4UMEA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion and kdo molecule
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
HMNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
total genus 62
structure length 174
sequence length 174
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umeA00
1WVIA 4OFZA 1SWWA 2EATA 2WF9A 3QU9A 5AI6A 3QUQA 4EX6A 1ZJJA 2AUTA 4QQFA 3N5KA 5ALVA 2R8XA 3KZXA 4B6JA 3N8GA 4QJBA 3KBBA 2C9MA 3OCWA 3NUQA 5ALWA 2YJ6A 4Y2XA 1U7PA 1VJRA 5AVRA 1RLOA 4HGQA 4XOUA 1NNLA 4IG4A 3AR7A 4Y2QA 1O03A 1TE2A 1TJ3A 4FFDA 2HHLA 3DAOA 5AI8A 4EELA 5A3QA 4J03A 2I7DA 3E58A 3OCXA 4JB3A 4O8CA 4FYPA 3IB6A 5AIAA 5AM0A 1CQZA 3QU5A 5ALSA 5AW7A 2FDRA 4UAUA 2FI1A 5AI9A 1L8OA 5ALZA 3QUTA 3L8EA 5AK3A 3WK6A 5ALYA 3U7FB 3SKXA 3AR2A 5A3RA 5ALQA 4YH1A 3B9BA 3WKBA 1Z4MA 3RFUA 2BDUA 3WK9A 2WFAA 3AR4A 5AI5A 4C4SA 5AW8A 3N07A 4GIBA 1WR8A 1U02A 4UMDA 3L8HA 1WZCA 1RQNA 5ALMA 4YCMA 2B1QA 4HYTA 2HF7A 1RMTA 5AKKA 3EF0A 1Z4KA 1L7PA 4YCNA 2D2VA 1QQ7A 3QU2A 3AR9A 3PCTA 3UM9A 4ZEWA 3ZWKA 2ZBEA 2I6XA 3AR8A 5AM5A 2NYVA 1AQ6A 2I33A 5AW3A 1L6RA 1WPGA 4XE5A 3J7TA 3ED5A 2IOFA 4YIHA 4BX0A 5ALIA 4CF5A 4JDPA 3B9RA 4G63A 4G9BA 5AHXA 5AK4A 2R8YA 1RRCA 4IFTA 5FP0A 3MC1A 2RBKA 1Z4JA 5IT4A 4CF3A 2GMWA 4J2TA 3SKYA 2CFRA 1EK2A 3ZVMA 1XPJA 3E84A 1Z4NA 1EK1A 4F71A 3FVVA 4CF4A 1J97A 3KDPA 2YY6A 2MU1A 1YMQA 2AH5A 2I55A 2IOHA 5IT0A 5AVWA 2JAOA 1YV9A 2CFTA 3U7GA 2FPXA 1L7MA 4YGYA 3UMCA 5ALLA 5ALNA 3TLMA 2CFSA 4YIKA 2IOFK 3MMZA 5AKEA 4CNQA 4NABA 3MN1A 2YFYA 1ZD2P 1LTQA 3L1UA 3ZVNA 3W5AA 3NAMA 4HGRA 3QGMA 1XVIA 4BBJA 2C4NA 2G1AA 4UASA 2Q4RA 3HYCA 1VFPA 3QUBA 1U2SA 3QXGA 3ZU6A 2JGAA 3QNMA 4BNDA 4EEKA 3R09A 1Z4QA 3U13A 1L8LA 2YMQA 4UM5A 1Z5GA 5E0OA 2FUCA 4DWOA 2C88A 1ZD5A 2AGVA 2ZBGA 3WK5A 3PGLA 2B8EA 5AW5A 1TJ5A 2HCFA 2RAVA 3WKAA 4NFLA 2YMLA 3HLTA 4F72A 3W5BA 2NO4A 3CNHA 3EF1A 4Y3UA 5AVXA 1L7OA 4UM7A 2I34A 2JAUA 4Y2PA 2HF2A 4L6CA 3A1CA 3OTQA 1NRWA 4E88A 3MPOA 5AK6A 4BX3A 3I76A 4C4TA 4XQ0A 2PQ0A 2ZXEA 3L1VA 2P27A 2YBDA 3BWVA 1QQ6A 1KYTA 4NWIA 5JJBA 1RKUA 3CZ4A 4AP9A 3FPSA 5AKJA 5AKYA 4DCCA 3U7EB 4OD0A 5AICA 3F9RA 5ALHA 2WF8A 2ZBDA 3FM9A 3L8FA 4BYGA 4NAVA 2O9JA 2PR7A 4PNHA 3M1YA 1Z4PX 3GYGA 2R8ZA 3I28A 1LVHA 1RKVA 3PDWA 4EZEA 2HO4A 4HGPA 3FGOA 4MWOA 2NO5A 2G80A 4HAIA 3A3YA 4MUMA 5AIBA 3BA6A 3NASA 4KX3A 3SHQA 5ALKA 3ZI4A 5AI4A 2HX1A 2X4DA 5AVQA 1Z4OA 3ONNA 2FPRA 5AW2A 2R8EA 1YNSA 3B8EA 1YDFA 4UU1A 5ALJA 5AK5A 1Z5UA 4XPZA 4OHFA 3N28A 4UMEA 1XP5A 3L0BA 2HDOA 2ZG6A 2WF6A 2WM8A 4ZEVA 5A3SA 1QH9A 2I54A 2Q4TA 2W43A 3IRUA 3WKDA 2FUEA 5AVSA 3L8GA 2MSNA 4RESA 2P69A 2B1RA 3KC2A 2GHQA 1YJ5A 4KNWA 4BEWA 1SWVA 3WK4A 2WHEA 2G09A 2W11A 2GHTA 3WKCA 2YJ3A 3NALA 1ZD3A 1JUDA 2B82A 1IWOA 4UMVA 3QUCA 2BY4A 4GXTA 4UAVA 3L0YA 1L7NA 2YJ5A 1ZD4A 2JARA 2G07A 5AVVA 2HI0A 4Y2YA 1RQLA 2VKQA 3AR3A 2B8JA 3KOOA 1T9ZA 3A1DA 3I6BA 3ZWDA 5ALGA 5AKHA 3ET5A 3N1UA 4Y2SA 4KYTA 1QQ5A 3ZVLA 4CE6A 3ZUPA 4ZEXA 3PGVA 3L7YA 5AW6A 3U19A 1Z4LA 3L0CA 3W5CA 2PKEA 1ZOLA 1RKQA 5AM1A 2OM6A 1SU4A 1T5TA 3FZQA 5AM2A 1X42A 3NIWA 3SD7A 3S6JA 5AVYA 3FPBA 1MH9A 2GO7A 2C8LA 4UU0A 3DNPA 2RARA 1VJ5A 2YJ4A 4DFDA 3P96A 2B30A 3OPXA 3E81A 3KD3A 3RF6A 5AW0A 4BNDB 1Y8AA 1RLMA 1F5SA 4Y2TA 3A1EA 1T5SA 4Y2RA 4AS2A 4EX7A 3U26A 5AESA 4L6AA 3ZX5A 3QX7A 5AKIA 4DW8A 2HSZA 2YN4A 2EAUA 3DDHA 4OCZA 4UATA 4UW9A 5AKXA 5AM4A 1S8OA 3ESQA 4EENA 5ALEA 3IJ5A 4KX5A 3OCUA 3UMGA 5ALTA 2OYCA 4UARA 2G06A 3WGUA 2BDEA 4L57A 1O08A 5AVTA 3DV9A 3W5DA 2WF5A 5ALXA 3D6JA 5AW9A 4I9GA 1NF2A 2QYHA 2QLTA 1TA0A 2HOQA 4HGNA 3ZTWA 5AKZA 2OA0A 4C4RA 2RB5A 3WK8A 1U2TA 4Y2VA 4Y2UA 4BKMA 4Y2JA 1N9KA 1RC8A 3EPRA 2G08A 3R9KA 2ZOSA 3WK7A 5AVUA 1FEZA 5AI0A 1RLTA 2HEGA 2FPWA 4RETA 5ALPA 3OCVA 4H1WA 4NV0A 2IYEA 3ZX4A 4UMFA 3L5KA 2P11A 2IA5A 1S2OA 3R4CA 2OBBA 3K1ZA 5ALDA 4KN8A 4KNVA 2ODAA 3SF0A 5AVZA 1PW5A 1RMQA 4BEVA 2W4MA 1Q92A 3QU4A 1U7OA 2EARA 5ALRA 1K1EA 1ZRNA 2O2XA 3NANA 2JAWA 1Z4IA 4AS3A 3WGVA 1RMYA 2YMMA 2CN1A 5T41A 4YCLA 5AW1A 1Z88A 2ZBFA 2G0AA 1ZRMA 3VAYA 3E8MA 2WF7A 3EWIA 3QU7A 5ALUA 2FEAA 2FPUA 1RPZA 1QYIA 1TJ4A 4HGOA 3QLEA 3ESRA 5IS2A 1J8DA 3WKEA 2GFHA 5ALFA 3ET4A 5AKGA 2P9JA 2C8KA 3SMVA 2FPSA 3M9LA 3AR5A 3QYPA 1Q91A 3I1YA 3UMBA 1ZS9A 5ALOA 3U7HB 1YS9A 1N8NA 2YMPA 3OCZA 4BX2A 3ZW7A 3NRJA 3SLRA 4I9FA 5AKLA 5AW4A 2B0CA 5AM3A 2Q5EA 3OCYA 2AMYA 4FE3A 1CR6A 1RDFA 2DQSA 3AR6A 3ZTYA
chains in the Genus database with same CATH superfamily
