4UMGA

Crystal structure of the lin-41 filamin domain
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
130
structure length
102
Chain Sequence
SGPCAKNSSIVGDSFKKAIRERQTVIYVQLRDACGDLLSTSDVQAFVISPDGSTVEVTMTPRENGIVALSYYPSIEGSYTLNILVKGTPISGCPTTMDIRRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Trim-Nhl Protein Lin-41 Controls the Onset of Developmental Plasticity in Caenorhabditis Elegans.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Structural protein
molecule keywords PROTEIN LIN-41
total genus 21
structure length 102
sequence length 130
ec nomenclature
pdb deposition date 2014-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00630 Filamin Filamin/ABP280 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4umgA00
1MAJA 1RD6A 1Y6MR 2CDGB 1MWAH 4H20H 5EWIH 2J1KA 4KAQH 2J88H 4JQIL 1ZMYA 4PJ7B 4JGJA 4HWEH 5LGJA 5HD8D 3O9WB 3LHPL 4DGIH 4LSVH 1KCUL 4M3KB 5BCAA 1XF2A 4TUJA 3WIIH 1UCBH 3T0EC 4QRQA 1WFNA 5JIIA 5DDHB 1LP9E 1I1YB 4AK1A 4C56B 2DI8A 2IQAA 5HGAB 1Q0YL 4I48B 5E94A 4LHUB 2IAMB 2EC8A 1XGUB 3MOAL 4KK6C 3ZDXF 2AEQH 3LKPB 5I1EL 3D0LB 5E70A 3SDAD 4JRXE 4KROC 5ALCH 1BEYL 3S88L 2AV7A 1PQZA 1U8LA 1CFTB 3PP4H 4F7TB 3V52H 3X3FH 5HI3C 4NUGH 1BLNA 4YXHH 1QSVA 4M6OH 3D3VB 3HI5L 3C8DA 4PV8A 2XA3A 1T1YB 3PNWA 3GRWH 2HJLA 3Q0HA 2IAMD 1YMHB 4NQDE 2YD2A 3QWOA 1KTLB 5ACZB 3ARFD 4JFDA 2YSSA 3T1FA 4JFQB 4CMHB 2CIKB 1OGAB 4YC2C 2EKSA 4JY5L 2EXWD 5L0QB 2KH2B 1IGFL 4DEPC 4JQXC 2WSKA 2E7LA 3KPOA 5E03A 1XH3A 5JQ6H 5ICYB 3ZDZF 1UKQA 4L3EA 3JUYA 1YYML 4JJHA 4XH2B 4ZPTA 1EHNA 4L8CB 1REIA 2VLRB 3MV9A 3O6KH 4A6YA 3UPAA 1NUNB 5JIKA 3BH8A 2VLLB 3QZWA 4MJ6B 2ZP0T 4XBGA 2O5ZL 4K3EL 3UBXG 2GSGB 3TLRA 5HY9A 5BV7H 1RZFH 1CF8L 1CDIA 2OZ4H 1F4HA 3G04B 4NKQB 4EBQH 4E41D 1ZEAL 3QEQE 7FABL 1GZPB 1I7RB 3GSXA 5F9OL 3R8QA 5I9QC 1G6RL 4FQJL 5EZIH 1IEAB 5DJDB 4S1SL 1CL7L 