A 3VKWA 3WGZA 2FX2A 5F2OA 2QP9X 4KXQA 5AI0A 1COZA 1MRZA 2VZ8A 1K4MA 4AECA 4D46A 4B40A 3AETB 1WHTA 5IJ0A 1NUHA 4KX5A 2C5LA 1G18A 3PC6A 2Y3IA 4WZAB 1QJCA 5FADA 3VI4B 3ZCXA 4B3HA 1ISIA 4YPVA 1ESNA 5LD2B 1CLUA 1SN7A 3H9JA 3KQKA 2PG3A 4CE6A 2YW9A 4OL0A 1ONOA 3H97A 4E4RA 4KWHA 4K9QA 3UA3A 4HAOA 3RYFA 1CUXA 1FP4A 1MIHA 2XNSA 2Q45A 4Q0MA 3UXHA 3DGEC 1V6AA 4MQ5A 1EBUA 3U7IA 1A7KA 4B7XA 4M1OA 3VAAA 4W8OA 3O7WA 5LQKA 3B3GA 4FDMA 2V8OA 4DM3A 2RK3A 4FNAA 3G5UA 4AKGA 2QQFA 1B76A 2ZBDA 3BN3A 4BVKA 5FV4A 1FDVA 2QYSA 3KETA 4Z3OA 3LUPA 3TOZA 5KJ6A 1XTRA 2QR5A 1XZBA 5P8WA 2IIPA 2GASA 3A32A 2HA0A 3L04A 3NGXA 5BPHA 5CFPA 1KTIA 4PYNA 2IODA 2GEJA 1F8YA 3QU4A 2JKVA 4IGIA 4PC2A 4YMGA 2G77B 3TI7A 1OXKB 3O8DA 4CM9A 1KI8A 2HPVA 2XUQA 4M1YA 4REMA 4A26A 3D02A 1LBIA 3KEQA 4G0VA 1ULAA 2IUYA 3WWOA 2V7PA 2VXCA 2V58A 3O4VA 1QGYA 5FTNA 4D43A 1JDTA 1U7UA 1NBMA 3ZKWA 2JK1A 1KI4A 2ZYIA 5AT1A 1I5OA 5FWXA 4MKGA 3VH2A 2C3MA 3LE8A 5MN6A 3MLEA 4DJTA 2GEVA 5TS3A 5KVCA 2J31A 3FB1A 2FKNA 2FEMA 1FX0B 2HM7A 3B6EA 2F3SA 1F8UA 3NXKA 3GGPA 4H7FA 2X6RA 1XB2A 4J2TA 3QBVA 4Q3KA 4EKYA 4QU5A 1RRMA 2VBFA 3UMFA 3KAQA 2G1PA 3U26A 1TVMA 1PGPA 1RJGA 2VDRB 2WIFA 1HDGO 2JLVA 1U5AA 3GFTA 3Q1KA 4L0QA 3QLTA 1X2BA 4RF2A 3SG0A 1KVTA 1GJRA 2J4FA 2YRFA 4IP0A 4TQ9A 4D4KA 1KKLA 2WILA 5T8KC 1WPGA 9GPBA 2DKFA 1ZMTA 3GP5A 3FVWA 3HP1A 4YTEA 1XD2B 2A0FA 5LQNA 1XNRB 2HMUA 2R6AA 4HUJA 2R7NA 4DMUB 1OWOA 1Z0FA 1NUSA 2F8SA 1X1EA 2XWPA 3MTDA 3NBUA 3U7RA 5IRCD 1AURA 5HDQA 4E1AA 2A5GA 2NVBA 3C15C 3NFYA 3KQLA 3RS0A 4HGYA 4GXNA 4N5NA 5IYZB 4JLNA 1WD5A 5DW0A 1TQ2A 2DFLA 1ZWKA 2R1TA 1L4BA 3B6IA 2ZDHA 3UHPA 3UMVA 4A0RA 4JLOA 3KBBA 4MINA 3ZHSA 1WZIA 5IU6A 2ZUFA 3UENA 5JARA 1V37A 2EAUA 4L5CA 1JVBA 2VJKA 4BU1A 3PDIA 3VYWA 2OXFA 1SVNA 4MUGA 2JIMA 4JI2B 2ZIWB 3ROFA 4PSAA 4NBKA 4LV8B 2J5XA 3VU8A 4QD3A 5L6MB 3KUUA 1Z2DA 4DSOA 3DZHA 2BMWA 1L5YA 3TIVA 1SHJA 2QVZX 1FFCA 1FUIA 1L2TA 1DT3A 1N5LA 1JW9B 1VFPA 2GEBA 3PHJA 4KIWA 4QOIA 5DM60 4EW2A 1YQEA 1YR8A 1G9TA 1FYWA 2P41A 4DA6A 3MWEA 3IILA 3Q9SA 4BNTA 1AHHA 1N5OX 3H2GA 3WKBA 2HLDD 3NUGA 1XDUA 1XXHB 4Q9KA 2XW6A 1NYLA 3ZX4A 4CLRB 1C3LA 3NRCA 2GN6A 1RM4A 3BCUA 1Z5UA 1JILA 1JFVA 2PWPA 2REQA 1YOBA 3DOFA 3VVLA 4PZAA 3N3BC 2GARA 1WXFA 1DIGA 2I03A 1LC0A 1OWMA 4V0RA 3MVEA 3AERB 1I4DD 5K0BA 4Z7JA 4GMGA 2UZ0A 2ECQA 2KBEA 1K0FA 1D1QA 1NXOA 1TZCA 3OQ6A 1G4AE 3PNQA 4FW9A 5CLQA 3UMSA 2H8GA 1X7GA 1DAMA 1NVUQ 1VSBA 3DZIA 1DAHA 1G66A 4MDFA 5DNUA 4HVCA 2ZZKA 1YRYE 3IJ5A 2HHHB 1U6KA 1MAUA 4ER7A 2FRDC 3OZTA 5LLDA 3GLIB 2PRZA 3O1IC 1W4BA 5A1TA 5FR1A 3M8KA 3JYPA 2VDOB 3TZHA 4Y9UA 1KQFA 2PNFA 4F7DA 2ZYHA 1T9AA 5B58T 4JR0A 5TT0A 1BE1A 2OC9A 2WBLC 5LBIA 4WINA 1PWXA 5IT4A 4EJMA 1TADA 4P3NA 3PGA1 1JIJA 3V34A 2IPAB 1I13A 3HA7A 3E81A 5D2CA 5HGXA 2R44A 1UP6A 2ERXA 3QU7A 4AMYA 1TGVA 4RENA 4BATA 1UBTS 2WKWA 5CFMA 1K1EA 1E0KA 3RGGA 1GNQA 3PUHA 1G64A 3IURA 4HKTA 1EXDA 1DC5A 2IEBA 3AOGA 2VN8A 1V1RA 4N3BA 3NVMB 5KYWA 4IRUB 4MQLA 2Q21A 1Z4NA 4RKWA 4Z3DA 4YPFA 2O8CA 2VRNA 2QTRA 3RU9A 4P7KA 1IY2A 2Z04A 3H0KA 3IRVA 3EA0A 3G2QA 3L0YA 2I4MA 4L27A 4MTLA 2VNSA 4YMLA 2C4NA 4QOHA 