3LT0A 2Q6OA 4MRNA 3ESBA 4IOMA 2AJ8A 1WUTA 4K03A 4I8DA 4ZFNA 1DRVA 2QLMA 4JKYA 3CR3C 2HIHA 2G25A 3ZU4A 1AQJA 2BGLA 2XMBA 1N6OA 1SHUX 1T2AA 4CEJA 1KBOA 1O94D 2R8XA 4B6JA 2PKWA 1J00A 1YS1X 3WL3A 4BV2A 5BYBA 2H7XA 1E2DA 2JFWA 3VR6D 4TZ6A 1JDSA 4BKQA 2QN2A 4X94A 5G1PA 2FW0A 5BNWA 1EG7A 5AVRA 3VYVA 3ABQB 2PO5A 1EUQA 4JL5A 4JLWA 4Y9TA 3ZQ6A 4FVTA 1LJUA 1T8RA 3AR7A 4A4DA 1T9DA 1L5SA 5CLFA 2NU6B 1KEEA 3H6HA 3PUIA 1HLDA 2OENG 4YDQA 5LDDC 1CEYA 3CGGA 5FUXA 3DZ8A 2PAAA 4OXIA 4ZCTA 5DCYA 5K09A 3Q11A 4DMLA 1CYDA 3DKKA 1NI5A 1ULHA 2GUWA 2V4ZA 3OMLA 4MS4A 4OA5A 5CFNA 1FZQA 1R4AA 4Z7NB 5BV2P 4G0PA 521PA 4NEQA 4B6FA 3C97A 4Q9JA 3T1VA 1DL5A 4HDKA 1U0LA 1PK8A 3AFMA 3DHWC 4IXTA 3ZJUA 4ZIRB 3OP4A 1RE1A 1WS6A 2EDCA 3RODA 1UEXC 3ZI0A 3ZZTA 1REQB 1N1EA 2JI6A 3AVYA 1OYVA 3PD7A 3QUTA 3CF6R 1VCMA 4TVSA 2QRKA 2PUJA 4KGXA 3JQ8A 2II6A 4RKEA 4ZQHA 3P0RA 5GIOE 1QYDA 3F6CA 3U7FB 4Q05A 1B8PA 3ILSA 4PXSA 1W88B 4BX9A 1C0PA 2J59A 3EGCA 4ECEA 3ESDA 2H9AA 1OCEA 3UOGA 1RYMA 4M88A 4FR0A 1FU7A 4LBZA 4OQXA 4XVCA 1ZXXA 3HB7A 5DMXA 2ZATA 5JYDA 3GG2A 3NWPA 4GICA 5HE8A 4FUQA 3CE6A 2CF5A 4MNTA 3T0IA 1KI1A 2OHIA 2ZYDA 4A03A 4IUDS 5AW8A 4HQRA 4QFCA 3FKJA 1QWSA 4GOKA 4IXNA 3UT0A 2QPTA 2X3FA 2X19A 2B1QA 1QP0A 1BE6A 3CY6A 2BGJA 1Y7PA 2J8ZA 2OSVA 3ICPA 4MTCA 5UKDA 3TBFA 1NY5A 3UMMA 2IITA 3QU2A 1C3JA 4WLEA 1KDZA 2JHAA 1SQSA 3GGPA 3VOBA 5LXTB 2GN2A 1I8TA 5EJ7A 5EWLA 4JLSA 5JO9A 2ABWA 2NTEA 2ONCA 2PJRA 4N48A 1T9HA 2GJKA 4UM9B 1NTRA 4A73A 5LJLA 1JBEA 4CL8A 2FY8A 4L8WB 3WHKA 4JAVC 4WNAA 3ZLTA 4MQMA 3C8UA 3D8SA 2P2SA 2QW8A 4XQ9A 2AOUA 1EDOA 4MUIA 5EKUA 1JWLA 1B7GO 3LOQA 5KTTA 1T3HA 3TN7A 3C3DA 2VHYA 2M6LA 1TJNA 3RK0A 4CEIA 2ZCVA 3AL0C 4JDPA 1AUPA 4D3SA 1MNQA 5AK4A 3DB1A 4FCWA 1ORHA 4JV5B 1PNTA 3SGLA 2ZVJA 3Q7EA 2G9ZA 1V11B 2BOVA 3GEPA 4D92A 2FFJA 4YJHB 5AUOB 2PSEA 3GIWA 4KFTA 4YRCA 2Y99A 3ROPA 4B7UA 4BNXA 2WDPA 3ZCQA 4CXMA 1GADO 4YRKA 4QSHA 1BWSA 4OK3A 1HNXB 3OETA 1AUXA 1N2EA 2WT8A 4QEDA 1SXIA 3KPUA 4G8BA 3UVEA 1SA0B 2R1VB 2Z09A 2HHHB 2ZRJA 3PPYA 2CFTA 4M1OA 1VBNA 3B1KA 3UA4A 4BNLA 2DETA 4ALMA 3T9EA 3U61B 3RVNA 3DYVA 1JDNA 1SCAA 1EQAA 2D3TA 4ALLA 4D79A 5C8VA 1N2HA 1M2OB 3L8YA 4FJ2A 4QBTA 4XD2A 4AJIA 4BKRA 2JJMA 2XOKA 1IB0A 1PFYA 1F2VA 1ZUWA 3SX4A 3E1SA 3AVQA 4BV8A 3O93A 3QYFA 1F6WA 3KU4A 3E5RA 2YTZA 4CKYA 2ORIA 1X1BA 1FIUA 1ZZGA 4OP3A 3V80A 2ZSKA 3PQDA 3DOEA 4O0MA 3T61A 2PLNA 2NAFA 1H8HD 1U8UA 2X8AA 5FTJA 2Q4RA 3LK6A 1XU9A 1YQ9A 3CU5A 3TFOA 1VLJA 1XAGA 4JJ8A 3F7NA 1VG0B 2P0YA 4KSBA 4RV5A 3S99A 2PPVA 4CKBB 3B1JA 3OD5A 5E2AA 4G8CA 5JSKA 5K0EA 3RIMA 1RBQA 4HMOA 4PW0A 5DMHA 1L8LA 3RW9A 3THWA 2QRVB 1XUOA 3NDPA 4YAFA 1IVSA 4IZ6A 1W47A 3OOWA 3WIVA 3OLVA 2PH5A 3NVAA 3ZE7A 1RQGA 1E3QA 1TVMA 2BF4A 2D62A 2AFIA 2H2WA 3P5SA 4D9HA 2H48A 1MENA 2JCXA 2R62A 3JY6A 1Q3TA 1WXFA 2ISCA 5KU1A 1GRQA 2YRWA 2C9YA 4JYPA 2H7CA 2Q1UA 4WT7A 2D4HA 1DFGA 2I80A 3FIUA 4FU0A 1K6EA 1GTMA 1MX3A 2XDYA 2XUJA 3KV3O 4IDPA 3LFUA 4IRUB 4U3JA 5A7GA 4CIXA 1MOSA 4BJ1A 4K6KA 4MB0A 2HPZA 4DDHA 2Y1LA 3DBRB 5K3AA 3OU6A 2DFLA 3OF2A 4OX9Y 3RUAA 2PZEA 3ZGOA 1LLCA 4KIFA 2O06A 4XGQA 5EP3A 5IDQA 5CB8A 3OJOA 4EDFA 1G20B 2JJYA 2MINB 2PRZA 4C01A 3ER9A 4N39A 2LPMA 4GAEA 3SE7A 1KL7A 4J3NA 3FM9A 5IYZB 2F1IA 5JSYA 1WY5A 2FQWA 4CUKA 1P2GA 1XD9A 4TYQA 1WUYA 2A92A 2HCJB 2PU5A 2WT9A 1VBMA 4N3CA 4P8RA 1Q11A 1ZSNA 1S96A 4PXYA 1VLVA 2RGGA 1MF7A 3D3WB 1DBIA 2R8ZA 1EE2A 1LVHA 3I28A 3HKBA 3V9AA 1S2NA 3GLHA 1UDCA 4KJXA 4R0MA 5CFPA 1HDIA 3JD1A 3PXGA 4PZDA 1T1RA 3EUFA 3AESB 2GBGA 2ZITA 3CLTD 4H0CA 5KQSA 3IQXA 3MTEA 4IIJB 3PKJA 5FHQA 3TIFA 1IB6A 4IHJF 1FFYA 5D84A 1VZ2A 1KZHA 1U1FA 4G0UA 4QVIA 4KFRA 1A1VA 1JHPA 2R8BA 3DEZA 5K3BA 4WZAA 2ZRIA 4EB8A 1W36B 1EDBA 2EQBA 4FYWA 1AKEA 4YAEA 2QJFA 1F7UA 1CW2B 4YCJA 1P1CA 4QUGA 1TEHA 2JI8A 3OCJA 4X6YA 4I50F 3N8KA 4O63O 2V6MA 2GAJA 4WCFC 5LDGA 4BZQA 4X71A 5CX1A 5IJ9B 1ZI8A 2FNAA 5FKJA 1ZVMA 4QXPA 1YC5A 5JJKA 3GJYA 1C3EA 4IW3B 4LBYA 1HFEL 1LBTA 1I2CA 4LC0A 4EJ6A 1YVRA 4TVOA 4OB7A 5H4GA 3I9KA 2X0EA 4YK7A 1A2QA 5KSZA 4BJ6A 5KIAA 1CE8A 1ZFNA 4H77A 5ICGA 3SXUB 3K94A 5DNWA 1E9DA 3ZS8A 1SBTA 1ULBA 3Q8XB 2HDWA 3DOFA 3FR7A 3IRUA 1C9EA 1KVRA 1VJGA 1GL6A 2ONZA 2BJVA 2GCOA 1ORTA 3I2FA 1DCTA 2PVCA 4R9VA 1FSGA 2B25A 4WCDA 1NX6A 1IC6A 5CVVA 4BL5A 4LGVA 4MARA 3LUBA 2RGDA 1X1RA 5L40A 3W8NA 3MQ4A 1C1XA 2V3VA 1QQAA 5I8WA 2P4HX 1NU6A 1LDBA 4PHTA 1SC4A 2PVSA 3TNJA 2B6NA 2C2KA 1VYUA 2UYOA 4MV1A 4OQPA 2R6AA 1ZBQA 3SQLA 1JU4A 4ZDJA 4EM6A 2F48A 4M9CA 5FR2A 3PFWO 2B6HA 4UMVA 1KQNA 1YQUA 2FETA 5EE5B 4BCBA 4XWWA 3VDRA 4BWYA 2BP7A 5EUBA 2XY4A 2ANCA 1XZCA 1KEWA 1M0SA 1SUCA 1J2TA 3E05A 2XE4A 4Y2YA 1RJFA 2OECA 4GSYA 2C77A 2CDRA 2NT3A 1BN7A 3AR3A 3JAKA 3UEOA 3RLFA 2O2EA 3FCSB 1Z0DA 4DLBA 5LKRA 1U3TA 1IH8A 1YRWA 4GUAA 4EJFA 1ZGAA 3DPSA 3ZNOA 4PCVA 3TPZA 4M9UA 1X38A 2EVWX 5DOZA 4WFIA 4YAGA 2V58A 3FVRA 4QYTA 2Y0PA 4RYDA 1TOAA 1XCLA 3LW7A 1T3ZA 4A27A 3EXAA 3P19A 5A0VA 1IHPA 4X0EA 1CUXA 1T6XA 2IFTA 1W29A 3F78A 1Z22A 1EFDN 1V0JA 3KV1A 2KI5A 4JA0A 3VPDA 2XE7A 4EUNA 1PVOA 3EZ9A 2A9OA 4KLRA 5DLQC 2ALJA 2ZT7A 1H4SA 1IBCA 2KB0A 4QXRA 2FLVA 4EG8A 1SXJB 2FSVC 2JFQA 2ZYVX 5DW0A 4AQ7A 2UUBB 1LLUA 1FXUA 2HADA 1V4BA 2I03A 1ZR4A 1L5VA 1QH1B 3DEKA 3GOQA 5KJFA 2NG1A 2ZUSA 1WETA 1DT5A 1EAMA 4ASUA 1QO0A 2C42A 2BEKA 3EQ6A 4Q4JA 3I12A 4XGRA 1KEKA 1CJTC 2FA9A 3WOVA 4LZOA 1Y6GA 1N2CB 1DJPA 4CCAA 3C6QA 1BIFA 2I3DA 1VIMA 4LGCA 4EB6B 2F9MA 4IIEA 3WL8A 3A2LA 3UANA 2YJTD 3HJNA 4TROA 1WHSA 4ZQBA 1JSRA 2WI8A 1KTVA 1MBZA 1UJ2A 1ZGGA 4B31A 3F6SA 3RF6A 2E21A 5FI0B 2J08A 3HCEA 3KXKA 1VE9A 1JJFA 1CUWA 2ZE5A 3D6TB 4RF2A 3FF1A 3WLSA 2QJOA 1MW8X 4IYJA 4EUHA 1MTZA 4YAKA 3NNSA 5CG2A 1KKMA 2FSVA 1P8AA 1FRZA 1GZHB 1LSUA 2HSZA 4RD0A 4BLWA 1Y3HA 3GEBA 4TYNA 2UZ1A 3G2PA 2H63A 4RLSA 3S7TA 