1OQOA 1OAKL 3RNKA 4ZYKB 2BY0A 4DFIA 3PHSA 4TUOB 1L7IL 2GUOB 3CX5J 1UKTA 2HRPL 1T0NA 3QWRA 5D96C 4HFUH 4OFIA 2BK8A 4OIBA 4ODTH 2EDLA 1X5JA 1S7VA 4K94C 4LSRH 1NC4B 3MV8B 4CU6A 1BZ7B 3C5ZA 1ULVA 4JRXB 3F62A 4TVPH 3U7WH 4UTBL 2R56H 2Y23A 5DVLA 4MJ2A 1EA9C 3W0WB 4P5TC 4M4RA 4WU7B 4DW2H 1I8IB 1INEL 1JFQH 5DHXB 2AJUH 4Y4HD 3QFJB 3RWFA 3LKSB 3ARFB 3SCMA 3VXRD 1PLGL 1BM3H 1T66C 4ONHB 3GMOA 4GMTH 2NPLX 2HFEA 5H35A 4GKOA 3RUGE 3HZKB 2MWCA 1JUFA 4ELKB 4AY0A 2VDLL 1NL0L 1OW0A 4U3XA 3PL6A 1MIEL 4WJ5B 3WIFA 1S7VB 5HVGB 3QPQD 3TA3C 3RIAF 1PYWB 3L5XL 2GY5A 1YEIH 3H9SA 4BSJA 1IVLA 3WFZA 3TBTB 4JQXA 5HGBB 2XQYK 2YPVH 3C6SB 3C6LA 3UTSB 5FEBA 2D3VA 5E8OA 1HHJA 1KXTB 2IMNA 4IS6B 4WTZG 4M7KH 3VXMA 1P7HL 2F53B 1OWWA 4MQSB 3L3OB 3GSXB 1WWCA 4HCRH 1BAFL 4PLOB 2Y25A 3GI8L 3F58H 4KFZC 4O2FB 2HTLD 1T4KB 5IROA 3VXSE 4FP8H 5DRNA 1I9EA 1CZ8L 4X8XA 3VMNA 4LGRB 1E4JA 1MRFL 3VWKA 3RTQC 1A7PH 1SYSB 3C5SA 2MMXA 3SGDI 1B6UA 1OP9A 1QVOB 1UZ8A 1BOYA 3V4PH 4YNYB 3V0AC 3NFPB 2PYEE 3VXOB 5E94B 1A6UH 1OT2A 2XYCA 3FN0H 5IHUL 3BWAB 4NO0D 3KPSD 2FCBA 1JI1A 4Z7VF 4JVWA 2X44D 3WIHH 2XNAB 5ITBL 2HJFB 1MPAH 3BP7A 1BD2D 3PDOB 4WFHD 1A5FL 1K4DB 4DZBA 5GGTH 5SWSA 4FQXB 5E5RB 3EJYD 3D3VA 2AI0L 3BMVA 1RQ5A 1LEGA 3ISWA 3LN5A 4LCIH 5CJBA 1FZMB 2EDEA 3N50A 5I1LB 1MQKH 4UV4L 4ZS7H 3QIBD 3CFEA 5ALCL 1S5HA 4K71B 3MRHB 1FDLL 4UAOC 4N0YL 5CZKA 3PG2A 4QYOB 4F80A 1QP1A 2FIKB 1OAXL 4GMSH 4X5XA 2A73B 4Y0GA 1H3PL 1JNHA 5CSGA 3RWDA 3MYJB 4HKBB 4ODWB 3L3HA 5DD5H 2ZSVB 4FFVD 1DBJH 1R6VA 1JRHL 4O9HL 1JYWA 1QG3A 5TE7L 4DZBB 1UYWH 5CJQL 4HIJA 1U8NB 1GPOL 4O5LH 4CADB 4N0UB 5CP3H 1MCOL 2WINA 1Q9WA 5MEND 1LGVA 1HEZB 4HAGA 5GIRB 3HPJA 1OP5H 5JXEC 2EDDA 2NX5E 2LAGB 3WFEH 3M45A 3W39B 3CFIC 3HMXL 5CCKH 5CGYD 5CLTA 4N5ED 3VD4A 2ZCKH 3DX8B 5LBSH 2BMKA 3WMSA 4Y16C 4XVJH 4WHYG 4R2GC 1DN0B 4TNVK 4NQDA 5HDLA 3PV6A 1G7JB 4GXUN 