4UMEA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion and kdo molecule
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
174
structure length
174
Chain Sequence
HMNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
total genus 62
structure length 174
sequence length 174
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umeA00
1Z4IA 2PR7A 5AVXA 4BX0A 5ALDA 4Y2YA 3S6JA 2WF9A 2OA0A 1RMQA 1K1EA 2FPXA 5AI6A 3UMCA 3NAMA 4O8CA 3U7GA 2HEGA 2G80A 3WKDA 1ZD3A 3ZX4A 4DWOA 5ALVA 5AW1A 1RC8A 4EX7A 4HGOA 3ZX5A 5ALJA 3EPRA 5AW9A 1TA0A 2RAVA 2VKQA 1XPJA 4CNQA 3I28A 5ALTA 1RQLA 5AKJA 1WPGA 4L57A 5AVSA 4J03A 2B82A 5AIBA 4I9GA 3KZXA 2G06A 2FPSA 5ALIA 3L0YA 2YFYA 2NO4A 2IYEA 2YMMA 5AKEA 1CR6A 3WK9A 2O9JA 3FGOA 5IT4A 5AW2A 3OCUA 1ZD4A 3L8FA 3QNMA 3QU5A 4KN8A 2G09A 4UW9A 2O2XA 3F9RA 3WKCA 5ALMA 4QJBA 2HF2A 3K1ZA 4IG4A 3L8EA 1RLOA 3QUTA 4FFDA 1U7OA 1Z4NA 3CZ4A 2WF8A 1O03A 1VJRA 1U02A 5AESA 3KC2A 4YCMA 2QYHA 2GO7A 5AW6A 3ET4A 1CQZA 2FUCA 4UARA 3SMVA 4ZEXA 4UMEA 2EAUA 2WM8A 5A3RA 3QU7A 1EK2A 2YMQA 2I54A 4G63A 3W5CA 2HI0A 2BY4A 3QUBA 1J8DA 3ESQA 4HGQA 4YCNA 4QQFA 4Y2PA 3N28A 1L8OA 5IS2A 3M9LA 3ZWDA 5AKKA 5AW7A 5ALWA 2JGAA 3NANA 4UAUA 2YJ5A 2ZOSA 4UMFA 1Q91A 3CNHA 4UU1A 2EATA 2I34A 4CF3A 2C9MA 1TE2A 2RB5A 5AKHA 4CF4A 4UM7A 1J97A 3FVVA 1WZCA 3DNPA 4IFTA 3ZWKA 1ZRNA 4H1WA 3UMBA 1RQNA 5AW8A 3I76A 1WR8A 5AKGA 3SF0A 2OBBA 2CN1A 3EWIA 4ZEVA 2ZBFA 5ALOA 1TJ5A 5ALRA 1TJ4A 3ONNA 4BNDA 2JARA 3U7HB 1L7NA 4Y3UA 2AH5A 3L8GA 4C4SA 2I33A 3ZVMA 3UMGA 1RMYA 3WK4A 5AKYA 3PDWA 4Y2SA 3KDPA 2G0AA 1L6RA 3SLRA 4J2TA 1Z4OA 4NWIA 4RESA 3OCVA 1VJ5A 2YN4A 4CE6A 3RFUA 1SWVA 2P9JA 5IT0A 5ALZA 5ALEA 1XVIA 4YGYA 2FPUA 2FUEA 3ZI4A 3HYCA 4Y2JA 3I1YA 2YJ3A 3J7TA 4EELA 2ZBEA 3OTQA 4F71A 5AVWA 1RPZA 2G1AA 5AKXA 1ZJJA 1L7OA 3WK7A 2CFRA 3KD3A 2YJ6A 4C4RA 3KOOA 1Z4PX 1RDFA 3E84A 3L1UA 3HLTA 4Y2XA 1T9ZA 2G08A 1ZD2P 3W5AA 1RKVA 2B0CA 2FPWA 3QXGA 2GMWA 3NASA 4KYTA 3U26A 1EK1A 2P11A 3PCTA 3ET5A 4F72A 3FM9A 4YIKA 3NUQA 3RF6A 4NV0A 5ALHA 1Z5UA 3OCYA 5ALPA 4AS2A 2Q4RA 3I6BA 2ODAA 2DQSA 4HGPA 3IJ5A 5AI0A 4YCLA 5ALYA 3MC1A 1Z5GA 2C8KA 1YJ5A 3FPBA 3DDHA 5ALNA 3AR9A 1XP5A 1RKUA 3QU2A 2PQ0A 3QGMA 2BDUA 3A1EA 1IWOA 2B8JA 1VFPA 3U7FB 3ED5A 3N07A 2C8LA 2ZXEA 5AK6A 4BNDB 5AI5A 5AW3A 1Y8AA 5ALXA 3L8HA 4EEKA 4EX6A 2P69A 4Y2QA 1LVHA 2WF6A 3GYGA 1ZS9A 4KX3A 3WKEA 3ESRA 5AVYA 4G9BA 2R8YA 4JDPA 5A3SA 4YH1A 4MUMA 3AR4A 2B1QA 4Y2RA 3R9KA 1JUDA 4RETA 3WKAA 5ALGA 2GFHA 3VAYA 3L0CA 5AVZA 5ALQA 4BEVA 4DW8A 3UM9A 3WK8A 3E8MA 2YMLA 5E0OA 1NRWA 2FPRA 1N9KA 4KNWA 2YY6A 2P27A 1WVIA 4UASA 4C4TA 1Z4JA 3E81A 2JAWA 3DAOA 3N5KA 3P96A 3L7YA 5AM0A 2AGVA 1QH9A 4DFDA 2YMPA 3ZUPA 3IRUA 1YS9A 2EARA 3R4CA 4HYTA 1MH9A 3D6JA 5ALKA 5AVTA 2I6XA 3AR3A 3ZTYA 2C4NA 4BEWA 4YIHA 4I9FA 2HX1A 2FDRA 3NRJA 2HSZA 2PKEA 3AR2A 3SKYA 4BYGA 1YNSA 3L0BA 4XOUA 2G07A 5AKZA 5AVQA 1Z4LA 2CFSA 5T41A 2B30A 3WKBA 3WK5A 1PW5A 1YV9A 3A1DA 3OCXA 4UMDA 4L6CA 4OFZA 2C88A 2I55A 4XPZA 2QLTA 3AR6A 2HO4A 2MU1A 1RRCA 2FI1A 5JJBA 1T5TA 1YMQA 2D2VA 2RBKA 3QU9A 4XQ0A 3NALA 5AICA 2WFAA 1L7MA 2FEAA 5A3QA 3W5BA 2GHQA 5AW4A 1F5SA 4UM5A 1QQ5A 2NYVA 3A3YA 3SKXA 3TLMA 5ALSA 3KBBA 4GXTA 1L7PA 4HGNA 3U13A 3E58A 4EZEA 2B8EA 4GIBA 2WF7A 2R8XA 1KYTA 2ZBGA 5AM1A 4AS3A 5AI8A 4FE3A 5AKLA 4BBJA 1RMTA 3DV9A 4L6AA 1RLTA 1AQ6A 3AR8A 3EF1A 4BKMA 4CF5A 1N8NA 3MPOA 3WGUA 4OCZA 2NO5A 4AP9A 4NFLA 3A1CA 3QLEA 2ZBDA 2HOQA 2RARA 3ZVLA 1L8LA 1Z88A 2WF5A 4PNHA 1TJ3A 2I7DA 3NIWA 1S2OA 2GHTA 2MSNA 1Z4KA 3ZVNA 4ZEWA 5AVVA 2OM6A 5AVRA 5AI4A 2IA5A 3L5KA 1SWWA 5AM4A 4Y2VA 1O08A 1ZD5A 2OYCA 3ZU6A 4Y2UA 4B6JA 1LTQA 4BX3A 3ZTWA 3W5DA 3QYPA 1T5SA 4HGRA 3PGLA 5AM5A 2HDOA 3U19A 1RLMA 1QQ7A 3SHQA 5AIAA 1QQ6A 3FPSA 3OCZA 2JAOA 4HAIA 4NABA 4KX5A 4KNVA 1U2TA 1RKQA 5AVUA 3MMZA 3AR5A 2W11A 2AMYA 5AM2A 2R8ZA 2IOFK 3WGVA 1Q92A 1ZOLA 5AW0A 2Q4TA 3AR7A 1U7PA 2W43A 3PGVA 4FYPA 4MWOA 5AK5A 3OPXA 3QUCA 3OCWA 2JAUA 4Y2TA 2Q5EA 5AK4A 3U7EB 2ZG6A 2R8EA 3B8EA 4E88A 1QYIA 3MN1A 2AUTA 1S8OA 3WK6A 1U2SA 5ALUA 3L1VA 1NNLA 5AKIA 3QX7A 5ALFA 2YBDA 4NAVA 2CFTA 3B9BA 3N8GA 5FP0A 3IB6A 3ZW7A 1ZRMA 5ALLA 3M1YA 2HF7A 3QUQA 3R09A 4XE5A 1NF2A 2HCFA 5AW5A 4EENA 2X4DA 3SD7A 1SU4A 5AM3A 2B1RA 3QU4A 3BWVA 3FZQA 4OD0A 5AHXA 4BX2A 5AK3A 4DCCA 2W4MA 1Z4QA 1FEZA 1X42A 2HHLA 2IOFA 4UU0A 3EF0A 1Z4MA 4UMVA 4OHFA 4UATA 2IOHA 4JB3A 3N1UA 2YJ4A 4UAVA 1YDFA 2BDEA 5AI9A 3B9RA 3BA6A 2WHEA
chains in the Genus database with same CATH superfamily