2Z4TA 3IAEA 5AM4A 3VYSB 3W8RA 2WMDA 3K96A 1E2LA 4FT4A 3WNBA 3FWKA 3FLMA 4FEYA 5KKNB 2QAGA 1VPTA 3BTSA 4UXIA 2WHYA 5KYKA 3NONA 5K8IA 2WKSA 2OB1A 3COSA 5EXDA 3CO0S 1CYEA 1V9CA 3KKLA 3MWEB 1VKHA 4C30A 3TG8A 1Y7LA 2GM3A 5JCZA 4CW7A 4ZU3A 4YXFA 3DQZA 3P9RA 1WDMA 5E6RA 5F9HA 5EL0A 4EA7A 2PMCA 1Z28A 4YQFA 1C0IA 1D07A 4YPFA 5C4GB 4XB6B 1NRJB 3RVMA 1UXGA 4IRXA 3YASA 5IC4A 3EIUA 1RC8A 2BI7A 2N42A 1HDCA 2HCRA 3O95A 1XQVA 5GZ6A 3DZDA 3GUVA 3LZ6A 4A6EA 2NVBA 4HL6A 4DDMA 3R20A 1AY0A 2Q4DA 3OWOA 2XB2A 2P3SA 1W35A 2J6HA 3H9BA 3FHTA 1GG2A 3AIOA 1OYOA 1QLHA 3OT4A 5C35A 3G68A 4MYSA 4EFKA 4JQOA 2R6CA 1K88A 3VH1A 4H1WA 1Q1NA 2IY9A 3KKQA 3SEQA 3H8JA 1JDUA 3PPVA 3DLPX 2OV6A 3WFIA 4D98A 1RR6A 2H29A 3ND5A 2PIDA 1T0JB 1S2OA 1RI3A 2Y1XA 3L6DA 1KQPA 3KAPA 4DTIA 2QNRA 3F4LA 1TTQB 5DNYB 2Q0QA 4IGEA 4U2DA 4XSHA 5DGXA 5L3RA 4CM3A 3SF8B 1H3FA 1KETA 5CAEA 3D5EA 2Z3ZA 1T3LA 4JLJA 3NDIA 2XBUA 3UAOA 4DQVA 1F1BA 3ZDYB 3QU4A 3UO8B 1HR0B 4G81A 1JMYA 2QTAA 2FDXA 5FPHA 2Z9CA 3SZRA 3ZGLA 1ZICA 1BOOA 1L5WA 1AG9A 2EEPA 4MA4A 4RDCA 3QFTA 4A2QA 1Q0RA 2ZJ0A 4GWLA 2DPGA 3MGKA 4B1FA 3E5NA 4MAFA 2FU5C 2CN1A 4WBXC 3SBDA 1JWBB 3WIUA 4H1HA 3MJDA 3MLAA 3OIGA 4GD3Q 3RSLA 3HXOA 1JFLA 2YYZA 5ALUA 3VNSA 5LZ9A 1SXQA 4NU5A 1OGJA 4L15A 4BQEA 2E48A 5JE8A 1NLUA 2OV3A 4WZBB 3WNQA 2QEQA 2R8PA 2A1IA 1Z7EA 1XZLA 4PZCA 2FPGB 3U4QB 1Q0QA 1S2GA 1WMDA 3VVMA 4C6RA 3K0CC 4BO6A 3H75A 3QYPA 1JHAA 3HVRA 1YIDA 1GUBA 3QELA 3V8VA 3X1DA 3BX1A 1F8YA 3OCZA 5AP9A 4WWHA 3UENA 2I4TA 5DNVA 1P29A 4I9FA 1XFDA 4J1QA 4JWTA 1NW8A 3CURA 2I65A 1BMFA 2RGBA 3HBLA 4R1SA 4TV9F 3LPCA 1IJKA 4AWAA 1PR1A 3NRCA 4AT1A 1OT5A 4B34A 1UFQA 4D5GA 4M21A 2PRYA 3DBHA 4EY8A 5JO0A 1TEVA 5K3CA 2XA1A 2CYBA 3DLHA 1XZPA 1DEKA 2VRWA 5G3ZA 1NJ5A 4ENSA 2GD2A 2VF8A 1RZRD 4Y1RA 4UBMA 1NJ8A 1GCIA 1X86B 5B3LA 5BN5A 2F59A 2QRJA 2QUAA 3K5IA 4NENB 5KVAA 4EFDA 3KB6A 1Y5NA 2WUFA 3U44B 4BCDA 1OXTA 2JGDA 1JHDA 2HW8A 1PZXA 3U3RA 3A14A 3LYLA 2EJWA 5JPCA 3K0CA 4FMBB 4YMLA 2CJWB 2I4LA 5CCEA 2BBOA 2GVNA 2QNIA 4PN3A 4PPQA 2FR8A 3H9CA 2XEXA 3OEWA 5CG1A 1GARA 2YJ6A 4NZNA 4KXWA 1SG0A 5IW8A 3RVPA 2N1MA 1T5HX 2Q9BA 2VAPA 4MZDA 4NBKA 3TNLA 3UBMA 1TZCA 1YQDA 3PCXA 2FN7A 2QOEA 1CEQA 2DAPA 2DUUA 3ZCXA 4U63A 4D4IA 1B6TA 1JJ7A 3DAOA 5MFZA 2C5SA 5BRAA 1R1DA 5L3SB 4ZCPA 2LCIA 5DF1A 1IFXA 1ZOPA 3F47A 5T4BA 4NICA 1R6VA 1XDSA 2O48X 2PV0A 3WNVA 3DEJA 3D4IA 3MOGA 4XWKA 1MN6A 2O2JA 3IB6A 2VXCA 4J07A 1A98A 4NBUA 3WYNA 1I51A 3CJTA 4JXZA 3QU5A 2H1HA 3R3JA 3DVRX 4AU1A 4ZCIA 4QLOA 3IPRA 5CA1B 1E3WA 1KI9A 3Q88A 1P7ZA 1ZIOA 3D0RA 3DFUA 3DFKA 3DV0B 4ZAXA 1M34E 3GNSA 3WLTA 2FEWB 1KDYA 4G65A 3CZQA 4BP9A 2B37A 5K99A 1V35A 3VR4D 4FOLA 2RI0A 4XX0B 5KYWA 1U3WA 3R3SA 1DAOA 4WASA 1N7JA 1K9SA 3AR2A 1KZ7B 3NKFA 3QPUA 4MEAA 4A0QA 2A5YB 4UAJA 4AD8A 4DN6A 4DWWA 5G1OA 1NBAA 5JHGB 2BW0A 3ZDRA 4ZOQI 3C3XA 3GAZA 1SUPA 1GGNA 1ZK2A 2D8MA 4L51A 5EJIA 4BB0A 3PTLA 3EULA 2C2GA 3WOHA 3RR2A 5JAUA 4P4LA 1IN7A 1MDFA 3AEYA 3V1KA 1MPXA 3A6LA 4II3A 5CT4A 4R9SA 5L7WA 1H1TA 3TGPA 4ZTZB 5DU2A 3W4KA 5CCDA 1KRWA 3GRUA 3GFTA 4NYJR 1DLIA 4KKVA 3FTPA 2UYYA 3IDQA 1J24A 1WO8A 4A36A 5EMKA 3ZWOA 4CFZA 3AFNA 1YXMA 3FR8A 4TTSA 4EA6A 1LB1B 1S7GA 3AEKB 1DEOA 3PUKA 1S6YA 2BZ0A 2NYVA 3CTPA 4I7EA 4C5AA 2P41A 5C8ZA 1Q0UA 2OM2A 1CY6A 1L6RA 5BMVB 1FDTA 3A6ZA 1W49A 3ZWQA 4AY4A 4FYIA 2VZLA 3WTCA 4ENRA 3H1FA 1BE0A 3I9V1 3K9WA 3GRRA 5MGBA 4YIHA 1TZKA 1WCIA 1HGXA 1NL3A 4OF4A 3HSKA 4XW2A 2VCYA 5EEHA 1EJ0A 3PDIA 3SG0A 1VMDA 3MRVA 3QHAA 5LYJB 1BTOA 1QIGA 3L8CA 3KQPA 3MBIA 1YB7A 3W8DA 3VXKA 3QVKA 4G8JA 5JQGB 3E9DA 4J2TA 5FBHA 1N5OX 3DC7A 1QFSA 2HU8A 3G9XA 1T26A 4BLVA 2ETXA 4OP2A 2FPIB 1Z8NA 3DGEC 3MD0A 4H2DA 4MRVA 4Q47A 4XIIA 3QHQA 4ZGWA 4R54A 1DC8A 4FQ7A 4N5LA 3M4XA 1J97A 3E15A 4ER6A 2XCRB 3L4SO 2G40A 3L7AA 2HA7A 2EKDA 4MVJP 3BXGA 4EGJA 5K6TA 1AV6A 3CZ5A 4RTMA 1KERA 3AF4A 2CLKB 2CL6X 1OA0A 2PLRA 2XTAA 4XEUA 1Y4AE 5HQ3B 5FUQA 2E49A 3N70A 3TOZA 3KFXA 1FDUA 4E30A 1LBEA 5ALLA 3TD6A 3R6WA 1HQKA 3DLTA 1ZVQA 4NOLA 2CFSA 4E21A 1T8WA 1FNBA 3CEJA 4OX9B 3RQSA 3QJYA 3ZI7A 2RH5A 3FDZB 4FIZA 3CW8X 2JEYA 2OCAA 4P3NA 1L7VC 1R18A 1H2EA 1SU8A 5CM9C 5AMXA 3IP1A 1BO6A 3VR2A 5JIBA 5KNDA 2OVBA 3L1UA 4AJ4A 5EIAA 1NN5A 4WXHA 3S44A 1UWKA 3NAMA 3W5AA 4R4JA 3Q7TA 4GYKA 5FI1B 3MQFA 3HYTA 2AN5A 4IDFA 4K9PA 4LYEA 4D44A 4HC4A 16PKA 1NAHA 2W2NA 2UVQA 1OBVA 1MJGA 1NN0A 1QGUB 3EC1A 3KYIB 1A9ZA 4HDSA 4QBIA 4URVR 1L1QA 2NAPA 4PRZA 5K8JB 5KQRA 1JKMA 3QNMA 5CW1A 2VG8A 4JSTA 1BE1A 1IPEA 4URZR 1GN9A 1GFIA 1BKSB 4LY6A 5JWHA 1Y3CE 1BSVA 3GELA 3JQ7B 4B3XA 4BFTA 2BEWB 2FN4A 4DWOA 2C88A 2WINI 3B48A 5DTMA 1GZVA 3VC1A 4QTUB 5C8YF 3H2YA 3EVGA 4PG4A 4LXTA 3S2EA 1K4MA 2YOFA 3DHYA 1FYEA 4EFMA 5BW5A 2XOEA 1LU9A 1G3QA 4GOJA 4YCSA 4O08A 1E94E 4KPYA 1VRCA 4NFLA 3RQIA 2HRRA 1TZMA 3DVAA 2O8VA 2PQ2A 2W6PA 2GK7A 4Q37A 2FFAA 3EHDA 2A9VA 4EITA 5B4UA 5BYKA 1OX6A 4DRYA 2EJBA 3EVZA 2FSIA 1KMCA 3CNBA 1CIPA 3MIZA 2NU7B 4L6CA 5DULA 5JAQA 1MXHA 4ENPA 3EY4A 1US8A 5BSUA 4G1CA 4CDMA 1YR2A 3ZHVA 4S24A 4F5DA 3ZHZA 3JQGA 4YRAA 3V1NA 2H1OA 3N3AC 4YP6A 1T9GS 2JGEA 2YC2C 3OIVA 2IEZA 5EEGA 4G84A 