5DJ0A 3CZFB 3IFOB 5ESAB 4XXDB 4F9PA 1XR9B 2X40A 3PHOA 2Q20A 2NZ9D 4JZOA 3KLHD 4WI8A 1OSPL 2AEQL 1EZVX 1U8NA 5KJRL 2D31A 1LDSA 4K2UH 1FCGA 3VA2C 5LGKA 5CJOH 3ZYOA 1SJHB 2YA2A 4RMVA 4XMLH 4NNXA 1CBVL 5HHMB 1Z0NA 2WV3A 4FQJH 3LKRA 5EZIL 3VXUE 5CD5C 2WANA 3P0YH 5IB3A 2Z4QA 3V5KB 1F2QA 2ICEB 1Z9SA 3ZE2F 5CBAA 3RWFB 2RCSL 1HYRC 3SJVD 4M3JA 1TZIA 4HS8H 3RPKA 3UTOA 1FG2B 3MRCA 2HVKB 3EYFB 5BZDB 3PWLA 2DI7A 5HDBF 3P9LA 3MO1B 2M26A 5DD6B 1FSKB 4FQHB 2RGSA 2AS5M 3PIQB 4HUUB 5IF0B 2YBRA 4LDEB 4F7MA 1A4KB 3U7WL 4KVCL 1K6QL 1IKNA 4P46B 2MKWA 4CMMB 4NHCL 2FJGB 5SWZB 1SJHA 3T04D 1GIGL 2XA8L 4BH8B 4KUZL 2NYYC 3IU4H 4C56E 1TJIH 2NY5C 3TCLB 5HI5D 3JWOL 4LPTA 3GMPB 2DBLL 2DYPD 1SEQL 3DX8A 3C2AH 4PJ5A 3U6RA 4UILL 1HQ4A 5LGJB 4R96B 5I1LA 3B9KA 4MLSA 3W2DL 3IDIA 3EYFA 3OL2A 4P49A 2OR8A 2BY2A 1KIRB 5HYSA 2VJXA 2ADGA 1EK3A 2UYLA 4HHAB 4JFFD 2OZ4L 2VKWA 3JTTB 3SKUD 3GJFA 2CJUL 3OX8A 5E9DE 3K2UH 3EBAA 4R97B 4JANB 5CFHA 1RZ8B 4G6AC 4DN3H 2V5SA 5JMOC 5EOTB 3U36B 1T5WA 3T0DA 3OXRA 4CN4A 1TENA 1SBSH 4RISH 1KIQB 2EIZB 2J6EH 4CN1A 1KF9B 3IXAA 5C07B 3JVGC 4LIQE 3ZE1E 2H3NA 1O5DT 2DMBA 3BIAX 2A6KA 1IQWL 4N0UA 3P77B 3GHEL 2YRLA 1S7QA 3TO4C 3IDMA 4EUPA 4IRZL 5IFHH 3WJJC 4JY5H 3GJEB 4X6CF 2G9HB 1CK0L 2Y7QA 4ISVA 4XNUL 4KTYA 2IBZX 2J12B 1W0WB 2Q3ZA 1KIRA 1F6AA 3WXWH 3BPOC 5HYSB 5FGBC 3MLYH 3O6LH 5DJCB 2MQ0A 4YJZL 3RPIA 5MEPB 2VDQL 1JHKL 5E8DL 1S78D 1YN7B 3DVFA 2MQCA 4JHAH 1RK0B 4OT1L 1RJLA 5CWSA 2FIRT 3AMKA 2QQLL 4GOSA 3U0TA 4PFEA 1YDPB 3F7VA 1KEMH 2ADIA 4KRPD 4Y7MA 4KK6D 1I9RL 4HG4J 2EIDA 3P4OA 5HPOA 4OZIF 3EUUA 2OR7A 1H5BC 3ZSTA 4Z7VB 3ARTA 3QRFM 4U0RC 4LVHC 4M7JL 3VFPA 5E2UH 4NM4L 4YDVA 4OFYA 4JKMA 3PQYD 1P4IL 3IFLL 3WFHB 5D5MA 4N1HB 3HR5B 1WWWX 3DBXB 2VDML 1DJSA 1CLOH 1XAUA 1FL6B 3GGWB 5DEZA 4P4RB 4XVSH 4G9DB 1RHHB 1JGDB 1XFPA 4L3CB 1NC2D 1TZHB 5CMAB 1YN7A 3UTSD 4NQDB 3B5TA 4G7YL 