3UK1A 2XD9A 1YGPA 3GN2A 4K7JA 4HTFA 2JFBA 1OXXK 1P44A 3A25A 3A9UA 4NYJQ 4OHCA 1AKMA 4QU9A 4O4IF 2PH5A 1G5QA 2ZU6A 1XDWA 4Y2YA 3KVOA 2XT0A 3U3RA 4ASUD 2VHYA 1QU3A 4A16A 2PJZA 3FWKA 4R54A 5T6MA 1OX6A 4DXAA 3A11A 4N7BA 3COSA 2ZR8A 5IDWA 4HDKA 3RK4A 4AJHA 4KLAA 1OIWA 1SUDA 5E7QA 5HGJA 4C03A 3WV4A 1E2IA 1GA1A 1EK5A 2ODQA 1H1DA 2EGGA 1YC5A 4EG3A 3BIJA 2A33A 3ZX4A 1IIBA 2Q9UA 3FGPA 4ZT4A 3QSGA 1ZKDA 4LCJA 3ABIA 4WE3A 4JIGA 1HH4A 2VXOA 1E89A 2HGZA 2OSBA 4NYIQ 4XCVA 3K4QA 2WMDA 2JLQA 4EF6A 1NP6A 4IL5A 4Q4HA 4PYRA 1EEHA 2ZT5A 1OXKB 3OTIA 3VTFA 1QHXA 1C3XA 1J8FA 2B82A 2CNLA 2WV9A 2GCPA 5CLLA 1JE1A 3WIDA 3ZD7A 3V2UA 4Q34A 4NNOA 3K1TA 1NQVA 3O93A 4E1AA 1BWRA 2FPSA 5IG2A 4IICA 2PAAA 1YASA 3GRAA 1P8JA 2LP4Y 4HTAA 3D3EA 3UIEA 4QQNA 1G3UA 3I6IA 2O1WA 2QD4A 1W5AA 2QPOA 3TL2A 3VHQA 3ZQ4A 4DDKA 5I7HA 1NUPA 5KWIA 4MV6A 1IAVA 2IE0A 4M60A 2EWVA 3RKSA 4ZVNA 2X13A 3HWRA 3PXUA 2WWXA 4DB4A 2A5GA 4QYIA 5EIBC 3T5GA 2ZYTX 5COQA 3IA2A 1V8ZA 1LTKA 1N2CB 2ODEA 2VLBA 4G5HA 4GPAA 2PVCA 1A95A 4KN8A 2G7ZA 4PICA 1BROA 3BIWA 3M34A 1KPHA 2D8MA 2Q0QA 3K1ZA 2DBYA 2FEKA 2ZANA 2VRWA 3NC1C 2BN4A 1R0WA 4IM7A 1WXQA 1U0FA 2OY0A 3BJEA 2CXUA 1TXGA 1M2KA 2I6TA 2QSZA 2LKCA 3EXHB 5D6OA 4EUNA 1F2TB 1VPEA 1VPTA 4JY7A 2ADFA 2R25B 5JCJA 4AMYA 2CCJA 3L7KA 4G0VA 4G0PA 3RS8A 4HNUA 5JQWA 4JJ6A 1SKUA 1YK1A 5KHOC 3LK7A 1O89A 1FTYA 3GO4A 1QKKA 3CUTA 5KNDA 3ZU3A 3VU9B 5JECA 3WC4A 2A8YA 2DPYA 2WWFA 1O3YA 2ZYHA 2LDBA 1RYBA 3ESDA 1N7IA 3W8NA 2IZ5A 3UFBA 3W5CA 5K3EA 4YN3A 1LBSA 5BVGA 4HGQA 2L82A 1ZMRA 2VJNA 2EVWX 1DCMA 4OHRA 1EWYA 3EISA 3M4JA 4D79A 3N28A 1GEEA 2GA9A 3KD2A 4KO2S 5GY7A 2Z43A 1OLSA 1C1HA 3C7KA 3CUUA 1Z0DA 3ILHA 2VSXA 3OU2A 4IHQA 4F46A 3IXQA 1A9XA 1K7YA 1VCIA 2Q50A 3IP6A 1YHNA 4EI8A 1R4MB 5DBFA 2PYZA 1U2ZA 5CLQA 1BKDR 4HNHA 3AM1A 4HXGA 2NLOA 3L7JA 5CEJA 3D8UA 3F6PA 4NS4A 4RVOA 4B4OA 5CFMA 4H6PA 4WZ6A 3GJ3A 4B9EA 1VG8A 2R4UA 2ATXA 4KPFC 2ETXA 3WX0A 2BUBA 4TL7A 3MJTA 4B3XA 2NVUB 3AVUA 2ASEA 1F2UA 1KVRA 1U11A 2P4UA 3ZWKA 2Q21A 2B8NA 3WTBA 1ZLYA 2WB2A 1JDJA 1OZFA 4AY2A 3V4SA 3K35A 4NE9A 1JIUA 2YIVX 1ND6A 3NNNA 2YQ4A 3NVAA 3ORYA 4QJ5A 2L19A 3WLIA 1FZQA 3H0KA 4WESB 1AMUA 1IY8A 1CR4A 2J85A 3I42A 4WACA 4PXAA 1ENYA 2F3RA 3TM5A 3S5JA 3DQPA 4NCBA 1II9A 4NOLA 2OD2A 1XTPA 4FWIB 3CN9A 4KO4S 1JWBB 3BMOA 1UCFA 3BFXA 2AH5A 2OL4A 3L8GA 2JHCA 3THXA 1COWA 1F8UA 1KY3A 3S70A 2F67A 1RJDA 3L01A 2PX0A 5DISB 5FWYB 4MYDA 4J0DA 1WB6A 4R8SA 3B3QA 1ORHA 3PC6A 5IFKA 2EHDA 4TKUA 3UATA 1Y33E 3AP2A 2MYUA 2QEQA 3DM9B 3ETJA 3GROA 2P3LA 5F1OA 3WWCA 4CEHB 3RM3A 4D4MA 4J9VA 3E9YA 1UPCA 4DLAA 4DR6B 1E64A 1N0IA 4CE6A 4LK3A 2RAUA 4PGGA 5ER9A 4ZCLA 4DADA 4HUQB 2YHAA 4MIKA 2AMVA 2WJIA 3AVOA 1QE3A 4E5NA 4WDRA 3W4JA 3WXBA 3HRKA 2P2NA 3KZOA 2VAXA 3TFOA 2VXCA 5FL7D 1YO6A 3RRMA 3EGOA 4RF3A 5AHOA 3EUFA 4F9TA 3J7TA 5KKNB 2FP4A 1RWMA 3DD5A 4GZLA 4TL9A 5FBKA 2W22A 5JYDA 3G13A 3PSAA 5TGZA 2V4ZA 4RYDA 1UZAA 4KXLA 1XEAA 3AKCA 4LMRA 4URFA 1SHUX 3EXIB 4NE7A 3HS3A 2QI9F 4YYEA 4DA0A 3QKRA 4P86A 5MDHA 1C2YA 1Q77A 2WIJA 3H2GA 2O8BB 2F2TA 4JLWA 2CFCA 1XTUA 2HMUA 4GLOA 2EF1A 4I50B 1ZMTA 3RJZA 5GGYA 5B12A 3KQSA 2PZAA 4PPGA 2QJRA 1DO8A 2W6IA 3BZWA 2H1CA 4FINA 1S7CA 4G0ZA 2W8ZA 2YJZA 4XYMA 1GILA 1X9HA 5DW3A 2IYOA 5FJIA 2X0NA 2DJ5A 2VP6A 5AOVA 4BU0A 2BKEA 2OV4A 1M1YE 1KJWA 1UQTA 2I3ZA 3FOBA 1XZGA 4OQFA 3IPYA 5F12A 1P4AA 4N5HX 5G4KB 3TXYA 1AHPA 3D3KA 3FCOA 3AH8A 1E77A 3E9QA 3RIEA 4CETA 1BWSA 1FDTA 1OYVA 1ZUNB 4W5HA 1YQQA 4EF4A 4YT2A 3RRBA 1IMJA 3EXEA 1X7DA 2BV3A 4DNXA 3MYRA 3IJ5A 1O96A 3R9IA 5BNZA 3MC1A 4JNKA 5J1SB 2X58A 4NMWA 4J1TC 2CLOB 4LXQA 2QAJA 3HHPA 4YPFA 1G8MA 3C3JA 3GUVA 3B85A 3THYA 2R1VA 1RHJA 2G88A 4FGWA 4H77A 3QGMA 1TCVA 1IWOA 2V59A 5DEOA 4KRXA 1K27A 2CXXA 3AWIA 2FMHA 2PLRA 1Y1PA 2D1FA 2Q1UA 3MTGA 3J80A 1SQ5A 3P4YA 2DERA 1Z33A 2DR3A 1T26A 3ESAA 1PQPA 5LFAA 3QW4B 3QVXA 2EBHX 1IJFA 4J7UA 1L9KA 4WLEA 5F2EA 1L4UA 2ZPAA 3MMSA 4LVCA 4MKHA 4LMBA 2P2LA 1D4FA 3DEZA 4G65A 1ISSA 1S4QA 4RCZA 3FZYA 4WNYA 5IW8A 4C0QC 3GLUA 3AGPA 3LO8A 1TIPA 1WKBA 2JAXA 3FB4A 3PPYA 1TK3A 3R5FA 4X41A 1Q1NA 3I09A 2EFCB 5JCJD 1DO0A 1YULA 2JFFA 1H8EA 1B8VA 4FCTA 3EZYA 1L5WA 4QUAA 3MLEA 4FOTA 4B4UA 3A1SA 1QIHA 2BC9A 4KPEC 4PSVA 3W79A 1XYGA 2PS0A 3U39A 3IRVA 3V3TA 1A04A 3EA0A 4TGLA 4D7AA 4PIPA 3DUFB 2ORIA 4EUFA 3QTTA 5DNDA 3QOYA 2Q5FA 4L51A 5DDIP 4BKPA 3DE6X 4DIFA 2DB3A 3N5KA 1U3FA 4ERNA 2CBZA 3P96A 4LHSA 1LS1A 4TV8B 4B6FA 1PTJA 3SX0A 5BN3B 1FC0A 3CPHA 4HDNA 2V65A 1W4ZA 1HZZC 4IXDA 4PN3A 2AXPA 2C3YA 3ENVA 4RZUA 4ZYZA 1LF0A 5KDLA 3STWA 1ECGA 1KNXA 3R4CA 1PZNA 4HYTA 4ZTZB 4X1YB 1X7ZA 1BYUA 4MWGA 5CCEA 2R96A 1XAIA 3PUZA 5LOVB 4BCBA 1ACLA 3HSKA 1YU6A 3PDIA 1U7HA 1WKCA 2QXYA 3LTEA 1KF0A 1ZD1A 4KZKA 4R7ZA 1Y8RB 1GNQA 1IBRA 1XHLA 2OAQ1 4WCFB 2EJCA 5BQFA 5GZ1A 3PFFA 2Y8EA 4D9KA 2GASA 4GPIB 1UMCB 3WIUA 2PE5A 1N5DA 1LJ8A 2Q3CA 1N9ZA 3OQNA 2HSZA 3OT1B 1LS6A 2VTBA 5AWFC 3E18A 1A97A 4NATA 1XMPA 4RMJA 4CWAA 3PF8A 5LP6F 4CXMA 5AKZA 3M5DA 3GC6A 5JLJA 3SJBA 2BGWA 1JYSA 2OHVA 3CUSA 3IEKA 4ZTBA 2N0SA 2G71A 3WK5A 2O2DA 1A8PA 4NBSA 1FQOA 1UJ5A 4V0ME 2X1LA 3ON5A 5JG7A 1COWD 5CIYA 2LCFA 1IN4A 2XMPA 5AD1A 2OD7A 1TGYA 3G8AA 1XDGA 2NSJA 3PXCX 3O3NB 4R2IA 4XWWA 4LRQA 4D3ZA 1RKBA 2R6AA 3DVAA 3RYHB 3WWPA 1OSNA 1UJNA 1BQ4A 2FV8A 1C7IA 2I3DA 4NE2A 1XZLA 2DX7A 2RHDA 1C3EA 3MBOA 3ZZMA 4EFKA 2XQJA 2Q5IA 2VTDA 4BLQA 1A9YA 4NECA 4JJ4A 3AY3A 4FFSA 5F2OA 3FLBA 5IUJC 4MWSA 4MWEA 1OLUB 2QGNA 3QFCA 3G2HA 4ESOA 3B6MA 5IBQA 3C45A 5CB4A 1S2DA 4UBMA 1YFLA 2FW6A 2YXLA 1LD3A 5C7YA 2R5FA 5FDFA 4XYGA 1YOBA 3KETA 3FMIA 1UXKA 2R97A 3RT7A 1CETA 2BTOA 4MVJP 4R2HA 3ZV5A 2Q3DA 2E5LB 2ACEA 2HWYA 4KH1A 5KWJA 3X1WA 4HN4B 2Q5QA 1OFUX 2P0AA 2PUDA 3EF1A 3WGGA 2CT8A 2FJPA 2A5JA 2IXGA 1EM8B 