4UMFA

Crystal structure of 3-deoxy-d-manno-octulosonate 8-phosphate phosphatase from moraxella catarrhalis in complex with magnesium ion, phosphate ion and kdo molecule
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
173
structure length
173
Chain Sequence
MNEIYQKAKHIKLFAMDVDGILSDGQIIYNSEGTETKAFYVQDGLGLQALKQSGIILAIITGRSSAMVDRRAKELGISHIIQGQDDKLTALVGLTKKLGIELSHCAYIGDDLPDLKAVREAGFGISVPNGCEQTRAVSDYITTKTGGNGAVREVCELILKAQNNFDAFIATFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Ligand-Bound Structures of 3-Deoxy-D-Manno-Octulosonate 8-Phosphate Phosphatase from Moraxella Catarrhalis Reveal a Water Channel Connecting to the Active Site for the Second Step of Catalysis
pubmed doi rcsb
source organism Moraxella catarrhalis bc8
molecule tags Hydrolase
molecule keywords 3-DEOXY-D-MANNO-OCTULOSONATE 8-PHOSPHATE PHOSPHATASE KDSC
total genus 57
structure length 173
sequence length 173
chains with identical sequence B, C, D
ec nomenclature ec 3.1.3.45: 3-deoxy-manno-octulosonate-8-phosphatase.
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00702 Hydrolase haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 4umfA00
1U7PA 1Z4LA 1F5SA 3PCTA 5AW9A 3K1ZA 1CQZA 5AVYA 2WF8A 4EZEA 2R8XA 3SMVA 2O9JA 2BDEA 4BX0A 3QXGA 2Q4RA 4DFDA 4EX7A 5ALVA 3L1VA 3RFUA 3FPBA 3OPXA 1WVIA 3N07A 2B8EA 2YFYA 3PGLA 2JAUA 4AS3A 3I1YA 3L8EA 5AI0A 5AK5A 2NYVA 3EWIA 4Y2JA 4J03A 1TA0A 2WM8A 3ZI4A 3ZTWA 3ZWKA 4PNHA 5AKLA 3ET5A 1Z4NA 3E84A 1ZJJA 1XP5A 3W5CA 3QUQA 4IG4A 2EATA 2PKEA 2YJ3A 4Y2VA 2JGAA 5ALYA 3AR7A 1RPZA 1L7OA 2AGVA 3ZUPA 2B30A 3DDHA 5AKXA 3ED5A 3KD3A 4HGOA 4XE5A 1WPGA 5ALLA 3GYGA 3AR5A 2RB5A 4EX6A 1NF2A 3NANA 2FEAA 5AW3A 5AM1A 2R8ZA 4UMVA 3CNHA 2FUCA 3ET4A 3U7HB 2R8YA 2FPWA 1IWOA 2YMMA 4OFZA 1LTQA 4NWIA 5ALJA 4KX5A 2JAWA 5AK6A 5AKJA 4BX3A 1RKVA 4YIHA 1Q92A 4YGYA 1L7NA 3OCVA 5ALKA 3ESRA 1KYTA 5AW1A 2NO4A 4L6AA 4C4SA 2W4MA 4DCCA 4UMDA 3OCZA 4CF5A 3E81A 3BWVA 2R8EA 3IJ5A 4HAIA 4DW8A 1N8NA 2IOFA 1QQ6A 1Z4MA 1Z4PX 3OCUA 1Z5GA 2FPXA 3WK7A 2YMQA 3UM9A 3WKEA 3ZX5A 2B1QA 5AW0A 3L1UA 4FE3A 4YCNA 3W5BA 3UMGA 2IYEA 3WGUA 3ZVNA 4GIBA 4XQ0A 3M1YA 3EPRA 4Y2SA 5AM0A 4F71A 2YY6A 1CR6A 1SWVA 1ZD4A 3NRJA 1J97A 2DQSA 3N5KA 1TJ3A 4Y3UA 1VFPA 3ZTYA 2HEGA 1ZD3A 2YN4A 4Y2RA 3P96A 1YV9A 2HO4A 1L8LA 4I9GA 1S8OA 1J8DA 5AVZA 3OCXA 3QU4A 3QUBA 1T5TA 3KZXA 3L8FA 1Z88A 1QQ7A 3N1UA 1EK1A 1L6RA 1TJ5A 2FUEA 4HGPA 4UU0A 3DAOA 2RARA 3KOOA 4MWOA 5AVUA 5JJBA 5ALNA 5AW2A 3NALA 2CFRA 3L5KA 3F9RA 4FFDA 3N8GA 5AI6A 1T5SA 5A3RA 5AM2A 5AKHA 3I28A 3E58A 1O03A 1RMYA 1T9ZA 4YCLA 5IT4A 2CFTA 4Y2PA 2O2XA 2WHEA 5AVRA 3ZX4A 2D2VA 4BNDA 3NUQA 3MPOA 2ZBFA 1L7PA 2OM6A 3L0YA 3PDWA 2ZXEA 3OCYA 1RKUA 2YMPA 5ALFA 4AP9A 5E0OA 1L8OA 5ALIA 3IB6A 5IS2A 1RMQA 3A1EA 1RC8A 2G06A 2P69A 2HF7A 3R4CA 2QLTA 5AESA 4C4TA 1RDFA 1ZS9A 2P27A 3B9RA 3PGVA 2GO7A 4CF4A 5ALWA 5ALUA 1FEZA 2C8KA 1U2TA 5AKEA 3SF0A 4E88A 2MU1A 4UMFA 2WF5A 5ALPA 2GHQA 4Y2YA 2Q4TA 4C4RA 3MMZA 1XPJA 1Z5UA 5AKZA 2IA5A 3NASA 4BKMA 2ZBDA 4G63A 3FPSA 4I9FA 3QU2A 3DV9A 2Q5EA 1SU4A 3U13A 2I33A 1ZRNA 1SWWA 3L7YA 3U7EB 5AW6A 4HGNA 4NAVA 2G08A 2EARA 3R09A 3FZQA 3S6JA 1ZD5A 2BY4A 5AVVA 5AKGA 5AKIA 1U7OA 1N9KA 5IT0A 1TJ4A 4KX3A 3QX7A 3WK8A 5A3SA 3SKYA 3EF0A 3HLTA 5AI4A 2WFAA 3N28A 3U7GA 2HI0A 3AR3A 2MSNA 4Y2QA 3QLEA 2ZBEA 5AW7A 1RRCA 4NFLA 4G9BA 3U7FB 3QYPA 1JUDA 5AVWA 3A1CA 3WK6A 4KNVA 2P9JA 2RAVA 1LVHA 2C8LA 3B9BA 5ALHA 2VKQA 5AI5A 2X4DA 4AS2A 2W43A 1Z4QA 4RESA 3UMCA 1EK2A 2QYHA 4ZEVA 1PW5A 4GXTA 5ALSA 3D6JA 4FYPA 5AI9A 5AW5A 4B6JA 1X42A 3MN1A 1QQ5A 1RLMA 3WGVA 2B1RA 1RKQA 5AKYA 2GFHA 5AIAA 2AUTA 4O8CA 3TLMA 4UM5A 1L7MA 5ALTA 1YDFA 4L57A 4MUMA 2GMWA 5AW8A 4XPZA 1Y8AA 3QUCA 2OA0A 4ZEXA 2GHTA 4UMEA 3FM9A 4RETA 5AW4A 3KDPA 2C9MA 3WK5A 4KN8A 4UAVA 3ESQA 5ALZA 2HHLA 4EELA 2G1AA 2IOHA 3ZWDA 4CE6A 3NAMA 3R9KA 1YJ5A 2AMYA 3AR9A 2I7DA 3QU9A 1MH9A 3HYCA 3SD7A 3L8GA 3WKDA 4HGRA 4OHFA 3OCWA 1VJRA 2B0CA 2HF2A 2RBKA 2YJ5A 2HCFA 5ALEA 5AICA 3U26A 3ZVLA 5ALDA 5AVXA 2W11A 3AR6A 3IRUA 3WKBA 4H1WA 2I54A 1WR8A 3L0CA 5ALRA 1RMTA 2PR7A 2FPSA 4HYTA 2G07A 1ZRMA 4Y2UA 1Z4JA 4DWOA 4HGQA 2CN1A 4UASA 3A3YA 2C88A 4UATA 2G80A 4JDPA 5AIBA 2HX1A 3QNMA 4UARA 4BNDB 3B8EA 3BA6A 4KNWA 5FP0A 3OTQA 3W5AA 1ZOLA 4L6CA 3E8MA 3KBBA 4Y2TA 4BYGA 1O08A 4BBJA 3MC1A 5AM5A 1RQLA 5ALXA 3DNPA 1QH9A 4JB3A 3I76A 4J2TA 1XVIA 3L0BA 1NNLA 3WKAA 2C4NA 3J7TA 1WZCA 4F72A 4IFTA 2B82A 2I6XA 1Q91A 2NO5A 3WK9A 1Z4KA 3KC2A 2HDOA 4EEKA 1Z4OA 2JARA 3ZU6A 5A3QA 4BEVA 5T41A 1YS9A 4KYTA 4YH1A 2WF6A 3FGOA 3ZVMA 2AH5A 3L8HA 2IOFK 3AR2A 5ALQA 5ALGA 3QU7A 1K1EA 2I34A 5AM3A 4BX2A 4CNQA 4OCZA 4UM7A 3WKCA 3RF6A 3NIWA 1NRWA 3QUTA 3VAYA 3ZW7A 5AVQA 4CF3A 1RLOA 3QGMA 4UAUA 5ALMA 1YMQA 2ZBGA 1S2OA 1RLTA 2G09A 3ONNA 2FPRA 4UW9A 1U02A 1VJ5A 3M9LA 5AM4A 2JAOA 3WK4A 5AK4A 1TE2A 4QJBA 2HSZA 3FVVA 5AK3A 4QQFA 1QYIA 1YNSA 2B8JA 3EF1A 2FPUA 1RQNA 3AR8A 3I6BA 2P11A 4BEWA 2PQ0A 2I55A 3A1DA 3AR4A 2WF7A 5AVSA 2YBDA 5AHXA 5AVTA 2ODAA 2YJ4A 2YJ6A 1U2SA 4Y2XA 2ZG6A 2BDUA 2FI1A 3SHQA 1AQ6A 2G0AA 4ZEWA 2OBBA 4OD0A 2OYCA 3UMBA 3U19A 4XOUA 3SKXA 3CZ4A 2WF9A 5AI8A 5ALOA 1Z4IA 3QU5A 4NV0A 2CFSA 2EAUA 4YIKA 2ZOSA 1ZD2P 2FDRA 5AKKA 2HOQA 2YMLA 3W5DA 4YCMA 4EENA 3SLRA 4NABA 4UU1A