2XN9A 4YBQD 1ES0B 4OM1L 4G9FA 5D6DC 4LHUG 3H8NA 4RGOL 1RSFA 5DQ9A 4AT6B 1NCCH 2BNRB 4LL9A 1QOKA 5DD5L 3MQIA 4LLQA 3EOTL 4QTIH 5AUMA 5D7LA 1UM6L 4M62H 1MRFH 2C3VA 3D18B 5EBGA 2OL3A 2BHUA 3PWJB 3LRGA 3W0WA 2QR0B 1BWWA 1G84A 1H8OA 4JRWA 3LEXA 2PTVA 3G5YA 2DF3A 4TSCH 4UBDC 5IB4A 1NGYA 4X7TB 2LTQB 5IVXE 4NP4L 5BO1L 1R5WB 4NFDA 5F3HB 3ZKMC 3FONB 3S37H 1ZGLB 1KPVA 1A47A 3DX6B 5EH1A 4Z7WF 4GKSA 3UJJH 5HHQA 2OLDA 4U6XA 3VXRA 2ILLA 4CU8A 3TVMA 3KXFB 1AXIB 2JB5H 2SEBA 3RVXD 5ABDE 4XHJC 1F11A 4GSDH 3P9LB 4G9FB 2HRLA 5B38A 3D6GA 4HHAA 3BVNB 3KYMB 4ZOBA 3C2AL 3VU2A 2X89A 2DL9A 4Q0XL 3EDEA 1WWAX 5C0IB 5C09E 1PD6A 2CKNA 4LLWB 1QSEE 4PBWD 4QRRB 1N0LA 4C4KO 2BOCB 1WISA 1ADQA 1FFNA 3OZ9H 4KXZI 4O4YH 1H3UA 1U8KA 4X4ME 5HI3D 1DBML 3O4LD 2APXA 4P3CL 4Y4FD 4RFEA 3HUJE 5F7MC 3VXMD 2RHEA 4ZAKD 1QKZL 1MJ7L 4IJ3B 2VDNL 5F70A 5F3HA 1AR2A 1NFDF 1IAMA 3IJHB 1RZJC 5FFLA 4ACPA 3HC3H 3FQTB 1XF3A 4OLYH 1A9EB 4PRIE 3QA3B 4HFWB 3T4YA 1D5XB 3MLSH 5C0FA 1MNUH 1DLHA 5IVOA 4TOYH 4DQOL 3ULUH 3MR9B 5IVNA 3QWQB 4OJFH 3BQUD 4NNYA 2WLZA 3K4DA 3FB8A 3PP3H 3ZDYE 1H15B 5GS1B 4ZOAA 3P4LA 3MUY1 1KC5H 1F58L 5E6ID 3EDJA 4TTGA 4HDIA 4JO2L 4CDGC 1JPTH 4EDWH 5D7KE 3KYOA 4PPTA 2A6IB 3N0PB 2XNAA 2P44B 5AYUH 3WO4B 1FJ1B 2PW2A 5DJ8B 1RZ7H 2X70B 1Y18A 3RZCC 5IOPA 2VABB 5KVFL 4KMTL 4FQIL 1JHLH 1TVBB 5IB4B 3NTCL 3ARZA 3P77A 3NACL 4PJFE 5D7SL 4AQ1B 1ZGLP 3MRRA 4XVUD 3UTSE 1EEQA 3C5JA 3AU1A 4URTB 3B8SA 5B38G 2AJVL 3ULVL 1UKSA 5IMLB 4HBCH 2ICWA 2QQQA 4S1QH 2JCCE 4HAFA 1ADQH 1BOGA 1OL0A 5D1XD 1NUFA 2XACC 4UINL 3MLPA 2GYSA 3MFFB 4Z6AT 1H15A 4KMLB 5F7DB 2UZYB 3MBEA 4PGBB 5DT1L 3K80A 1CGUA 1YNKH 4BUHA 3UPRB 1P84J 3QG6B 4HC1A 4ZOCA 3S5LB 5FUOH 5E8EA 4R2GB 1FO0B 1I85C 1QYGH 1M6OA 32C2A 4XC3H 5EO1A 3O6ML 3GSRA 1R3JA 4JG1L 1RHFA 3D2UB 3NAAH 2YPLE 1JIBA 5D96B 3RU8H 4TYUA 1KNOB 3TZVB 3CLFH 3FO2B 2DRUA 25C8H 3QH3A 3G5YB 