1QHEA 2CLEB 2H57A 2QE7D 1WF3A 3O8QA 3O8DA 5EIOA 1X3SA 3WSVA 4E09A 4ZQFA 4C4XA 2JBAA 5ICEA 3R40A 3L5OA 4M0LA 1XV5A 3GJ7A 3T54A 4ETMA 5BR4A 1XMQB 1M83A 4YMWA 4CT4B 5DTQA 4I1PA 1GPAA 3WVNA 1SQ0A 3SF8A 3TSZA 1R00A 3DHVA 4J07A 4KQMA 1K7XB 4A92A 3AUAA 3EY9A 3H99A 1ZLXA 1CEYA 4FNOA 2GFIA 3U9TA 1UOPA 1XZNA 3HYNA 1L0BA 2I29A 1WMFA 3AI3A 4TKVA 1IDOA 4C06A 1WY7A 4KGXA 1JHXA 1XHFA 2BHTA 2JJ2A 2XMSA 5AVRA 1VA4A 1XMIA 2GHRA 3WL8A 3C6XA 1CJBA 4BB0A 2AB0A 3BZBA 5AI4A 1Z6XA 4JKIA 3TRDA 4EHFA 4LF6B 4AKGA 3JWPA 3KCNA 3BDIA 1SWWA 1XN4A 3V9PA 3LU1A 3QLUC 2NUTB 1WSWA 1EWTA 5JAPA 1R5NA 4CKZA 1KGDA 3I6YA 4IDEA 3VOTA 1OB2A 3ZWCA 3AONB 2F8MA 3E2PA 3QPUA 1F8GA 2GCNA 5AM5A 2GEUA 1W35A 3BORA 3EDYA 5LM3A 3CVVA 5H80A 4PC2A 2Z56A 4G9EA 5KYNA 4EY6A 3DO8A 2QQEA 4KR6A 1PT7A 4RVGA 2BELA 1B2RA 1ORWA 1YVPA 2H4WA 3IUYA 3KRTA 4D9NA 2I87A 3Q85A 3LDUA 3C4VA 5CW1A 1EP3B 5EXTA 4EPXA 5EIEA 4KSCA 4QRIA 3R75A 1ZNQO 4KNVA 3DMTC 4L4XA 1IH8A 4EKYA 5ITZA 1PG0A 1SXGA 3U31A 5I8ZA 3E7XA 1E58A 3LM8A 3RVPA 1TVCA 3AXTA 3FOAA 3MMZA 4TV9A 1PT5A 5JXJA 3JWGA 2AMYA 3RIGA 4QXOA 3ICOA 3DPUA 1GAJA 1ITZA 2BBSA 4S04A 2YVUA 1B6GA 4FYPA 2FHSA 1JFSA 3KEQA 1OFUA 3H1GA 3QKWA 4RHTA 2C5SA 3B8EA 4I4TB 5JYCA 3MJVA 1YS6A 1YUNA 2PIDA 4RM3A 1NUSA 1JB9A 4A15A 2OEPA 1EAYA 4HNQA 4QYWA 3VR2D 3FWHA 4AIRA 4QBKA 4POOA 2CNWA 2YL2A 5AKIA 2EU8A 4MEAA 2ZPUA 3EZ6A 4FX5A 4NAVA 1ISMA 1TFRA 2CFTA 2DAPA 4HO1X 3KZ1E 4MYCA 4QOEA 1KQ3A 4WZAB 5ELLA 3U7JA 1L5QA 5BRJA 3CT4A 1THGA 3QUQA 4OIFA 2GJ4A 1DC7A 3GK3A 1E6LA 3JATA 1HE8B 3H4IA 1SKQA 3Q5GA 2HCFA 3M70A 4P84A 2J46A 2VH5R 3AI1A 3BWVA 3M6XA 1M1UA 3QLJA 3QU4A 4QODA 5HDQA 4HVTA 4UNIA 4G26A 2VYFA 1L5ZA 2IDKA 3T4XA 2KBEA 1E7SA 1X2BA 5JI2E 3DAFA 2VIIA 5LJLA 5DXAA 4G1FA 1MO3A 1YB6A 3N2NA 2ZDQA 2BBTA 2QN7A 1VP9A 1O94D 2OCXA 3F6RA 3PNQA 3Q6NA 4BNXA 1E60A 3OIWA 1D2NA 4YJ3A 4CMBA 2P0EA 5AI9A 5LYJF 3ZW8A 5JMWA 1Q0QA 2DWQA 4IIJB 4X90A 3ZK8A 2OHHA 4ERXA 1CUUA 2GVDC 2QZJA 3QXCA 2W2TA 4QQKA 3BHNA 5EXEA 5FOTA 3PQFA 5JY1A 1QWOA 2WNIA 3GUCA 4N1AA 2B7BA 4ABTA 1FMTA 2AKEA 5A6SB 2FPLA 2O0LA 3DLIA 3PFWO 3NLLA 5DBEX 2HJHA 3UC9A 4H17A 5KC8A 4YYZA 1GCUA 1F48A 1SB8A 4ZPJA 3K4HA 3KR0A 4MKRA 2YBEA 2WR8A 1QNLA 2CW5A 4GO1A 4HB4A 4HYEA 1JZQA 4KQHA 4WPGA 2QD3A 2ODTX 1TOAA 4N3NA 2IELA 4OX9Y 5HF8A 3GI1A 5B5SA 2G1KA 3T41A 4NZYA 1JU9A 5BSMA 1ZD3A 1P7WA 1VE1A 5F21A 4W5OA 5L3ZA 1EM6A 2FK8A 2GPNA 2BWJA 3D8BA 3FLMA 4GLJA 3E7DA 2H1FA 1E9CA 3F71A 2NV6A 4JI2B 3ZWNA 2IYTA 1JWLA 2NUBA 3PPIA 3EULA 1VHWA 1TA0A 2GAOA 1N2SA 3H2HA 4W1SA 4E4RA 1KZ7B 1UBRS 3ACDA 5DCUA 4AMUA 1CUSA 2ECPA 3JQ6A 4JU9A 2QQ0A 3R7WB 4D4JA 1DKQA 3DHYA 2JH3A 3IUPA 5K0JA 1Y7TA 3U80A 1QAQA 4DLNA 5D1NA 3ZE6A 1B73A 1I01A 1JEQB 1RBQA 1W8DA 3IDQA 1R0KA 5BP7A 3W6NA 1CY0A 3B52X 4TSKA 3UMSA 5KNCD 1PF7E 2AEJA 3HZZA 4KSBA 3OO1A 4XRGA 5A0VA 3UANA 4Q4AB 4IJKA 4O1IA 1OXVA 3DF7A 3HCNA 4X94A 4UPDA 1GDDA 2NVOA 3AUTA 3EDCA 5DEIA 2QR3A 3F9CA 3CLHA 1NW8A 1RXEA 3THWA 1KZYC 1W5EA 3H5VA 4R2LA 3ZH2A 4IDQA 5A4DA 1ZIOA 2QRLA 4HEA6 4US1R 1KSHA 3O1IC 1FTQA 2HAEA 3PDCA 1E2LA 1JIQA 2QSYA 3R5SA 5G1OA 4EHKA 4FD3A 5K8IA 3DB2A 4ENPA 4UW9A 1I0LA 3KOMA 5B4VA 3O9MA 5FNVA 4RD0A 4QVIA 1E63A 3F6CA 1Y9ZA 1MKYA 3MLAA 2W6ZA 4NMHA 5H68A 3ZQJA 1FDUA 1C1DA 3KUCA 4NMMA 5H4GA 4JI7B 4XJSA 1GZUA 1K7CA 1TQ4A 1Z4NA 4MP3A 3DTVA 4RQTA 1KS2A 3EFOB 1PZXA 1QGOA 1QM5A 3CNNA 3G49A 4XR4A 2XA1A 4IFBA 3WLQA 5DPMA 3H1EA 2QRJA 1TYBE 2QR2A 3MCZA 2PKXA 5BUZA 2NM0A 4HCJA 3W77A 1VYHA 5K3FB 3I2HA 3IBCA 4LI3X 1X8KA 1H6AA 2I8CA 2JPDA 2P1ZA 3BICA 4X6XA 3UB3A 4MQ6A 2NZ2A 5DTRA 4EKGA 1RJGA 2YMQA 1RHQA 1UT6A 1X14A 2XSZD 1YB1A 1KVUA 1U2GC 2FPIA 2OV1A 3GIDA 2XRFA 1TM1E 4RPGA 1MENA 3OJXA 4JFRA 4XGRA 3FDZB 2EIHA 4GOND 4U6QA 3MTQA 1OU0A 3UMYA 4U39A 1AQJA 4TZKA 4PYIA 3PSHA 1JMKC 4AJ2A 3WRWA 1ZESA 5BYAA 2A0UA 1KGSA 2CF5A 1RJ9A 1U5BB 4JT2A 2WHPB 3RIXA 3EVDA 4DCGA 4O1HA 2PBRA 4PZ0A 3GRFA 3SP1A 4B43A 3OCCA 5AHKA 2O7RA 3DTYA 1ZW6A 5DGHA 3GUYA 1LK0A 3RYFB 1QG2A 1Z06A 2UUOA 4AO6A 3J81k 1AQYA 3QI2A 4QRDA 4HAUA 1UOOA 2VHJA 3N6RA 4L0CA 4QELA 2FPGA 3TCNA 4C0WA 2XB2A 1E2UA 2P7IA 3OLZA 4B5LA 5CLFA 1QQBA 1PKEA 2C99A 4MZDA 4HADA 2AC7A 3TB6A 5JS2A 3VKUA 1GU7A 3ZYZA 3TJRA 4E5VA 3M8KA 3W2HA 2QAGB 2QI9C 2NXEA 5BSGA 1T3GA 3VX3A 2H06A 2ENWA 2JLCA 2CCGA 2YV4A 2V97A 3ZJ5A 1D4OA 4MGYR 1A71A 3H11B 1PS0A 1PL0A 1D04A 3KP1A 4LF4B 1TLFA 5K0GA 1T9BA 1ZOSA 2FPPA 4LXHA 2JARA 2AWOA 2R68A 4IDFA 1L7NA 4MVJA 4DA7A 2DTXA 1YI0A 1RAEA 8AT1A 5CAEA 4IUBS 3ZWPA 2BJHA 4FDLA 4J0EA 4J29A 1YWGO 3HU2A 3MJEA 4Z3OA 1P91A 1O97D 3QNWA 3WK4A 3H9QA 3NBQA 4TL6A 1AF4A 1GD1O 2FF7A 1OHHA 4CQJA 1A50B 1SQGA 2RHJA 4KW7A 1C29B 1XRPA 1NBEA 2XYRA 3OSUA 4MCAA 5DK4A 1B6RA 1U90A 4B74A 5CA1B 1O0CA 2HTFA 2JGNA 4RESA 4TT3A 2WY2D 3SLGA 1KBQA 4QGGA 1X13A 9MHTA 1LB1B 5CPFA 5KJ1A 1KMNA 3GB9A 1HE4A 2XQVA 3Q3GE 1G5PA 1ZVQA 2PUWA 2VJDA 3OZFA 2GM4A 2IZ0A 1YQUA 1M5RA 2CXOA 1M8KA 1TO1E 2VPXA 4B73A 2UUBB 4FOOA 1P2SA 2G9RA 5ENVA 1LV7A 4NEHB 1DBQA 5E6SA 4L3OA 4EYSA 5JHGB 4YA6A 5F3WB 1JIJA 2VHQA 2UXCB 4B3JA 1ZGGA 1RWVA 1XU9A 1FYVA 2J67A 4PLFA 2Y0EA 1U8EA 3HJBA 4M6WB 3JSXA 4ZVTA 2X3UA 3VNSA 