chains in the Genus database with same CATH superfamily
1FTNA 5I9NA 1ENYA 1Z4LA 4JASB 4ZFNA 3UV7A 4CL8A 1K8XB 1ORIA 1HG0A 3A3KA 4HAWA 3TUZC 3BMCA 1LD3A 1AD2A 2I29A 3OETA 4UVDA 3QXGA 2QG9A 2QWXA 1XRMA 2ILTA 3IP7A 5ALVA 4FFRA 3IIEA 1L4BA 3A4YA 3CPEA 4UAGA 4YJGA 1MOQA 3GQBB 4KDEA 3JAWA 4AS3A 2GBGA 3T9DA 1RPAA 1D04A 4HI0E 3D6MA 2P78A 5E7JA 4HNAB 4KVGA 3PNBA 1H1DA 5C8VA 1GLVA 3WRVA 1YDHA 5FNVB 1HR0B 3C70A 1UOQA 3CHYA 3PGJA 5B3JA 1RAHA 2ZULA 4MVYA 4RQBA 2EATA 4JSRA 1L6IA 3SZRA 2YJ3A 4FEGA 1OXBB 1MX3A 5JASA 2DP4E 2XYGA 3KFXA 2VJMA 3G7UA 1JA1A 1FPMA 5J4HA 1K2VN 5CEJA 1DBRA 2I66A 4RPIA 2P79A 1M2EA 2BFEA 3EAGA 3WNQA 4JI3B 3VNRA 3HXQA 1L7OA 4PGMA 1ZC4A 1FDTA 3UQYS 3WYEA 1Z8HA 3FBWA 3QLUA 1NUTA 4PYLA 2ZUDA 4FLMA 1H05A 1H0KA 2WSYB 3BT7A 3E22A 2GTIA 2OR3A 1W6UA 3L8DA 3MB5A 3V1MA 3LHSA 1Z2DA 1ZIYA 2P62A 1EJ2A 3A1FA 4I2VA 4K86A 2H51A 3P9ZA 3PENA 4OJKA 2B61A 5CMLA 4B8WA 3I01M 3EPJA 5IT5A 1NZFA 3BXEA 2BSQA 1MB9A 1XZEA 3GN1A 2QF7A 3S68A 2QQFA 1UOPA 4OHUA 4C5BA 5DKFA 4GLFA 4MMYB 2FEMA 4AIIA 2JJ1A 3TOVA 3UANA 2QV7A 1Z6AA 3PPXA 3SC2A 2WSSA 1H22A 3JZIA 1P17A 3U3XA 2HSJA 1XL0A 5EQFA 4CFSA 2KHZA 3W8RA 5HR5A 1Y1TA 1PT5A 2JK1A 1R4NB 4OFZA 2FQYA 1LPNA 2HZ7A 4RX1A 1H2AS 1KAHA 2JAWA 1L4NA 5H02A 2GBLA 1NVVR 2WUFA 1Z7YA 2YNMD 4KSBA 2I7VA 3IQZA 4YP1A 3BMXA 3ZJ4A 4Q21A 4E11A 1SFRA 3X2EA 4D0GA 1DO8A 1XVUA 4TL8A 1S2LA 2CKDA 5JNSA 1Y6GA 1CBUA 1P7CA 1T2CA 3NG1A 3ENQA 3E81A 1N7JA 3LD9A 3W8NA 4R9UC 2BTEA 1ENOA 4TYYA 4RELA 1ZAYA 4KMRA 1BMFD 2WA2A 1Z4PX 3R3ZA 4WK6A 2DR2A 1GAXA 3EXFB 3OQIB 1PJBA 3TLGB 2CZCA 2QI9F 4TMXA 4DLUA 1E5TA 1VKOA 3SU8A 2JBHA 1VHTA 3LDFA 5JHHB 4X24A 4Y1EA 3PJRA 2BWJA 3WNZA 4YCNA 3S70A 3RSQA 3UMGA 3DZHA 3L6OO 4LBWA 5MN5A 3DFFA 4QELA 1KMHA 1S89A 3M4ZA 1C8KA 1RXVA 5F98A 1STOA 5F78A 4EZIA 4FQ7A 5EUMA 3QKUA 5CH5A 3TW4A 4O2AA 4LBZA 3GLHB 4HWRA 2QTRA 5E1MA 4DR4B 1U9ZA 2ZANA 1PR2A 2BEJA 1Q0LA 3NBQA 3L7IA 4CG1A 3PXUA 1WG8A 3WZMA 4F97A 3PPYA 3BFVA 2A0KA 4ZQCB 2C58A 1EG7A 1BYIA 4I7EA 5GVRA 5JD6A 2JKVA 3GK3A 3I8XA 3UAWA 3PQ7A 4WXPA 2X22A 2FSUA 3TPCA 4RHCA 5IDQA 1R5NA 1ZJ6A 1ZM9A 5IJWA 4JX9A 1BEZA 5I4IA 1JR3E 3V8BA 1UKCA 3KZXA 2ZE5A 4ESOA 4FOSA 3PLNA 4TTIA 4YALA 2WTXA 2G6TA 3ELBA 3F7NA 4J29A 4UFOA 2OPBA 1I4WA 3JAMA 1RQ7A 2YV1A 3FNBA 2ST1A 2YRXA 3GJ3A 2J08A 5CM9C 1GPYA 1NURA 1K0FA 1RCUA 4ZD6A 2PR2A 4G0OA 3W8EA 3WQRA 4C89A 5E7IA 5HF8A 1ZG3A 2H7VA 3EISA 1MQ8B 2O2JA 3NKVA 1X7XB 3CUYA 5AM2A 3HBMA 4IIVA 4QT4A 2V7UA 2PKXA 2A2ZA 2PLRA 2Y2UA 3OE5A 4JP3A 4M55A 3SDBA 5FF9A 2VZLA 3D64A 4BQOA 1XMSA 5KYTA 2OCAA 4BVFA 3JW8A 4MAMA 2O2XA 4AN0A 4CEIB 5BOVA 3H16A 4DIKA 4E31A 1JHRA 2HBQA 3GRPA 4R8MA 1PQUA 4B32A 5JBIA 2RJNA 2FUKA 1FRQA 4HUJA 3KQHA 1N2OA 1PJLA 2GN9A 4RH1A 2WIJA 3WGGA 1FRZA 5CT5A 3SG0A 3D8BA 5KTYA 4CF6A 5FRDA 4I4TB 3TLCA 4LXIA 2FNAA 1KXZA 5A9TA 2HHAA 1QVAA 3AUUA 4PG6A 2Y1EA 2WJJA 5D7BA 4BRUA 5K3SA 1A0OA 3F4LA 3D31A 3DD5A 2K2WA 4FT4A 3DV0B 1Y7TA 2FWRA 1D1SA 2QB5A 4TOIA 4OX9B 1NUAA 1JEYA 1X9HA 1FNNA 3ES9A 5CDFE 3E4CA 4BWFB 3O95A 2CVZA 2GO7A 1L5KA 5A9SA 1DCMA 3OX4A 2IUYA 3V8NA 4Z1OA 4MDFA 2G9QA 2Z3WA 3P0HA 3Q10A 4CN9A 3RANA 4ETIA 1J9GA 4M53A 4F2PA 1GPH1 2W8BB 4Z9BA 4YWHA 5ANRB 5JLAA 2OCLA 3URMA 1WCIB 3BFJA 4N12A 3NRBA 4CBVA 1JBKA 4DMGA 2P77A 4W9RA 5KB3A 4L9WA 1N6HA 3L8YA 3DZIA 3M5WA 4PRZA 1TDJA 3ORQA 5G4KB 4EATA 3KSUA 2YFKA 4LXXA 2X8WA 3H75A 3KWFA 3HPRA 3SIXA 4B40A 4QG7A 2XNDA 3OO0A 5H8WA 2QRJA 3KUDA 1EINA 5DWDA 4UTXA 1DKOA 3WHKA 4EITA 1OZHA 3A1NA 3L8CA 1FXUA 2QT1A 3LDHA 4PM4A 1VPEA 3ZHOA 2IOYA 2DKOA 3EDCA 3GELA 2VPWA 4OI2A 5LJIA 2R7NA 4MYTA 4MROA 4A82A 2VQSA 1RRMA 3GEIA 4UUNA 3NWJA 3ZVKA 4DLNA 1E4EB 3IOEA 2HSEA 4KOAA 3CJTA 1DINA 3R09A 3SNHA 4BKRA 1XZLA 3TGWA 3UG7A 4K88A 3BMNB 1W5EA 2JLXA 2VSOA 5KEIA 4NZMA 3HFJA 4KDCA 2X15A 4J7UA 4NDAA 4TV8B 5B58T 2ZIAA 3HLKA 4H1VA 3AV0B 2LVBA 2MSKA 2TECE 1NI4B 1QRDA 3JAKA 3Q8WA 2QMQA 3W5SA 2Q8QA 2I7TA 3OA0A 3OZBA 5AJUA 2PZLA 3RWOA 3EJWA 1YZYA 2AJBA 4YR7A 3N8HA 1OCEA 4P2BA 2AJ8A 1O95A 3ETCA 1O6GA 3SY8A 4A23A 2EL7A 5LOVF 2BM1A 2CLMB 3HYTA 4XWYA 1Q15A 1YRYE 2H11A 3DMTC 3EH1A 3PC2A 4UE2A 3IHKA 2Z57A 5TARA 3HHEA 3I37X 2R0QC 5ALHA 1CZKA 4HEHA 2OHFA 3AFHA 3RKRA 3SNKA 3TGPA 3JQDA 4O02B 3PUYA 1A2OA 3OFND 1OD6A 1NP3A 2XSZA 3KQTA 5A7GA 1KR2A 3OJCA 3ADCA 3GLHE 3JASB 3MOGA 3LWNA 1C4XA 1NAIA 1X42A 2CYBA 4R8SA 5JZVA 4MGEA 4Z0NA 3H9QA 4GI7A 1D2GA 2WTEA 3E7DA 3GY0A 5CFOA 2K7FA 2C2YA 3OJWA 4ENPA 1L7MA 2J9YB 2NO9A 3LZ6A 2C4WA 3H5WA 3GDHA 4NYJQ 1OLSA 1ZA2A 2GWHA 3BQMB 3RSGA 3BQ9A 2YIMA 4BUJA 4R0MA 1ISRA 4AKGA 2AB0A 4A5OA 2ZXUA 1ABFA 2RKWA 3I09A 5K51A 5CB8A 1EUYA 1J56A 4IHJA 1Y6ZA 3KQMA 1QFMA 3PDJA 4UMEA 2JIOA 4W5NA 1X1SA 2O1EA 1FDRA 4NBUA 4WECA 1Z29A 4X92A 4ZVQA 2ZRGA 4UAVA 2ICAA 2NU7B 3JATA 1XK7A 2WAXA 1SO8A 2XCIA 4WRRA 3R7FA 2L0XA 2I2DA 2QTGA 4O4HF 1TEZA 4XSHA 2AJLI 3Q6NA 4MEBA 2REQA 4ETWA 2ARKA 1NXWA 2BUCA 1G41A 3M1IA 1SCJA 2VAMA 2P9EA 1JL3A 4N54A 4NRDA 1SMKA 3C3KA 4JGIA 2IW1A 4GLBA 2Y1CA 2NYRA 3D5QA 4M60A 2PUWA 5FOXA 1MH9A 2F9MA 1CZHA 2PYDA 521PA 3TTTA 4E21A 4NDZA 1UT5A 4HGRA 4UFNA 4QU5A 3ZDYB 4P3KA 8ATCA 2HF2A 2HSDA 2WYIA 1DUIA 2ZGVA 1JJ7A 2JIQA 1KP3A 3U26A 5HS6A 1EK0A 