4QOFA 2D7JA 1SBYA 4AP9A 4CQMA 1U81A 2BGUA 3IBTA 1MA3A 1ZHFA 4FLFA 4F6LA 4X8OA 1WB9A 2WIAA 4KWCA 4ZREA 3HWX1 3KOMA 2D0OB 5CNJA 4KMMA 3O73A 3SR0A 1R0KA 3L7BA 3PNOA 1AGPA 3RYFB 4PY2A 1AJEA 1AOXA 2IZ1A 4JA2A 1AD2A 2QRQA 4OO3A 4UQOA 1EFLA 4EW2A 2O2YA 1YBFA 1XF9A 4S1VA 5E9AA 3WP1B 1FPMA 1L4UA 5C37A 3K4QA 1N78A 1RQXA 3EXEA 2I2CA 4AZWA 1OLUB 1AMUA 1Z5ZA 5EOVA 1I36A 1PX2A 3OQ1A 4QXAA 1PFWA 3VR3A 4OQEA 4J3FA 4PBSA 2W6NA 3QE9Y 3P1JA 3DGFC 1P7WA 3P94A 4XYMA 3BORA 7REQA 4ZVSA 4A6XA 1R4ZA 4JFRA 4GOOD 2QMZA 3SS8A 1PGJA 2P2YA 3RSZA 4Z1MA 4HT3B 1FYDA 1LPAB 2XB8A 4DOMA 5TGTA 2BM1A 1C1HA 3DDWA 5D3KA 4TMVA 5I47A 4I4TF 3RHZA 4CF7A 2AZMA 3VU9B 1PJ2A 2R8OA 3VAZA 5IJ0B 2JLVA 1IVYA 2GNAA 4JB8A 3PYXA 1FTWA 5I9IA 3HP4A 3COWA 1H1DA 3HVIA 1NP7A 3OO0A 5CXQA 1YAJA 5BV8A 2FTKE 2PL3A 3CPJB 1NMSA 2HU2A 5CDSA 2CXTA 3WYEA 5CGZA 1Y9EA 4XWOA 5EUQB 1T2CA 1LBSA 1FTGA 5MN4A 4RBNA 4YRIA 4TSFD 3TQIA 4QGAA 3HK2A 5L4LA 4BNFA 1S4QA 3TRHA 1A7AA 2PCLA 1OPRA 3UTDA 4OOEA 4UBKA 1PHRA 1XJ5A 1UF9A 3OKAA 4PQYA 4MYRA 4QHTA 4TMWA 5TEVA 2WVHA 1VIAA 2YJ3A 4HOYA 2ZAOA 4P4TA 1KYQA 3GGSA 5IAJA 3SOPA 5IHXA 1EFRD 4OHBA 1WDLA 4J7AA 1IWOA 4EI2A 2IS4A 3A32A 3U49A 1YGYA 1XL0A 1DX4A 4BRUA 4O2BB 5EQDA 4MWEA 2G07A 1T0UA 2IEBA 1D2EA 2R84A 4KRGA 2HI0A 2H1SA 3RS2A 4V1CB 1Z6GA 5DN6D 3MS4A 3ZK9A 4HAOA 1N2JA 2X9NA 1BC5A 1NMYA 3IBCA 3NYWA 4N65A 2Q5IA 1NVTA 4OXRA 2JCGA 4RJJA 5C34B 1A2OA 5KNBD 3ROGA 3I5YA 2VDQB 3GL9A 4B3RB 4UZEA 2ZLBA 2XUPA 4RMHA 4N49A 1F0KA 1U2GC 2Z5VA 2ZIAA 3JQDA 4RVHA 1TQ8A 4BVHA 3G2MA 3DF9A 1W76A 2ZUUA 1C9YA 4KQ6A 5B3JA 3VRHA 3MMPA 4UHHA 4BFZA 1DKOA 1NVAA 3IQDB 3OZRA 3TL2A 3DKPA 1FP6A 1R8XA 1DRUA 2JF0A 2J85A 3ZU5A 5IZ4A 4OPMA 5G0UA 2VHUA 4BMNA 3VO8A 1ZNZA 3ERCA 4W6QA 4YQYA 1T34A 4JX8A 5LBTA 1P1IA 3NR2A 1FVFA 2P0AA 4DQDA 4UQLA 5AW6A 2VNHA 3GLIA 5IG2A 1UMBA 2P2DA 3H5IA 3SQWA 2F64A 4C7VA 2D3WA 1CZUA 1Q3KA 3OA0A 1CJUC 1E9BA 1PGNA 3GVIA 3RTDA 2JHCA 1BMQA 2PR2A 2R60A 4DLVA 4UCFA 4L4XA 4ZJZA 1A3CA 2CNWD 1DAGA 1FRQA 2C3UA 2H0RA 3FSEA 4KC0A 3S6JA 4LDPA 1PJCA 3A1FA 4WN3A 3ZWWA 5K20A 1KA9H 2ODQA 1W0CA 1IBSA 2D7CA 3KKKA 2XADA 5IJZA 1EWQA 1CFZA 2B30A 5JNSA 5C4IA 1ZU5A 1EFCA 2IYNA 1XZBA 2CXHA 1P4JA 2JD0A 3OPXA 5ITZA 1XP8A 3KD3A 2F2TA 2VTBA 2JA2A 2FEXA 5EP4A 1JZQA 1QLWA 3ED1A 2BGIA 2WTEA 1IY2A 4FEGA 3LI2A 3PJFA 3IMEA 1V9LA 3I32A 1I1QB 3HLKA 4I4LA 4B83A 3UWPA 4C0XA 1P8JA 2QT0A 5FOQA 2AFRA 3PC8C 4L6AA 3DL7A 221PA 4MYHA 3VVCA 5HXAA 1E2NA 1URPA 1J07A 4UATA 4C4XA 2FFBA 5BN4A 2CKDA 2XWPA 4UZSA 1OVGA 1X7WA 2D2IA 5I4KA 4GX5A 2WIBA 1CS4C 3CZPA 4UBJA 5GTDA 5K3DA 4RK5A 5F5NA 4NJEA 2BCGY 1TU0A 1DJNA 3CX6A 1ISRA 2G06A 5HFNA 3IEPA 2ONKA 1DUSA 3IHLA 1N7GA 4L57A 1YBVA 3QWHA 4LTDA 2VR1A 4BU0A 4RACA 3VX4A 1VA4A 4PX2A 5I7UA 1Y8CA 4G1FA 2JBAB 3NG1A 2PH3A 4YO8A 5AKZA 2NTJA 1Y8RB 2OA0A 3LQ4A 2YV3A 3NBAA 1FNNA 2HHJA 3EXFB 2C9ZA 4W9MC 5J2TB 2WMOB 3PC8A 4D96A 4C4OA 1KWGA 2G08A 1GWNA 4RVSA 1U4OA 3PJEA 3FNBA 1U11A 1HLPA 3GN1A 2ZOSA 1GPYA 3NEJA 4DS3A 3SJBA 1N5KA 2QM0A 2DT8A 4IHKA 4UNNA 5KJ6A 3VV3A 2FR1A 2P30A 2UYHA 5JMOA 2FPWA 5ALPA 2XR1A 2ZWAA 3IHWA 4LECA 4U7DA 1WXGA 1RAIA 1X77A 2A3NA 2V7VA 4J4HA 4QATA 4W5NA 1U3CA 5T8KA 4JU9A 1TJYA 2PN1A 1JPJA 1FYVA 4IIUA 4BNHA 2HZ7A 2XH8A 5I7AA 1G55A 4CKEA 1VQ1A 2IHYA 2QHXA 3PK0A 4Q93A 1CVRA 1RKBA 2FE4A 3M34A 4CM1A 4JUDX 2FP4A 1H6AA 3A58B 2WU0A 3ZLUA 4G0XA 4UUMA 2FFQA 4AW9A 5BSMA 2P6NA 3ASYA 1R8YA 3GV0A 5CEEA 4Z9AA 2J5RA 5B55A 4DF3A 1CRQA 2NUBA 1VE5A 3V6LA 4X7MA 1KEUA 1PX0A 3A9SA 5DM1A 3OY7A 4AN0A 5A7FA 1BQEA 3H65A 1RBZA 5BV0A 1YUNA 4CMBA 1ZA1A 2QQ5A 1RPJA 3OQOA 2EV9A 4KHPB 5IAAA 3IDFA 1K06A 1OC2A 1U1EA 4Q3BA 4UHCA 4EJSA 5CT9A 3BK1A 4W9RA 3FTEA 1Y9AA 2X4GA 1TXGA 1VKNA 4C03A 3IPXA 2SKDA 4LKRA 3HCNA 5ED4A 3EBOA 3OZIA 4EY4A 1QH8A 1VYHA 2QIPA 3K3PA 4CKXA 2QSZA 3ETLA 5TF4A 1IQUA 2WWIA 1R74A 5EUCA 3O21A 1AB5A 4DQLA 1B1AA 3SMVA 1Y6ZA 4H31A 1GAXA 1TAHA 3RD5A 1OLSB 2HDNB 2LTAA 1NV9A 1T0BA 4G8DA 1KEVA 3IL2A 3W0LB 1NIJA 2V55B 2GFIA 4QASA 5ED0A 4G0VA 3INYA 1CY1A 1PS8A 3SXJA 2HT1A 2J6IA 2RC6A 4AO7A 1AQYA 1WXEA 4FD2A 3KJHA 3OTGA 1LPOA 5JVDB 5GV8A 1EI9A 2HA6A 3ETGA 5JAMA 1KFBB 1UBLS 1V71A 3IEUA 1MKYA 1YA8A 2AS0A 4KLAA 1BX1A 4PO3X 1F9EA 4RL6A 1ZJWA 1YUMA 4C4ZA 3SBEA 1UMDB 4F56A 1BVUA 4Y1GA 1RQ2A 1WVIA 1ETHA 1KY3A 1XTSA 3TL6A 1KYVA 1GUYA 3LBYA 1OH8A 1ML3A 4S35A 3T06B 2WHXA 1M1YB 2AUTA 2BBSA 4IQFA 3PE4A 4QQFA 4BGVA 1YA4A 1G5RA 4EL5A 4KR2A 2IYUA 3SYKA 3GLGE 3SHOA 4TYMA 3WHIA 2C9MA 4DA4A 2QMHA 3K0FA 2V03A 1BEUB 3TEFA 2OKGA 1Q7EA 4J9UE 4NV3A 4Y2XA 4NZYA 4OLFA 4DM7A 3C3BA 2A86A 4YVFA 4ZA2A 3NDBB 3GRCA 1R15A 2HJ9A 4X20A 2LV8A 3EWAA 2WG0A 3OEED 1XHFA 4HNVA 3CBGA 3G8YA 3V1YA 4N41A 3ZV4A 1UKEA 2O57A 4AY5A 1A9TA 1QJCA 5HRUA 2GEKA 4AULA 1LVGA 4MVJA 3PUYA 4RZQA 4YP0A 5DBFA 1CUFA 1P0PA 2C4UA 4TMYA 4ATNA 4EUSA 3A1NA 4CR7A 4JB3A 4FNAA 3ZIUA 3FJOA 4EHKA 1SKYE 2ECPA 1JMKC 2R6GA 3UCFA 2EKLA 3OZEA 4BU1A 1BA2A 2X2EA 3P2MA 5EWMB 1B00A 2AC2A 2ZAIA 1SAYA 2ZYAA 3O26A 4OU5A 4O2AF 4ZC8A 2A58A 5DNUA 2JJQA 1FUIA 1CZKA 1GPMA 3HPQA 4CN9A 5JPDA 3KQMA 5JJIA 2PT6A 1DX6A 1U98A 1EHCA 4QQ8A 5CLJA 2P4UA 6AT1A 5JBNA 