1O6ZA 3WISA 4KN9S 4EG8A 3HACA 4MV5A 5SY4A 3SZOA 5BR7A 1ESEA 3RUEA 1Z4PX 1NF8A 4MV0A 4YDQA 3EGEA 5TQVA 1JE0A 3K70D 1SJ9A 3HJRA 2ZWOA 2Q0XA 3AY7A 4CR6A 4DMRA 4YAWA 1BOFA 1NBIA 4JT9A 1GPWB 3QRWA 2C8VA 1NJGA 3L8ZA 4JXJA 4WNAB 1SO8A 1RLIA 3D0KA 3MZ0A 4NJOA 4KTTE 4RELA 3VUEA 3HK2A 1B6TA 4FFPA 3ET5A 2ID9A 4JROA 5CM9C 2KBFA 2EC5A 1NXPA 1G4UR 4JLUA 1NULA 1QCDA 2ZWVA 4NCXA 3S1SA 3HCWA 5ALPA 3L6UA 5K3CA 4AS2A 3C8MA 3KNZA 2H3EA 5GV8A 2F1HA 3QI7A 5BNTA 2IVFA 3H9UA 4Z4GA 4MVWA 1C80A 2DUWA 1SPXA 1ILWA 1D07A 1KIMA 1BDMA 5KSWB 1T1SA 5HWSA 5JISA 1K8ZB 4AN4A 1BHO1 1E92A 4LGCA 4D8XA 2KM1A 4GVXA 2CK3A 3B1KA 1QB7A 1AB5A 3CKMA 5CTJA 5FKJA 1MOZA 3RH0A 3RS0A 1D2EA 4KR9A 3OQHA 3A1TA 2ZU0C 1GZ7A 2ISCA 2A35A 2E85A 3KOUA 5GGXA 3UPDA 1R4ZA 1CQIB 3LOUA 1GZHB 3VBEA 3TQCA 4MUEA 4I55F 1WBJB 1QSGA 3DWFA 5K3DA 4Z0TA 1GUDA 1R6TA 1EGAA 3AQIA 2BFDB 1BS1A 2XYGA 2PZ8A 4HRXA 4OQQA 3QF4B 3DLAA 4R8VA 2CZCA 3QMMA 3QYAA 3RC8A 3LL7A 3OVMA 4RDCA 2JNWA 1JB1A 3F90A 3L04A 2MINA 1CUHA 4FVTA 1EZ4A 3KUKA 2IL1A 4JDPA 4P58A 4LOJA 1G66A 1KJNA 2PEYA 3BIXA 2PZGA 2EJBA 3GGSA 4RETA 5LP6C 5LUBA 1VLLA 3DPSA 4E2ZA 3M6LA 4S2UA 3UOGA 5JSKA 3ACBA 4CKCA 2P2GA 4YVFA 1RNLA 3BAZA 1QJ4A 4S3MA 4LZZA 2C97A 4O0MA 3SNKA 2HQ1A 3OU6A 3ELDA 3KJHA 4YJGB 3GUZA 1GVHA 4LV5B 5EZYB 5F23A 1NVXQ 1Z35A 4F93B 4L07A 5LXTB 5CA0B 4KNWA 4MS1A 4I08A 1IEVA 1AUVA 4UCQA 1WPRA 2XTJA 1ZZGA 2DE0X 3QSYA 3GLGE 2Q2OA 3GJSA 1F60A 3S8YA 3MGKA 4RABA 2GDJA 3EMBA 5DN9A 3LUAA 4YECA 2GTPA 1CRLA 4EHDA 3KQPA 3SZRA 3LL4A 3TIGA 4XX0B 3SJ7A 5IANA 3E22A 3HKBB 2GM5A 3CZPA 1AC5A 5KQPA 4KXNA 4ZMSA 5CB4B 2ZYDA 1YDMA 4Y6GB 1M6HA 4LQLA 3ENZA 3NHBA 5HXAA 2V6FA 2ERXA 2G25A 1ISIA 2O2EA 1Z5WA 3EMKA 2JGRA 3IO5A 2P78A 4K26A 4ZT2A 4DIUA 2Q3MA 3E82A 3REQB 1DEOA 3H1FA 1VLHA 3TOXA 4H35A 4CTOA 1RI2A 2JJMA 4Q7KA 5C2JB 5BQOA 5BOSB 3EZ7A 1ECFA 4YIHA 5KNDH 4BECA 4F4JA 3OOSA 4G5SA 3ESBA 5T4FA 3LX5A 3H9EO 4D6YA 2C00A 1TZ2A 1X7HA 4R16A 4AKIA 1UDAA 5DZSA 3PD0A 4BYGA 2BBWA 2GPSA 1BXGB 3Q9UA 1NIPA 3I72A 5IHXA 2WT9A 2QBYB 3DFZA 5AVQA 2IDMA 3NHRA 1JAIA 2Q1TA 5AO9A 3V4VB 5DX8A 1OW3B 2PUHA 2HWWA 3RLFA 5KOJB 1IHYA 1LY1A 1OX5A 4Y0VA 3TIFA 5LU8A 2H4JA 4WNCA 1E9FA 5IKEA 2GBLA 1G8SA 3L8MA 5DYYA 3GR6A 4LJ6A 4ZQIA 2BSXA 3U4DA 3SQNA 2OXTA 4QU5A 4E5PA 3ZBUA 2FPKA 1XNQB 2Q1WA 2Q6OA 5IDXA 3JASA 1IB6A 2YHSA 4M0MA 2WPDD 1JQAA 1LWNA 2RGNA 3V8NA 2WFAA 5A5DA 4PTZA 5KSOA 4RTPA 3G0CA 5EJGA 3D7SA 1VSUA 3A2LA 5CIQA 2ODPA 5J5AA 4YASA 3WB1A 2P8JA 3GLIE 1QG4A 1YBMA 4GFDA 2BZGA 4K3VA 1US8A 1OWPA 2IXBA 3TSAA 3SG0A 1GGKA 3ITKA 1NFFA 1MPTA 3CEAA 2B9VA 2WBLC 1ODCA 4NDNE 1H4TA 5EJAA 1RADA 5JU6A 2II6A 1S2MA 2Q28A 5GAJA 1QMGA 1LC0A 3G0OA 4G5FA 2GN1A 4QXRA 1YR8A 4F85A 4GWLA 4RSGA 4F9GA 1EVEA 4M7PA 2P6UA 1Y6QA 1J9ZA 3NIGB 3LT1A 4R1MA 2F17A 2H11A 3OESA 3RHTA 4ZCIA 3AT1A 4PHHA 4RWEA 3DDWA 1M1ZA 2RK4A 3T7CA 1UFRA 4R71A 3E9NA 2A9OA 2EJWA 1SOWA 1DIBA 2CLDX 2C7PA 5JHHB 2JA1A 2BSAA 1H1TA 3IAS6 3OJLA 1ZVVA 1DLIA 1QHHB 2H2AA 4PZAA 4YJHA 3UBMA 1TO2E 2JJYA 4ZEWA 2Q07A 4BRWA 2BP7B 2LW7A 4P4NA 5LMNB 3FHOA 3EIUA 1FMFA 4D43A 4L78A 5LLSA 2KS6A 4CM4B 3CWZA 3MJDA 4IIDA 2A9KA 2WMOB 5LPNA 4EMUA 3RSLA 1CQXA 1BX3A 1K92A 2AT1A 5IKMA 3HA5A 1MJGA 5K6RA 1O9HA 2VH2A 3H04A 3M3DA 1M73E 3OIYA 6NULA 2SECE 4TMFA 4DQXA 1G3QA 2XGOA 1GLNA 3BB3A 3WGYA 1FLNA 1QQ7A 4MDFA 4PEVA 3GHYA 1LPSA 1P45A 4QUBA 2C3UA 2ZUTA 3AL0C 1S8NA 1SCUB 1U2EA 3FRJA 3Q40A 3A37A 5LKAA 1DQPA 4ND4A 8LDHA 1HNWB 4ZJZA 2JLWA 4HAIA 2QVXX 3UAOA 3G2JA 3M6WA 3LYUA 4B09A 1FMJA 4JB0A 4JWKA 4NLLA 4DCPA 2FOIA 5L6MB 3N39C 2VC2B 4JUBA 1P6XA 1QOPB 1TYZA 5BYJA 3WGLA 2WE8A 1DTWB 3T1NA 2V5AA 2GT1A 3KV1A 1QRSA 3K92A 2G8LA 4OI2A 1XJWA 3LDGA 4ZALA 1R18A 4E6PA 4M0KA 4OHKA 4M8SA 3HSYA 1WZEA 2QTTA 1Q92A 3IP1A 1UL1X 4FXOA 1BS2A 4UHEA 3IUMA 2W43A 3WL3A 4MMZB 1I4LD 1AXGA 4MQFA 2DCUA 2P4QA 4GKAA 3E5HA 1C9NA 2WJPA 4B79A 1N3BA 2DHCA 3QW2A 4LJ5A 1T1EA 3RAJA 2FQQA 1Q7CA 3GWZA 3UKOA 2YZKA 3X2SA 3TZHA 3AFGA 2G9NA 4I81A 3RFTA 5I45A 2JLBA 1P2BA 2C2BA 4A5SA 4A3SA 4Z6KA 4MW2A 3H7AA 3K70B 1QFYA 2QG6A 4O2AA 3ZDRA 4BWGA 5DM4A 2C7QA 4QWMA 3JAWA 2IJGX 5IEBA 3WFJA 1YB5A 1QTQA 1FTSA 3ZXYA 1GAXA 1ETHA 3BTOA 2XF2A 4WN3A 5EYPA 1Z6ZA 4QXQA 1NF2A 1XF9A 4AY4A 1DV1A 3TD6A 2UZ0A 1H0RA 2I78A 3W9YA 1J2TA 1SBTA 4IWNA 4F8JA 1HEIA 2BM0A 2VK1A 2WTMA 5G3ZA 3SBXA 3ZE8A 3F0TA 5CTAA 3UK6A 3JCZA 5HQ3B 3H18A 4B85A 2XI4A 3MQ4A 4UU0A 2EKBA 5CT4A 1GUZA 4D3XA 2IW1A 4MRPA 3DS8A 1X86B 2AOXA 4YB8A 3N86A 2ZQ5A 1EKXA 4IDPA 3ZE2B 1TTTA 4N0EA 3STUA 1OILA 5KVSA 2GO1A 1WVGA 4ED9A 1XAJA 3F5QA 1FP4B 1YJXA 5I5EA 1QRAA 4Y9TA 4BNGA 1XMXA 1H2HA 1YVRA 2FQYA 3JAKB 3KKEA 4XI9A 4ZCRA 2RGYA 4IQ4A 1UMKA 3K0CA 4L9SA 1BZYA 4UOQA 1FRFS 1U7ZA 1E62A 4MITA 4XIYA 5AVXA 1W2GA 3BK1A 1BU5A 2IHTA 3QTLA 3B9PA 2P9YA 2DUNA 4U6NA 4AMZA 1TUEA 2OXRA 4EG5A 2HIAA 5ESRA 2GEDA 3KXPA 4QHSA 1CR1A 1DJQA 4BMYA 3QWFA 1PQYA 2MSDB 1C7EA 1ODSA 2VHVA 2ZZKA 3DT8A 4ALIA 1OV4A 1U9CA 2IKQA 4HOYA 3DDZX 5HX7A 4MK4A 3U7GA 3PXDA 1N5IA 2X4GA 5A06A 2O2CA 2YH2A 4E70A 2IYWA 1UKYA 2XEDA 3UXMA 4ALMA 1X7GA 4OP3A 5G0WA 4R9NA 3RTBA 3S2FA 2QJFA 1G4HA 1KFKB 4JWTA 4LOLA 1JR3A 