2Q8NA 1LKZA 5JYBA 2H4XA 4EUFA 4L74A 2JGFA 3KOXA 4P4TA 4UE3S 2I54A 3PE3A 4HV4A 1QP4A 3KYCB 1H2YA 3SQMA 4EBBA 5FWXA 1GZ7A 2IBTA 3G5TA 4E4RA 4L85A 1CUHA 3TLKA 1K98A 3FDJA 3NKLA 1AO0A 3REQA 1GL7A 3QOYA 4Q1BA 2HA3A 3D4PA 3TNLA 4CKYA 4CEJB 3ZCTA 4Q9JA 1CZOA 5D5HA 1OMOA 2G80A 3OE1A 5L3RA 5IULC 3GLIE 3QNMA 4WGGA 4RA6A 1AMOA 2R11A 2I4RA 3EQ7A 4CKWA 1RFLA 3BRWA 1L5GB 3M1LA 2V5UA 2HQOA 2IU4A 1J6UA 3WG9A 4B44A 2FW8A 1W36D 1DO2A 4KQIA 1O57A 1XTKA 4L7VA 4UZEA 5L3VA 3S5JA 2ZM5A 4RGBA 2HGZA 2GF2A 1GUYA 3PQFA 2FH5B 4P7JA 4X5OA 4WMLA 3REFA 3V46A 4A91A 2P30A 5HZHA 5KVVA 4CG3A 3PLAE 1RQLA 1TVEA 2ZROA 3IOBA 2CXXA 3JD1A 1Z7GA 3F74A 4HFNA 1H8EA 2OGZA 3E9YA 1TAQA 4J2TA 1CY1A 3SYRA 5F2EA 1IUPA 4N3BA 2JLVA 3I6MA 3KELA 3FUWA 3ORRA 1T24A 3PNSA 1R18A 4PX9A 4BMVA 2XXAA 1WTAA 4CEJA 1Y3IA 2W58A 3OUTA 4RVUA 4KIFA 1JVNA 1NPTO 1U1IA 3HA2A 4LYDA 1X80A 1NXPA 2ETVA 1MAVA 4ENUA 1V2GA 3MWEB 4EHIA 3DHWC 1DFGA 2Q2NA 5BWOA 2V7VA 2JFUA 4JGBA 4PPNA 3TIFA 1FNMA 2BHLA 4TKVB 3RTDA 1MA3A 2KBFA 3VDNB 1E3DA 4LZOA 4KYTA 2GJ8A 4BFCA 5C3MA 5BURA 2WI8A 1RXWA 1E99A 1HH4A 3AERB 1AUOA 1KC3A 3X43A 2F4VB 2MR5A 2CUZA 4L9AA 3IFSA 1PR5A 3ABSB 3ONVA 5AT1A 5TRTA 1T9BA 5J9FA 1H3NA 3UK6A 1KK0A 3DFZA 5SZKB 2LCQA 2XSZD 2PBLA 3BGVA 1NW4A 3AHGA 4L16A 3DWEX 4IZIA 1EK6A 4GX2A 3UFXA 3RADC 3TIVA 4HNGA 1SCIA 4ALIA 2HF9A 5ECYA 2Q2QA 3RFTA 3ZW7A 3G0GA 1P33A 3IUSA 2GH1A 1MO4A 4ZKEA 1CWUA 4MV5A 2R6GA 2Q7XA 1JEYB 2I76A 3FSRA 5HIKA 1KNXA 4NU8X 2C4KA 1IMJA 3DF9A 4RTOA 3OIGA 1FLAA 2AEJA 3V4ZA 1JG4A 1FFEA 4MJ3A 4RV4A 3C5VA 3BMQA 5JXIA 5JRJA 2XF8A 1QZZA 1SC3A 3Q0IA 4FFBB 3FVVA 4HLUA 2WJ3A 4OK5A 3QXCA 4I66A 4NBNA 4WEOA 5AK3A 4X20A 1NIPA 2I7XA 1GAJA 4BNTA 1MO6A 3PHJA 5MGNA 2WAMA 5IJXA 4ARVA 4I4NA 4W4TA 3DMNA 3MYRA 2JIDA 3P94A 1ETUA 2H7XA 2I2BA 1WBJB 3GG2A 3H2SA 3NDPA 1KJYA 1X2BA 4HMQA 4LNAA 1D8AA 4AYXA 3I58A 1Q17A 3WYNA 1ST2A 4O4HB 4RD2A 3UBMA 3J80A 5EJ8A 2WP8J 4QUKA 1WDTA 1M2GA 1V6CA 3GMIA 1DXQA 1FP4A 4YP0A 1ZISA 1IQUA 5E8RA 5SYMA 4Y2XA 1KORA 3EBLA 4JLOA 2CCGA 1S4QA 5C31A 4NJEB 3ROZA 4ATNA 4CLHA 5GZ1A 3SZUA 3ZDCA 1IXYA 1OPRA 1RWVA 1AZWA 2JFBA 1E60A 1L1FA 2IIQA 3FMGA 3K1AA 3MPUA 4TTVA 2OO3A 2II6A 7MHTA 4K9SA 1PZHA 1Z17A 2JLRA 3CG4A 3UJ8A 1FJXA 3IO5A 3R3XA 2G5PA 4IKOA 4KWCA 5LDDC 3NBMA 1RYYA 4HVTA 4HD8A 4TM8A 2X5JO 1B3BA 3B3GA 3HKCA 1NYLA 2JATA 4UM8B 2V5AA 3WDLA 4L27A 1O0SA 1PWEA 4B83A 2VLBA 2VK4A 4BNGA 1OWPA 2Q9UA 3C3JA 3IELA 1J1IA 2ZU0C 3K9BA 4EW1A 4U3JB 1KPGA 3KZ1E 3ZPXA 3LPMA 3DXFA 1P2UA 2XUQA 3VPHA 4DZRA 4QTTB 2W2NA 3QXJA 4GQAA 1F2UA 1H8HA 2JHPA 2NYUA 4MW6A 2AIRA 2YR0A 4V0NA 3SMVA 4GDMA 5LR6A 1GSOA 1XRLA 2GNOA 2DFDA 1HKUA 1N7GA 2YV4A 4Q1EA 4X1IA 2Y4NA 4EZBA 5IJAA 1EVLA 4F8EA 3VZRA 4C0LA 5IVHA 1RHJA 1EGAA 1K8YB 4JI2B 3HU1A 2B8EA 4R68A 1U28A 1U94A 2JAUA 3AKZA 3I1YA 3L6RA 1XN4A 4FBGA 3REQB 1NBMA 2IODA 1TGYA 1IPEA 4OKSA 3OHSX 1SUCA 3NHBA 5NLLA 3QPAA 2QM7A 3G5UA 1P0MA 1AQYA 2EP5A 4FN5A 4MK4A 4G0YA 1DE0A 4TN5A 4D9GA 5JVDA 3NTQA 3RVLA 5AVJA 4G1UC 1DKNA 4QRDA 4PAWA 3CR8A 1YMUA 5T67A 5B4UA 1NKSA 1UC4B 2ODEA 5BV7A 3KJIA 1U3WA 1WQ1R 4JLVA 4KQMA 1FMCA 2VVTA 3CB2A 4RPKA 4ZO8A 5TB5A 1WV0A 3NH9A 4N7BA 2QNRA 3B1YA 1UBJS 1TB4A 3EWAA 2OCXA 5IYZB 2ENUA 2ZBVA 1Z5PA 1RRVA 1EFUA 4A2WA 3AZPA 1H2XA 1IRXA 3L7KA 1Y7LA 3PTAA 2C5BA 3RKUA 1GNRA 3VKHA 4ENTA 3GZNB 4XE5A 2FMFA 2PHZA 1IEVA 1GRNA 5CEFA 1RU3A 4HLCA 4ZRNA 3ZGZA 3NH6A 4LOIA 2RKBA 4FZVA 1OWLA 5F21A 4TLEA 5AHRA 2AX4A 5AW3A 5F9HA 4WXRA 4LOLA 1TIBA 3I9KA 3NYWA 4MR7B 1E77A 3IV9A 4DXDA 2C3YA 1LJ8A 2FEOA 1LX7A 3KZVA 3ND5A 4YEDA 2ZAIA 3MQFA 4O3FA 4DA9A 1IWOA 2IXEA 1U1EA 3UHFA 3DBLA 4EVRA 2UUAB 1JHOA 2E85A 4CJXA 5A5VA 2O2GA 3E7WA 5ENDA 4D6YA 3T4EA 3F8WA 4KXVA 5FULA 4FMDF 1K7YA 1Z0JA 5C7OO 3JQ6A 1Q92A 3AVTA 1P3Y1 3X1ZA 2C4VA 3EIOA 1KIAA 4D9NA 2MYPA 3AINA 3KJGA 2Z4SA 3K70B 1O87A 2IT1A 3L92A 4NICA 1TCCA 3KSMA 3DZKA 4C1BA 4KCGA 1RRFA 3A3OA 4GRDA 3RFXA 3UUFA 4EI9A 3T52A 4C76A 3PRYA 1UZUA 1Z5GA 4DTCA 1D03A 1KR5A 1JPJA 1R3UA 1LNQA 2Q3EA 5DP2A 1AK9A 2HU5A 5TSDA 1GG2A 5JT1A 2NP7A 2YS7A 1KEVA 3UM9A 4OXRA 4TV8F 2NVWA 1DSSG 3EF3A 1HEUA 2A8YA 3PNMA 1B0PA 2QG4A 2V7QD 4KR9A 5F2NA 1OH6A 4J76A 5BSWA 4YO8A 1R6DA 4MULA 1UDRA 4OP3A 4YCAA 1Q1ZA 1UMCB 2XE6A 5CLGA 4F3CA 3C97A 3U61B 2YY6A 1KZ6A 1X8JA 1SIUA 2EFGA 2NZXA 4IVPA 4YV0A 3H65A 3EQ6A 4FJ0A 4BE7B 1E6EA 2OBYA 3TPFA 5FFFA 1DRUA 2IY7A 3ZTYA 2VNAA 4M54A 4BXOB 1N57A 2V7EA 1XAJA 5CGZA 1AS0A 1DAEA 1G60A 1QGUA 3P96A 2PX8A 3PDUA 4H7DA 4QQNA 3UJ7A 4UXHA 1MQAA 4J4BA 4RKYA 4BGIA 4RTRA 3UT5B 3ECCA 2C77A 1GPUA 2AX3A 2P40A 5DHUA 5FI3A 3M6IA 1SQGA 3GLIA 5BUQA 3RSZA 3FLEA 2DCUA 4DPLA 4ZVMA 4KKXB 3UA3A 1CUCA 2DAPA 5EWLB 2G5GX 1R9JA 4URYR 1X74A 1B0UA 3G0OA 1U0NA 2HFKA 3TD9A 4FDTA 3HUFA 2CFRA 3G0DA 4RK7A 4FFDA 3HM9A 1KJIA 5CA1B 4CHTA 3R6WA 5KNCH 1JLMA 1EX7A 2PQ6A 3G7SA 1T5SA 5AI6A 4ZGGA 1OZGA 4E2ZA 5EL0A 2PH1A 5DP1A 3H2ZA 4WKGA 1EIZA 4FSDA 4OAQA 4J90A 3GCXA 4MQ4A 4AUEA 4DZTA 4L50A 3AKCA 1P80A 1TJPB 4XB2A 3VPAA 3G0IA 3WWPA 5BN1A 2J5QA 4IVNA 3N0VA 3RRZA 2BGGA 3CVOA 2ZTMA 3S81A 5CUQA 3R5JA 3WL7A 4EGJA 2PMKA 3FKSA 2HA4A 5ICMA 2EZ4A 3VKUA 1SBTA 2FE1A 4M0UA 4LI3X 4DADA 2HJ9A 2UYHA 2ZJ6A 3PGKA 3ZCQA 4DUPA 4YCDA 4Q48A 2A67A 4A6DA 5K6RA 1MX1A 5DASA 1A7AA 