2BEUA 3O31A 3EWNA 1YQTA 1XCBA 3S2SA 1SHLA 1XTJA 1YCGA 2YX1A 5EXSA 5THKA 1P75A 4KK3A 4NULA 4QGFA 3PTZA 4A8JA 5LPNA 3RSFA 2P9GA 3KO8A 2REOA 3IUSA 1V96A 3NTXA 2VK2A 2VYCA 3JR3A 5LB2A 1RJEA 4OYLA 3SHVA 4S1OA 2Z6QA 3UH1A 1F6BA 4HDQB 2A84A 1E1CA 3GUHA 4IBOA 4JITA 1IG3A 3RKRA 5JZ9A 2DHCA 4YC7A 4JDUA 4NBTA 2B1GA 3PF9A 3BGIA 2QQGA 4UUQA 3N07A 1C41A 4CM4A 4G41A 4C2TA 5ICCA 1WUKS 4XPIB 4GQAA 2Z30A 4MWSA 1JSXA 2C04A 3I8SA 5FPTA 3ROFA 2P5TB 1K7XB 2F3SA 2OAGA 1A9RA 3OFVA 3SZGA 4PS0A 1CS0A 1S2LA 1PQUA 2W7TA 2WYHA 3NAGA 1QV6A 4DG9A 1BW9A 2A9FA 2QDXA 3C74A 2VPPA 4DM4A 3VVBA 1RT9A 1U9JA 3NAZA 3HPRA 3ZU3A 1GIAA 4L16A 5CIYA 2CV1A 2HMSA 5TIIA 1YZGA 3KDSE 1H2YA 3GNQA 2D1YA 4KO1S 3RDPA 5B58T 3H8WA 3TSWA 4TL7A 4DJAA 3KAQA 1YF3A 3UB4A 4KMRA 1R0XA 1JN0A 2OMEA 1K6XA 3HACA 4IJ5A 3K1YA 4G9BA 5FUYA 1XMXA 2FG5A 3LYUA 5FXMA 5IT4A 4MK4A 3O3OB 3TLYA 1W0JA 1A69A 3DZBA 3EJ6A 2D1QA 5MFPA 3KZCA 5F2EA 2ZWPA 1KZ1A 1V6AA 1J22A 4MWCA 4TZTA 4JVSB 4CCYA 1UBNA 3LLUA 2PMWB 4KR7A 2ZJZA 4TKMA 4ARVA 1N6HA 5B6IA 2BLNA 2MU1A 2PRIA 5C1IA 1YMQA 2VNAA 3PHHA 1FNDA 4UVHA 1X8KA 3PNMA 4GXQA 2AXPA 2DWOA 2W2LA 4RDXA 5JSFA 1RHKA 5HBRA 2BYTA 1RYZA 2FPXA 5IUNC 5BNZA 1QG6A 4MDFA 2O2GA 2VRNA 3PC2A 3R76A 1WBBA 4B35A 4TL9A 2FN3A 1IZ0A 3LXUX 2CL7X 5LCXA 1T4CA 2YV5A 1X74A 2QP9X 3CEHA 2AK3A 3F3KA 4LNAA 4M1ZA 4MYTA 4WRRA 5G2OA 1E1RA 4ECAA 4HNHA 2QTVB 2XYPA 3GPBA 2ZSHA 4ZU1X 2Y0CA 1A5SB 4AN4A 4CMJA 3CXUA 2R4UA 4YT4A 2J87A 1XXHA 3K53A 3GLTA 3IQFA 4WY2A 1O54A 2XNDD 2OCBA 2HJRA 2WWWA 3T95A 4HGYA 1ZD1A 2W42A 3WMWA 1R50A 3HYCA 3E7XA 4R8KA 3N0VA 1RCUA 2CCGA 1W8IA 1OB5A 1WCXA 2G4VA 1UPXA 4FKBA 4EEKA 4EW6A 1R9MA 4ZQGA 1E2HA 5JXJA 2JLQA 3FTQA 3L0PA 4CKWB 5JH7B 1J2YA 3I9JA 1QPZA 2F6RA 3W77A 2ZBGA 3JWPA 5A4KA 4Q9AA 1C30B 1H2ZA 1ECJA 4MMYB 3M1LA 3WL4A 1OTHA 3KUUA 3O4GA 2PA0A 4P31A 2IGTA 1TJ5A 2EBFX 2W37A 2GCEA 1GQSA 4L8FA 2BHLA 4NYIR 2CYAA 2O05A 3BPSA 2OQRA 3ADKA 4Z0HO 2ERCA 1AC5A 2ZUCA 1U8YA 2I34A 4N82A 4QLAA 4N47A 3ZCUA 2JK0A 2CFCA 3ICWA 2QZ4A 4ICIA 4LK2A 3OOHA 5EG5A 5LMCA 3PEYA 3MS7A 2DH6A 3UT5A 2PQ6A 3HO6A 3WYAA 1FMFA 1Z47A 2EGGA 1T2EA 2OORC 2PQ0A 1QRSA 5KYUB 3OZAA 5GONB 3LGAA 3QOWA 2V7BA 4KBYA 4XKJA 5KSYA 5CCXA 1F4LA 1ZQ9A 1UBFA 3GNLA 4PO1A 4YJ3B 5I4IA 4O4HB 3U9TA 4Q7KA 3CRNA 3GBVA 1NZJA 2I1LA 3Q2IA 2QENA 3STHA 3F9IA 5C2JB 5DBHX 1XTIA 4Z4EA 1Q15A 3CHYA 3F7TA 3FD8A 5DGTA 2YZNA 4FLEA 1KQOA 1T36B 5DBOA 1XPOA 1XROA 4ND5A 1NQVA 3LK7A 4IVNA 4JOCA 4QGHA 1OREA 3JVVA 4DLKA 4F4FA 3M0EA 2DM6A 1YJAA 3FGOA 1Q84A 1KR2A 3V4SA 2XB6A 4G89A 2I8LA 3S2FA 4D8VA 4YV2A 2LWIA 3D7LA 4F6RA 3FE2A 1A8SA 2OORA 1UEJA 3O7WA 1XHEA 3NZEA 4B0PA 2C1XA 4KB5A 3GVHA 4N1AA 3KL2A 3BM5A 1E2JA 3N7AA 3PL5A 1P5JA 2J9GA 2VPQA 3PU6A 1WULS 2JCBA 5B3KA 1QIDA 4M1TA 2VWGA 4JLMA 1FFGA 2BFNA 1JPUA 4OQDA 1P4RA 2NSYA 1I4DD 3ESZA 1Q17A 2OZEA 4DLYA 4MGYR 1R0RE 1NUTA 2GTHA 1KMIY 3L84A 1PNQA 3UGKA 4DKXA 4DBZA 1H0RA 2BMDA 4F5WA 3CJQA 2J9XB 2VP4A 2ST1A 2ZYUX 2JKZA 1QE0A 3KKZA 1AKRA 2FCAA 3BQMB 3JD0A 5CD9A 1H9CA 4ZEVA 2E2WA 5CLHA 3VVLA 3BHIA 3AP3A 1TKBA 2I54A 1DQSA 5EIOA 2GZSA 2Q5FA 3NEAA 2W43A 1QONA 5CYPA 1HTBA 4LWPA 2BGKA 1F2UB 1AX9A 4LHXA 4BNTA 3H86A 2Z1NA 2VOEA 4RE5A 4LXIA 2FQYA 4HZUB 4Y6RA 3TRFA 3QMWA 1UBTS 2YZKA 3D0KA 4GPD1 3R0IA 5ILGA 4CU2A 3AX6A 3L1HA 2I3AA 1L4HA 3LBHA 2B4AA 2CXSA 3ZXIA 3T9FA 1MC4A 4WKBA 3BBPA 3QPBA 3LRPA 2B34A 4BMPB 3IAM6 2IHNA 1JZSA 1USUA 3WKCA 4FN5A 1VMAA 4M8KA 4RIEA 3THRA 2LBPA 3NGLA 3WFZA 5JATA 1RC1A 3A31A 2X3UA 1KP3A 1W46A 5FOUA 2FH5B 3FSRA 3LC1O 3GFQA 5HVNA 1FTSA 1GZ3A 3CJRA 4L2IA 4XFDA 2WVJA 5EMHA 1NPDA 3S1AA 2I6FA 1KJ8A 4RO0A 3IVGA 4LNUB 5JSHA 3IEMA 3HKEA 5IVPA 2GLUA 3WNZA 4D0LB 4OMCA 3I05A 1T5LA 2P77A 5EJ2A 2OO3A 1JSCA 1JVNA 4MITA 4E03A 3EG9B 2NZ8A 4JEUA 1QX3A 5BQPA 2QU7A 3KZVA 1Z29A 1SUWA 2J3DA 2OYSA 3HCBA 1H1LB 1LWNA 1KJ9A 1OFVA 1UPTA 2I91A 2OAQ1 1V6CA 2GLTA 1VPVA 2Q5JA 4TXJA 4H7EA 3WMEA 3A1WA 3RTGA 3ZWNA 2PFKA 4PPGA 5I6DA 3DMGA 4BRWA 1XDUA 4CQLA 4JBIA 3ONWA 4FGKA 2HBYA 5EA2A 3QNWA 3RIEA 1SO8A 4S0ZA 1Z39A 4GR9A 2WQ6A 1I1HA 4NMWA 1QQ5A 3ZVLA 3EA4A 3GLFA 1XMOB 2XMQA 5IJXA 3ZY3A 4UBOA 3U5TA 3U3MA 1J8YF 3IQWA 4O4IF 4IIFA 1PRYA 4HLCA 3U3JA 4ACBA 4DADA 4DJTA 5BNTA 2Z6UA 2JAPA 4GKVA 1YC2A 2A0KA 3HUUA 3Q1LA 2PMEA 4B4DA 1MJGM 1D4FA 3GA5A 3ABOB 3BAFA 1TTTA 5JRZA 5DISB 4KTTE 4M76B 3P0HA 1OAOA 4C0AC 3NHSA 1QPGA 5AM1A 5LFAA 3FW1A 4UVIA 1ZK4A 1H8EA 3GEEA 1C80A 4PLYA 3EZYA 4UBNA 2JFYA 3A2KA 1ZX1A 3C98A 3DLCA 1ZN9A 4G0MA 4CKCB 3A36A 5LC1A 1FNCA 1GNTA 1QKIA 3D6FA 3P96A 4OSEA 1A71A 1Y63A 3PI7A 5EIHA 1GVNB 1P0FA 2IX3A 4PEVA 3GLFB 2CL0X 3TQCA 1MIOB 4BTEA 4C4TA 3KOYA 3QPWA 2IV7A 1F5SA 3KCQA 4JP3A 4DC1A 1Z45A 4EX7A 2NP6A 1KJJA 1YVEI 3KLOA 3O8RA 5D1NA 4CM9A 4PYRA 1XALA 3LV8A 1AA9A 1RWOA 1ZITA 1K9VF 2EWMA 2MMGA 4KACA 4UW9A 3AY0A 5AKXA 5KX5A 2JLYA 2BHRA 2WIFA 4RPJA 1S8OA 1KZGB 4C89A 1EAYA 3LDUA 1HEYA 4OYRA 4KX5A 3U3DA 3DE4X 2FF5A 3VU0A 3R9WA 1IM5A 4IGKA 2OYCA 5BUZA 2FE1A 4G1UC 3H7IA 2X3YA 3GQBB 3I4LA 4TYPA 3WGUA 4BZPA 1JP7A 1PO7A 1Q22A 5ERXA 3W5HA 4K6FA 5LA6F 3VPAA 4BNNA 4H3HB 3KZMA 3F6RA 1SUFA 3QSGA 1N2GA 1DBRA 4D8TA 1EGHA 