2CXTA 3NDPA 4EITA 4HGOA 4WKNA 3ZX5A 4XKJA 2RK3A 4E3WA 1I4TD 2I4LA 1XZHA 1RTTA 1ZICA 2RAVA 2ZJZA 4L75A 4LV6A 4BLTA 1E2KA 4ITUA 4JN6B 1JKJB 3OJCA 3IBSA 4WWHA 5ANRB 2HRCA 5GM1A 4OHPA 4ZYLA 5D3MA 3TNJA 1A8UA 2WTNA 5B7QA 1SQFA 3HJTA 2ZFUA 1P2DA 4D45A 2H4HA 4DC9A 4R6WA 3DFMA 4GUDA 3TLBA 5SYMA 3U3KA 3AUSA 3FYDA 4YRGA 3PK0A 5KYKA 5CCBA 1I6KA 4D0NA 2CLKB 2PX2A 4HN2A 1A77A 4XOIA 4ZXPA 3OWOA 4Q3DA 1IBSA 3IQWA 3ZGZA 3PPVA 1ZHHA 1JLRA 1GUAA 3OT4A 5HPYB 4JLOA 1CR6A 2P2DA 3OE7A 4IAOA 5E8JA 3SXJA 1MFZA 3DZKA 3LKDA 4D4HA 4F0JA 3WLLA 3PTAA 1MORA 1F1BA 4O59O 1UFKA 4CMKA 1VHLA 1E1CB 2YZ7A 2OCYC 5KYYA 1B42A 2B6HA 3F9RA 5E6RB 4BNHA 2C2HA 1F0KA 1PAUA 2A5DA 2VS1A 4NULA 2HB6A 3HM9A 4J0CA 4DUGA 4EPYA 4CCWA 4C3ZA 5E8RA 4LDZA 2WHYA 1KYYA 4CUZA 1NDUA 5KYVA 1C1XA 4OQPA 4RIGA 3VKGA 3ICVA 1U02A 2KWIA 3WY9A 1YZFA 4PZYA 2ID8A 2QTCA 3CLTC 2GO7A 2ERCA 3FAZA 3UW1A 3ZDYB 5E2IA 4JLKA 3ZD8A 3G2NA 4MI3A 2P7HA 3BC1A 1MEOA 4HR7A 3BD7A 3B6ZA 5TMEA 2Q4EA 1RYFA 4BQNA 1HT1E 4YCNA 5F4ZA 3DSRA 3W5UA 1IFXA 4B7ZA 1JQKA 2Q2VA 2VQDA 3LQYA 4LKOA 4Y2PA 1EEXB 4B34A 1N2ZA 5AKKA 2E2WA 2LIPA 1GZVA 2XCIA 3A9SA 1LLCA 3R3SA 4MJ3A 4MWDA 2WKRA 3MS7A 5HCUA 2R6JA 3GGCA 1VL1A 3KCQA 4NJMB 3T15A 4G56A 1U2DC 5KTYA 2PX3A 5FR2A 4EA8A 2ZTHA 5A0TA 1Q12A 5K8UA 4OBWA 2IYYA 4V0RA 1DCFA 1SA0A 2QOEA 5P8WA 3IQDB 2YQZA 5HMLA 4INAA 2IZ7A 1CQWA 2OFOA 3R20A 4BLOA 2BZSA 5E6SB 3TFWA 2ZSAA 4XVQA 5D3ZA 2G67A 4IVPA 1TRHA 2QN3A 1GDTA 1XCBA 3VNQA 2JB9A 2L42A 2YW9A 4B3DA 4XCQA 3B2QA 3FKSD 1NE7A 1SHLA 4UUBA 3DV2A 821PA 3JWIA 1Q44A 1GYRA 4I1UA 4RA9A 1BH2A 4ISCA 4PLCA 5ALOA 1DAHA 1XBTA 5GQSA 4PWYA 4QASA 5DHPA 1JHPA 2B8WA 3ED1A 3EZXA 3LQQA 2NGRA 1J5PA 1A88A 1RYYA 2XWSA 3CONA 3WBFA 4QECA 5FIUA 4D42A 4DG9A 2O19A 1U99A 4H2DA 2BH2A 4MS4A 1DXHA 4MVJM 3AOGA 1QDUA 4Y1RA 4NTZA 2JGLA 1SAYA 2XGSA 1B1CA 3WLSA 1II0A 4AB1A 2V8BA 4PQEA 2ZT6A 2X0EA 3CB4A 5D84A 5J1TB 1TUBB 3KL2A 3TQIA 2G77B 2PRIA 2YXDA 4PRZA 4ML3A 5D3KA 4J16A 3VPAA 4V03A 1RFGE 2QIOA 2CV2A 3E9CA 1XKLA 4DE5A 2FSVC 2WAAA 1DUIA 4KXWA 2OMEA 2WJVA 2YQ5A 3ZIUA 5FTLA 2P9JA 1HDYA 4BBAA 2PVSA 2GK7A 4UDXX 3U44A 1TA9A 3PZRA 2XNDD 4JVNA 2C78A 4Z49A 5BUSA 1UK8A 4Y2JA 4C6TB 3E3AA 1ZUWA 5LBIA 1S2IA 4E94A 3DZDA 1NNEA 3SDBA 4P7GA 1JDVA 1ZMBA 2WP0A 1G0OA 2GR9A 3AFMA 1BS9A 3W5VA 4EJSB 3T1HB 1L4MA 2AR0A 3F4BA 1YR2A 3THSA 4BFTA 2VR1A 3SIPA 2C96A 4HSEA 5WRFA 1XZ8A 3COWA 3GG9A 3MCTA 2WT4A 3PWSA 4XZ3A 4HDSA 5G02A 3PJRA 1EDOA 5THQA 3CPEA 3RIMA 3TRKA 1KZ6A 1U04A 3SVLA 4FHFA 1EU1A 2AFRA 1NYRA 1P19A 3IBGA 2GYWA 4LWZA 2BMWA 3L1UA 3P5SA 3SZ3A 3T7DA 1Z5ZA 4EY8A 5I7EA 1OH7A 1TEHA 2MYNA 2BMFA 4HLCA 1N8KA 4F11A 2BH9A 5HFAA 4OGLA 3EFEA 2GMWA 4IXMA 3GCGA 2I3GA 2V0CA 2Z5FA 4Q66C 3MGCA 4EKDA 4L08A 2WK1A 1WLSA 4LXGA 4RYLA 5B55A 3IVCA 3K15A 1P2FA 1YJQA 3PCXA 4U4AA 2P9BA 3OCYA 1CHDA 3BXOA 3HUDA 4I5IA 2Q4RA 4X8LA 3T61A 2NYRA 2ZI7A 2R6GA 3I6BA 1K86A 3H5LA 5DCLA 2AG5A 4DY6A 1WHTA 1Z5GA 1YJ5A 3GA7A 3GGGA 2DPLA 2O5CA 4V39A 1M6WA 4MWBA 5JMTA 3TVYA 1XP5A 1HNNA 5DNYB 4ZU6X 5B64A 1NBWB 1I6WA 3VYTB 2BI8A 3GGJA 4X64B 3I30X 1BD4A 1M8JA 1OBHA 2ZSEA 4HMPA 3SN6A 3GVCA 1WCYA 2XE6A 3CX6A 1YKGA 4QFMA 1GNRA 4QDTA 4TMZA 4ZVVA 3GFTA 4YRAA 2A94A 2PGNA 4L9RA 4DCMA 5CB4F 2WWWA 4Y2QA 4YI3A 1EZ1A 2XUAA 3EF3A 1SUPA 2BAGA 4LXIA 2ET6A 5HM8A 1ISJA 4AVYA 3GEEA 1SUIA 4DR4B 1BDIA 4UZFA 2Y71A 1NN0A 2CDCA 2X1VA 3C3KA 2GCOA 3W1VA 3W4KA 2HYIC 2A2ZA 3PC8A 4PGHA 3VNVA 1I30A 3LO5A 1WIWA 4NBUA 4KXUA 3MWFA 1MGOA 1N5RA 3I73A 2PWPA 1M74A 4AURA 3W04A 2DY1A 3K6JA 3N2ZB 4JBGA 3WS7A 1XDDA 2RMKA 4IH4A 3Q7TA 1KO1A 1N5OX 4JBNA 4DR3B 1U4NA 4BEVA 2O3RA 4NVRA 1MX3A 1A4IA 2C8JA 3FUTA 4IXTA 4R05A 1HORA 5E0OA 1D2RA 1C3OA 1R4NB 4D8WA 2PFGA 3B3FA 4UC0A 2EQBA 4DQ0A 3NVDA 2XECA 5FPSA 4BO5A 3I1IA 1T9DA 2C2KA 1GCIA 4QYTA 4X1KB 2CVPA 2CMKA 1RACA 1E1QD 4FYIA 2JGKA 4LAFA 3U9SA 4RD3A 4TVSA 1FP1D 2A59A 3R3JA 4NHEA 3T4PA 2X8AA 3AFOA 3ZQ6A 1A2QA 2ODBA 2VDPB 2OPHA 3OEYA 4CFYA 1NI4A 3FUCA 5CX4A 3VAZA 4DCSA 2CBXA 4XB6B 3E2MA 2GERA 3BUSA 4ND8A 5DLYA 1P31A 2Z6QA 1E3DA 4G1UC 5JI3E 3MILA 1MB4A 4GOLD 4IO1A 3RC2A 2ACVA 3BEDA 3OM1A 1G55A 3EUEA 1P0QA 1QR6A 2EZ4A 3M0EA 1N78A 3SC2B 3U3XA 3WMRA 2I3BA 4I9UA 9LDTA 1FRNA 3HBMA 4EI2A 3AVQA 2UYOA 1T3HA 1XELA 4PBTA 2NTJA 3ROMA 3CVWA 1BXRB 1LCIA 3UW3A 5CURA 3IX7A 2G07A 2W70A 3R7BA 3N9IA 4ZAGA 2H2DA 4UBKA 2FX5A 4JMLA 3T5BA 2VYVA 2CJWB 1ESCA 4GLLA 4YJHB 4TV9F 1QZ3A 2AG0A 1EFPA 3X44A 2WM3A 2VHWA 3I6ZA 3OCXA 1S3FA 1ZA2A 2GF9A 3WG9A 2MT9A 5LZ2A 4BZWA 2XB4A 2RI6A 3VVLA 5KWVA 3KOZA 3OLWA 2AZDA 5DO9A 2CVOA 5F2KA 2H4XA 5G0SA 1R27A 2EJUA 1T5TA 2A7XA 2D2VA 2ST1A 3NEYA 4XQ0A 3FYTA 3P2MA 1K66A 1LLQA 4UDYX 2ZTLA 5FTJA 3KUUA 3SQOA 3ZHSA 4KNYA 4BV9A 2X3FA 4Q02A 4ZICA 3LQKA 4YWJA 2N47A 3T7EA 3EFBA 3OOYA 3WJ7A 3GJ5A 4QNNA 1KYXA 1JQ3A 4KV7A 3QVTA 4LJ4A 3WL5A 2FEOA 2C42A 4A0QA 4EO4A 1ZMOA 5JDCA 3DPIA 4ZODA 1Z63A 1NNI1 1VHTA 4EZEA 1VMAA 4OI4A 2DPXA 4NG5A 1WX1A 3RQSA 3X2EA 4WKGA 3LBAA 5FPYA 3AKDA 4WXHA 1M1YA 2O2SA 1K4KA 2R84A 4PS0A 4YAIA 1NC3A 5EZSA 3JPWA 2A58A 3EN0A 2DR0A 4MVJH 2UUCB 2BFFB 1DQRA 1CU1A 1F2VA 1GSHA 1Y80A 4V0QA 1CULC 3CZMA 5BV2P 5GADl 