1J2JA 4D4LA 5CH8A 2HWKA 1SBNE 1SXJB 4UBOA 4NFSA 4HN9A 1TT7A 3C7KA 1P2FA 1IZ9A 2GOYA 1K7CA 2H59A 2Z8YM 2IE0A 3LHDA 4YAEA 3UFXB 1HKUA 1UBNA 2DZDA 4OFZA 4E6PA 1NAHA 4ODIA 5HDBB 4EF6A 1J22A 4F2DA 3BKXA 3OJOA 5EUBA 2IZOA 4RKEA 4M1TA 1Z6PA 4KH0A 2VYND 1OKKA 2WFZA 1B4DA 2ZBGA 4Y6SA 5CVUA 2HYDA 1RVDA 3R44A 3WQBA 5KNCD 3ABZA 4LK3A 2PIDA 3M49A 4H1UA 3R6GA 5A6SA 2IZ6A 5EP1A 4BLRA 1YUNA 4NAHA 5KNCH 4EHNA 4EI7A 3L1IA 4YJDA 5AKXA 3USZA 3PGXA 4QDKA 4A0GA 2W7TA 4AP6A 2Z8XA 1Y63A 4PFJA 5I9NA 3J81k 4P0QB 1AB6A 4KQGA 1DQRA 2NZ8A 3PHBE 3P9SA 3MJTA 2Y76A 1XZ8A 5AIBA 2BL4A 1Z7YA 4TZTA 2RBGA 2LDXA 1UMCB 1YSCA 4I1OA 4MUBA 1T9BA 4XJTA 2B3TA 3LCMA 4AN0A 4NEGA 2XCRB 1DAEA 2XBUA 4R1PA 4D8VA 2G1UA 1S3SA 2QMZA 3N2EA 4H6PA 3U0BA 2B4KA 5KKNB 4R1TA 2XVZA 1VFNA 1NHWA 2WMDA 3L9XA 1SXIA 2VWHA 5B57C 1X3LA 4BDTA 4JODA 5CJPA 4MUJA 5DFAA 1Y6RA 4A92A 4RW0A 4BB9A 1A88A 3BGIA 3NTQA 3I30X 2B0JA 3IKJA 5DZSA 1DUVG 3M70A 3T6KA 3ZDBA 3AYXB 2D6FA 5G3ZA 3VNAA 3O0TA 3RVBA 4WJKB 1ZK4A 1HM5A 4GM0A 1DXYA 3G0DA 3HA2A 4NBWA 3NHYA 4ZOLB 1GA1A 2VP2A 1ZHOA 2B99A 1WQ1R 2BEWB 3ECSA 3RBXA 4B3DA 4HX2A 2WUDA 1PJBA 1WKVA 1CFJA 4NOKA 5EYPA 1N0IA 1O94D 3KT6A 4ZO4A 1FTNA 2EJWA 2FZ4A 3WIBA 2B34A 3D3WA 1T0PA 4AZ0B 1JSRA 4MRSA 4IIFA 3OMLA 5ESDA 5LA6B 2BVNA 1T1IA 1KZGB 4GOKA 1E3EA 4J94A 5A03A 2FEKA 4BFWA 1YQGA 4BX8A 5CT9A 2ILVA 3WL3A 1HPLA 1JXAA 2QZ4A 4I55A 3WADA 2AHOA 3Q15C 5F9FA 5E7MA 4M83A 4N03A 2ZSBA 2ZS8A 3NRBA 4HGPA 4BTVA 4FHZA 4H4CA 3EDQA 5DLQC 5ARCA 2Y9MB 3TFWA 3QF4B 2J41A 2J3KA 3F97A 4GLOA 4D92A 2WJ3A 4DUZB 1SQGA 2D13A 5LBTA 1YU9A 2FTKE 1CIJA 4JUFA 4M0EA 2CMFA 1E1RA 1KK2A 3PB3A 4TTTS 2Q9BA 5DGDA 3Q3IA 3VX4A 1RYYA 4FK8A 1JE1A 1NQOA 4XA8A 3RFXA 3ZDFA 1Q1AA 3FOCA 2AG6A 4E3WA 4WNAB 3LIPA 4P81A 4OXIA 3WQSB 3THRA 4ZYTA 2FQYA 3LBNA 1HTWA 4G0MA 5FPPA 1OZAA 3T5GA 3COJA 1NTRA 1GLGA 1M2VB 2XCIA 1CY8A 2W6ID 3VJMA 3N2KA 3WNVA 4R8VA 1VI6A 5HM6A 4TOIA 4AY4A 2HU7A 2C2ZA 1A5AB 4QLAA 4CCWA 5HYVA 4XGKA 5J5VA 1FNCA 1RM0A 1JA0A 4MX8A 4CDMA 1ISSA 2JATA 2ZTHA 5F1KA 4Y6PA 2JEOA 3OTGA 4CM1A 4D7AA 5HUQA 1AS3A 1BNCA 3B13B 1MDFA 1UDCA 1OE0A 1GG8A 2J33A 3BK1A 3FKSD 3FPJA 4X8MA 1M8FA 1QYCA 1LSSA 1RAAA 3EA5A 4H2DA 4M99A 3SDZA 1KYIA 3FCEA 1J25A 5CA1F 5CBPB 4MW9A 2V5VA 3GBPA 3KIPA 3FETA 3PCXA 5EWMB 2QN8A 3PLRA 2ZIEA 1QCCA 1X7HA 1LX7A 4Y6RA 3Q7EA 4JYPA 5AVZA 2VPTA 3O7MA 4JJ8A 1K6IA 1K7YA 4EUFA 4Q9IA 5JH7F 4PYQA 3T9AA 1Q3HA 2CNWD 4KWIA 2DBYA 3I6YA 2VH2A 3GFQA 1DS6A 3QSGA 2I8AA 2Z2ZA 1QRSA 3P9QA 4UZSA 4ZXFA 4FGZA 4BBAA 1T1RA 1NNEA 3PFWO 1BTOA 1CETA 3F1KA 1UJ4A 1G8MA 4B2IA 2IJGX 1XAHA 3SKVA 4EENA 1EP9A 2Z57A 2CZCA 2RHWA 4IRMA 4KYTA 3R5XA 1CP2A 5ALLA 1DTWA 2B1GA 4U7FA 3PVZA 1KY4A 4LRSB 1GCAA 3NDBB 5LUBA 4Q4CA 1NVVR 1CK4A 2RHCA 1C2TA 1W36C 5DWQA 4FFMA 3EDOA 3DE7X 2VZ9A 4LJ9A 2IYXA 2LXNA 1ZD1A 4CCYB 5LNK6 4LJ8A 3BSFA 4BFXA 4JBNA 1L7RA 3NBXX 2PJZA 2F8TA 1A4XA 1Q14A 3N59A 1JHRA 4CQMD 4RA9B 3N2GA 3BIWA 3AUJB 2K7FA 4IDFA 4UBIA 4WNYA 4JB3A 3U7FB 2V6IA 2XX3A 1QMGA 3IESA 4IIHA 2QUAA 1SUCA 1ZWLA 3RIHA 3ZHBA 1OWLA 5HX7A 5KUTA 2BC9A 1JHXA 4C0QC 3FBGA 3LV8A 3OLVA 3KJEA 3TQTA 2XTJA 2VJDA 4O4IA 