3LD8C 4JDVB 3O0RH 1MWAB 3DO3A 4W4NA 3PGFH 4U1HB 5FM8A 3NIDE 1M7DA 3HG1E 2X10A 4XBEH 3KVQA 3NFNA 4CVXA 2X1PA 3D5OF 5J89A 1E6OL 4YLQT 4NN5B 1SEBA 4Y5XC 3DIFA 5GS1A 4OI8A 4KPHH 3TO2A 2IGFH 4HWZB 4OZGB 3S5LA 3WUWA 5MERA 2BNRA 3ZHLA 1WFOA 3LY6A 5IEKB 3UTTA 3IJSB 3RVUC 2ID5A 5E08L 4LSSH 3G5XA 3QXDA 4JPKL 5IMOB 5DFWH 2R23A 3O6LL 3UC0L 3N1GC 2QQKL 1WEJH 2BSTB 1QLEH 4Y16D 5CJQH 1XF1A 2OXGA 1DVFD 3TBWA 3WEXA 3HUJF 2FD6L 4Z76B 1IM9D 2A6DB 2DM3A 5HHOD 2Y1VA 4DOHB 5D71H 3MXWH 4J12A 1AQDA 4RAVB 4I0PA 3QDGD 5HYJD 1UB5B 2CLZA 5IEHA 5DA4A 3VDCA 1GOGA 5GS0D 4YHOH 3DGCR 2APWA 3HE7A 1LO5B 3WS3A 2X1XR 4QOKB 3LN9A 4P9HH 4X6CE 3O9WC 3S88H 1BBJA 3V5DA 1H5BB 2YEZB 1RVFL 2ICES 2X4NA 3NA9L 1S3KH 4Y8AA 1A3RH 3S36H 1DVFB 4G8GE 1LD9A 3K4AA 1JNLL 3EO1A 2FGWH 4PJBF 4RCAA 3BRDA 4U6VL 4P2OA 3MOAH 3SBWA 4XPHH 5K33A 5I1AB 1Q1JH 4PRAA 5I9QB 4XGZB 1JHKH 2C3HA 5E8DH 3IDUA 1OAKH 4EI5B 1N6QH 3MUGB 4Z0BL 3RL2B 5C2UB 1HHKA 1J5OL 1I4FA 4HEME 3LQZA 3THML 2R1XA 3W81A 1DUZA 3NIDF 5I8EA 1CE6B 3J7HA 4QT5A 3NCMA 1CF8H 1TJGL 1Y6NR 2H6PB 5LGHH 2IC2A 4ZNEA 4P4KA 4ZSOA 4ORGA 4LLDA 5D70H 2VLRE 5C3LD 4Z18A 4MNGA 1A6ZA 4H1LA 3MCG1 3MRDB 3U30B 5CD3B 3DJ9A 2R23B 3HLAB 3QUXD 5MP6H 1U3HD 2GAZB 4BUGA 1RV6X 2O5XL 2VERN 3BPLC 5JPNB 4K7FA 1QPXA 2NXYC 3EYQC 4EQ3A 1MAML 2NNAB 3OKMB 3G6AA 4NRXB 4KRNA 1QFWM 2W0PA 1I7UA 1JPFA 1YEIL 1KBGL 2R2CA 4KI5D 1AP2A 1BJ8A 3FHAA 2GK0A 1LEKB 2VZUA 4N0RA 3TYFA 2OMNA 5C2BL 4JPIA 3NIGF 1NGQH 3SDCA 2B4CH 5EUOA 4N8VA 4D9LH 4HH8A 4WI2A 5ITFB 1RZIA 3QCTH 5IK3B 1FN4A 1IEHA 4X6FB 1BQSA 1CU4L 1DQML 3LKOA 5KSAC 5FCUH 1HH9A 4KJPD 1XCQA 1E4XL 4ODVL 2BRRH 3BISA 4I0PC 3LH2L 5T5NG 4WHTA 3O3AA 1YQ2A 3SE4C 3MREA 1WZMA 3VGHA 4L9DA 2DQFA 4OGXH 3SE8L 1CGSL 3O6FA 3QR2A 4WW1B 1YEEH 5IHBA 1QFUL 1VEOA 4U1GC 2ICWI 1LVEA 2ATPA 3FN9A 3KS0J 4KWUA 4Z95H 3CMOL 5ADOH 1J86A 4LEOA 1YEDA 2GSIB 3OGOE 1ZS8B 4GLRH 