3K9FC 4PF1A 3QA3E 2CVQA 4K6CA 5KTMA 2BFCA 3OECA 5EMLA 1A8QA 2IXEA 2ECFA 3QJ5A 4ZT7A 3LNCA 4FKZA 5BV8A 4TMTA 3P5BA 3MUEA 3A1CA 5H83A 2R1TA 3U2QA 3TQTA 4RPKA 5AJWA 4RTSA 4RA6B 2YR0A 1ZOIA 2GVNA 4LOHA 5E2AA 4BKOA 4OOEA 4YJ3F 2CYBA 2C2MA 3Q3VA 3U09A 2A14A 2Q46A 4JEMA 2X2PA 1PV4A 1OLXB 2HYDA 1MZVA 4IMRA 3RB8A 4CQMD 1KEEB 1QPBA 4JC8A 3D3NA 3FMFA 4CR7A 5KYWA 2GDZA 1X70A 4R1UA 3VR6A 2FSHA 4JUFA 4JJAA 4WW0A 4I5GA 5CDFE 4FLEA 1V6CA 4Q3KA 3P32A 2CXRA 2XA2A 4MEBA 4YRPA 2OYCA 4RTRA 1KTIA 3B1FA 2O8DB 2A9JA 3O03A 4RGQA 1EFCA 1P9LA 4GOOD 1A9TA 4AJ4A 4Q3OA 5DN6D 4DLKA 1PFQA 4WJKB 1J70A 1GLVA 3PGLA 3R41A 4E30A 2O0KA 1CV2A 5AXDA 5MN6A 4CQLA 2QU8A 4ROSA 3D6TB 1UAYA 1MJGM 1X7YB 2HA0A 3EPPA 1QNFA 3LGSA 3ND8A 5EUMA 4EAQA 3C8ZA 1R0ZA 1J5EB 2NU6B 4GW3A 3RS5A 2D00A 5EWJA 1FNSA 4RV4A 2HADA 2O5VA 3OCZA 3VH2A 4YMUA 1FNDA 1CY4A 2NPFA 4CT5A 3KJEA 4G0OA 1E20A 1UJMA 2WWVD 1T5OA 4Q7EA 1BCSA 1U7UA 1EFHA 5FV4A 1PRYA 1WHSB 1M1NA 2PPLA 4WRRA 4HS9A 3RRJA 3ZCXA 4OLJA 1NHWA 3W8FA 5HOQA 5H9WA 1J8QA 3VQTA 3N2GB 4ZOCA 1TW3A 1QTNA 2GQ0A 1DKLA 2NZUG 2WYHA 3GLRA 3L92A 1M66A 3QUCA 3V7FA 4BBPA 1QH8A 4BKUA 4BLWA 4BHTA 3KKKA 3VO1A 3LJKA 3ITDA 1E2HA 3T7SA 1T2FA 2O2YA 1U7DA 4ZO4A 5L4SA 4MTCA 4PTYA 1ISRA 2IODA 3G2IA 2RH8A 1GP2A 4LGYA 4TQ9A 2JBWA 4E4TA 4P34A 5C52B 4XFDA 4LF8B 2I4IA 1MJFA 2NTEA 4IWYA 1E1YA 4X7BA 3QX7A 5FNVF 1T4DA 1WU8A 4MA4A 3TKYA 4O4HA 5KWSA 3I62A 4N9QA 4KAJA 5CXUA 3VH1A 3OBIA 1W30A 1CF2O 3ID6C 1ZK0A 1RIFA 3H4TA 2B1RA 3IELA 1AJEA 4PLVA 1WBDA 4OQXA 5EJ7A 1BDBA 2JIMA 2XPCA 1KRHA 3EWNA 2WAOA 4V0MA 5DYNA 1L7DA 2AFIE 3HFGA 1P0MA 5KOHA 3QWHA 1AQIA 3BYZA 5CVJA 4JFAA 1G38A 4CKXA 4U9UA 4REMA 2Y1EA 2C4MA 2QN1A 3ECSA 1HYGA 5G2OA 3DCYA 3IPXA 3O0TA 4BNZA 3W7BA 3CT6A 1T2EA 5D3QA 2L2QA 2YY7A 1YRAA 1F4PA 2PSSA 3B1JA 2WHEA 3JARA 3ER8A 5EFOA 5SYNA 3P2KA 4M9CA 5EN4A 4Y0NA 1T4CB 2IVZA 4KG7A 3GFGA 2BM8A 4FKBA 3AL3A 4GXNA 3A2MA 3F3MA 3IFSA 2TMGA 1QLHA 3HR8A 3A06A 3S81A 3WFIA 4ZQHA 1GAEO 2BEKA 1OR8A 2VYVD 3EPKA 3ZDZB 1KQOA 1OX4A 2YVLA 1JH8A 2X42A 5ESDA 2FPXA 5DWDA 2FW9A 1HNZB 3UMCA 3QFFA 3DDOA 3OQ1A 2PDAA 4O8CA 4BAZA 2NXJA 3G68A 1XR3A 3GELA 1U7TA 3UJ8A 4FGLA 2XNCA 4BUJA 1CS0B 4XWYA 2AOUB 5UKDA 1UP6A 4N82A 4TTQA 2ZI6A 1Q5PA 2R6DA 3LT5A 1E7WA 1WQ1R 4ZOEA 2XE4A 3RASA 3PNVA 1WXHA 3F8TA 4PBSA 1CDZA 4CNQA 3HZRA 4Z1OA 1MRNA 1CR2A 1V5IA 1G2OA 5HJEA 4EB6B 1R0XA 3G2PA 1G19A 4GXRA 4DLRA 3L7IA 4MVJF 2R8PA 4DIKA 4LHXA 1GTSA 1MZPA 2O8FB 4N7RA 3U48A 1MC4A 3DR3A 1MP0A 5AIBA 1WCWA 1BO6A 5DSZA 4AY6A 3HYSA 3KB6A 5A5GA 2J0UA 3CCFA 3L0YA 4DCNA 4IJ5A 2R85A 3CJQA 2Y3IA 4UXIA 1NSFA 1AS0A 1Y4AE 3MS4A 5BSVA 2VPIA 1QS0B 3V1NA 2XYQA 4Q93A 1D8TA 1SEVA 4R68A 5FI5A 3I04A 3ST7A 1QCCA 3C15C 3WLPA 4URUR 2HUPA 4G0WA 2HJVA 3OTOB 5HCIA 1XLVA 3G0IA 1T5HX 2C2ZA 3IBFA 4UDOA 1JIKA 2AE2A 2CVZA 4DRXA 2G09A 3L06A 1WO8A 2O0JA 4GMGA 2PS3A 4QVGA 2PO5A 3P9QA 1QHYA 5EKTA 3R76A 3TI7A 3OE5A 3HG7A 5KO2A 3RSSA 4BO3A 3QIAA 3RR2A 5FUXA 1BYIA 4M9QA 5TVGA 2GTIA 3I5MA 4BTLA 4B6QA 3NTLA 3WLFA 3ZHUA 1HXHA 1T29A 4FFLA 1J1UA 1U3UA 1DG1G 4M76B 1DX9A 2C3PA 1X1EA 2WSSD 2YS7A 3DAHA 2H1HA 2HZ7A 2WM8A 2C59A 1RRKA 2ZUDA 1VMDA 1I13A 2BONA 2PPVA 2QLNA 3M6IA 7MHTA 4NR0A 3DUWA 1IE3A 2WW8A 3WYAA 1YBHA 3SX2A 3SHFA 4BJ1A 4ZHQB 2QX6A 4RQAA 4OSPA 1FX0B 1XRQA 3TMAA 2QENA 4CMHA 5IS2A 1MEJA 3LH5A 2PA3A 3IP9A 1NN5A 1NF9A 1KVQA 3BXGA 3OKAA 3TSWA 2QTZA 1O4WA 1Q20A 1YB2A 5IAKA 4A26A 4C7BA 1SD5A 3QPVA 2BTQA 4MPDA 7ADHA 2OO3A 2YJ5A 3VR0A 5KNBD 2JEOA 4K88A 1WSAA 4OHZA 1Y4SA 1YVDA 3T4UA 4HWOA 5HUJA 1E6CA 1PTJC 1EG2A 1IN5A 3DMFA 4EARA 2GESA 1IVSA 2VF8A 2D5IA 1MUUA 4HGYA 4UM7A 3ZU2A 2QX8A 1DWOA 2FQWA 1WZCA 2Q9BA 4NCAA 1AT1A 4E22A 3A05A 3UMBA 3IOCA 4BUCA 1J06A 3TTWA 2MDTA 3FYUB 5CLGA 3S7ZA 1B15A 1Q83A 1GSAA 3SF0A 5I4KA 4DRYA 2BGIA 1CVRA 3K5WA 2B21A 1XN1A 5H1YA 3HDJA 3EG9A 2X5NA 2NV0A 2EL7A 1NM5A 2FRVA 3SYLA 1CHNA 4Y9DA 3WLKX 4I5DA 3U7HB 4G1VA 5DW0A 3TW8B 3AOEA 4CQMB 2W2KA 5AJTA 3MAGA 1VSQA 1L4BA 1JJ7A 5F9HA 1E2NA 2ZS8A 3NTOA 4ZO9A 3UCXA 1SC6A 4H3HB 1BEUB 1N36B 3ZXIA 2CJXA 2UUPA 5AJUA 4BPRA 2DPMA 4DOMA 1T8WA 5ILQA 3PHLA 3PUYA 3FPJA 3OCVA 2UZAA 4NK5A 1WQ4A 1TZBA 1JR4A 1FYWA 4CI0B 5A03A 4AMVA 1U8UA 1RXWA 4WXYB 1A3CA 2GCEA 2ZRHA 4W82A 2E7ZA 3ZZNA 1E6EA 3SYRA 4A8JB 4O4JB 3ZI4A 1AY0A 1M8PA 1OYWA 3OCJA 3VSBA 4N48A 5CJJA 3IEVA 1VQ1A 1SK8A 4QEDA 1FDSA 1RQGA 1PJBA 4KL8S 3G8BA 4YMVA 4MXDA 3RODA 1OXBB 4U7GA 1NBAA 1U3GA 1NVKA 3CX8A 1GGMA 2ACKA 1AQLA 1UBJS 3DLPX 1W49A 4GGMX 2BMAA 3IT2A 3SYNA 3RVOA 2FE1A 4H3KB 4RVDA 2D1QA 3UNXA 1RQ2A 3VSAA 4UTRA 4GR5A 1WPQA 3VGPA 3F5MA 4HH4A 3LX4A 4OAQA 2BTEA 3A1UA 2O7VA 3C43A 3I53A 5FBQB 3UK0A 3V1LA 2VK2A 3LQ1A 4MDEA 1QYWA 3HFRA 3R9XB 4RMIA 4UAGA 3HVRA 5F3RA 1FFBA 3UMFA 1BCRA 1DZ3A 4GRDA 1IQPA 4D3FA 4J76A 2ZUCA 3GY0A 1Z6GA 1W7AA 1QQTA 1E8MA 2HWXA 3RHZA 2VOJA 1HL7A 4LMPA 2CYAA 1KEKA 2BJVA 3LHFA 3G89A 4WSOA 1RHUA 4AQYB 2B9EA 2GJKA 1UBTS 4G3XA 3S8EA 4R41A 3IL2A 1QFSA 5CDGA 2IYLD 2FZCA 5A62A 1QHGA 1X0XA 4INZA 4DTIA 3WRXA 1TM3E 2WU1A 1OA1A 2V7PA 2YXNA 3GAMA 1LC3A 3QF7A 3QQPA 4G0MA 4IVRA 1R0SA 1QO7A 1FDWA 3KS9A 5BMVB 3O9VA 3V32A 1T2VA 3UTCA 