1XDSA 2C54A 1S2NA 1A8SA 1B6TA 1O6FA 1ESDA 1OLOA 5JV5A 2EGHA 4RYLA 2JEZA 1S02A 2KW5A 4BWYA 2B20A 3G79A 3NC4A 4I4TA 5B3LA 5KUTA 1AV7A 2JPDA 4RH3A 1ZHFA 2RAFA 5A3VA 4RMJA 2WSBA 2G1PA 1XXHA 3QFHA 2IHYA 3OF3A 4CLRA 1L3IA 2PXHA 1BWQA 1OI7A 2DUWA 1K75A 5IAAA 1KSGA 2FFBA 4UE6A 1FDUA 1R64A 1E2UA 1UPAA 3VZSA 4DN6A 3SCZA 5ELXA 1PVDA 2O0HA 4HR7A 4Q24A 3ETLA 3WP1B 5HKLA 1PFWA 1GY8A 1QIFA 3ER6A 3PJGA 3SFZA 2ZB7A 3PSHA 3AVWA 2K87A 2DWCA 1MHPA 3HUEA 4NAHA 3NS7A 1SBYA 2BKEA 4ILEA 1DXYA 4FFNA 5LXTA 4TUYA 4H7EA 2UXBB 2NOAA 4G25A 3D0RA 3ZV3A 4ZV9A 3P2YA 3FPSA 3N7AA 1B8OA 3IBCA 4LK3A 1OE0A 2WIBA 5HBRA 4D0LB 4TRJA 2NQTA 4YAEA 3EVAA 1QBKC 4DR2B 1JG3A 2MYTA 4HQLA 1DAGA 2C82A 2B34A 4YV1A 1D1QA 5LZ8A 4JP2A 3A9VA 1U3FA 4QYIA 1MT0A 2Q4DA 5HJ5A 1W34A 4HGNA 2V6JA 2G88A 4WY5A 4GUDA 5FKJA 4J7AA 3P0EA 3DO5A 4EGFA 3ZE8A 1X3LA 3L05A 1T2DA 5JDCA 3CLKA 2BY4A 2DKNA 1BQ4A 5EWMB 3TZHA 4BL5A 2GERA 4MKIA 1XC7A 1S1MA 3PEVA 4A16A 3IPRA 4X60A 2W2KB 3MT9A 3KR2A 1OX6A 4FFSA 4IP0A 3Q7TA 2A9JA 4OO3A 3CBQA 4XDHA 3VUFA 1IN5A 4LPSA 4AJ1A 5A02A 1NE7A 1QE3A 4HRAA 4Z3DA 1U0SY 3JD3A 2M2IA 3O9VA 4CM4A 2IZOA 2XMSA 3B36A 4LS3A 1KFEB 2KWIA 2QT0A 3C85A 3EF0A 4ZU6X 3SSMA 3ZGOA 1RI5A 1LBEA 3AEKB 3SC2B 4YMUA 1XTVA 2PJDA 4X3CA 5IPFA 3I6QA 1BU8A 1I7PA 4M1YA 3RRYA 3PTLA 4NFLA 4AYWA 4LE2A 2ID8A 4BO6A 2WVAA 4G9BA 3QYPA 1WKBA 3DEFA 3D43A 2D3TA 1Z37A 3HBJA 2QUAA 4JQYA 1MTOA 3DOJA 4ZT6A 5FAXA 1V11B 3ILVA 3FGZA 1AHNA 5CVEA 2CSXA 2JGDB 2IS6A 4PYRA 1Z38A 4RKRA 5CX1A 4U6QA 4DJTA 4E2FA 4BQRA 2OPHA 3DWFA 1C50A 3K0BA 4MS1A 1EK2A 3CN9A 4UEWA 4F21A 4JT8A 5EHXA 1BVHA 4AG5A 3EMDA 4Z49A 5IK2A 4UFPA 3WGVA 4IDNA 4CM5A 4NU0A 1GA6A 2XMRA 1UR5A 3AUSA 4O4JF 2DLDA 4FGZA 1P9RA 2DUMA 3DOUA 2CV2A 4BNXA 4I55B 2C2GA 1WW8A 3MGAA 4UCXA 2DHRA 3SHTA 4MI3A 3ZGYA 3IH5A 1ZXXA 3HXLA 3C6BA 2IWHA 2CY0A 2DBVO 1FUYB 1V7PC 1PFGA 1JI0A 3E9MA 2Q3CA 3U48A 2GHTA 2R1UA 4Y67A 5K0SA 2XWPA 3TLGA 4ZZ3A 3G2QA 5IJ0B 1N9ZA 2OHOA 1CERA 3WK5A 1R8SA 4B9EA 4EHJA 2VKTA 3GZ4A 3FAKA 2XBUA 4OXIA 2XGOA 4PIPA 1R0WA 4GM0A 5IKEA 2F3TA 1PDWA 1X77A 4G5YA 4F11A 3WYFA 1XT6A 1JA9A 1XFDA 2BEUB 2K5UA 1N9GA 1ACLA 2PS0A 2YICA 4GICA 3ZIUA 5JISA 1V9CA 3ZWOA 2WJVA 3KR9A 5BWBA 1U0EA 4AUNA 2I7DA 1B3RA 4CEHB 4GMKA 2AXPA 1EGMB 3HU2A 3M9XA 4B4OA 3O38A 3IE0A 1DOHA 3B5IA 2R7LA 3DOCA 3EZ6A 1PL8A 2J9FB 1CRPA 3MCUA 2HCFA 5EJ2A 1A71A 4AMZA 1SG6A 2FUG1 4IQ0A 1RXEA 4CFYA 3GJRA 4RPCA 1ODJA 2Z3ZA 4PC1A 4RHEA 2FSVC 4QBHA 1N2EA 3IVAA 3MILA 1QLWA 2YUIA 4HYQA 4NFHA 4Q19A 1BG6A 1JRLA 1KKMA 1Z4JA 4DMMA 1NF3A 2JI8A 2HMYB 2I1WA 3LY8A 3SBOA 5AUPB 1O5IA 2ES4A 4WKPA 3GI1A 4MRMA 4R01A 4YPVA 3ECSA 4M9ZA 4DQVA 5EXTA 4FDAA 4W5WA 2VXYA 4U0KA 1H2HA 4Y2TA 3RD5A 4LF7B 1A4XA 1M75A 4F4CA 1M10A 1CLUA 3FFXA 2P3QA 4JLKA 4CMKA 3H2JA 3MC1A 4PZDA 1OX4A 5D3MA 3KWLA 3NTVA 3S1LA 1NY6A 2V0CA 4A03A 2VUTA 3ACCA 3AG6A 1TTPB 2R6JA 2Y1DA 4H6VA 2QS9A 2HIHA 2VHCA 3CF0A 4COKA 1IXRC 3ZWXA 4M7RA 3CGGA 2KSQA 1AXEA 2AR0A 1R5BA 3H42B 3DE2X 1U2GC 3HB7A 3U3JA 3RJ9A 2J6HA 1MC1A 3SQNA 4IQGA 4KGDA 4N8EA 1B16A 2BZSA 4BVHA 3DLPX 4BO2A 5KSOA 1JSCA 4WLVA 3FHCB 1KYIA 1WB5A 4MQLA 4BGUA 3KC2A 1HYQA 4XUEA 1WBBA 3H3FA 1Z4OA 1XJWA 4G1VA 2ERXA 2BR3A 1NV9A 5DM60 5A3QA 1UM8A 1VL0A 5JAUA 1MFZA 4ARZA 3FGPA 1G38A 5LNK6 3GYBA 1ZGBA 1QUEA 2AHOA 2FVXA 3L6EA 3ICWA 3R6TA 2AKAB 2QN8A 5ULLA 1OHHD 1QM5A 2ZSAA 3L8HA 4XQGA 1YS7A 4XUCA 3HB5X 4U6SA 2ECKA 3RS7A 2XVMA 1XTRA 2I34A 2ZSKA 3IPAA 4PZPA 2SNIE 1PFYA 4P4SB 1WP4A 2WJHA 4PC3A 2YQ5A 1P4RA 4MRMB 2E18A 1T8PA 4PVCA 1CUJA 2CXPA 1ECGA 1AS2A 3AF2A 4PG4A 3DZ8A 1E7YA 3K4HA 1N25A 1QVVA 2QJWA 3B48A 4US2R 1KSJA 1NNI1 3LKVA 1RJDA 4XWGA 3H4IA 1JSLA 4YAWA 3UCFA 2BSXA 3GLFB 1JWBB 4U7HA 3ZDBA 9ABPA 5JYCA 3ZDQA 4CVNA 2QQ0A 2CJXA 4B85A 3C48A 1Y5MA 3B9QA 4EG8A 5ES4B 3SXUB 2AYYA 4WESB 3RV3A 1EUDB 3A9CA 1TK3A 5BNTA 1G18A 1GUDA 3DB1A 3H6GA 4P35A 3VO1A 3W7VA 1EQAA 4MQ5A 1H4QA 3OKFA 4ZARA 3KKEA 4LAFA 1T8UA 3CX3A 3FYUC 3WLQA 1XJ0A 1I9GA 3BSSA 4M7WA 3I6BA 4L4UA 3WNBA 5IKPA 4HGYA 3LLCA 1PKEA 3H0EA 1SOMA 3U62A 1DB3A 1P29A 4M9XA 4DA4A 3ZHSA 1R6BX 2BONA 2WF7A 1YHYA 3O94A 1QFYA 1EXVA 2NXWA 4AP5A 1HOXA 3NWOA 2LIVA 2WU1A 2A3NA 5AVTA 1RLJA 1E5DA 1TU4A 2XCQA 4JNKA 4KSCA 4C88A 3U80A 3ZD8A 4NL4H 1RLIA 1U0BB 5IBQA 3SHOA 2B7LA 2VP2A 1U2SA 5HFNA 4P86A 1EDEA 3SHQA 3GUCA 1ZMOA 4RLHA 2D7JA 2DQZA 2EWMA 4US1R 3C3XA 3UMBA 4YI5A 4CCWA 3SYMA 2WQZA 3SHVA 1QHIA 3IKLA 3ZV7A 3ENWA 4GMFA 3NBFA 5IAOA 2A78A 4Z53A 1CJCA 2J4DA 3ZJVA 1R16A 4TKMA 1W4RA 2OD9A 3QU5A 4YHHB 3ITNA 2O3RA 2ETXA 3HB4X 2A0WA 4AZSA 2DB3A 1L1RA 3AVYA 4OEHA 1FYXA 2ZIWB 4KR0A 2YMLA 4AMYA 4HQRA 2NTVA 3TAUA 1IAVA 3E03A 1PN3A 2IPNA 4MOWA 5DTQA 5BOSA 4HDSB 3PF9A 1GG5A 3DJFA 1OVMA 3DDZX 3H8JA 2IKSA 2WLTA 1XTTA 3F2IA 3K1ZA 3QXXA 4HN4B 4AICA 1MRSA 1ZC3A 2BGTA 2YBEA 2ZI5A 1YRWA 3CTPA 3QJ5A 1I6KA 3M4JA 2I7CA 3Q11A 2PPLA 5JZOA 3ZY3A 4CCAA 3MFYA 2GETA 2Q4RA 1XD2B 5KMGB 1TZBA 4OJNA 1F5NA 3SYLA 4N3GA 1O95D 1XVLA 3N07A 4PSVA 2ZR9A 1I3MA 3L2OB 3H2HA 1MCZA 4FFPA 2XUIA 3STWA 3WLSA 2NSYA 4RV5A 4XD2A 5DM70 1DC5A 3ZI4A 3MZ0A 1PQWA 4OJTA 3FKJA 4RIEA 1DGQA 1MVNA 3FTFA 3Q7QA 1U28C 4R8KA 1USUA 3ET5A 3FXAA 5EXSA 1EBFA 1FMJA 3VV2A 1TLTA 3BD9A 4JKIA 2QI9C 4MPDA 4GKJB 4XJTA 2G36A 1ID8A 3NHMA 