3B1XA 2HOQA 3NAQA 3HG7A 4YAOA 1NBMA 2D5IA 1ZC4A 1U2TA 1A77A 2GVZC 2ANBA 4TXLA 2EKBA 3JQAA 3RT9A 3BMQB 5KB3A 3CVUA 1L7AA 3AETA 4E13A 2XJ4A 3D59A 1EWKA 3QE4A 2B92A 2RHCA 3GIDA 4J0HA 4RKQA 3OQBA 4C07A 1G8FA 1DTWA 3GFBA 5LBUA 3AVVA 2QP4A 2JFUA 3BJMA 4B47A 1OHHD 2ET6A 3HB1A 1XQ6A 4Z9BA 4Y6LA 4MGEA 1C9NA 4Q3LA 3O9ZA 4MCHA 5A4FS 1L5OA 3G02A 1WSDA 2AOXA 4YJFB 4RJTA 3TG2A 3QXXA 1KYYA 1ANKA 3OEHA 2PX8A 3RH0A 1QHSA 2ZEJA 2G70A 2V9ZA 4B44A 1YRYE 1IUPA 2VJBA 4RK7A 2P1ZA 4X54A 4YI3A 3ZGXA 4ZHQB 2OBBA 4B74A 4NCAA 4B2PA 2ZRGA 2PWPA 4IX9A 5ALDA 4MZXA 2XUHA 5K0LA 4C0SA 1Y48E 4AUNA 3I3SR 1WW2A 2VI5A 1MX5A 1P72A 3UOAB 1RYBA 4X45A 4BEVA 1LPSA 3E48A 4WEQA 1P39A 1DAHA 3KYDA 2GBCA 3D5QA 2JIBA 2OMKA 3KX2A 5G41A 4LF5B 5KHAA 4TN5A 5E4YA 2WB2A 1A9SA 1N0UA 1K1EA 1YACA 2XDWA 3MD9A 4LC1A 4AS3A 1V3QE 1ZIDA 1S4MA 4LCJA 2Q46A 4L4UA 1DQPA 1K5HA 1M8FA 3PHJA 3R9IA 4WBNB 1E5DA 3N6XA 4JJ4A 4W5TA 4CG3A 5EP2A 1P1KA 1JAHA 3DDSA 1IJFA 1U0TA 2AFHE 3WGLA 2A4KA 3QA9A 1CY7A 2DQYA 4O02B 2ZJ6A 1QYIA 1SCDA 2O1SA 3E9NA 3G1TA 2DB3A 2EYUA 4CBVA 5BWOA 1CUGA 4J76A 3ET4A 3U17A 5KOHA 4Q3DA 5TGDA 2FKNA 1J8VA 4B71A 4A9AA 2DLCX 3R44A 5DYWA 3E82A 1GRCA 1PV1A 1XTBA 4LE2A 1R88A 3RKSA 4U39A 3RIHA 4K87A 2YW9A 2QZJA 4UNSA 3KE8A 1M2WA 2XX3A 4P7GA 4TTTS 3QWIA 3KSMA 2BGNA 2VZ9A 4YEDA 3SICE 5FWDA 3GP5A 5CK4A 1J49A 1SVSA 5GIPE 3ELYA 1T10A 3AEQB 1XMSA 3HZRA 1XD2A 5U9CA 3C4JA 2X0DA 4AJPA 4RKWA 1WBDA 4KVGA 5TRTA 4Q9IA 1KPIA 2OHJA 2PXAA 3PS9A 4QARA 4D2IA 1G59A 3WBKA 5IUKC 3RUFA 2FEPA 2BM9A 4RANA 1YQXA 3H3FA 2QTGA 1MG5A 1O94C 4A1OA 3FOZA 3CLVA 1V5IA 1FNSA 3DZFA 3GJ3A 3VTZA 2LKDA 3L4EA 5KCMA 2VPTA 3DE5X 3PE3A 3QITA 4ZCMA 4HYYA 2EW8A 3DV2A 3TFQA 1R8JA 4RD1A 2PZAA 3FBWA 3K30A 3QE0A 5ALWA 4CLRA 3I23A 3K6RA 2XUQA 1IN5A 1M6WA 1OOEA 3KB2A 2FHSA 1XVUA 3S2YA 1PT5A 5TSDA 4QECA 1NTOA 2JL1A 4I3HA 4F2WA 5BOSB 3VDXA 4JXJA 4MICA 1QYRA 2MT9A 3AUUA 3ITKA 3JTEA 3WB9A 4QGGA 3W5JA 2OYRA 2Z8ZA 3PWKA 1L5MA 3HN7A 1IM8A 1B6GA 1NSYA 1PZNA 3C8MA 4Q5IA 2MCFA 4C29A 4FB5A 4IILA 5MN6A 2PZGA 3DBOB 2BGGA 4FR2A 2GCPA 4MKHA 4LXUA 4YJ2F 3W6OA 3F5QA 3PT9A 2C7RA 4IDQA 1L5YA 3PUJA 3T3DA 3PLAE 3LX4A 2Q3DA 2ZULA 4ITUA 3D7SA 1SULA 1FUUA 1Q77A 1F38A 3SIWA 2WAOA 2V8OA 3I2JA 2OBNA 5AIAA 3RTBA 3T1QA 5KYYA 2C4HA 1LK7A 2G72A 3IA2A 5B30A 3TQSA 1TM4E 5HUQA 3VR6A 2CBZA 1CQJA 5AW7A 2ZTLA 3CZAA 1J06A 4I5EA 2V45A 2FI1A 4FZJA 4P0PB 5T4EA 4KMOA 4UHDA 2CLSA 3T52A 1G3IA 5JJCA 3JRWA 1YQGA 1O9GA 3OFND 2MSEB 5A5GA 5ALYA 4FX5A 4F8JA 5JJ5A 2F1HA 2CV2A 1P2SA 4EPXA 3H5RA 1C4WA 2Q3BA 4YT2A 2FMTA 2I71A 2WZBA 3B9BA 4WDRA 2HCBA 2BI8A 2B78A 1CRWG 3P0FA 4JVNA 4JZKA 1XZIA 3IVRA 3WK9A 5I9TA 2QA5A 1W0KD 4HAUA 1U02A 4QHSA 7YASA 3P9XA 3WRXC 3TTVA 1KDOA 3RTEA 4RA9B 5H5JA 2VJMB 2QX8A 1EGQA 2H54A 2V7TA 1DV2A 4HLQB 3A27A 5HCIA 4KQXA 3FLAA 3DSRA 3BWMA 4REMA 5CA0F 2Q07A 3HU1A 2SCUB 1IPHA 3H9QA 4GQIA 5D2CA 1L4GA 3FOCA 1JQLB 2Y68A 3C8HA 1S8FA 1T0PA 4ON9A 2LKCA 4LYJA 1XFAA 2EL7A 3NDJA 4QICA 1FX0B 2H4FA 1SIUA 2WJZB 4UEJA 2E89A 3D3QA 4YYZA 5T7BA 3B7GA 5AW3A 3WQHA 3FOFC 4P4GA 4X8LA 1LSOA 5HTOA 3FHJA 5T4FA 3TJRA 4A0RA 5IM4F 1P77A 2QX6A 3W7VA 3UT6A 2XT6A 1CULC 2P78A 4RHTA 4K0KB 3WTBA 1C2YA 3H5WA 3W8EA 4A26A 3FGPA 4BX0A 2I4NA 4BB6A 3AHGA 3QM1A 4CF5A 1MRSA 1GKKA 1NHGA 3AUSA 4P1ZA 4I2NA 2N75A 2PL9A 3AHJA 1GA1A 2OD7A 1OBHA 9LDBA 4XFJA 1X1EA 4DIUA 1VPLA 1ZNXA 4WK2B 4RD3A 1VPWA 2XKJE 4OI1A 3NBZC 3EOAI 2WWVD 2HPHA 1DAKA 4C78A 5FL7D 1M2JA 4LYDA 4Z3OA 1N8KA 1W85B 4FTWA 4J0KA 1VOTA 3HDHA 3HJGA 3SNHA 4M37A 2I55A 2G4CA 2RGWA 3CINA 1TRHA 4X7BA 1SFRA 1V8ZA 2ZSJA 5K3FA 4C21A 1UMKA 5C5CA 3O8DA 3GGJA 3HJHA 2WYWA 1J6UA 4NBWA 2QD3A 3COZA 1P31A 3TQFA 1ZMOA 2QAIA 4DMKA 4N5NA 2RD2A 3QX8A 1Y6RA 4LQLA 4MEJA 5AKEA 5JEDA 1CQIB 4ZOAA 1IWPB 2F8LA 3UJDA 2FOXA 3DOCA 3OCCA 2IH4A 1T9CA 5COQA 1M8PA 3LZCA 4RZSA 3GCDA 4C7BA 4QTZA 4D3ZA 2OSBA 3A26A 4Z4GA 4RTJA 3RUPA 1UK9A 3WNDA 3H9UA 4WL0A 4PSUA 1JR3A 5B7PA 2JFZA 4H59A 1ZD9A 1N2ZA 3RHFA 4CG1A 3NJ8A 1AN0A 1G2OA 1GGJA 2XXBA 5B7NA 5IAOA 1BRTA 2DFTA 4HH4A 3X1JA 3IKVA 4M7OA 1YA6A 1ICIA 1NRIA 3LHSA 3MG9A 1W36D 3KVRA 3HB4X 1R0LA 2I1QA 5A02A 4F91B 1F12A 2FUCA 5J47A 2IS1A 2ATVA 1NW7A 2XWQA 4L07A 3D3NA 1F0PA 4CMIB 4E5KA 1GPUA 3R3WA 1U1IA 1ZXBA 4DJDC 3QJ5A 3TW6A 4HMQA 4QWMA 5EMJA 1FA9A 1XG5A 3T4PA 1FFCA 3WKAA 1M7BA 3QY0A 5LL6P 4HB3A 4DCPA 1I3NA 3HCOA 3S1SA 2QT9A 2IKQA 3HCPA 2F8SA 2RDMA 5JPIA 5AFSA 4CZ2A 4NC9A 3CNHA 3SJUA 3QPVA 1ILWA 4PICA 3C5HA 6PFKA 1W1UA 4X1IB 4B2LA 3D0OA 1ZN2A 4KNYA 1H8HA 3QI2A 1TAQA 4C5CA 5IF3A 1JFFB 1GAWA 4U4AA 4GRIA 1MT3A 4QOGA 5EYPA 3OTQA 1C5KA 3WYDA 5HS4A 4E5VA 4YMHA 4BX3A 3I42A 4WXMA 4MQEB 4JNKA 3SSNA 3U4AA 3RAEC 5JD5A 2G5TA 1ZK0A 2O0HA 4LXXA 4C22A 1PJLA 1ZN8A 3U4MA 1TTPB 3HKDA 1GCOA 2W48A 4PX3A 1U5AA 4CEJB 4RZ2A 3SYMA 3ETEA 2NVUB 5JFTA 4MQUA 3ISJA 5DW3A 2PNJA 4MVJM 1CT9A 1T13A 3UJ7A 2OBLA 3HNOA 4GM1A 1QVRA 4KFUA 4MP3A 4CM5A 3WIDA 1M6EX 3WO0A 1N6NA 1EUYA 1DZ3A 4AKTA 4AIRA 2PUEA 3GARA 4HMPA 1T43A 1WLSA 2RHTA 1HOXA 1CX9B 4V0QA 5DXAA 3EPKA 4PNHA 3M1YA 1KEEB 1G4AE 1EVKA 1DARA 2RBEA 3BE5A 4QJ3A 3NHFA 2J0EA 1KSFX 3ORFA 2YWEA 3BXEA 3OG9A 