2C4UA 2WWTA 3HUEA 1TZMA 2ZM5A 1RZRD 1JXQA 1V4NA 5GINE 2QX4A 1D0SA 5FFFA 1E4EB 1UBSB 2VDUE 2Y67A 2VEOA 2WJZB 4KXMA 3RUPA 2XMQA 3DBRA 4BASA 5JQGB 4M87A 4XWGA 4LI0A 1IONA 3PQ2A 1ZD9A 2Q8QA 4B31A 1E32A 2NAFA 1P1KA 2AKAB 4L16A 2Y2UA 4K9MA 3E7WA 4JEHA 4BGUA 4BNDB 1QYDA 4ND8B 3L8HA 3KSAC 2AW3A 4QRHA 1IHOA 1AKEA 4YFYA 3LD9A 5IVKA 2F1KA 5HVNA 4GMDA 5C53B 2QN8A 4RIIA 4XPIA 1HZJA 3C3AA 1TVKA 1W73A 2GUGA 3LYHA 1XQXA 3BRCA 4LG1A 3JV7A 4V24A 3OLVA 3UUFA 4NIMA 3Q8KA 4YO8A 2XE8A 1X0VA 1I4DD 2WD7A 5IAAA 2P30A 5K8VA 5A3SA 3U56A 2VP4A 1T36A 1PJ4A 4CM8B 3MGGA 3EXFA 3Q7IA 2I22A 1KRWA 2V54A 2GFHA 1YB7A 4JH0A 4ZC8A 1ENZA 1OV6A 3TVTA 3V8BA 2OCGA 2TRSB 4ANFA 3UJCA 3R7DA 1W76A 2NADA 3L6DA 3K0AA 1TJYA 5KI6A 4CVNA 1UBCA 3VNAA 3AB7A 2PYIA 4X24A 3CLSD 1FSPA 1QTIA 3QH4A 1I4WA 2VNIA 2P27A 1R9JA 1CUJA 3HB0A 3NW9A 4K9SA 4LIPD 1SVIA 3SCZA 6GPBA 4MW7A 3ABOB 4D9FA 2LRHA 1XC7A 3HC7A 1KOJA 4FMBB 3TKLA 4I1OA 4EL5A 1A9OA 2H4YA 3KBOA 4P36A 4EKNB 5E6UB 2X76A 4DFDA 1H2FA 4TUYA 5KYGA 4PO3X 2PUTA 1V5EA 2JGDB 1FMCA 4PQYA 4XYEA 4NYMR 4PZDA 3BCSA 1NY5A 2EARA 5J2UB 1RZVA 4S1PA 2ZJ1A 1WUIS 1CRPA 3ILYA 2G5CA 5ELMA 3MB5A 4MHSA 3PC2A 4FFBA 2EGHA 2OHFA 4ZN6A 3NPAA 1JHZA 3MINB 1JEJA 5B53A 1U80A 2QPLA 2I76A 5BN4A 3PNBA 2O8CB 2DHEA 2EQAA 3OZTA 4Z53A 1XRMA 1M2VB 2GNOA 1IZ8A 3CSUA 5L45A 5IJXA 4Y6SA 3NWPA 1EESA 4DWWA 4HEHA 4NESA 3RG8A 3IJEB 4ECEA 5FHQA 3V6MA 2O5EA 4PBRA 2R1TB 5DYTA 3FCXA 4V0NA 5JC1A 4Z0PA 1UDXA 2FZGA 2ZIXA 1E7QA 4JLSA 4HFJA 1ADCA 3LS2A 3NM6B 2DGDA 2LNDA 4N6OA 5BWCA 3SBEA 3M7IA 1NQTA 1UMDA 4Z4EA 1MO5A 5FFNA 3AHFA 4GM0A 2N9UA 4PRKA 1YZQA 2ZRDA 4W6QA 3EDMA 4PNPA 5KYWB 4QT0A 2XF8A 1NHGA 4U3JB 5MGNA 3RANA 3SEQA 2FI1A 5JH7B 4PIMA 1LRKA 3TQRA 1K6EA 5DBIA 3FHLA 1P80A 5EZ6B 5HFNA 4D9CA 5JC8A 2R7NA 4R01A 2GHQA 2P3QA 2Z58A 1GLGA 3C6MA 1V4BA 3B3AA 1M5UA 2IF0A 4O2AF 4XVHA 1I1QB 2H29A 2ATCA 5BW6B 1I33A 2QNIA 1ZAYA 1ORVA 3EVFA 2WNHA 4FHCA 4ZQBA 3I5AA 4OXNA 3F7MA 4MWZA 5DYWA 4BZZA 1U63A 3KPVA 2ZBGA 3DKRA 5DTJA 3U60B 4K9RA 2ZTVA 3RWOA 1PS9A 3KOWA 4R5MA 1QH0A 4LRXA 4JHLA 2XCTB 3IUJA 1DAPA 3INNA 3N0VA 4NF2A 1T91A 4BX8A 4OCZA 4IF4A 3VR4A 4Q4CA 4DQVA 5KKCA 3ZHXA 3OAAA 5EEGA 4D3SA 1PG2A 2VZ9A 2IXAA 2ZBDA 3MD9A 4WK6A 4QAQA 2PUJA 5JE8A 4DJDC 1L3BA 4X7MA 3LK6A 1XK7A 2B78A 2XJ9A 1L8LA 4OGKA 4AAYA 4BP1A 3M81A 1GO2A 1Y1TA 5C8YB 4KVGA 4O4LA 4DSNA 3IXLA 3KTAA 3NIWA 4MS3B 3IQEA 3RWBA 5DOZA 1UKZA 1AB6A 5D5PA 1Z4KA 4M37A 2C07A 4K81B 1CERA 3GA0A 5EQJB 1H0SA 2XR1A 2ZRJA 4GYJA 4INOA 5GJVC 1LDMA 1XXHE 2HBQA 2VJCA 3ZCQA 5ITWA 4TN1A 1NBME 5ER6A 5I5GA 1HEYA 5ECGC 1ECCA 5IK2A 3SSNA 2RSLA 4D4IA 1P4SA 4D9JA 5K3BA 1MV5A 1O8CA 4W8OA 4Y2VA 5AM4A 1XQYA 4ZT5A 4AJIA 5LZ9A 3S68A 1UM8A 1WW3A 2AQIA 3GDGA 2ZT8A 4ACBA 3ZCUA 4FBGA 2C9DA 4PYNA 4JAVC 2PT9A 3QEJA 2VJAA 3Q15C 4TVBA 5KOYA 4Q4JB 4P0QB 1GUFA 2VJQA 4MPJA 3UOWA 2F1RA 2JKYA 2GOYA 2HDOA 4LOKA 3M6MD 4BP3A 3UT6A 2YTZA 3L40A 1RLMA 4I6JA 3UAZA 1CLEA 4IOKA 1BOOA 4WFKA 2BHNA 4JP3A 5B1HA 3SAJA 5EL0A 1ID8A 2N46A 4JXXA 4BVGA 2JD1A 3MJCA 3AVWA 2GSDA 2XGGA 2B99A 3RNLA 2GAJA 1ZM4A 1B8UA 3OZAA 4E12A 3I9LA 2P65A 4HDMB 4CV0A 1I2MA 3FRIA 5HRCA 1JILA 5TMDA 3JWHA 1DDOA 2C57A 2VUUA 2QK4A 4XTRA 3RROA 3WZ2A 1H9AA 4R83A 1NZDA 5ECYA 3VPCA 3ZN2A 2V5UA 2HA3A 1PQUA 1ZJ5A 4I5FA 5K8LA 1E3QA 1JA1A 1KFJB 3JARB 3MQ2A 3H9BA 1IB0A 3NIDB 4KWCA 2UVQA 4OXIA 4PLPA 3ZHVA 4Z7QB 1BRMA 5JPDA 4LSWA 4JZKA 3BTUA 2NUPA 1PJCA 1EUDB 2JAUA 3T9DA 3KL4A 1R8JA 2GD2A 3DBLB 4M36A 2OORA 2G3YA 1Z56C 3MN1A 1LPAB 2DXIA 1RJFA 2OXIA 4DRZA 2VUSA 1OKKA 1M2EA 2HU2A 4H3SA 4OQMA 3EPJA 1Q7TA 3HP1A 1ESDA 1M3SA 3ANNA 2BFBB 1C4XA 3JD4A 3U7QA 3R6GA 3WGZA 1DAIA 3RJ5A 1PK8A 1T13A 1BHJA 3PQDA 4ZVSA 2XZTA 1AZWA 2WSIA 16PKA 3URKA 3LFTA 2HPZA 2WYWA 2QY6A 1CD5A 4US0R 3UWDA 1C4OA 1UC8A 3CKKA 4LDNA 3R0QA 2G76A 2NSDA 3RJ9A 2WHRA 1Q3TA 3E8XA 1CF4A 3SD7A 3PU6A 1WE2A 4P35A 1EGQA 4XUGB 3TWOA 5AUOB 1GTVA 2W8BB 2VDKB 5I7UA 1GYPA 4RZIA 3HCBA 1L5FA 2ATEA 2EDCA 3TBFA 1F8YA 1ML3A 2K6GA 2GXSA 5CM8B 3NVKI 2OLJA 2UZIR 3CGWA 4KUEA 2BT4A 2XLCA 2ZPTX 3DOHA 3H5IA 2F1JA 4N01A 1M2NA 1NW5A 5DJ5A 3K31A 4C3OB 2PU5A 1RXCA 3QITA 4JLVA 4D81A 2YWHA 4UAVA 3D02A 3DF9A 3UXYA 5BNWA 5ITVA 2Y2VA 3ANLA 2YNMA 1R9NA 1RE0A 4CDGA 4CR8A 4GMFA 4ZI2A 2XNSA 3WNQA 5I9TA 1IZYA 1ZWLA 4WL0A 2HREA 3N76A 2Z2IA 2Q0HA 1PSZA 1XRLA 4MVJG 5EG5A 2OXEA 2XQGA 5K4GA 3GLIA 3NTVA 3NBAA 3DVSX 2C20A 1NBHA 3IALA 4NZNA 2HMVA 4HXFB 4QREA 4E11A 1RSZA 2XOEA 2R00A 2Q3EA 1JFFB 2ORYA 3OY2A 2A57A 3VOBA 3FNHA 2DCMA 2FJUA 3G5TA 3GVHA 5I8WA 3U1TA 3DYIA 5LUAA 4D6XA 4YCAA 1R1DA 1JEOA 2FMIA 2JHPA 2ZJ0A 3VDNB 4C7XA 2ZKLA 2Q27A 5J4YA 4NAUA 1MEEA 5LKRA 2HEGA 2Q9CA 5KU1A 4QDUA 3TNDA 2IEDA 4H1UA 5CJ2A 1P6QA 1ZVMA 2Z9CA 1EBFA 1KIFA 2OO7A 5J47A 1MX1A 4KEAA 5AW1A 4AROA 3UH0A 4CKWA 5C5DA 2G1JA 3E4DA 3SXUB 1LX7A 521PA 3VYUB 2RBEA 1DV2A 2CE7A 2ONYA 2GZ2A 2F1IA 2Q2QA 3FFAA 3PGKA 3K8OE 2RONA 4JA2A 4JKOA 1P5FA 2WTEA 4F91B 5CM2Z 3E0XA 1J7KA 4LEIA 1YE8A 4PAMA 3O3CA 5I9BA 1QLJA 4NBRA 3RSHA 1U81A 4UTNA 3D2LA 5M5BA 2WU8A 1Z0FA 3AM4A 3GMDA 1L4HA 1AKNA 5IAJA 3T1YB 1TCUA 2YFYA 3O8OB 5JLAA 3ZHRA 4LPKA 3MVEA 5B4TA 4ZHQF 