1CSEE 3EGDB 5TQ0A 3V4OA 4PHHA 2HDHA 4TV8A 1JVBA 3B78A 1K4YA 1T4MA 1V5WA 2VLIA 3BH7A 4RLQA 5B3AA 3U37A 5BVHB 5ALYA 5EIBC 4PHFA 1I0LA 5KX5F 4QTYA 1CR0A 1LA2A 4GP6A 1RPZA 4N01A 4MWBA 3ZHRA 3QPDA 4UM9D 2PX0A 4DRXB 1GPWB 3EXIA 1XZHA 1INLA 3OP4A 2FRDA 4HWPA 4KAJA 1CJMA 1T3HA 3ED5A 5AKXA 5HDQA 1J7KA 3AY6A 3KQLA 3N2ZB 3ETNA 3GYGA 2BL4A 3VYUB 1MW9X 1NI3A 3DGFC 1P0FA 3CH6A 2XNSA 3LXXA 3NOOA 2JI4A 1KSHA 5D1HA 3W7BA 5JHGB 5CVJA 1H69A 4JVNA 2QMOA 3DOFA 1M0WA 3PSAA 3S2EA 4LXQA 4C0AC 2AVDA 2I2XB 2E0IA 3BTSA 2C2OA 4F96A 4HDAA 2WHYA 1K5GA 5I9BA 1JFSA 3NBKA 3BB3A 3P2IA 1VE6A 3E0QA 1UJMA 4ZALA 1ISJA 5F3RA 1XRRA 4UVEA 1NMYA 2ODPA 4MAFA 1LTQA 1JAYA 1YKSA 2AI2A 1VL2A 1F0KA 3GFSA 5TJHA 4B33A 5DCWA 4EG0A 1WW2A 1GZVA 1R1DA 1QOPB 2YC2C 3MEQA 1NATA 4MQEA 1IHXA 5FPHA 2BUAA 2LXNA 5DI3B 3U9LA 4K6CA 4W1RA 1YU6A 4KWTA 1L7NA 2R84A 2YQ4A 3K0CC 4MUBA 1KYTA 2FJUA 2V7WA 4MW0A 4RS4A 1R10A 4AX8A 4CMAA 4OLHA 1VL5A 3MGCA 4Z86A 3TZKA 3V1KA 4BNWA 1YUNA 1G20B 4JBGA 1BFUA 5GMOA 6ABPA 2QL9A 3AVUA 4OQDA 5HDBB 2BMWA 1B6GA 1DCKA 1DDOA 1VRWA 1BVRA 2RGYA 2ZLBA 3UHPA 3SK0A 1GLNA 1R0RE 4D44A 5LQKA 1NR7A 5DNVA 3IE1A 4R0VA 1Y33E 2WJYA 3PE4A 4IMIB 4A6EA 3ZG6A 3P4UA 4RS3A 1KNQA 2MJLA 2QVGA 3JD2A 1R0KA 4HEA1 4HWGA 3WRWA 5T4HA 3ZVNA 3C6KA 2W22A 2D8AA 3IBYA 3CVUA 1TF5A 1Y37A 1NF8A 2FWJA 5BR8B 1SVNA 3E5MA 2AR9A 1K6XA 3ODPA 3SM9A 2CXOA 1SWVA 3G9ZA 2ZREA 3NRJA 4MVJP 3IJRA 2NQ2C 1U31A 4GZ6A 4PLTA 5FI1B 2ZJ3A 1E5LA 2YZKA 5HCNA 1QMGA 1C3EA 2OAP1 1HZZC 1QKJA 4IHQA 3WISA 1BX0A 3HH8A 4ZVPA 1DC8A 1TRKA 4CQJA 3MTIA 2ZIVB 2ZQ5A 1OXXK 1NGSA 2SBTA 2XTJA 3QU4A 3ECAA 2XJ9A 4PCAA 3BX1A 4E15A 4JYZA 4MA4A 1IBRA 2A9FA 5EE0A 5EZYF 4B6PA 4MCAA 4M9SA 5A6VA 1NU8A 4C20A 2OYRA 5C8YB 1KDPA 1XOIA 4PEVA 4C2TA 3LPAA 2ZAMA 4UU0A 1RHMA 3JSAA 2ZJFA 3DAOA 1WETA 4C3UA 2C9YA 4I3FA 2O2EA 3GG9A 2I99A 2FN8A 3MW8A 2QR5A 5AVUA 1DFHA 2OORC 2Z6VA 4MWTA 3SXJA 1C0EA 1NVAA 4OJYA 1HDZA 4XQ9A 3N8GA 4KYIB 2NAFA 3LDGA 3V6MA 4FYMA 1XKQA 2NX2A 1WUHS 5KCZA 4MW5A 1T29A 5DYTA 2GZ3A 4M89A 4CMJA 8OHMA 4CR8A 1G64A 1LBTA 1TF2A 1J42A 1Y80A 3ORHA 5KQMA 1I3OA 2Q45A 3N87A 1NE2A 4AI6A 3FWHA 4LOHA 3TK1A 5EXXA 3MF4A 2PBFA 4DLWA 1XWFA 2R1VB 1K6JA 3IUQA 3QKSB 1DZIA 2H2AA 2J32A 2JI7A 4YBZA 3INNA 2JA2A 4LZWA 3B1JA 1G3QA 1L4GA 2AWOA 3HP4A 2GXSA 3L18A 4IZHA 4GQIA 1Y4DE 3FF1A 3AHHA 5FYDA 3G2JA 1FP7A 1KAMA 1G19A 2A33A 1BVUA 3R0IA 1U0JA 2F43B 4HQFA 4C30A 1EAMA 3ADDA 1UBCA 3CUKA 4X00A 1WMSA 4C4TA 2YXLA 2GAOA 3ENKA 1O3YA 2FPGA 1I5RA 1PEDA 3DBOB 1JR3D 5FXMA 4GYKA 4XYEA 5IVDA 4ZVTA 3INGA 4NOKA 3VR5A 7ADHA 2D54A 3HJUA 2V6GA 3PA8A 1T8TA 2GEVA 4WXHA 1O0CA 4C43A 1SVMA 1N5JA 4L4XA 1K0UA 4MUEA 5EIFA 5A6SA 2QN6A 1P3JA 2JH8A 3EGOA 1GO2A 2X40A 3W6NA 2WMDA 3KKNA 4F6LA 1D2EA 3MERA 2IV2X 1LDMA 1BDHA 1ES9A 1W8IA 4XASA 2CFOA 4K9KA 3RH0A 3GZTB 2VL7A 3VAZA 3GCGA 4BFZA 1JWLA 1MV8A 3WFIA 1L7RA 1ULZA 1XPJA 1HQDA 3L5OA 5HFAA 1U63A 1O94C 4FD3A 1W5BA 4X1KB 1N2ZA 1CP2A 3AQIA 4RKFA 2VTBB 1D0VA 2O20A 1E3IA 2O3TA 3F46A 3VH4A 1F0NA 2BGLA 1SA0B 5DCYA 4UCFA 3QU2A 4WFIA 2OUKA 5L45A 2VRWA 1OGIA 4EHLA 5IABA 3WWYA 1P2SA 1IEXA 3WFZA 1M8PA 5KSPA 1E61A 4DLSA 1AHHA 4PAGA 1H3FA 3JD0A 4ARAA 5D87A 4NBVA 3CO0S 2IZ6A 3K2IA 4XD7D 4BLQA 1EM6A 3LGAA 5CDYA 3GLGE 2QQGA 1HG1A 5HEKA 4MVJI 3E9EA 1XVAA 3OIDA 1YOVB 2HU7A 1JDNA 1Z56C 4EGCB 3IV6A 1ST3A 1W29A 4PONA 5CDHA 4L75A 3ZHVA 3DT9A 1SIWA 4G4IA 4OM8A 1G291 3B82A 2ZYGA 3KFVA 3EA0A 4XLZA 1U7OA 4DY4A 5HUJA 3LE8A 3W79A 1CJKC 1A96A 4GSLA 4HDKA 5B7GA 2FR0A 4MI9A 1WPXA 2X8LA 4M36A 4URVR 2C20A 3JVVA 1VSTA 1SCUB 1N77A 1YULA 3R6DA 3U7GA 4AJOA 1EI9A 1OBOA 2HAEA 3B1ZA 3KSZO 2UUOA 3CIFA 1JQBA 1R4MB 3IBFA 3MCTA 1A8PA 3RVSA 3ZLBA 3AVVA 5KCMA 1P19A 2A5FA 4U1RA 2PMBA 3KVYA 4M9CA 3D8SA 4RABA 3U7FB 3OU7A 1FDSA 1JDJA 4FX5A 3CRQA 5HUQA 4KNVA 3HHPA 1VKHA 1XA0A 4J7CA 4PC2A 4Q3KA 5LA6A 2W2OA 1GZ3A 3AF5A 3PEEA 2CYAA 1II8B 4LTMA 4LX8A 4NOLA 3TR0A 4DMCA 4XCXA 2Y66A 2HY7A 1NRJB 4EIWA 4YFVA 1E7SA 2NVUB 4D3SA 3T9BA 1XF1A 3W8FA 5FUMA 1GYPA 1Q0QA 5LQJA 4KVZA 2G4VA 4RSHA 3D8NA 2OECA 3IT0A 4L4ZA 3RYHB 2JHFA 4O59O 1VCNA 1HYGA 3B1KA 2B1RA 4FMBB 4GFDA 1G5PA 4RYDA 1JG7A 4D9FA 5B6IA 3KPJA 2PM8A 5CDSA 1KH2A 2RHWA 5K8JB 3CEHA 1YDFA 1YRBA 1NXQA 1T3TA 2VPPA 2GEUA 3F3SA 3BA1A 3EVDA 1E89A 3NFRA 2OBNA 2JFYA 2CK3A 5LU9A 1XZJA 3T5BA 1NW5A 4E5UA 1FW6A 3HUTA 3O0DA 1B8UA 1X0VA 4QIHA 3LY5A 4RETA 2RFLA 2ZKIA 2AUNA 2JIRA 3A6FA 3AJDA 3AU9A 3IA7A 3PRHA 4GXRA 4URZR 2XUDA 2E87A 1Q7EA 2VBCA 4P7KA 4PYQA 4ZA2A 2HXSA 2JFFA 2WMNB 4M1EA 4R51A 3UATA 2HMAA 4OU4A 1U0GA 1SBNE 2Q1SA 2PH7A 3FNEA 1KEZA 1S3IA 1Z26A 2O2YA 4IO0A 5CGQB 3UOGA 3W34A 1I51A 1WX1A 3ZE9A 3NT2A 3VI3B 1GTMA 1GDTA 2GUGA 1VL1A 1ECCA 3EFEA 2VQ6A 5JWOA 5JH7F 1Y3DE 2VP4A 3I5MA 5JVDB 2XKKA 1Z25A 5ERGB 2XGMA 2Q99A 1D2AA 3BHNA 1Y5LA 1LSUA 4FZRA 4NZ9A 5A9RA 5JW6A 2DQKA 3ZQ4A 1JTVA 3DLBA 2HRDA 2L19A 3CX7A 3CLVA 4NLLA 3EBPA 3ZHUA 4YJ2A 4IS3A 3VR2D 4V0LA 3JWEA 4ER5A 3T7EA 2FN7A 4HB3A 3V3KA 5BV8A 1E6MA 3ZU2A 5HW0A 2XOKA 3PQEA 2W2QA 2XNJA 3ILHA 3KHSA 4D26A 1XRQA 2XCUA 3I45A 3RT1A 4X90A 2GVZC 2VWQA 5KU1A 1VZ2A 3BA6A 2ZBPA 3KSBC 4EMUA 2ZIEA 3NI2A 5IC4A 4LZJA 1LPMA 4J1NA 2IP2A 1YA4A 2VDKB 3GHHA 3RIHA 5KOJB 3VPGA 2IIBA 3S7TA 1O08A 1CUXA 1W4BA 1P1JA 