3CLTC 3UW3A 4BE4A 2NO5A 3UWDA 3J80A 4MS4B 1A96A 5FUVA 2VDPB 5M29A 1EFAA 4XR9A 2MR6A 1B0PA 3HGMA 4B6QA 3C6MA 2M32A 2I9KA 2JLRA 4NJOA 4BQSA 2G76A 3C24A 1QYXA 1V95A 1ZMRA 5AVQA 1GZ7A 2A88A 4W5QA 3N53A 3STXA 5AW2A 3RRJA 4BP8A 4L9WA 5FQOA 4YYEA 2I8CA 2Y1WA 3BWBA 3JQ8B 1ZLYA 3MIIA 4UUOA 2XXAA 2MSWA 1Z38A 3TKLA 4JJKA 1GPDG 5H02A 1KGSA 1Z5UA 1PR0A 4V0OA 4B76A 4MA5A 3PPXA 5J2UF 3FVQA 1GSIA 1CKEA 5GP1A 5SY9A 1ZIXA 4OH1A 2ZG6A 2A0FA 2W6JD 2A0UA 2FG7C 2VPIA 4DV2B 4TV9B 1AUVA 1Q7CA 3IUJA 3GX1A 2IYWA 3OPMA 4LWQA 3CX7A 4AG3A 4B17A 5JUWA 2R9VA 2TRSB 3GRYA 3Q3JB 1LRLA 4C3OB 4XH9B 4Z1OA 3FKSD 5F35A 1YNOA 3F6BX 2MSCB 5I8PA 3LBFA 4TLAA 4B3JA 4RTNA 1H2XA 2P69A 4C87A 3CNEA 1ZM2A 1P0MA 4KNWA 2GD6A 2C5GA 4BEWA 5A3QA 1W4AA 1CU1A 4F3RA 2YXNA 5CVUA 2LCFA 5EWLB 3CTMA 4FILA 4FOTA 1SY7A 2VF7A 4LZWA 4OBXA 3ZY4A 1OKKD 3CH7A 1DOZA 5EHGA 1SVKA 2IU0A 4ZI7A 4JKOA 1PV4A 2VYQA 3DT8A 3LL4A 3SZMA 4HEHA 3LD9A 2BIFA 3GH1A 4JR1A 4LJSA 1I7SB 1XQXA 2JIOA 5LZ7A 5P8WA 1C7RA 1UM9B 3G0OA 1P3JA 1Q0SA 1TMKA 1PV2A 2JEZA 4W7IA 4XRGA 5AQ1A 3HBMA 4K28A 4L02A 2ZB7A 3TMAA 3LCCA 3N2KA 3U3KA 3EDYA 3JZFA 4RNDB 4TTAA 4OMUA 2OKCA 4LSWA 5LQCA 1X7YA 1II8A 2TSYB 4L4YA 2XZLA 5CGQB 3FI9A 1QF7A 3CLRC 3FPJA 5E1DA 4DLAA 3UFBA 1U0NA 1C2TA 1Y1PA 1YS6A 3EA5A 4MWGA 2MYTA 3EQ2A 5K8UA 3A1DA 1HE1C 4BMOB 1W9HA 3IBFA 3KKEA 1XAJA 5ALGA 2X0JA 1F0YA 4U2BA 2NZVG 2EG5A 4KDRA 5AOAA 4EYQA 4MINA 5A1TA 3C5VA 2O0JA 1OFGA 4FEEA 4ND7A 1KIAA 2GXUA 3VH2A 4JX9A 5LP6C 1V4VA 1E20A 4O29A 1JB1A 4PGHA 1PF7E 3WDKA 1SHJA 2LE0A 3E8XA 3HWSA 2B4QA 1O9HA 3MBOA 4QUIA 1OV4A 1Z6TA 2VA9A 3TDKA 3QTBA 1NUQA 2FRDA 2ZR9A 3SKXA 2XGMA 3BZUA 1UJBA 1QHEA 2WHRA 2QD4A 4RWZA 3BOSA 1RJ9A 4XGIA 3W5CA 2CLHB 1G0OA 5L3ZA 4DJJA 1CY0A 4LHSA 1SVUA 2B1IA 2JIMA 2R65A 5AM2A 2FW9A 2BV3A 1JG6A 1XLTC 5KYVA 1O57A 2V3CC 1AHNA 2GO7A 2C3MA 3BA1A 1L7QA 3BRCA 4BVJA 4ZYUA 5M2QA 1G7CA 5ARDA 1CBUA 1Y89A 2VDUE 4R41A 4M99A 4ZT7A 2H31A 1VKJA 2GZDA 2IYZA 3SFTA 5BSHA 1J21A 1JR4A 4PG5A 4R3NA 3IAM1 2B21A 2IYRA 1VE7A 2WWRA 3BBLA 3H99A 3MCUA 1Q0ZA 5LP6A 3DMRA 4CTNA 2WSLA 4MV0A 4ZO7A 4M3NA 3THWB 1SVOA 3O83A 1T6BY 3H6KA 1T1GA 4TQUS 4LDQA 2BSAA 4DW8A 1QK3A 4LRWA 3ZHBA 1X70A 3K9NA 4UNQA 4WUTA 1T1JA 3A4NA 4L4RA 3BDAA 1SIOA 3RT7A 3T1OA 4DJ5X 3OU2A 3D8UA 3TB6A 2O8BA 1LPMA 1DUVG 1MABB 1NXTA 1K6JA 4J6FA 3H16A 4G5YA 2PA3A 4RQAA 5F5XA 4YUYA 1XLTA 2G17A 3ZV5A 1Y6JA 1KC1A 3ZNPA 4Z4FA 4CM8B 1EFVB 2NADA 5FDFA 3I9OA 1DC5A 2PX6A 3HB5X 2GPJA 1A72A 2G8NA 4X3CA 3UFXB 4DMCA 2UYQA 5KYTA 4LV8B 3KBOA 5FORA 3UAYA 5A03A 3WGOA 1NNSA 4PTLA 3KPJA 3SAJA 3FWYA 5J3JA 1T0IA 4F93B 2OHVA 2G7ZA 1RRFA 4R51A 4UHJA 1T2FA 2BFOA 1G2IA 2IEGA 2QM3A 3SE0A 1SC1A 1LDNA 4IWXA 3ZHYA 3B2EA 4ER7A 3TTXA 2MOKA 2WUGA 5KNLA 4PNZA 5KVQA 1G21E 1USKA 1ZI6A 5K0CA 1MZPA 1KYZA 1TYEB 3PNVA 4TKLA 3C1UA 4FW8A 4M46A 1S3SA 4B6RA 2I3GA 3PNLA 4D4LA 4J0DA 3HKBB 4ND3A 4QUBA 5FPPA 2O0KA 2P11A 2VWPA 3ST7A 2IHZA 3OMXA 4ID3A 2BEJA 1MO4A 1TX4B 3CSDA 2CDBA 2DPMA 1GU0A 3FPKA 3W9YA 1NOJA 2ODAA 3DUFB 5FNVA 2NX2A 4GYYA 3NFYA 1E3LA 4LJLA 2X15A 3C7TA 5E0KB 4BP1A 4ZARA 4AF8A 4D9MA 1U7WA 2IU6A 3A4LA 4FYKA 2IQ5A 4WZAB 2D0IA 2CT8A 3WLJA 2QT1A 1PT6A 3H4MA 3JX9A 2DPXA 3LPMA 3NANA 5DHAA 5TEWA 1NE7A 3GJRA 3FZEA 1O58A 2YMMA 2HF8A 1GUZA 1ZWLA 1DAEA 2XOKD 2SKCA 3QMPA 4IHAA 1ENYA 1ZRMA 4OHRA 1UWCA 1G38A 2GCGA 2JLAA 4PN7A 5I7OA 1A2KC 1QOPB 1YE5A 2GYUA 3EWIA 4KIJA 1UIRA 4RZXA 3PC6A 1XIVA 3ROEA 4RTPA 3TQRA 3CVYA 3D7MA 4U7PB 3K71B 3BRWD 4FGJA 3EODA 1CDZA 1E1KA 1T3GA 3GJTA 4PONA 3FY4A 1XQ1A 1WB4A 4U02A 5ALFA 4WADA 3QJGA 4NZZA 5K0TA 3Q5GA 4FONA 4A6DA 3M9LA 5U4QA 5FTKA 5TB5A 3GRKA 1Q91A 2PUFA 1QBKC 3VH3A 2H5LA 4G5SA 2QSUA 3RJMA 1HK7A 1IN1A 3SVLA 4XJVA 5HRCA 1F60A 3ECCA 1T8PA 1YS7A 2J6CA 4G1EB 5AT1A 3NPAA 2VYNA 1GKUB 3BTUA 4PZAA 1BHSA 4LJ9A 5G53C 3SLRA 4BIIA 2PE5A 3N0XA 2NUTA 1C1XB 2M2IA 3ZDDA 1BKYA 2I1VB 3KB1A 2HMTA 3LBAA 2NV2B 7AT1A 3N2ZB 1MOPA 1NXWA 4AVYA 4BRZA 3BCUA 3CZRA 1PWYE 2E82A 2R66A 4GBMA 1RDFA 3QKRA 1TM1E 2WSYB 3IKMB 3RVRA 3KQQA 5EJ9A 2NTYC 1DOAA 1RXWA 1CCWA 4MV4A 4NRDA 1SOUA 2E3JA 1N7HA 3L6OO 3QOYA 1BRMA 2HK7A 3TX2A 2QN9A 5KQGA 3GP8A 1O9BA 1FL9A 2JGFA 1F2TA 3QVWA 2VDWA 2WSSD 3SVZA 4US1R 1KJQA 3UAXA 4FE7A 5H8WA 1VLZA 2ZWIA 4YRZA 2WFLA 4ALIA 3N8GA 4L28A 1KRXA 3JAKB 5IJWA 4E2ZA 1P7YA 1W93A 3RSHA 2C7BA 4D25A 4Q7EA 1KK1A 4GL2A 1U7PA 5IBPA 2NOAA 1IHXA 4X66B 1Z17A 3GQVA 4C14A 5E2IA 2ZB3A 1I4OA 1LC3A 4M60A 4DNFA 2IBTA 2XF8A 2CNLA 3ADCA 2R00A 1GQFA 3JS5A 4W5WA 3KS9A 3OLXA 1RZRA 4H3VA 1XRLA 4N5HX 4J03A 4PLTA 2FMUA 3S7ZA 3TNYA 4DLRA 3A11A 2O8NA 1NY6A 4RUKA 2QZZA 3HVKA 5AQEA 4M83A 4F8YA 3A6EA 3V7WA 1PJTA 3ZIDA 1K08A 3BSSA 1QFZA 1VIDA 3DYIA 1BHO1 1YSCA 4FHGA 2ZS7A 1SQ0A 4F85A 1UBEA 4HPJB 1MRZA 2CFOA 5FEUA 1LCIA 1P9OA 3NIGB 4J1TC 1HURA 1V41E 4OI4A 3BXOA 2OXIA 1NKSA 1V5WA 2A9KA 2XUGA 4PLGA 3X1YA 4KYVA 4EAQA 5ALZA 3MWLA 4Q4JB 3B13B 1B16A 1ZGCA 2WD7A 1FFXB 1G7RA 3P9QA 3PXAA 3DKRA 3OBIA 3EEOA 1OXMA 2V7QD 4M0DA 1TQDA 1V48A 2WHPA 6Q21A 1WZEA 3HNPA 5SY6A 3OF3A 1JFVA 1WHSB 4K9LA 2Q3CA 1TPYA 1ONNA 2H1CA 3PF8A 1E9EA 4GWKA 2VJDA 3O0DA 3SC3A 4B79A 4UUPA 2CZQA 