1A98A 3EUAA 2FEPA 3W6OA 4U0KA 1C3VA 1KKLA 2R6HA 3P9NA 4I4CA 3LWBA 3O47A 3IDOA 4N6GA 1J8VA 4PCUA 1KDYA 4ER3A 4CLRA 2UU9B 4GWKA 5B7NA 4A73A 1XVAA 4FE4A 3HJFA 5IVDA 3NKLA 1ZD8A 2CLCX 2CNNA 4L5YA 2QHXA 3LMKA 2HGSA 4ROTA 4OMUA 2GEJA 5HJ7A 2YJNA 2HC9A 4WEOA 1BW9B 2A0FA 4P3YA 4OUDB 5IEJA 3JWEA 4L3VA 1QF7A 3BH6A 3QLTA 4F3CA 3QEOA 5CYFA 4CMJA 4OFXA 5EPEA 2AZXA 1Z29A 3JZAA 1PCXA 1T9GS 5EWMB 3EWSA 1QVVA 2ZDHA 3GCXA 4WMLA 3A4VA 2VF7A 2YWXA 2W90A 4IGKA 2WWRA 5DYIA 1SBYA 3D9QX 4KUHA 1VJRA 3T7TA 3X0DA 3KC2A 1LF5A 4JELA 2OCBA 3DEIA 3VU8A 4ZI3A 1XTQA 4E1BA 4KIFA 2DMRA 3VV2A 4E07A 1A9QA 1QFZA 1OI2A 2G7MC 4CG2A 3EDQA 2R9VA 1CQZA 4S1NA 4WFJA 4ZJYA 5C7IO 2X0RA 2EAUA 3I3OA 1GYQA 4LPSA 2ORWA 2V7UA 1GNPA 1N6LA 5GP1A 4KSYA 3AV0B 3FJ1A 5L7YA 3AF0A 3BGSA 3F2IA 3Q12A 4S35A 3ZGVA 1GGJA 4R84A 2IOQA 1YONA 2BRUA 1O95A 3BDAA 3JX9A 2NU7A 3QKSA 2BCEA 5E1BA 4YP9A 2GRJA 4UD2A 1QCZA 3GN1A 4K3UA 4V02A 5K0LA 2R11A 4AQDA 1M2OA 2OK7A 1GGNA 3KLMX 4HAXA 4EY4A 2IQIA 2OZLB 2RI0A 4QC2A 3EARA 1U6KA 3IQFA 4IRXA 2QLFA 1Z0JA 2V0NA 2AE1A 4AICA 3R4VA 4G85A 3VPDA 3DA8A 2GCGA 2A5YB 2K7ZA 5C5EA 3D6NB 4FNGA 5JZMA 4MR7A 1TCAA 1WLYA 1W0JD 2G36A 4IMPA 5H02A 3X1MA 5EC8A 1OBFO 2YN2A 3OEWA 2B0JA 1NMSA 2IYXA 3BQ9A 3JQFA 4L8FA 1DRUA 4BGDA 1FPQA 3I76A 4AZ0A 3DFFA 1RPAA 2Z1DA 3A6GA 4F2DA 2FX2A 3DT9A 3JYOA 5JAZA 1TQ8A 3AF3A 1CFZA 5PGMA 4EY3A 1HTWA 1DC5A 2GD6A 2ZIVB 2J4DA 3EWIA 4G86A 2H59A 2H6EA 3C3DA 3EVTA 1V8FA 3K9BA 3LYLA 3DDUA 4P83A 3QE9Y 1V7QA 1KP9A 1PJQA 1OAAA 2XRYA 1Y3HA 5BWLA 1TT7A 1GNTA 3H8VA 4OHVA 5B6IA 1PG5A 5FOWA 4EUKA 2PRKA 5FPTA 2E4AA 2OBLA 3QEMA 3BL8A 2RHWA 5HCNA 2D0PB 1Z36A 4EVIA 2ERYA 2GWHA 3HNRA 3U4IA 4Z8YA 1XTKA 2GM3A 1G17A 1OGYA 1CYDA 1SUBA 2G0AA 4EW3A 5IM4A 3I61A 3WHKA 3O2NA 4IF6A 1KJYA 3PEWA 1LLUA 4E5DA 1ZN2A 1MMFB 4ZOLA 2HRZA 3AUJB 2NTNA 2GBLC 1MNAA 2QTMA 4N39A 1T5LA 1Y8QA 2ZVPX 2D0IA 2X14A 1X1TA 4P2GA 5DOVA 1HSOA 3DEHA 3I6QA 5ALEA 2PD6A 4JC5A 5I7OA 4YGYA 2QRUA 5AP9A 4MLDA 2ECKA 1R6DA 1ZC4A 3K0HA 5IJ9A 2RGNC 3LPMA 3Q88A 4HQRA 1CUZA 2QM8A 1MN6A 3ROEA 3N6VA 1ZH6A 4CIAA 4EFNA 5AVWA 1UWCA 1ISGA 4MI6A 1KH1A 1XHEA 4PZUA 4QUGA 1YZGA 3FPHA 1VBKA 2CXQA 1DOZA 2DECA 1QMPA 2FP3A 2MMGA 3PHCA 4LOIA 2H8KA 3PYLA 3T3GA 2CFRA 5FOVA 4EG4A 1DELA 3OD1A 5L3SB 1ORIA 3D2AA 5EJ5A 2W6NA 2BKLA 3PFKA 4YP1A 5J4LA 2BOVA 1SUAA 3R74A 2QTVA 4HAYA 1E5XA 2A67A 1ULAA 2QVZX 3AFNA 3HLTA 2PKRA 2ZSDA 4H60A 1BWQA 1XZBA 1GSIA 1RQ7A 1MHPA 3G3EA 5LYYA 3UH1A 2JGEA 1JL3A 4C4AA 4FR2A 5ICCA 4TMWA 1SQSA 1Y1LA 1JW9B 1WP4A 3V4LA 2WTAA 1C0EA 2IHYA 4TYWA 1YR1A 4K8OA 4WX2B 5HZGA 1IEXA 4RMHA 2QG4A 2QJWA 3K0AB 1QO0D 5I51A 3Q8XB 3UA4A 4WZAE 4GZ6A 1Z5UA 1YRWA 4BMCA 4UM8B 2PV0A 1NKVA 1GRCA 2OZEA 3ZTTA 3GQBA 3HBNA 4GM4A 1WKVA 2YFKA 4HGPA 3DBVO 3PYXA 4IIVA 4NNPA 5ALYA 1AO3A 3MWYW 2LIVA 5CCXA 1IY9A 3R8FA 3BMXA 3O74A 3QU2A 4P38A 3ZV4A 2VTVA 3TE6A 2BDUA 3KK0A 3KPYA 4ZFNA 4MYUA 4PPQA 1T6YA 3G88A 3Q9LA 1SH7A 3TR0A 3WYNA 3IKLA 4KXQA 4F6RB 1XJQA 3RK0A 5HR5A 2HM7A 2V7XA 4N76A 1NAHA 1DBSA 1LX6A 2P69A 1WETA 1PJZA 4F3YA 2WF6A 4GI5A 5CH5A 1QIGA 1OYYA 221PA 4IXNA 2JIBA 1N1EA 5IBPA 4GQBA 4WADA 4MQ4A 3DEFA 1VL6A 2BHSA 2ZJ3A 4F5YA 5EZQA 2QZ4A 5CHYA 4HB0A 4P7JA 1QWSA 4GOMD 1YIOA 4YH1A 1B0UA 4YUVA 5K0ZA 4ZVKA 1WD5A 1FVXA 5FA8A 4IGFA 5FUBA 3IE1A 4RSRA 4KDFA 4A36A 4C01A 3IVMA 3M4ZA 4NPAA 4RH1A 4YO7A 4HNGA 3NT4A 3E8SA 2PJDA 1YZTA 4RHYA 4XUDA 2BSQA 4QTXA 1ORTA 1W5SA 1YRQA 2CMFA 3DZCA 4LTNA 3UM9A 5A2QA 3TIXB 5IAEA 1XZPA 2VNSA 5LVAA 2GNAA 4BFXA 2OGTA 2D5LA 1K8QA 2JAWA 3PGA1 4BNKA 4EQ6B 3BHMA 1IDN1 1XRNA 1A5AB 3NAGA 1B74A 3ME5A 4P3OA 4RK0A 1QBKC 4TXJA 4XLTA 2A88A 2XVZA 4PPNA 1K7FB 2HK8A 1XJCA 3C48A 5SY9A 3F97A 4ZYUA 1J2YA 3IR5A 2MCFA 4QGSA 2WTUA 2R4QA 1IPHA 4WNIA 4DCJA 2AG8A 1ZJYA 1NJ5A 3FOCA 2LWIA 2HIMA 3P9KA 4BB6A 4DIMA 1SXJD 2G82A 2CY0A 3ZOZA 3L0ZA 3ZTYA 2GX6A 4NYJR 1WW8A 2JI9A 4F4CA 4Q1BA 4EP1A 4CCAA 1ZI9A 4V0LA 1BMFD 4BP8A 3V1MA 4E0BA 3I1FA 5HF5A 1N6KA 1PS8A 4XLZA 3NMUF 1X80A 1V3QE 1K06A 1X15A 3R3YA 3LLVA 4X8HA 5DB4A 2DT5A 3UJHA 4NJEA 3ADBA 2DHDA 4YMTA 1YNSA 1X92A 3M1LA 3WWZA 3BMCB 1HL3A 4II7A 3CF4A 5IXSA 4FLFA 5DVZA 3AIIA 2GKSA 1UR5A 1S2LA 4JNCA 4X44A 3VZSA 4N8DA 4EMBA 5T41A 4NYIR 5D8DA 1PWYE 2YWFA 2VDWB 5K45A 2WAXA 3L7OA 5BVHB 3AGQA 3L93A 1AGYA 3TAUA 1JEDA 3CKYA 4GYYA 3V80A 4L6CA 4MVYA 2VAPA 3K0CC 2R87A 1JMVA 1M2GA 1ZU5A 2NQ2C 2X8JB 4M8KA 5TEWA 1KQNA 3A6PC 4MAFA 4X91A 3AEUA 3CVJA 4JQZA 4BDTA 2Z5GA 4ZIRB 2REQA 1XCMA 1ST2A 1BE6A 2XUIA 3NALA 1IBCA 5JZBA 3QUSA 3GJZA 1IOLA 4OQYA 1Q6ZA 2JA2A 4EDFA 4ZHQA 2FEAA 7AT1A 5B2FA 1G2IA 1W88B 2DFTA 4YDRA 4TXNA 1DKNA 4JITA 1F0NA 1NUTA 4N3AA 4CCYB 1MBZA 1JG6A 3DP7A 4LNAA 2F8LA 5EFZA 5IUKC 1T0JB 1TU4A 3K9LA 2O8VA 4FN5A 2PUEA 2IU4A 3BWCA 1P2TA 1Y7IA 2HMAA 2PKYX 2UYYA 2V96A 4MLCA 4O4HF 4C4YA 2WF7A 4MV3A 4WLNA 4YRNA 3ICQB 3DD1A 5EE5B 2QU7A 2UXDB 2Z2KA 4L4YA 4LQ4A 3BWXA 1BG6A 4IHJB 1FYXA 4Q1VA 2HFJA 2QUKA 1M6NA 1PLLA 1Z37A 2H9IA 2JH8A 3V55A 4WQMA 1YF3A 4HZIA 4ZVOA 1CXZA 3MWKA 3GLGB 4OAPA 10MHA 2MSEB 2IYUA 5FI1B 3RTAA 1SD1A 3D59A 3STVA 2E4VA 4YJ2B 1G41A 4V0OA 2I4TA 4XEUA 4BFZA 1IXRC 2I99A 1JVNA 3I64A