4EJ2A 4EAAA 4LF8B 1BX1A 1NYTA 1XAIA 2GTPA 4NECA 2JGJA 4MITA 1L5WA 2PZLA 5CDGA 5L4LA 2X13A 3ZBQA 2W2PA 3IHKA 1U0GA 1KPIA 3CPSA 4L75A 5H3LA 3V4OA 3LDFA 4FZVA 1PR3A 2N47A 3C0KA 4GL2A 1ISJA 3HFJA 1FUEA 4LDQA 5FUYA 3KB6A 1Y6ZA 1M7BA 1P1RA 4GZMA 2IE8A 1QO0D 3MT7A 4G81A 4UHJA 2NUTA 1VPVA 3NT5A 2A1IA 2GD0A 4URZR 3QEKA 3QFHA 5B2ZA 2IHZA 1NM5C 3CN9A 3LYLA 2O52A 2PWZA 1ZCAA 3SF8B 3CIFA 2ZYTX 4AP5A 3HC7A 1KTVA 4MULA 1VHJA 4Z4FA 2PIAA 3DP9A 5AKLA 1ZN8A 3LHIA 2IZ1A 2PSSA 3KE8A 2Y92A 4R2HA 4W5TA 2L82A 4J1QA 4B6PA 2QN6A 4BVFA 3R76A 1IBMB 3OT4A 5K3SA 4LMAA 4R1OA 1SGWA 4MVJD 1J8DA 4UXJA 4HQ0A 1QQTA 1A9OA 4FYHA 5EHQA 4DCOA 5IDYA 4H08A 4P5DA 1H85A 2CHFA 4M36A 1ZK2A 1VSQA 2PKXA 3QHQA 4L4SA 3RS2A 1YIAA 3HDQA 1YZ3A 1DZIA 3PA8A 4GC5A 4LOKA 3QZUA 5E6SA 1PGOA 4CLEA 1N7GA 1PVOA 4BEVA 2OGTA 2B8NA 1P72A 2RMKA 3HY3A 2B7CA 4JVNA 4YAFA 1RTTA 3P0JA 4OX9B 3VUEA 1MAHA 5A5EA 3ADCA 5KNDA 2EJVA 3Q3GE 3QX7A 4D41A 4BMSA 1APBA 3CKYA 3GOQA 3RGWS 1LK5A 3NJRA 5HE8A 4LRTB 2IHKA 5LQJA 1XO1A 1D4FA 1Q22A 4KO3S 4UC0A 2BEWA 4GR9A 3X0DA 2EIXA 2PUCA 1VC2A 3LQKA 4Q16A 1NM5A 1T1JA 4PM4A 1GUZA 4MDYA 4RTSA 5M3BA 1T2UA 1RHMA 3C5EA 4GHWA 5F1YA 3RT1A 2OORA 5AM5A 5FOVA 3WNZA 2GVZC 1A5TA 3CEAA 2O8DB 2WZDA 1CEXA 1KL7A 1TL7C 2YWRA 3TVYA 1QP0A 3GNTA 2WWTA 2VP0A 2HRDA 4LS3A 1E1NA 1Z15A 2X5NA 1C7FA 1GPJA 1G7TA 3CY6A 5D3MB 5GONA 4WY2A 3RUCA 3RVOA 1NQWA 3CKMA 3PGVA 4BJHB 5JTTA 3SWWA 3QVGA 3AUKA 2BFCB 2BJHA 1C3XA 3EOZA 1NY5A 3KJNA 4X6LA 5DP2A 3TSWA 5IKPA 3L7CA 1PW5A 5GY7A 4UM9B 3FI9A 1KMIY 2ORED 1ZCBA 4WTOA 2C2OA 4AROA 3K0BA 1QX4A 4TRJA 4DQXA 5A5GA 3W5BA 1OXXK 3A04A 5TLSA 4G4SO 1PZXA 4MYTA 3VH4A 2E1PA 2G72A 2AI3A 3ONDA 4HH4A 6GPBA 1R27A 3W2HA 1ZICA 3L0CA 4HEA6 2W4MA 1XA4A 2ZI3A 4A23A 3ER8A 4IH4A 2A58A 2C2MA 4RL6A 3T7EA 4GVLA 1P1IA 3M2PA 3L49A 1EM6A 3OFVA 5F1PA 5JNWA 4C78A 3WYEA 4KHZA 2I2WA 2XUPA 2XUHA 2VWGA 3W3AA 4L0CA 4PE5B 4B3XA 1NJ1A 4YK7A 3VC7A 1NG9A 4CQMA 1H6AA 4FKMA 5ISMA 4I0WB 5JZSA 2ETVA 4UOQA 4LKOA 3CSDA 1W73A 1KI6B 1OXSC 3MTQA 3ITEA 4PG4A 1SQSA 3FYUB 4YFYA 2W42A 2C4TA 3K2QA 3WGQA 5L3QB 1LPNA 3I4LA 4O8CA 3ZWNA 4TVKA 5B4UA 3C3DA 4J4HA 5AW6A 5IWCA 4EJSC 1W5AA 4A0QA 3U7EB 1NVEA 5ED0A 4DIMA 5KMGB 2PCJA 9LDBA 1QZUA 1UOPA 1VQ1A 1ATIA 1OVMA 2HIHA 3OY2A 4YA6A 4C07A 1DX4A 1SHZA 4TUYF 5BSRA 3TD6A 1B14A 5JJIA 4Q05A 1BCSB 1S9DA 2HSJA 1J00A 3AOEA 5A05A 3TLMA 1UT8A 2PWAA 3COZA 4QT0A 4EO4A 1CJSA 1X1QA 1PG2A 2P1DA 3C97A 3PNPA 1NXWA 2BBSA 2W43A 4NBNA 2O9JA 1AUOA 5ES3A 4BNNA 4CF6A 4IL5A 4FT2A 1FSFA 4GP7A 3FMVA 4KLNA 3TPCA 5JXHA 3JYLA 2PD3A 4RDHA 1ECFA 1O9HA 1Z0UA 2A4KA 1WMEA 2PT9A 3B82A 4H6XA 2VCEA 4FU0A 5B3AA 4DHWA 5LMCA 4MUHA 2RIRA 3CLSD 3LCJA 4R41A 3SVZA 1ISRA 1PD1A 2JLUA 1NP6A 3FFXA 1DL5A 3C1OA 3QITA 2OV8A 4BVBA 1V1MA 2FWMX 5HFJA 2O3RA 5AVUA 1JVNA 4HXYA 1WUTA 3QVGB 3EB9A 1NOKA 1ECJA 2ZSFA 3UT0A 3IOCA 4CTKA 2PL3A 3B9PA 4M22A 1TYEB 2P35A 3AFIA 2ZZMA 1G1MA 4WKBA 1OFTA 1U28A 1QZXA 4TMKA 3NTXA 2PVSA 4FIDA 2O0HA 1XCJA 2HCRA 1TI7A 1PFWA 1RZRA 2Z3ZA 4MV1A 2ZLBA 3PENA 1CQWA 3KFVA 4WLUA 1AM4D 4J0HA 1NLUA 3M9WA 1BS2A 5H5JA 3COVA 3RS5A 3LBIA 1EQ2A 1RRPA 2OV3A 4NG5A 