5GZND 1E4KC 1BX2B 3OKYA 3T77B 5KG9A 4NYLA 2WIIA 4HLZG 1CFSB 4WI5A 1GGCL 2JELL 3O8XA 4NZUL 1WCBA 2J2ZA 5EZLB 2V5YA 2OTPA 4JGUA 5K9KA 4QLRA 2YPLB 4OZFH 2RBLA 4X7CC 4J4PD 4CRPA 3WXVL 3F7YB 3L9RB 4UB0L 3IB4A 3UBXB 3BAEL 3GKWH 1T1ZB 1OF2B 5IMOA 5T3XE 4L8DB 1F4YL 4NC2B 1J7VR 3S8WA 5E2WH 3A6OA 1UVQA 4Y1AB 1PY9A 1ZLSH 2NTFB 3U4BL 5IGXL 3BPNB 3HNVH 3SDYH 4XPAL 2MNUA 4CVZA 1QA9B 2O61A 2W59A 5I1CH 3VWKC 1J1PH 1P5UA 2D0FA 2JJTC 4ZPTB 4JDTH 3HG1B 4BFIA 3VCLA 3BKJL 3QEQB 4AENB 2EDRA 3ULUD 2X89D 1C7TA 1G7IB 4M61A 3PWPB 1XR8B 4JZJC 5TE7H 3VWJA 1HXMA 3WHE1 2BOCA 1I7RA 1MHPH 4MXQD 1I3GL 3AVEA 4RX4A 4Z7NE 3BOVA 4NQCE 1R3HA 4PY8J 1UJ3A 1Q1JL 4PJHE 3UYRL 3HI1A 4ZYKA 2C1OA 5JR1H 2IPKB 3LKRB 3KPRE 5FDWA 3U2SB 3E6HB 3UJTH 3B2VH 2JB6B 2BOBB 3RWEB 2OK0H 2CR6A 4NN6C 4ZO6A 4JCLA 3C9NA 2DIJA 1XF3B 1T7ZA 4I3GA 5EIVA 4WY7L 4YXLH 1ZT4B 4APQD 3ARBD 3HZVA 1ZT7B 4M7ZB 4RMSA 4HBQA 3S37X 2J8UE 4ZTPH 4MNQD 4LSQL 1FZOA 4JFED 1I3VA 2Q8AH 5KSBA 2AXFA 4OZGE 4HWBH 4DCQA 3QRGL 3DURB 2BDNL 2X7LB 5I74B 3PL6D 4OAWB 4PJFF 4OQTL 3W9EB 1GPOH 4O5LL 3ARRA 3DI3B 3EW3B 1KN4L 1CICD 1S7TB 1QUNA 5F1OB 1NJ9A 3O3AB 5JW3L 4CVZB 4UDUB 1XIWD 4HCRA 3O2DL 1MRCH 4Y2DA 4U1KB 1WIUA 1DP0A 1Q9KA 1WBZA 1N59B 3KPPA 1R3LA 2E27L 1JGVL 2CMRL 3TN0D 3C5ZB 1X5LA 1HXYB 4TVPL 3VA6A 4O02H 3RWCB 1TZGH 3MV11 2EIBA 3KPQA 1EAPA 3DVIA 2K1MA 1F4AA 1H0DA 3L1OH 5I1IH 1IGML 2WIIB 4LVNC 1QFWH 4PJCA 5HI5C 1QEWB 5E8EB 2CSPA 2XT1B 1XZ0B 4J3UA 3X11A 4KJQC 2R2HB 3AAZB 4WW2C 4PLKC 2YPLD 4LQFL 5FOBA 4G8IB 2WK2A 2BVYA 1SYSA 3C5SB 4F57L 2Y6SC 3QISA 4GG8A 3MA9H 1RI8A 3NH7L 4DN4H 1JNLH 1FE8H 3C09B 1HILA 2ATKA 1L0QA 1RUAL 5SV4A 5D7JA 2GCYB 4ZSOE 1F5WA 4XVTH 3CVHB 5IJKA 3ME0A 1ZHNA 4UOJA 5HGDA 3LV3B 3MRLB 3RPIB 3RX7A 1FZOB 5JHDD 1BWMA 3HC4H 3V79C 2EYTB 3BE1H 1LP9F 1BX2A 43CAB 3MV8A 4TSBL 1X7QB 2V2TA 4KMQA 4W6YB 5ECJE 3GI8H 1X4ZA 3V0WL 4MAYD 