3FTNA 3FHTA 2V74B 4E94A 4F2GA 4BBJA 1KMHB 4DR3B 3ROPA 2G67A 4H4EA 3DZGA 2QMHA 3WWCA 3LCRA 4FHFA 1E1LA 4ND8A 1MDFA 2Q6LA 1XCOA 3HGMA 3RHZA 1NX9A 2AMJA 3PD7A 3ZWBA 4NBTA 4BLWA 1V8BA 4CR6A 2ZUEA 1BXGB 3WKAA 4CPDA 5AMXA 4DAOA 2PFGA 4D2IA 5AJWA 4EPRA 3L43A 3DLHA 3HSYA 3OD1A 2DTDA 3QOFA 2B82A 2QE7D 2XMPA 4QG3A 4HXEB 2PEYA 2JLYA 3WK9A 1E7RA 3TSCA 4UKDA 3UENA 4EEKA 4NK4A 2BTOA 4HVLA 3L9WA 4RE6A 3ROTA 2F3UA 1KMCA 2PUVA 3BE8A 1N5IA 1Q21A 1OGYA 3VR6D 3QSYA 2JCBA 1DKQA 2FMTA 1LC3A 3NHPA 3OTIA 5KNDH 3OD5A 3WRXC 4BKOA 4OXXA 3HXKA 1G1MA 1NJ5A 2PUHA 3M1AA 4B47A 1Y8RB 1ZVQA 2D13A 4MVJD 3UMMA 3H5IA 4OGFA 4DMFA 2B3DA 1QB8A 3FNRA 4A0SA 1CQXA 1KO1A 1QJCA 1V5IA 4OBEA 3H13A 4MYRA 5C32A 4ISBA 1E6CA 1BH6A 1AG9A 5G0SA 2O8VA 4FOPA 4Q6WA 3U3RA 3VAYA 2GAIA 2UVPA 4IEIA 1YS1X 2Y27A 3THSA 5HK8A 2DBRA 4E32A 5F5LA 3NJ4A 1YR6A 2BH2A 1DKRA 3OVMA 4US0R 5ALMA 1YJCA 1ZAKA 4MKXA 2W2VA 4E5KA 3D7NA 1RLTA 2A9PA 5H5JA 4KL8S 3VSEA 2CL6X 2WINI 3BXZA 5HA5A 2GB4A 2CJWA 2XCRB 1CF4A 3DFMA 3VOBA 1XDUA 1YR2A 4IWNA 2WUWE 4Q4DA 5KQPA 3LCJA 3EGXB 1XMIA 3FLBA 3LP8A 4QJBA 1TUIA 4IV0A 3T1QA 1Q16A 3WB2A 5BN3B 4JYAB 4GRAA 3O3CA 3FR8A 4GNKA 4QQFA 3H2YA 4PLZA 3EF1A 3NDIA 1PZFA 1RQNA 1ZI8A 2F17A 2P11A 4CU2A 3EGDA 5TQ0B 3M5PA 3I34X 1WCWA 4XIJA 5FB3A 4PX5A 1A69A 2FPIB 4F91B 4OATA 3JPYA 1YKGA 2R96A 4BFUA 3EG5A 4NU6A 3BULA 1U99A 3FYSA 4X9XA 5CHYA 2POQX 5DNCA 3THWB 4BOYA 4Q37A 2MYUA 4RY0A 3V00A 4LGCA 4I5DA 1NBWB 3P0JA 4M6WA 3ZCSA 4QEDA 2XGJA 2Z08A 1ENZA 3R8CA 5A4MS 2VIIA 3L46A 1RRKA 3RQIA 4UDXX 2PJZA 1TUGA 5JJIA 3ENZA 3E3NA 1P0CA 1SXHA 4IRMA 3PC7A 3PITA 2R47A 4DJEC 4LF6B 5CJ2A 2EW1A 5JR3A 3F7TA 1X39A 2J07A 2FMKA 1YR1A 2WWXA 1ZD2P 1KBQA 3BPSA 3KD2A 4MWGA 4Q7KA 3UTCA 3AEUB 4J0FA 5K3FA 3VC2A 3LY9A 1C3JA 1F5SA 3HP7A 3RK0A 5AJHA 2IZ0A 1GJRA 8ADHA 4P22A 4B17A 1PSDA 2Y67A 4XFKA 2NZYA 2M98A 4F3KA 4DQUA 3AOGA 2BKLA 4V1CA 2RG7A 4X44A 2CT8A 4W8HA 1IULA 3CPHA 4D4IA 1N7HA 3IEXA 1GN9A 3PRJA 3A2NA 1BD3A 4UOQA 3I5XA 1LVUA 2G5CA 2YFYA 4IUYA 3WLKX 3PGLA 2VXBA 5FWXB 1FZTA 4D45A 5AI0A 4ZTBA 4JOBA 2NYVA 3EWIA 3K4QA 2YYSA 4KQXA 1FTWA 4O2BA 1M6NA 1TA0A 2C3OA 2ODBA 3MXOA 1KHTA 4R9RA 1QF9A 4I4TF 5DI3A 3K0EA 1Z07A 3ZTWA 2KS6A 1XCBA 5AKLA 4EQZA 1L7VC 1MAAA 2RIRA 2GXQA 1WLSA 2BW0A 4WNAB 1CEYA 1L5QA 2J41A 2ZRJA 4OQPA 1U8AA 3U0VA 1XL1A 2BMDA 2JGAA 3QFRA 3DNFA 2O7SA 1Z2AA 5BWMA 3BZUA 5J63A 2X5KO 4RGYA 1VKZA 4AZ3B 4DA7A 5DTEA 1EESA 1GSHA 1TQ6A 721PA 2AGVA 3LFUA 3LL7A 4HWTA 4REQB 3EIXA 1CV2A 1J1ZA 1DOAA 1QV6A 4H7PA 2HXYA 3Q3VA 1QDEA 4KR2A 3DW3X 3TVDA 1T9GS 4XYMA 1YA6A 4V0OA 2NV2B 3UCEA 3CCBA 2RB5A 1SXJD 2NG1A 4JMLA 2PSSA 2IXGA 3OPQA 2XXAB 1Z5OA 5IZCC 1NF2A 2GPAA 1L4UA 2EFCB 2P2NA 3C6MA 5J5AA 2HQRA 4KWHA 4S2UA 1UWCA 3RTGA 2X4GA 2XYQA 3WYGA 2H31A 3ZHYA 1GXSA 3DZBA 4BCCA 3MCAA 4K1XA 3ZXYA 2TMYA 1XMVA 2Q41A 2QL6A 4QBFA 4BPRA 5B2FA 1X7YB 1HGXA 3U7HB 2OKGA 1PAUA 2BHTA 4QUBA 3MAGA 2IF2A 3W1WA 3RAFC 1NF9A 1OT3A 2HMVA 4WK4B 5BRNA 3H2GA 4FD2A 5KHOC 4J1SA 3T9AA 4OM7A 3HJGA 4NYJR 4EUKA 4KX5A 1O97D 1MP0A 4H77A 1SCNE 3F5MA 4AMUA 1PKXA 4DLYA 1JR6A 1B1AA 5CNJA 3S44A 4Q1DA 3UGQA 4DT1A 1F3LA 1RVV1 2APJA 4Q9IA 4DBLE 1G5QA 1E1YA 3IVMA 5HFJA 5CVDA 4ED9A 1NJGA 1B0ZA 3FTPA 3IPLA 2H16A 2WLSA 1KY3A 3CG0A 4JJ4A 3H18A 3IMFA 2Z5GA 1ZA1A 3VR6H 4WKNA 1NNEA 9LDBA 2PUBA 2IXDA 2X8AA 4ZI7A 1IHYA 4KH1A 4D6XA 4JUBA 4EH1A 4YK7A 3SJUA 4L72A 3PA6A 1NJ1A 2QP3A 2ILVA 4DIFA 3BRCA 2FPPB 5IJ9A 2B1QA 2Q2OA 5LQUA 2P9CA 1O54A 3THXB 4UUBA 2IEBA 2MINA 4CM7A 3AF4A 4Y1RB 3N75A 1TKBA 1R00A 1AUPA 1HE1C 1P1IA 4YPOA 2WTUA 5MGBA 2G9VA 5FUYA 4UTPA 5CD9A 4MVJG 5I7WA 1YFJA 3UPUA 1ZD3A 1BGVA 5M29A 2I4LA 3ABRB 3LDAA 3GJQA 3IDOA 3Q0EA 4N76A 1G5RA 1L8LA 3CKKA 4I9GA 2Q0XA 5G0WA 1P1HA 1FMLA 4G1FA 3TRHA 3PVSA 3JRWA 1R9NA 1UZLA 2QD3A 1IJEA 1BE0A 3MGGA 2XD4A 2YYAA 3DEYX 1M2NA 1U7HA 4OPMA 4ZPJA 1UXHA 4BMSA 3EAFA 2FR8A 3A26A 4QGFA 2R79A 1SRQA 1HZZA 2LW7A 3H8SA 9ATCA 1UK6A 1HXHA 4O2AF 4Q3BA 2D5CA 1E3LA 1F8XA 5IDWA 3DBHA 5EJIA 2H1WA 3KLBA 1UPTA 1ZOIA 2LDBA 2E37A 2XBLA 4RO0A 3HP1A 3TQCA 5KOIA 3U6BA 1GSAA 4E70A 4BO5A 2B9VA 3N5CA 5EWJA 2JAHA 1XE3A 3LZCA 1KI8A 2VAVA 1ONSA 3PPWA 3TW8B 5L6MB 2OD2A 3E58A 2W83A 4MLDA 1JS1X 2JH9A 2EQBA 1QXSA 1RJWA 2ID4A 4FWIB 4GR9A 2D00A 4Q4HB 3RVNA 3URKA 2Z2KA 4YRJA 1M34E 1WOMA 3F3MA 4I0WB 1JEQB 3ZGXA 1Z5WA 2FVYA 4KLRA 4BP3A 5B7PA 1E5XA 1F2VA 2ECPA 3O4HA 4LRUA 3CCCA 4U9UA 4EKYA 1L7PA 3GGSA 2XDAA 5BNZA 4YB8A 3OZDA 4YCBA 3D6UA 4IVRA 4B81A 1VC2A 3V42A 3CBGA 5HJEA 3HVRA 2OGTA 5F64A 3CR7A 3OCYA 1XEWY 5FBLB 5ALFA 4BVGA 3TL6A 3G0HA 3ROGA 4KNYA 1C4OA 4PYMA 3JALB 3PYXA 1E7QA 4P34A 2VDLB 2PLNA 3W6UA 1L5SA 1MUUA 1RMQA 1THMA 2X77A 2ZIXB 5AJYA 1RQXA 3ZBQA 3HYNA 5DLYA 3I2JA 1MDBA 2C4TA 1RAEA 4DIUA 5JVDF 1Q44A 3D02A 2ZSDA 4E5PA 4KYVA 1XJCA 3N0TA 4ZCRA 1P5FA 1UK7A 5C5DA 2GGSA 2A0YA 2I3GA 2ZSIA 3QVVA 4LGYA 2FOLA 4DDTA 3SC3A 4CF7A 4TMZA 2VC2B 4C78A 4BB9A 1L3BA 1EG2A 3FDIA 3BK7A 3EWSA 2BEVA 4LN1A 4BMDA 4K6MA 1CJBA 4HPJB 2IBMA 1OXKB 1VSUA 1I36A 2FW1A 4JBWA 2OGUA 3MMSA 1PGOA 3QMPA 4IJQA 3RV4A 4BIIA 5ISMA 1AOXA 4O08A 4GH5A 3O4JA 4KRGA 3EH2A 2XHZA 3LJKA 2R1ZA 4ADSG 1X6VA 3TIXB 4G24A 2PIAA 3HWWA 3KALA 3WQQA 1V1MB 2FRDC 3IP6A 1W93A 1ADBA 1SU4A 1J4AA 2JGMA 3F98A 4E6PA 