5BVGA 3IPRA 1RRGA 1UANA 3VM6A 2GTIA 2AJTA 2PH1A 2YWEA 1OGIA 4Q48A 5LQRA 4BX9A 1XOIA 1DO8A 3L41A 4E5YA 5LQDA 1JTVA 1XZJA 2V74B 4DV1B 4N82A 5DI9A 3W5DA 4MWBA 2ZZNA 1GD1O 3ZV6A 2UZ4A 1P18A 4KFCA 2A7XA 4C6RA 4Z5XA 3TGWA 1T35A 1MJ5A 4LUCA 4XB1A 5I48A 4TZ6A 1KS2A 2CHUA 1EVYA 5ESXA 3CYFA 1X94A 2XDAA 3K94A 3FBTA 4P33A 1T2FA 4WKOA 3X1WA 1NW7A 5KVSA 2CLEB 1KDOA 4LTNA 4K28A 3W34A 4RQTA 4KXLA 4BLUA 3I4FA 4Y7DA 3AGPA 1ADCA 3IOYA 3KO8A 4I99A 4CKYA 1BAPA 1N6KA 2DCUA 1U2GA 3L4BA 1ZK0A 5HE9A 4AM8A 1E69A 1RIFA 2JHCA 1P80A 2X4IA 4GQAA 3WK4A 3QELA 5A5DA 4R2KA 4EHLA 1ULSA 4ALIA 1HT2E 3KZ1E 1VRVA 2FMXA 2WF9A 3HSKA 4EYQA 2PY6A 2QVYX 3TXXA 3WYGA 1ZISA 1L1EA 3NO4A 1F5SA 3A6EA 3LBHA 4NR0A 3TLGA 3LC0A 1M1NB 5JLAA 2AYXA 3CMMA 4XIIA 1T9DA 3K72B 1RYEA 5KCMA 3WXMA 4E5MA 3VZQA 2JG3A 3BMQA 3GGCA 1OXVA 1WPRA 1ITZA 3QKTA 3R5HA 2DBVO 4EZEA 3DBIA 4A73A 1O94A 2RGDA 2HK7A 3I8XA 2XNJA 3ND9A 3CR3C 3TZEA 1X6VA 2ZREA 3V3KA 5CDFA 1I1OA 1QE0A 2Z95A 4US0R 5JAMA 3KYDB 4GEGA 3Q88A 4K9LA 5FPYA 2ATEA 4R1NA 2IYWA 4WUVA 4HN4B 5GJVC 2B36A 2Q62A 4D6YA 1YE5A 1ND5A 3GV0A 1A2BA 1X7WB 4EY7A 2AZMA 3SPXA 3DWGA 1UKZA 1GM5A 4ZYYA 2XRFA 4U63A 4Y2XA 3BXZA 4V2IA 5SZJA 4JI7B 1I1QB 3NH6A 3R6LA 2R6FA 4UTXA 2ACEA 2XUIA 3ZGVA 3TRDA 3GB9A 2HJWA 2FWBA 5TS2A 3EUAA 1YR9A 1K88A 1BVRA 1QFXA 1J97A 1NKTA 1QS0B 5E7JA 4ZAFA 5G1NA 1EP3B 5A0FA 5E2IA 2R8YA 1M1YA 2CXXA 1HO3A 1U11A 3HLYA 3JYNA 4IIGA 2WF5A 4OG2A 4C29A 1D5CA 5FT9A 1W48A 4C4OA 3EASA 3H99A 1RWWA 3E6AA 4DL9A 1H4QA 4MR7A 4JCOA 4LMRA 5GM1A 2PEZA 4JI3B 5BUQA 3IDSA 4AZ3B 3QG5A 4HWPA 5JAQA 4PCAA 1H23A 4KQHA 2P5UA 4NK5A 2JGAA 1I7QB 4ME6A 4GE3A 5FWDA 1CRQA 1CZOA 1VECA 1WMSA 1JIVA 4UEWA 1P9NA 4PLFA 5I9BA 2JFHA 2XZLA 2BEUB 5DOZA 1XTVA 4I8XA 1KEZA 1J56A 4FGUA 4CDNA 1UKEA 5KNCA 1OXBB 4AIRA 2CZGA 2RCYA 5CDFE 2C4HA 4BXOA 1QH0A 1U8UA 1CV2A 1OA0A 3G5AA 3PXUA 1OBCA 4NDZA 4DIBA 3GJSA 4NBLA 1NVBA 4XI9A 4C0XA 1X7DA 3OIYA 4FOPA 5L53A 1Q57A 5DSXA 3UATA 3QPCA 3GRCA 4BO9A 3G82C 1RMTA 3OQIA 1PI3A 2YHBA 3QW4B 3A9UA 3TLGB 3U3ZA 4ZFNA 3LPNA 4O59O 1GTJ1 2PSJA 2B83A 3NOOA 3QOWA 3L6CA 3LFUA 3ODGA 1W34A 3LI2A 5HA5A 3WGHA 5AICA 2C2BA 1XTIA 3PUYA 5KSPA 5FNVF 4PXAA 3W5VA 1CY1A 3FXAA 2DTXA 2Z43A 4QPDA 1VL0A 3VU0A 3QE4A 1NUPA 2O2SA 3REQA 1B0ZA 3QVWA 1Y48E 2VHTA 1YJ5A 2JC3A 2BEJA 3K31A 4MGZR 3AX6A 4MS1B 2WYVA 4OK5A 3V7YA 4XWKA 2YQZA 1AMUA 3EQ2A 2ABWA 1EDBA 1T91A 1TZJA 3CKKA 4QULA 821PA 5KNDH 4YJ2B 1JEYB 3BXOA 5E3IA 1H93A 1MZPA 2ZUSA 3VKGA 4HLCA 3PQEA 1VLMA 4ARZB 1K2WA 1OPRA 4TVOA 4WAUA 4BPRA 5CDUA 2VPPA 4QRIA 3FNBA 3QPUA 1YI8A 3C5VA 1CUDA 1ECBA 2ROQA 2WHYA 3L4EA 3M1LA 3FKJA 2QT0A 3ZS8A 2VEDA 1QXSA 4K9PA 3V1YA 5EYPB 2RHHA 2VT3A 4HMPA 2FSVA 3WLSA 1BX0A 4RZXA 3K6RA 5AKHA 4BN5A 3A7EA 3KKLA 6NULA 4P31A 1JHYA 2AUMA 2P40A 5E1MA 2IIBA 2BOVA 3I04M 1E3MA 1SQ6A 4AF7A 1W4RA 3MYRA 2WHQA 3FOFC 3FOBA 2B9EA 5J4YA 3ICQB 4MAMA 2GEKA 2RH8A 4AZ0A 4BKUA 1NWHA 2B4YA 4KPGA 3QJ5A 2PLRA 2TMYA 2OPBA 3SCZA 4I8IA 4JB0A 3ZWYA 1VKJA 2HWWA 3K2IA 1GGMA 1V3QE 2AKAB 2NWQA 2Q8NA 2WU4A 3EISA 1GXSA 5LB2A 1Y3IA 4J90A 3RVKA 5T4EA 3AEKA 4AP9A 2QBYA 1PL8A 2OESA 1OY1A 1T2NA 3M83A 