1EKXA 1AGYA 1XZ8A 2OTCA 2WUWE 4OQYA 1JAXA 3EEFA 5F3DA 1E79D 2EBHX 4MRPA 4XQGA 3WMFA 4C4SA 4UFPA 3MM4A 3FDJA 4I14A 1TI7A 2H57A 1YZQA 4RGBA 1FFDA 5LQRA 1WZCA 3C3MA 4E46A 2ZB4A 3JD3A 3KVYA 3QP9A 3TM4A 1ZG3A 1JXQA 1RMTA 2UZ1B 3DMNA 1V9SA 2HPVA 3BGSA 3H8VA 1Z4KA 3P9NA 3R4VA 4QUAA 5EE0A 3NV7A 3DTVA 3KJXA 1E4EA 4LSMA 2A9QA 3WDLA 2IH5A 3K9HA 2ZAYA 1YAHA 4PAOA 1X80B 4GC9A 2AC7A 1AGXA 3VR4A 5IC5A 3MJFA 4DV5B 1U7ZA 10MHA 2OCLA 1TQ4A 5E3HA 3LF2A 2W2VA 4HWTA 1G1AA 5FPYA 3WMRA 3QFRA 3VJRA 4P9NA 3IP5A 3VA7A 4BPRA 5E6RB 1EXMA 4G2TA 1DGQA 1X1AA 2Y67A 2C78A 4YP5A 4J2HA 3HYLA 3C15C 3C5CA 2XAUA 3AKEA 1ZW1A 4P3PA 1OXXK 2HNKA 2CHQA 4FP9A 2WIKA 4RPKA 4LQ4A 3SJZA 5FP0A 5JR3A 4MQ5A 3R3ZA 4N8EA 2H16A 1EBBA 5JJLA 3AWIA 5C7LO 5ECYA 5A0TA 1YI0A 3HUFA 4GXRA 1KHHA 1YMUA 4L0CA 3AEUA 3E70C 3ANTA 2X7JA 1TA4A 3K1AA 3FPCA 4BLSA 4UU7A 3AOGA 4M0EA 2ISSD 4OGGA 1GPBA 1QHIA 3F2VA 1D1PA 4FZVA 3ZK8A 4EUKA 4FZRA 4XM2A 3LWBA 4KWHA 3FOAA 4DA9A 4GBGA 2C2XA 1V6SA 4MPDA 1KORA 4EP1A 5CEFA 2AG1A 1GL3A 1MCZA 4NSNA 1U0SY 3G1WA 1G2PA 1IYZA 1I13A 1E62A 1QX4A 2EERA 3AKDA 3PRKE 4IJUA 4TUYF 2DR2A 4MDYA 3B3QA 5HZMA 2HA3A 4KBGA 5KKAA 3SCZA 1KI4A 1YCHA 3MN1A 1J0AA 2J07A 1OWLA 4JNCA 4R5HA 5LXTF 3T0GA 3I52A 4ZTUB 4JBWA 3R75A 2ZQYA 4EOGA 1VCHA 2YYAA 3VNBA 4I19A 4EAAA 1VE1A 3UCEA 3BDVA 3EZGA 4P3KA 1XVIA 4JJEA 4RJLA 5DWVA 1RQPA 1D1QA 2HLNA 1GPKA 5TLSA 1N1MA 3H5TA 3N74A 4R1NA 3ZLVA 4RFSA 5J5AA 4UEKA 1IVNA 3QUBA 3QXGA 2ZRBA 2WTAA 3BSFA 1NR5A 4Y0NA 3ZHOA 3M82A 1EYZA 3ESAA 3N8IA 2DXIA 5F7OA 2DGDA 3DP9A 2YNMA 1DC4A 4BPBA 2ZREA 1DDGA 1EFUA 2VJPA 1WV0A 3H7AA 2PUTA 4MI3A 1ID1A 1YQEA 4ARSA 4ZJYA 2P6RA 2NMVA 1LV7A 4ZOEA 2AR9A 2C59A 3EHEA 4G1VA 3C48A 2BH2A 3QELB 3L2OB 4FM9A 1X87A 1K66A 1VDZA 2OC9A 1KO1A 2P5YA 2RAVA 3U31A 4ARZA 2AKYA 3B52X 4L3OA 2X40A 4YV1A 3L18A 3N0RA 3OFKA 1XTVA 4HGZA 4RJKA 4Z53A 3WQSB 2QIOA 4H7KA 5FRDA 3L7LA 5D6OA 3SOZA 4IOKA 3RC9A 4UM7A 1JFTA 2GXSA 2WWXA 4O5AA 4A15A 3KHKA 3BH7A 3SM3A 4GKKB 1T2NA 1XRNA 2Z2IA 1WWKA 4Z7JA 1G8MA 2WA2A 4JI3B 9MHTA 3H5NA 1ZR2A 4U9HS 5CB4A 3AB7A 1NHWA 2ZI7A 3SZ3A 1UKYA 3ZV7A 4TLBA 2ZUVA 2JGDB 4IEEA 4XIJA 3W1EA 4EEZA 3BTOA 4XARA 2ROQA 1UPCA 1ECPA 4OJQA 1PEAA 1QANA 1FYXA 2O7RA 2DKFA 2QB5A 3EVNA 3VDMA 2UXDB 2AMFA 2W6IA 2Y27A 5CNIA 5FFNA 2F43A 1U2QA 5KPJA 2HWKA 1ARZA 1M1XB 3K6JA 3RADC 1QFYA 1JT9A 1KMQA 1FPQA 2WQ7A 5C52B 2GJSA 1HI9A 3MUEA 3T5CA 2I6SA 3EZ2A 3ZLBA 3BG5A 3TINA 3AY3A 3CH4B 4IDHA 4J8PA 4XIYA 1QIIA 4KITB 1HF3A 4QTTB 2O9JA 3CF4A 2Q0SA 4IIVA 3GYGA 3LC0A 3AJAA 4K40A 2H2GA 4HQNA 4LQCA 4HJXA 2ZTHA 1YU6A 2QPOA 3QBDA 4J43A 1YULA 2PXXA 2BVNA 3MCAA 3TIXB 4G07A 4HAIA 1YTUA 4WNCA 1T8SA 1GG5A 4DMMA 4QOJA 1JIUA 4V03A 3DEIA 4UD6A 1JF8A 5AI4A 1BXRA 3ZY2A 3ZGVA 3ROQA 2E4AA 3OM1A 3BCSA 3CEMA 3ICVA 3LAWA 3O9VA 3QEKA 4NCNA 4DUYB 1JA0A 1E3WB 3LWDA 2GVDC 4LYFA 4JVOA 1U9YA 5KSWB 3WYBA 5L9AA 3ZD6A 5F4ZA 3RG2A 3FRHA 3RWMB 5BW6B 3HU3A 2RJ3A 2GT1A 3MWJA 3KHTA 5K2MA 3GDWA 3TSZA 2CNNA 4K9QA 2NZXA 5TY0A 1RJDA 4D0RA 3A37A 4Q9LA 2OLEA 3IA7A 4OFBA 1IAVA 2GI4A 1C4XA 3DNMA 1S8AA 1AXRA 4TWJA 3X2SA 3ZDCA 2HDOA 1VZ3A 3NCTA 2JIZD 3Q0IA 3Q41A 1NQUA 3O8OA 1VSBA 1K3FA 2Q8QA 4LYHA 3AV0B 5HZKA 4KI7A 3V42A 3I2YX 5H81A 1JBKA 1OBFO 4G0OA 1NQWA 1VLQA 4GLOA 3GT3A 2RGNC 3QG5A 5IYZF 1GQYA 1WD5A 2H9IA 2LDBA 2B83A 2Q0XA 2ZSEA 3H0CA 3IYLW 3KOWA 1G16A 2ZJFA 4MV6A 5I7FA 2HYIC 1JEAA 2GHQA 3BXHA 4I1OA 1U3DA 4G5QA 4NPAA 3QVOA 1BQ4A 3EVTA 2MSDB 1GQOA 1AS3A 1NRXA 1Z08A 1AS0A 2QTWB 4UHBA 5H83A 5JCOA 3PUHA 3RVQA 4DT1B 2Q6TA 2R6HA 4UDNA 1JTFA 4C88A 4R5MA 4B4KA 3G8DA 4FWBA 4Y9DA 5IUJC 4LY3A 4GEGA 2WQZA 1JUDA 4IIJF 2NV6A 4RU1A 1IXRC 1K3UB 3GJZA 1X2BA 2H1WA 2QZ9A 4I4CA 2ZE8A 4IIYA 1FTNA 1VCIA 4XEHA 3WAGA 1X3SA 1K92A 3IT0A 3L0YA 3T7IA 2F4VB 4HXFB 2RGYA 2YJ5A 2YL2A 4QU5A 5TV2A 5JRJA 1WCIB 3HCCA 3WIOA 4F5ZA 2GF9A 1ZJ4A 2QZPA 5JI2E 4FMDB 2ID8A 4EY3A 1MQ8B 2HNAA 2RKOA 2B35A 3D1LA 2CJFA 1NW3A 1K5PA 3R8XA 4E1VA 4TSFA 1UR5A 4LMBA 5BWCA 2DC1A 1NF8A 2H92A 4W63A 1SXJE 4YCDA 3FPGA 1EFTA 4PPYA 5EIWA 1P2UA 1W5TA 2BFMA 3T34A 5FV7A 1TUIA 3L1IA 3HUEA 3EAQA 2G3YA 4OHMA 5DYGA 2AN4A 2Z58A 3ET5A 3R74A 3HA2A 5HYVA 1CUYA 1XNGA 4JIMA 4NYMQ 1LFAA 3THYA 1E5TA 1EFRA 4NG4A 1U7XA 2ODNA 4WLUA 1P2DA 5HMLA 5GWXA 3UG6A 4CM6A 1ISIA 1LDGA 1SOVA 4GRAA 3RSCA 4YAIA 4CE6A 2JLWA 3UKOA 1DIGA 4HBZA 1LF0A 1TUEA 3DWIA 1U2ZA 1WAMA 3CG4A 2WMYA 4K3VA 3V2UA 1ZW6A 3PGVA 4OV6B 3NC1C 3BJZA 3DO5A 3L7DA 4LRSB 1HE2A 3HCRA 3ON5A 3R1IA 5FADA 5DN6A 3RCBA 1I7QB 1Z4LA 2P5UA 3T9DA 3AUFA 1CV2A 2JB9A 1AKNA 4U1RA 3TUIC 4TZ0A 4XJXA 5KNBA 3UJNA 3RF7A 3UATA 1SOMA 4V0KA 4DLZA 2WKRA 5FTLA 3BICA 4A8TA 2FQ1A 1O0CA 1F4VA 3CF4G 1QP8A 4DCJA 3DMYA 4UU0A 3SZLA 3Q2KA 4J0JA 3VX3A 2G9QA 4L76A 1YR1A 4FDLA 4EZIA 1M2VA 1SG6A 3AVOA 2VVTA 4HDSB 4B7ZA 3PQCA 4M0LA 1BH6A 2B2NA 2GM5A 3OP1A 3RUHA 1E0DA 2ZZNA 1ZOSA 2VRCD 3E7DA 4DANA 4BFWA 4YUAA 4DR6B 1PFKA 3P5BA 1QPBA 2C03A 3Q0TA 4EHLA 5DX1A 4QUJA 1D8TA 1LLFA 2DWQA 2JH8A 2R11A 3JQ9C 4EI8A 4EFNA 4RELA 2KS6A 1GV1A 1GYPA 2A5GA 4JUFA 1U2PA 2F3TA 2VCHA 1C14A 1QHXA 1UKVY 4RVOA 4TTPA 4E7PA 5KNCH 1THZA 4RZHA 4DM3A 1DBWA 1BN6A 2CNWA