1LY1A 4M76B 3HWRA 2D2FA 2H48A 4R7GA 2ZP1A 3R0JA 4M1QA 5T57A 4XWTA 5I7UA 1UPFA 1GU0A 4KE7A 4RTNA 2WFZA 1WQ3A 1AZTA 1W88A 4RK6A 1QIIA 5KNBH 3L7YA 3X1KA 1A27A 2O50A 1I3LA 3ZDFA 4ESEA 2X1HA 5E0KB 3COYA 5FWNA 3TN7A 2PYIA 2QMYA 1KJ9A 5TT1A 5LQDA 2AN3A 4FLFA 2ZKLA 1YVRA 4OTZA 2XZOA 2C78A 1CUWA 2HDNB 5ECGC 2NAPA 4ZTZB 1UBMS 2O7RA 1XQ6A 2XCTB 4PGAA 1I13A 3G6KA 2WUVA 3QMVA 1PE0A 4YUAA 3D3EA 4QOIA 5JANA 4KLZA 1KY2A 4MR7A 3E0XA 3ZY6A 2EZTA 2XXBA 5GJCA 2VK1A 1PHPA 1A2BA 4KRYA 2VNSA 5DIFA 3DLTA 6YASA 3PUXA 2ODNA 2WWGA 3GDOA 3KL4A 4LY3A 1V0JA 3EXFA 2PSHA 4X6XA 2EL9A 1JDZA 3EIWA 4QDUA 4HNUA 2R85A 1AA9A 2F1JA 1CK4A 2O3UA 4A92A 4D92A 1HE3A 3NV9A 2RHTA 1S2DA 2QTTA 2AZ4A 1QIGA 2W6JA 2AK3A 1PJ4A 4NCAA 2Y9PB 3IX7A 3A4VA 3KTAA 3HBAA 3F8TA 5LMUB 2C7PA 1NBIA 2EV9A 3B6KA 3D2CA 3DOHA 2H5EA 1SG0A 1U8YA 3EC1A 3GT0A 3LT2A 4A3SA 3CF6R 4LZPA 1T8RA 2QIOA 2RHBA 1KAGA 1JYEA 1WF3A 1WTCA 3IKJA 4HF7A 4L5JA 1SUPA 2B5WA 4NENA 4NCIA 5ALSA 3DTNA 4BO0A 4MYDA 3BF8A 4ZYLA 1LNSA 2WB2A 1TCVA 2P9GA 4YUXA 4OHZA 1QCZA 3T5CA 1MRZA 1ZJYA 1GCUA 4P3YA 1FRVA 1R0LA 1WXHA 4EG5A 3O2SB 3TLMA 4GZ5A 2ZTSA 3FVTA 5K0TA 2VTBA 1EH5A 1Y6RA 3EZ7A 5LYJF 3AB8A 3CF2A 4MVCA 2NV0A 2RJ3A 4FC7A 3X1MA 2B1IA 3QEJA 3UHJA 3BJMA 2HNAA 4IG9A 2W2KA 4TT3A 1GGHA 4CKEA 1ORTA 2WHXA 3LU1A 4HB4A 3CYFA 1SVIA 5E3JA 1O4VA 1ZH8A 2XMDA 4J0IA 1NQ5A 2IU0A 1S4MA 4BXOA 4YGXB 4JBXA 4C7OB 3QLTA 3KV1A 3JY6A 3VVMA 4BAUA 1OV4A 2IYLD 4C3ZA 4IH9A 2AFHB 3I32A 1OBCA 2KMLA 3ST7A 1YOVA 4KQEA 4A4DA 4CE6A 4V0ME 1YI8A 3R9KA 5DNAA 4NJMA 4NCBA 4JC4A 4G37A 3UYKA 1VSBA 5EJGA 4RBNA 4Z51A 3W5VA 3RGGA 1USIA 1YFZA 2IELA 1YA8A 1FSPA 1IN4A 1B93A 1UMKA 3IAXA 3RIYA 1KI6B 1M54A 2C8JA 2E49A 2P5YA 4M86A 4ANFA 5CVTA 3O2JA 2KM1A 1V37A 3MJRA 3EEFA 3OZCA 3PNKA 1AGXA 2G1UA 1YDMA 2GUWA 2CSUA 4JOSA 1UT6A 3E5NA 3ISVA 2V96A 3MMNA 4N65A 3W7AA 4EBFA 1W87A 3IIKA 2XQKA 1LWNA 3KBOA 3OFNA 2HSGA 3GAFA 4A8TA 2D7DA 3AR6A 4H1WA 4FYWA 4F92B 2J0SA 2H5IA 5I7AA 3RU3A 3ZU3A 4ZAVA 2B2NA 4JC5A 3L1HA 1FSGA 4B4WA 4BO7A 1J1UA 1IOZA 1XB2A 1Z8NA 4HYTA 2O1SA 5CXXA 2ZTHA 1VDMA 1Q50A 4KAAA 4DWOA 5K7SA 2C88A 4Z2AA 1CZUA 4UARA 3H5OA 1NMSA 4U2DA 2BFWA 4ZAGA 3VSBA 4B48A 3CM0A 1ZOLA 4EB6B 1OXVA 3EQ9A 1GA1A 3BWCA 4BFVA 4INPA 2O4UX 4KYUA 1H5UA 3JRNA 2DECA 4URUR 1LF5A 1E6UA 4LDPA 2G83A 1Q1QA 5FBZA 1VCHA 2O3SA 2OFOA 3HDVA 1ZH0A 3VNAA 5KVQA 1AKVA 4GT1A 3VU8A 1R5OA 8MHTA 5KOJA 1FFGA 5FADA 2RC5A 5JXJA 1QH9A 3NGMA 1N2CE 5AXDA 3I39X 2BMEA 3E6AA 1NBMD 3FTCA 4L5AA 3ZZMA 4EHBA 1RZRA 2O8FA 1XVIA 4JL6A 4AKSA 4MUIA 4ZMBA 1E3MA 4DDHA 1OXSC 4Q9HA 1E2LA 3RSHA 5DNEA 2AJCA 5DEIA 1H5QA 3BRQA 4FLEA 2YH2A 4RK5A 3NHZA 3DM5A 2XUFA 1EX9A 4P0QB 1U2QA 2CZQA 2GTPA 2OXRA 4K81B 4DGSA 1HZJA 1YQXA 2IHKA 3HUUA 2VWPA 4JN6B 4G26A 3VH1A 1C1YA 4CQLA 4BEVA 4YXFA 2NZVG 5BT8A 4BNKA 5FPPA 1KEUA 1JLKA 3PT9A 4Q93A 4XAQA 5EINA 4BLRA 2MDTA 1NDQA 4EG1A 5HK9A 1ULHA 2YY7A 1PZMA 4GGPA 5E2BA 2O8CA 4B5KA 1QG2A 1ESNA 1NVDA 2D5BA 4V24A 3H9EO 5AXAA 4BO4A 4LMPA 4OHXA 4C21A 4BX2A 3TTUA 1J90A 3A1UA 4OCZA 4G0NA 3RF6A 2J3QA 4ZQEA 2C4MA 3NHSA 2IGBA 5IAGA 2GZ2A 4DB2A 1FQWA 2AN5A 2BSAA 2V6FA 2DJ5A 2PS3A 5KNDA 4GGMX 1HK7A 3H6KA 3BWYA 1M0TA 2XH8A 3BK2A 4DBZA 6REQA 1JEAA 3S2GA 4FC6A 3T5GA 5ABPA 3TQQA 1RRGA 2DWOA 2OP0A 2VUUA 1QJ4A 3AB3A 2XADA 3KYJB 3OIWA 4PO8A 4XOIA 2Y68A 3G2KA 5WRFA 3BDAA 3K35A 5KDLA 3DE0X 2FPRA 2GBLC 1VJ5A 5IFLA 4FUTA 3W3AA 1W52X 3RYIA 2CB9A 2IBSA 3MTJA 3DL7A 3H0KA 4LISA 4GOXA 3TQOA 1P1KA 3JQFC 5IH3A 3GEDA 4DCGA 3AIKA 4RFVA 1YJXA 3WOVA 1EDDA 2TMDA 2DKFA 3JVIA 4O0LA 4Q47A 4FDMA 5CDFA 2NZ8A 4MXDA 3PWSA 2XODA 2YBDA 2OK8A 3P2MA 2CDCA 1T3LA 1XZAA 4COOA 5ADVA 4GS5A 2NPOA 1IN6A 2REOA 3V8VA 3SOPA 2PGDA 5YASA 2GN6A 3TJMA 2H4WA 1N5LA 1PG2A 1YOBA 3N9IA 3NVMB 2VRCA 3HKDA 5FA5A 2ZTVA 1J00A 3KEGA 5SICE 5KTOA 2PH3A 3HC7A 1RQGA 4KLCA 4RSRA 3C41J 4WKOA 4EL5A 4ZHQA 2GM3A 3PR2B 2Z8XA 3EMBA 2CMGA 1GKLA 1M7BA 5IM4A 4EJ2A 1H8HD 4JUCA 4WZAB 3ZHXA 1A82A 2P91A 4PYKA 3F6RA 1MGPA 3FB1A 1I1QB 5JNTA 3BBLA 3L41A 3OE4A 1T2EA 2XPCA 1BSVA 2XRFA 2WP0A 3EZNA 2DFTA 1EUZA 3Q5EA 3HZZA 2BGJA 2I3BA 3SLRA 2UUPA 1ZP6A 2HCJB 3OI7A 2OZPA 1ZLXA 3FOAA 4D02A 1R9MA 1SKQA 2GASA 2C1XA 1R0XA 2FSPA 3CXRA 3IMCA 4K8OA 4CMEA 5EC8A 1H93A 4YAUA 1K08A 4RJLA 4EHAA 1P0QA 3MJEA 4HK4A 4BX0A 4MCJA 1F2DA 5DGIA 3N6RA 1Z6PA 2CE2X 4C6TB 3UJPA 2IYUA 1IG3A 4IIUA 5CXSA 1EFVB 5EY5B 4NS4A 1GNLA 3VAAA 1QP0A 5I7RA 2BGKA 1V6AA 4KFCA 4LV8B 2HF8A 1KYXA 3UJBA 4QWWA 4TXNA 5U4XA 1XZNA 3A2LA 4U0JA 1A5BB 2W37A 4CMIA 4CKZA 5FTKA 4NKRA 2QJTA 2O7QA 4AKHA 2AMVA 2EDCA 2ZU6A 1L1QA 3O92A 4PNHA 1I4EB 4G5GA 1TA9A 4WA7A 3T12A 3S2SA 4CM9A 3UMRA 4C4ZA 2QXYA 4IG4A 5EZQA 2Z3VA 3NJRA 3I1JA 1V4NA 4OXYA 5GQSA 4DC9A 2FQWA 2KX7A 3RRNA 3UV6A 3NFYA 4KBGA 3G0CA 2QW1A 3MMXA 4R8RA 4B6RA 5JSQA 2PUJA 3HDYA 1U6IA 3PDIB 1GN8A 4KB5A 5TQ2B 3MINA 3V2IA 1W0KA 3GFVA 3FNFA 3VOTA 1DAOA 2C2XA 4KUHA 3PLRA 4PN7A 4TTPA 3BFKA 3HA7A 5K8UA 3TRJA 4J4TA 4UNPA 3ZUPA 2JW5A 3VNSA 5ILOA 2IF0A 2F1KA 3OEEA 4IHJB 3T5TA 1PTJA 3HYRA 4YJGB 1PUXA 2G25A 2NUAA 5K8VA 3QWAA 1YBHA 4XR9A 5EE9A 3BYZA 4C0QC 3ZH9B 4PLWA 3HCWA 4EHKA 2QNBA 3C7KA 1E66A 4O4IA 4KMMA 4Q34A 1LK7A 1QLJA 1XI2A 1KZHA 3P8ZA 1G4AE 1P1BA 2B4TO 4J6FA 3V97A 3HJTA 5LQAA 2EU8A 1GKKA 