2DWQA 1E3LA 3OJWA 1H9AA 1R15A 2XV1A 5K6TA 1U7ZA 4UNNA 1C0LA 1N75A 3ZZUA 1GAXA 4KQEA 2IEZA 3QPBA 1I3CA 2PH5A 2QPTA 4NCNA 4FDTA 3ULKA 1FFYA 3V8EA 4ZRMA 4L0MA 3D8RA 5B7QA 4A8PA 2Z58A 1BXGB 1SEPA 3VX3A 1MOQA 4IGAA 4LJYA 3ZY5A 2R6DA 2QTAA 3KK0A 3QEAZ 2AI1A 1Z5OA 1F14A 3L07A 2A9VA 4JSYA 1LFDB 3K6JA 1E1DA 3P4XA 3TSCA 4YAIA 4WWHA 2AW5A 3FTFA 5KYXA 4DR6B 3VR0A 5CAEA 3QIVA 1PIWA 1GCIA 3H5VA 1F8GA 3VJLA 1XIVA 1ZLXA 4JP2A 3RIMA 2FVXA 3FPHA 1E63A 1V8DA 4KDRA 3W8EA 3RRMA 1XNJA 3NUQA 5HFAA 4GKJB 1ZNXA 5TQ0B 5DHPA 3IIIA 3IVXA 3V7FA 4NSNA 3AVYA 4UUBA 4CUZA 2DGDA 3U16A 2H4XA 1CD5A 1HYHA 5L4SA 5FTMA 2EYUA 4KU4A 2ACWA 3OP4A 1BMFA 4IX9A 1GQSA 1MO2A 1QFZA 1VCIA 2D0DA 3R5KA 4JUBA 5HM8A 3AJDA 3DCYA 4HQNA 3C4VA 2NTVA 1P8AA 4FTWA 1BVHA 3M3HA 3BJZA 3ZXYA 2V96A 3VSDA 1JFSA 5TJHA 3CISA 1IVYA 3RJ9A 2QGFA 1OX5A 3CVVA 1TPZA 2E3JA 2P69A 3QP9A 3HR7A 3QQPA 4ZVKA 4ZAGA 4CCSA 5FBHA 4DCMA 3ZD7A 4RK6A 1N8NA 1E8MA 2CHEA 4XOIA 5HIMA 3HKEB 4HDRA 2GTHA 4G5OA 2AFHE 3VFDA 3I1YA 3H5AA 1KWGA 5EI5A 3IJPA 4OQLA 2YN2A 2Q4DA 5JCOC 2IBTA 3AKCA 3GW8A 1JIKA 1DJPA 4H15A 5AI6A 3BOSA 4PQGA 4XH9B 1QC5B 3MTJA 3EIEA 3GMTA 3HR8A 1G60A 2ARKA 3GJ0A 4GVXA 3HFGA 1KQ3A 4F5ZA 5F5LA 3IQIX 4M8SA 2P4SA 2W6QA 4B3JA 1U0OC 3SC3A 1L1QA 4GI3A 1EM8A 2DT8A 3L82B 3O4HA 4A4DA 2WJIA 3ZUGA 4QO7A 3WMXA 5KQSA 1CDOA 5ALOA 4DCVA 1KJQA 2P30A 3FMFA 2MCFA 4UPDA 1RD4A 4ZYVA 1RMQA 4YALA 2HIAA 1ZPDA 2FRXA 1XL0A 4QARA 1FU8A 4ZQCB 5DIFA 1MT3A 4MQFA 4BQOA 1QFSA 4IJWA 4TTVA 3FYCA 4EHFA 4LHVA 1Z39A 1K63A 4DJAA 1Y4ZA 1ZD8A 3C16C 1W9MA 3QKWA 4ER3A 1EFPB 2FV8A 4CPDA 2ZWPA 4BWFB 3STTA 1OOEA 1U81A 2J3DA 1TIKA 4GPTA 4LZPA 4XARA 2JFGA 2QE7A 4RZIA 1U9JA 1ZM2A 1RYHA 1L7DA 4P6VF 3PC8A 2D7JA 1XHFA 2YASA 2YH2A 5I7WA 5AUPB 2P75A 3AR6A 3GZNA 4O25A 2C5EA 4HZIA 1H2EA 1NT2A 1G8GA 3NDPA 2NO7A 3HLTA 4EFMA 3EOAI 3GL9A 3JYQA 4Q34A 1BHSA 4KXVA 2C77A 2XNKA 5J4HA 1Z47A 2XYPA 5JFGA 4G86A 1EVIA 3QKIA 4PRZA 2MU1A 4IVQA 5JALA 1XTTA 3K09A 5CVCA 4GDMA 3AW8A 3BSSA 4FCCA 3WYAA 4V1CB 5JC8A 3IBSA 3TLJA 4PAWA 2Q6LA 3SLRA 3IQWA 1T4CA 1YA8A 3B1VA 4DGSA 1Y1SA 2PS0A 2CDNA 2F4VB 4B44A 2O2XA 1VPLA 2EARA 1VG1A 1JU3A 3G02A 5C18A 2H08A 4I08A 4D96A 4COOA 3F5SA 4URYR 3AJAA 2BGKA 4YROA 4K03A 1PNOA 2P9HA 1R0YA 2D3WA 2FLKA 4GEKA 4II2A 5A4KA 3U6BA 2ZM6B 2X19A 4KK3A 4BTEA 4OHKA 1FTSA 4X8OA 1AQUA 4W1PA 5C1OA 3SKYA 5DHTA 4OXYA 4TL6A 1EWYA 4IKEA 1U8FO 3BAZA 4FEAA 5KKAA 3EGDB 5BMOA 1RW4A 3STUA 3R77A 2V03A 1KJJA 3UTDA 4L7QA 2RKOA 4O4HA 5ES4B 5INTA 4AULA 4XTRA 1GNVA 3O1LA 3OX1A 4UBKA 5F7JA 1AZSC 1G8KA 1MJHA 3G8BA 3BVPA 1XALA 3UJHA 3OF5A 2NXWA 2BEKA 2PMCA 3TIFA 1J0BA 1OMOA 2QT1A 1RJFA 1YAHA 2NACA 2QN1A 3HUDA 2WWRA 3WTBA 5FL3A 1Q7RA 5T6BA 3ANSA 1KFJB 1XF9A 2E85A 4LXTA 3HJRA 3LUJA 1CY4A 4L22A 1TUEA 4MVJF 5HILA 1C3VA 1J5PA 3JQBA 2GZSA 4IWYA 1Z7WA 1B2LA 2VJQA 2B69A 1D5WA 3KV3O 3RK1A 3UK1A 1VA5A 4HRXA 3D4PA 4I5EA 1E5XA 2UUCB 1DCKA 1XRQA 1X1AA 3M5CA 4X8HA 5CIQA 3WGVA 4L74A 2EFDB 1J1IA 1O95D 1J0CA 1CLEA 1QORA 2QM0A 2DU8A 2RJ3A 3EZ2A 2Q6OA 3MBOA 3G9TA 4KWEA 3AI2A 4M8IA 3KAKA 1S2OA 1TZ2A 2CXRA 2HHAA 5EOVA 1OGYA 1U3VA 3PGLA 2I6XA 4JOCA 1R88A 4M0MA 1QIMA 1YR1A 3EVCA 2LD4A 1WDTA 1H2YA 1VYVA 4LJAA 1DFHA 1SB8A 5DPMA 4BE4A 2IX9A 1T4CB 2W98A 2Z5FA 4HLNA 4TQAA 4QJ5A 4ZVQA 4DDVA 2AOXA 2Q5IA 5BV1A 2R86A 4NDAA 1J0AA 1H6DA 2OUKA 4ZA2A 5ED4A 4EY6A 1JA1A 1SC9A 3BWXA 5HTOA 3GT3A 1PX2A 4FYJA 1M74A 4RV5A 1YZHA 5EUMA 3HWWA 3OFSA 4UMEA 1EP1B 1IEQA 1QO0A 5FWXB 4YRRA 4R2LA 5F9MA 4C76A 2YRXA 3E58A 5JSQA 1N4DA 3ZCPA 3W77A 2KYRA 4F5YA 1E94E 3FZNA 3KL4A 4RTQA 7REQB 4QL3A 1VLHA 3ESXA 3HKBA 4QEDA 5CJJA 2HSGA 1BHJA 4TRNA 3TZLA 4B47A 1NLFA 5CBKA 1XA3A 1S4MA 1PS9A 2WG0A 4GYYA 1HDCA 3EF0A 3F0TA 5EJFA 4X1YA 2AR0A 1QZZA 2FFQA 2OORC 2C84A 1E3WB 1GGKA 3QU9A 3TOSA 1PBNA 3NKLA 4JYCA 4K88A 5JSUA 4LV6A 1EH5A 3P0HA 1IATA 5D8DA 1OV6A 4RIFA 3PUKA 2XT9A 1J8MF 1G3QA 5ALXA 5FI1B 5IT5A 3QQ5A 4AVYA 2VKTA 3OE5A 1T9HA 2C57A 5EZYA 1QQAA 4OU5A 2BFDA 3DF9A 3FYUC 1PFQA 4Z9AA 4DBLC 3K0FA 2G6TA 1QIEA 2QZ9A 2QR3A 2C4KA 3K8ZA 3LQ2A 3EDMA 2GKSA 3C4JA 4HADA 3GJRA 2FUG1 3TFQA 2RGNC 1USWA 4P1ZA 4RV4A 1DLJA 1NJSA 4L78A 2JDIA 4J76A 2YINC 5SYAA 5MN4A 3CH4B 1G98A 2YX1A 3NHSA 3FGZA 3GLGB 3EVFA 1V48A 4EA8A 4ZOQI 2BH2A 2ALJA 1BDMA 2GZAA 4QO8A 5A06A 5LN1A 5EPOA 5LP6F 1GGFA 2HWUA 3TEMA 1ML3A 4GQIA 4Y9DA 4YAUA 3OC6A 5LOVB 3VOTA 1LDEA 1VE7A 3OOYA 3SS7X 5LJLA 2GHRA 3JD2A 1TA4A 5CFRA 1SCJA 3EEQA 3PIRA 1D0IA 1C3JA 2Q2NA 4JLKA 2BJWA 4ZOLA 5FR2A 1EX6A 2I9PA 3FF4A 2G67A 4IV5A 3S68A 4BQIA 1RYDA 3IQGX 4MHSA 3DAYA 3GLSA 1Z3IX 4I9GA 1J0XO 1N1MA 1W29A 1C8LA 1Z26A 1ZGZA 4M8LA 2D2IA 5LA6A 3D2LA 1CYDA 2VZEA 2WUWE 4UTNA 4LZWA 1R6TA 4AJ9A 1AK9A 4K8OA 5AVSA 1A77A 4C7JA 3UMYA 3MRTA 2C07A 3GLGE 2IYPA 1R2QA 1LPSA 4EQ6B 4PQEA 3S1AA 1TTPB 5DLEA 2WSSA 1PR2A 5BWNA 1G291 5KC9A 3AVQA 4RD1A 3MFYA 1KOJA 4FEGA 5G0TA 3RO7A 3NM5A 4IJ6A 3NBZC 1J21A 4D6XA 5TE9A 3LOPA 3JQFC 4KBFA 5DM1A 2QTVA 3EGCA 2QJRA 1D7OA 2EGUA 2VTDA 2YTZA 3M34A 4HK4A 3KDSE 5DHUA 2FZLA 1UK9A 4M0FA 1ISGA 2EFEB 3S28A 3GLFE 1FXWF 3IBGA 4WMLA 5TT1A 1J7JA 5C53B 3RFFA 4DADA 4JFRA 4ND6A 3KPJA 1PT5A 4TWAA 3ANLA 4G09A 3ZBUA 3PHLA 1WZEA 3ORHA 4XCXA 4AK9A 5J4LA 3ZLTA 3OTQA 5EAIA 5LYJB 4JLPA 4MVXA 1E2IA 1IHPA 4FCVA 3OFNA 1D1PA 2YXEA 4YP7A 3Q2OA 1JIQA 5T4BA 2O5EA 2EJUA 3D4OA 4M88A 1VYTA 1BROA 2FN8A 1MPTA 3DOEA 3TDNA 4J1NA 4EJ0A 2PKQO 2R65A 4Q19A 5GWXA 3PE4A 5TPZA 4J8PA 4EA6A 1I94B 3ENQA 2Y1EA 4FX5A 3SM9A 1IRXA 4PSUA 4LC9A 1TLLA 4HTFB 5CNJA 1WIWA 2HK9A 1RM5A 2FZ5A 2IOQA 2VPXA 1CF2O 3FG9A 1HBJA 2PGXA 2XJ4A 3FNIA 3I01M 3MS7A 4OHOA 3PXGA 3ZIUA 4ENRA 4ZZIA 5F9HA 3PRJA 4YDQA 3E48A 1U0TA 4UHFA 5LPNA 3PX2A 4ZO9A 2JH3A 3QVSA 4FYMA 4Q37A 4LBVA 3L8MA 4LZZA 2JFUA 1TVEA 3JD4A 1VE3A 3ER9A 1P9WA 3GCXA 3UKDA 2B2XA 4X1KB 5DASA 5B6IA 2FSVC 1MAAA 4HAZA 3I72A 1TK9A 4BOYA 1WXXA 3CLUD 5CFQA 1E6LA 3FNQA 5GINE 2NTNA 3GRYA 3D6FA 4UBMA 3FR8A 4OGGA 5FUBA 4WI1A 4D79A 1TMKA 3JWJA 3OOEA 1G17A 1L8QA 4CNBA 2WF6A 1OA1A 4GI5A 3RS4A 4X94A 3T4PA 4BO6A 3E23A 2FN3A 3B7WA 5TPWA 5JBNA 1KMQA 3JU3A 3MD9A 1U3GA 3FDXA 3ZDAA 3BORA 4NESA 3R5SA 4QXAA 4JLDA 1QLHA 3K35A 4WIAA 4TUYB 3X1MA 2C1XA 4OQNA 4TWIA 1ZNQO 2JAHA 3MT0A 4HDKA 4YVFA 1VMKA 1AZLA 1CWUA 2QD3A 3HVJA 2HF2A 5D87A 2YXBA 1IAQA 1O77A 3K5WA 4X7BA 1OWNA 1ZMOA 