2XMCA 4UZSA 3GN2A 1SD1A 1SVUA 1HFKA 1SOAA 3P9QA 3GJ6A 4IS2A 1U2EA 1OTXA 1YZVA 1W8DA 5K8TA 2PFKA 1Q12A 1RWQA 5JBQA 4G81A 3DONA 4KRXA 2P7IA 1FW8A 4J43A 4CL2A 3WDMA 5ALKA 2Q6OA 4RNDB 3D3QA 3ESRA 3BGOS 5GV7A 1E2GA 3QOXA 4JCCA 4BP8A 4UPDA 2DHQA 2ZVDA 2W4MA 3CLRC 1BKDR 2O57A 5EIOA 4ZAWA 2X41A 5CCEA 2AG1A 3FOCA 3PPIA 2PE5A 1MXFA 2WKSA 3IJ5A 3VKWA 3W05A 2I2CA 4B3IA 2QUIA 4PSKA 3ANSA 1ISHA 3E2MA 4LA4A 5TQ2A 3S1AA 3UVEA 3A11A 2Y99A 2FPXA 4ZQHA 1K7EB 4D4LA 4D3DA 2XYPA 2EWVA 2FP4A 3H04A 4LVCA 1AB5A 1AKTA 1M6VB 2QX7A 3QVGB 4HQKA 1BOOA 3P9YA 3V2UA 2IUFA 1IZ8A 1ODIA 1WZEA 3ITEA 4M0CA 4MS1B 3RJ5A 1LDGA 5HKKA 2RHGB 1IN7A 5AW4A 1ZD4A 4X64B 1EJ6A 5DNUA 3FI9A 3PNQA 3TSAA 3RS0A 4UREA 1YB7A 1IWBB 5EHZA 3PFHA 4D9MA 4F1JA 2X2OA 4OQQA 4UU7A 3ZHCA 3I3SR 3QY0A 4CIXA 4D97A 4QJ5A 5C5IA 4TZ0A 2IDZA 5AVZA 1LQUA 3TYXA 1SXJB 3RVQA 4MGYR 1CUYA 5FT9A 3AFMA 2FLWA 1QGOA 4DLAA 3RIMA 1QIMA 4ZDKA 3M5DA 1X7DA 2QE7A 3PBKA 2NO1A 2W6NA 4WZBB 5DK6A 4D8TA 4GI5A 1HNZB 4GRIA 4AG6A 5FBQB 4MHOA 4EHHA 3PXXA 1GZDA 4NU5A 2X14A 2ZATA 3A32A 3NOVA 4LXUA 4RIIA 3LUGA 3OM0A 3O5AA 1K2WA 1FQJA 1N2HA 2R25B 2PLAA 3FMPB 1S96A 3WYAA 4BNYA 4BV2A 1BGWA 1TI7A 1PJTA 4TYMA 4A2QA 3MHTA 3H7AA 4B31A 4CUKA 1R3DA 1IN1A 3EVEA 2WB4A 3S99A 5B2ZA 5JU6A 2ZZKA 4REMA 1VGRA 2CEAA 2QD5A 2GK4A 1QGAA 4WFJA 3CLUD 3ZX4A 3NHRA 2BIFA 3MUOA 3H5VA 4Z1MA 5BPHA 5CITA 4DJ5X 4YO7A 2HL6A 2IQIA 2V7QA 2QBYB 3RJMA 1XZIA 2R6AA 2CDAA 2XGGA 3K72B 3PDWA 4TWJA 1S0UA 2JFVA 3WGYA 3BCRA 4J7XA 3E35A 3SQLA 4MKHA 4G0VA 1XV5A 4HCJA 3Q85A 4BATA 2WJZB 2W93A 5EZ5A 2RGUA 1NY5A 5HSGA 4U7DA 1XQ9A 1CIJA 1E1RA 2WQ6A 3DAGA 3BK1A 3B60A 1LFDB 3V8RA 3TFQA 1X92A 1EGHA 2IU6A 2YFQA 4INJA 4P8RA 2LBPA 1MN6A 2QEQA 2CL5A 4MQMA 1FJHA 2ECFA 1TFUA 2J0EA 1ZUD1 4ZKDA 5ICGA 1SC6A 4L1KA 3G02A 1WUJS 3O4FA 4OUKX 5TMEA 3RLFA 2ZXFA 3Q88A 1NULA 2JF0A 1FFDA 2VPZA 4ZYWA 1A9OA 4MTCA 1E92A 2UVQA 2WFLA 5AJTA 5HQJA 1PWHA 5ICSA 3U3ZA 2W6QA 2PUTA 1I2BA 4XPIB 3NYRA 4UHFA 2EJBA 2H29A 3GAAA 3HYSA 2YN2A 3A1TA 4WBNF 2UVPB 3GLKA 3HACA 4B35A 2OCIA 5F5NA 3BEOA 4L3OA 5AKZA 3RREA 3N39C 1UWKA 4D4MA 5H3HA 3PWTA 3D7RA 1QKKA 4OL0A 4XRRA 3A58B 4NYIR 3JCZA 5CG2A 4R1PA 3M6LA 5BNIA 1BA3A 3VH3A 1UXIA 4CWAA 4UUOA 3A9RA 1HT1E 1ISMA 3EDRA 3O7MA 4XX0A 4JIMA 4AIRA 1Y48E 4JI4B 3I62A 1SVOA 4NZOA 1PQYA 4BCBA 2BCEA 2I33A 2NO0A 3R5FA 5HKOA 5J43A 2JL1A 1XSEA 3DEZA 3TWOA 1VI6A 4UQOA 4CQMD 5HM6A 4O6VA 2G08A 3SZOA 2Y1FA 3ZW8A 1C80A 2RH4A 4ENWA 5C9ZA 1P2VA 4MVJA 1TW2A 1YQTA 2ATEA 2C9ZA 3KOYA 3V9PA 1BWPA 3LLSA 3WLJA 2Q4EA 1JFRA 4ABTA 2FR8C 2GSWA 3HCOA 3TEMA 5I4BA 3DKVA 4NMXB 4ZO4A 1WZ2A 2R00A 3I0MA 3U3MA 1ZOOA 3GPDG 1M2VA 2WU8A 5AOCA 5CIWA 1N32B 4WK2B 2NZJA 5C34B 1XTPA 4E33A 1QNFA 1ICIA 3LQ2A 3HLTA 4GOKA 4IOMA 3SHWA 1X3SA 1GTRA 4PPFA 2C1ZA 2VPQA 1Q74A 1UIRA 3KJZA 5K4AA 2P9ZA 1FNDA 2WPDD 3CLTC 2IDJA 1Y34E 1FL9A 1B2LA 4U7GA 5K8CA 3DZFA 4YX9A 3GFPA 2OHVA 1XNHA 2ZCVA 4A8JA 4BQPA 5L4NA 5IK2D 2DFLA 2D2IA 1PLLA 5K0EA 1Q0PA 2AW3A 1A9PA 5A4JA 2I4NA 1MAWA 1N0WA 1S8NA 1XHEA 1PNTA 1QONA 1Z28A 3LMKA 4OHMA 4DEYA 2FFJA 1X0XA 1D6SA 2JBAB 1P7PA 4ZCPA 5CFNA 2DFVA 3U7QA 2ORWA 2Y1KA 3K71B 1TT5A 3RNLA 3UMCA 3S7ZA 4GUAA 4B71A 4QJ3A 3Q8MA 2FX2A 3CLSC 1A1VA 2ZEJA 1N3LA 2CFIA 1M6YA 3B53X 4S04A 4B6JA 1F6BA 1PG0A 3MN1A 3CRRA 3G3EA 1FB5A 3BUSA 4JSYA 4JU8A 4YMHA 4PLVA 3Q2KA 4FJ1A 5AKYA 3ZKAA 1QQTA 4WVFA 3FW1A 3B1WA 4KC0A 4IIBA 5A4IS 4MEJA 4YJ3A 5HTOA 3KYDA 2PL9A 4LZLA 3JAWB 1G6KA 4CM1A 3O3NB 2NVOA 2GMWA 4HRYA 5AW8A 1SKAA 3R8XA 1VBMA 5IM5A 1HDGO 2HNBA 3TE6A 4CN8A 5C37A 2QTVB 1D5WA 2H2FA 1MB0A 2W2LD 2XNCA 3LO8A 4P92A 4J3NA 3W9YA 4DCTA 2ZRCA 5EJ7A 3DAHA 4X3OA 1U0FA 4AXBA 5C18A 5IVPA 5LQCA 5CNKA 4D4GA 3MIIA 1VJGA 5MDHA 4R84A 1TZKA 3HCRA 5LBTA 2C2HA 4MHSA 421PA 4IMJB 1IBCA 3DPSA 5F23A 2QRUA 1O89A 1N6PA 2B9EA 2QY9A 4AROA 1ZH2A 4KLAA 4J6EA 3EXEB 2R65A 1F38A 1UZMA 2PD6A 2YV2A 1SULA 4FKZA 5HZMA 4Q4LA 1LLFA 2YJ5A 2VJDA 2L82A 5AICA 3FPFA 4TL6A 3GVPA 4KO1S 3O03A 4FW8A 1R88A 4OQFA 5TVGA 4EPXA 2Q6IA 3NAZA 2QRQA 4KOEC 3RYHA 3WWZA 1IUKA 1G8PA 4FDLA 1KI3A 3NTOA 1T36B 3DMHA 3G88A 4CW7A 1GZHB 1QHGA 4FZ5A 4TRNA 4UASA 3FYUB 4JBIA 5H7XA 4JDPA 3WWOA 4ZOLF 1ZK4A 3BHJA 3I9V1 4QUEA 2BMVA 2QPTA 4P2GA 4YRZA 1XIVA 3VH2A 3AV3A 3FAZA 1EPUA 1XXHB 3Q2IA 5IUNC 4J16C 5EJFA 2R5NA 4MV9A 3RABA 4CDNA 1M0SA 3LP6A 3SI7A 4HJXA 1G55A 5JBNA 4DMHA 3ZYZA 4DR1B 1ND5A 3QPWA 1XROA 3NCHA 2L18A 3HB0A 1LPPA 2VBFA 4YAGA 1NRIA 4I8XA 1W1WA 1WMBA 1D5CA 3GOQA 3MMPA 5THKA 2VHWA 4BQQA 1CKEA 4I1PA 3JYHA 1MB3A 4DYDA 2R00C 3L0IB 4R2XA 1K7CA 1DQZA 1Q0SA 2RGWA 3PUJA 3BGDA 3J7TA 3I8SA 5JAQA 1KYWA 1M5TA 3KOMA 4IFTA 2NSJA 2R7MA 1T25A 5EFOA 3Q8LA 2IC5A 4KXNA 1NVFA 1RKBA 1EE9A 2WBLC 1XZFA 2H07A 5K3CA 4C7OA 2JARA 5JAOA 1SQFA 3N0XA 4ARUA 2G63A 1YVEI 1YBFA 4I6GA 4XYGA 4Y9SA 5EIHA 5T41A 4RFLA 3RPEA 1PGJA 4B7CA 1P45A 1G17A 4K28A 4NEHB 1ULSA 2FMXA 1G16A 1BE6A 3E9CA 1L5HA 1FTQA 2EEPA 4ND5A 5ALGA 1Q6ZA 3CJQA 1SC1A 2COEA 1CVLA 3GPIA 1D0SA 3LX6A 4R3WA 3BRWD 3FROA 1MFPA 1YIAA 1ZCJA 5BMVB 3K1AB 1WXGA 3Q3GE 4QC2A 2XWQA 4F5DA 1ICEA 3NIWA 4HP8A 4LPKA 5CW2A 3T0GA 4CL3A 3ZDXB 4EKEA 2C07A 3FPEA 4HZIA 4M21A 2XQIA 1ISFA 4GF5A 4C3OB 1P0PA 2AOWA 3OC0A 3QE3A 4FMCB 4HRXA 3DMYA 2XBMA 2Q1YA 3D2BA 3REOA <