3JZDA 2HPZA 3LF2A 5EIFA 3I23A 5EJEA 4HXEB 4QQKA 4JLUA 4Q7EA 3HA5A 2XHZA 1LF0A 4KH1A 4JBXA 4RDCA 4PG7A 3W7AA 2CK3A 1E92A 2I3GA 2Q2OA 3RBAA 2ZSKA 4LW8A 4LCJA 5K8LA 3GJ6A 3ODPA 2WKSA 2ZRPA 3PPIA 2EXXA 3DL7A 4QOEA 3LFHA 2Z0MA 4KI0A 4RMJA 1SWWA 3HB9A 1JJFA 5C1IA 2C9OA 4LZAA 4C0LA 1WHSA 4D97A 1J1UA 1ZRSA 1FSPA 4D9MA 3ETCA 1C8BA 3AR4A 1N5IA 3L6UA 3MQ4A 1EFHA 4GKBA 4MV0A 1G5PA 4GPZA 3PPVA 3JR7A 2JS7A 4JHXA 1G4HA 3CVOA 3QU2A 1OLOA 4MEAA 1C2YA 3NEAA 3UJ3X 2W2LD 3DB2A 4P3OA 1KZ9A 3ROGA 1L5SA 4ZI3A 1XP8A 1W1UA 2GFQA 2Y4OA 5CT6A 3EY9A 4LHWA 3D2CA 5FBKA 4BBZA 4ERXA 1W7AA 4AX4A 2XTNA 2ZBQA 2VDWB 5K0ZA 1FUYB 2FDCA 3AVUA 3LHKA 3UT5A 4QTXA 1V3UA 2VXBA 3GRUA 5M7EA 3DHYA 4DNFA 3EFEA 5CVJA 2DMRA 4ILEA 3D6VA 1C50A 2N9UA 3OPQA 5CW2A 4D6PA 3OQIB 4GMXA 1N6IA 3LXUX 3AUXA 1WSWA 3TR5A 3X3HA 4OFXA 3GGJA 5BV0A 5JCZA 3W8FA 1NASA 1E5LA 3FHJA 4TTSA 3S2UA 2GCPA 5JPCA 4QGBA 3UPDA 4AURA 1SUEA 1U0FA 3W5UA 1VL6A 4LYAA 4C6TB 3CLTD 2GO7A 4U2CA 4G1UC 5DBHX 5U4QA 2FQXA 3ZKWB 1YF3A 3L1HA 3QEBZ 5AVXA 5B3LA 3ETJA 3OQHA 1NMZA 3DW3X 1M2NA 1PQ4A 1NW9B 1VE1A 4IHQA 5JNUA 4KTVE 1AKEA 3U3KA 1OASA 4KRFA 1GZVA 4W1RA 3DTTA 3F3MA 1MC1A 5AW7A 3NANA 3W8DA 5D51S 4YMHA 4OGLA 4L0DA 2VBIA 3D6HA 4CFSA 2A0WA 4JKOA 4AO8A 5CDHA 2CMGA 2QUKA 2R6HA 5IAOA 2OP0A 3QVMA 4C01A 1PTJA 3GARA 2PBZA 1XKQA 3LIIA 4X3OA 4DA7A 5M04A 2GYUA 5E6UA 4PGFA 4JXZA 4QU0A 2PCLA 3QLUC 4YV2A 2WWHA 5IVHA 4JH0A 1DJQA 4BIIA 3SJ7A 2IDKA 3A9TA 3CTPA 5AK3A 4YWHA 5JJBA 2NAPA 1KNXA 5JSFA 2DR2A 4WJLA 3O91A 3C6YA 1RJ9A 3UB2A 3CBQA 3GDWA 4K0KB 4LY0A 4QXRA 2P2LA 2R7KA 5ENZA 3RODA 3VPXA 3HBFA 3AI7A 3BX1A 1E2PA 5EWJA 3AL3A 4R16A 3X1XA 4A0FA 4E88A 3BKWA 5K4HA 1YVPA 1NBEA 2BP7A 3B1XA 2AN5A 4OIMA 3UAGA 1EK5A 2IOHA 4LG1A 5IXSA 1NDUA 1UKBA 1VLLA 3JAWA 5J58A 1FP6A 1ODIA 2Y0BA 3FPKA 3ONVA 4L16A 3HXQA 4OUDB 3RHFA 2IYEA 2C42A 2I2DA 5ALGA 4R2WA 3SNKA 3TLKA 2QG9A 4EK9A 1SU8A 4PX2A 3TB4A 3ZGNA 1M67A 5FUMA 3TBKA 4LXYA 4MGKR 4KMRA 3L40A 4NCKA 4MGHA 4B2YA 3D3WB 1NNLA 4IDOA 4TQUS 1Q84A 3DBRB 3BDVA 5F52A 2OV2A 2WAXA 3O9ZA 3W0LB 4DC0A 4ENSA 3QIAA 4RSRA 5AM3A 3KOOA 4OGKA 3YASA 1HZJA 1PZMA 2IXFA 2CUTA 4LMPA 5C4GB 1P19A 4Z0PA 4XQ9A 1MCZA 1OZ0A 3WHPA 1O97C 4ZGWA 1KDRA 2IHTA 2ZRCA 5CMLA 3LW8A 2NQ2C 2WW8A 5BV2P 2R97A 2XCTB 3FSEA 5JEEA 4RWZA 1SM4A 1SXJD 2X5JO 1JQLB 1SD1A 4WW0A 2XKJE 2OV6A 1KQOA 2E49A 3HYTA 3RFCA 1X1RA 3JQDA 2QRJA 2ZAOA 3AR7A 2VPZA 3M6WA 1GPAA 3ZDDA 1OTXA 5CVEA 1U5CA 4X00A 3T5BA 4BAUA 3OTWA 5CLJA 1UOEA 4OH1A 3BL8A 3BULA 3DMRA 4C7XA 4MVJM 4MI1A 5TVKA 4RFLA 4TXLA 4B3SB 5C51B 3P26A 2FFJA 2O2IA 1YE3A 2QLFA 2QKYA 4US2R 1Z25A 3IV9A 3QVUA 4DEYA 4NAUA 1K3FA 2ZSUA 3V1TC 1WCIA 3U31A 2XUDA 4L73A 2IHYA 1EFPA 1T5OA 3MUFA 2V7UA 2ZW9A 5B64A 2DSTA 5EHIA 5JOQA 2YNMC 3GX1A 4E03A 3N8HA 5DCLA 4RULA 1KEVA 3MC1A 1A8UA 2IU0A 2HFKA 4C9BA 1L0BA 1Y3FE 2PJRA 1FNNA 1V16B 1PS8A 4B8ZA 3QWHA 5HHTA 4AWXA 2GDZA 3V4RA 3CLRC 4FKZA 2C5BA 3VDXA 4BX2A 1QHHA 5C3MA 1N78A 1CUSA 3ON5A 3FFAA 3OE1A 5ER9A 1A82A 3FNFA 2HA3A 2HSZA 3HDHA 1DCTA 2ZQ5A 1TKBA 2OGZA 4INAA 4IHJA 4JLJA 6YASA 3HTXA 1U99A 1TM2A 5I7UA 3VRHA 4JP8A 4RF3A 3ZU2A 2HA6A 1LPMA 1DC3A 5EHZA 2F1IA 1N5JA 4WK2B 4D82A 4LMBA 3PC4A 3HSSA 3QPVA 4L8YA 4YWJA 4X64B 1YBHA 3DHVA 4RFSA 1U0EA 2BEVA 1UK6A 2IDZA 3OIVA 2P0AA 2B6NA 1NJ8A 5E7QA 4O0LA 2JZOA 3DEAA 3LX6A 3NJ4A 4Y1RA 1GUDA 4R1LA 4V2UA 4KE6A 4PLGA 2H54A 5HZGA 5B4TA 3TZBA 3RJZA 3OI7A 1AUVA 4QXQA 4M38A 2QW1A 3C3AA 3JWGA 3T3PB 3TG2A 4NRDA 1OAAA 3FPLA 1D2CA 1NI5A 3ND8A 2PWYA 2ZFUA 3M6FA 5KTTA 2VPIA 4NU6A 3LW7A 4IDNA 3EG9A 4YRFA 3S40A 2JD2A 3CPJB 1CDEA 3JQ9C 2ZXFA 3PC2A 3T7KA 1XZNA 4L8LA 3U3MA 3RQIA 1OAOC 1ZH0A 2MWMA 3D64A 4CHTA 1KNQA 4MVJP 4WEQA 3WFIA 3F96A 4ND3A 3EHEA 1ZRNA 1BJTA 1Q1GA 1KO5A 1E2HA 4O3FA 3DG9A 3KLBA 5JCXA 1Q74A 3L7JA 4NS1A 4L28A 5J23A 2YZMA 3MQ2A 3THWA 2R00A 1V3TA 2XGGA 1N2BA 3ZCQA 2AEJA 3FW1A 3IJEB 1SXJE 4HVAA 2XMZA 4GAEA 3UJNA 4MUMA 1K3UB 1Z06A 3EH2A 1RFLA 2X6QA 3G2PA 1H94A 1I33A 1JR3A 3R6DA 1C7QA 3E3OA 3DAHA 5TY0A 1CUCA 2VHJA 2WM8A 3MK31 2K6GA 4AYWA 1XYGA 2FRDA 2OHXA 3GPCA 4IWXA 3B1WA 1C81A 4CT4B 3RTBA 1QKJA 1JWBB 1T43A 1I6MA 4LBZA 5AKZA 3QTLA 4ZREA 3CZAA 4GOLD 5JNVA 1OBVA 3RD5A 3BGDA 3V00A 4RTNA 1XTSA 2QVGA 3AH8A 3WJ2A 4COKA 5JMOA 1XRSB 1ZOLA 3R0QA 1D1TA 4LISA 2QTVB 3HLKA 3N6VA 2ZE8A 1ZW1A 1PP4A 1ZVMA 2F43A 1KSHA 2WG2A 1SBCA 1GZSA 1C7ZA 4BMPB 1Y4UA 4Q93A 3T5PA 1SKQA 1M6WA 4EHBA 5BW4A 5LL6P 5FWYB 3BWDD 2ACKA 2XYVA 1IZYA 1PG5A 1PRYA 4CEJA 1TDJA 2PMWB 3NTVA 3GG9A 4KMSA 5E6SB 4EHJA 2H4FA 3K70C 1WBJB 2Z6AA 4MLCA 1IHUA 4G0ZA 3EIXA 3KXKA 4YY3B 2VQEB 5TVGA 3RUEA 1QU2A 3KYCB 4Q24A 3ZWKA 1VLZA 1GY8A 1SK8A 2R2GA 1JJIA 2IZZA 3QE3A 2GJ9A 1YS9A 2GZ3A 1QH8B 5EJMA 4QLBA 4WGGA 5T3UA 4ARZA 2EYQA 3F4BA 1RLMA 3LQ4A 1DEAA 4DLRA 2W2VA 1XQ9A 2LKDA 3B7PA 1AE1A 3WL8A 3ASYA 1NGSA 3IXLA 1KP3A 5K03A 3OKCA 4AWAA 3WDMA 1J9ZA 3ZCTA 2OCYC 1GAEO 2IYLD 2YJ3A 3VBCA 5JTUA 3NT2A 4NV3A 2NZYA 2DR3A 4J0QA 1W5EA 3FVVA 3TYXA 4RHXA 3AP2A 4JELA 4ZOAA 3O83A 3W2IA 2J30A 2PBRA 1Z68A 3A1NA 2RKBA 3WDSA 3MBIA 1EQUA 4MQ6A 3QXCA 4AG6A 1ML4A 1GA4A 3L5OA 5A02A 1EESA 1YCFA 3E4CA 3V1KA 1KIFA 2XB9A 3WKCA 1ZM4A 1PKXA 1FSSA 5ELLA 3ZZTA 3ICVA 2B21A 1KFCB 3LA8A 3MAAC 4CLHA 3ACCA 1RDFA 4FZ5A 1H8EA 2J7KA 3ONEA 3FZYA 5FBWB 3PL1A 2B94A 5HZKA 4D26A 3AM1A 2VAXA 1B2RA 3EHDA 4I4TF 3DMNA 4DCSA 2B4AA 4J43A 1XCLA 1AV6A 4JI0B 4LAFA 5CA1B 2QG6A 1OYVA 4JMPA 2QJOA 3F7NA 4MPPA 5U4XA 3RFVA 4D8WA 4WN9A 2GN4A 2PNJA 2R5NA 3IE2A 4OUDA 3FYDA 5KYYA 5IAKA 1B26A 2WAAA 2OGWA 1XTUA 2K87A 2G09A 4KEAA 1NVVQ 4F8YA 1EJ2A 5JFOA 1XQWA 1U90A 1M1NA 5D1NA 1CJVC 5EIWA 3ONNA 2BMFA 3U4HA 1DTWB 3TM4A 3G7UA 1EUDA 2G40A 4XX0A 3HY4A 3W7VA 5JS8A 1O95C 4FWIB 3HB0A 1R4MA 1GKYA 1EHCA 4CG3A 5BV7A 1P4SA 1DQNA 1T6BY 1LDGA 2WYHA 4Z0TA 5J2UF 3NC4A 1OHHA 3OX4A 1D6SA 2IW1A 1HE1C 3ZVNA 2JIZA 1M75A 1DKOA 1QR6A 1AB5A 4FJ2A 4C6HA 1QLJA 2L18A 2BZ1A 3SK0A 1SQ5A 1X9GA 2HBQA 4J16A 4JGBA 5LLSA 1KAGA 1NXSA 5AVQA 1QX3A 2CVOA 3D6JA 2D0PB 3OPXA 3ORQA 1GSOA 3PFNA 4WNCA 1X7WA 3S1LA 3P27A 4EYSA 1P7VA 4HT3B 3VO8A 1R37A 1W88A 4O2BF 4NYIR 1DELA 3BDAA 5K3AA 5IJAA 4RZ3A 4NZMA 2H9AA 1AKUA 2QVXX 1QYXA 3ZZ1A 1O0SA 4RSHA 3NCHA 4ERNA 1NLMA 2F90A 3ZJ5A 2HAEA 1SUWA 3GZJA 5F3WB 1UAGA 5JI2E 3R0IA 2B35A 1X38A 3ZU5A 5DCWA 4YJHA 2F7SA 5DM4A