4LCWA 2V9RA 2R8SL 2A77L 3FO9A 1JZ4A 3L7FA 2DQDH 4XP1L 3VXUB 4LDLB 5JLZA 3MJ6A 4LRNH 2UZIH 3OHXA 3SQOL 2BSRB 3BD4A 1DUYB 3AC0A 4C56A 1UYWL 4NNPH 4PJDB 3L3IA 4JLRA 4JRYA 1VHPA 1R3LB 1BIIB 3S7GA 3OB0H 1R3KA 1TTGA 5J11C 3VXSB 1NLBH 3FAWA 4LSQH 3I75A 4WHYH 4FXKB 4X98A 4ZUTA 1NLDH 3MRIA 4QXTA 4ODBD 4KROB 4C4KT 1ZVSB 3BZ4A 2WBJC 4D3CL 3H42L 2FATH 3WO3B 1ZHKB 4TSCL 3OJMB 4QRRE 4XBEL 3ECBB 5TPWL 1WSST 5DYOA 3R8BB 4YHPB 1BBJB 3C6SA 4UQ3A 5GGTA 3NFSH 3MLRH 3H0TA 4BZ1H 2AXFB 4E9LA 3X14B 1FL5B 5EA0L 5HGGS 1JNJA 1BQLH 3H9YA 4PJDF 1U8PA 3IJYA 4FZEL 4OD3H 3HI6L 5I74C 3QP3A 1O7VA 3B5GA 4R97C 3VFUA 5CAYB 4BQ6A 3C60D 3WHXA 2H26B 1R3KB 3MGAA 3MNVA 4M8QB 1MCWW 3BEVA 4PP1D 1HNGA 5F44A 1GVIA 4MD4A 4YQXH 5I1HH 1DQLH 3FT4B 1XF4B 3AREA 1E28B 3LPFA 3BP4B 1YYLL 3QHFH 4XPFL 5ID1A 1KB9K 4KC3B 4AL8L 1PBYA 4HGWB 2F15A 1NCDH 3BVNA 5LCVH 4P4KB 4LLYB 3AS3A 1GAFL 3RKDD 1HQRA 7FABH 5ILTH 1OTUD 4WY7H 4GRMA 1D6VL 2D03L 2X4UA 4GBXA 1BECA 3UBXI 5C07E 1DR9A 2NY0C 3HS0B 3X14A 1ORSB 5TE6L 3KPMA 5JPMB 1YN6B 3R1GH 4KV5E 3MSPA 4I77L 2CGRL 5MENB 5BJTB 2CIKA 1FNHA 1LP9B 1F4WH 1QSFE 1N3NA 3O3UN 5E8PA 1G7LA 3B9KC 4GRWF 5IMMB 5JR1L 5HTSA 4TN9A 1F13A 1ACYH 4U49A 1WBYA 5KSVA 4FOMA 1A7RL 2QSCL 2NY3D 1XF4A 3MNWB 1G9NL 1ZVSA 2CXKA 2HJKA 2ZPKH 1YY8B 1FNAA 2XICA 4QYOA 2IJ0C 5FO9B 4OM1H 1WFUA 3FQNA 4OUOA 4G42B 5HHOB 1GSMA 4QHLA 2L4OA 1K4CA 1GZQB 4OIIH 4TTDD 2AAVA 1SY6A 4RBPH 4D0BB 2V5MA 1BLNB 1E27B 4GAJL 3EYUH 1A8JH 4JFFA 2GFBA 3EGSB 1I1FB 2FSEB 2HP4A 1C1EL 1VPOL 4NSKB 5FA3A 3SQBA 1MJ7H 1JGUH 2Y9RT 1YMHA 5TE4H 3D87B 3IDGB 3PP4L 1KPUB 1T7VA 4YHNB 5EUKB 3BIBX 5GS0C 1ITCA 2KL6A 4KJQD 3MRQB 3FFCB 2E9IA 5GGRY 3EYOA 5KSBF 3O6FC 1DN0A 5KVFH 4GW4B 3Q6GH 2P8MB 3K74B 1GCFA 2P24B 3CFBB 4IRJA 5IVXF 2BP3A 4BH7A 4DWHA 3QPXH 2I07A 5AYUL 1HCFX 4OCLC 4WRLA 3MCKB 1ZVHA 1XGTA 1FFQA 3SDAA 1JWUA 2A74B 3VD9A 1Q9OA 2OQJA 4PP2B 3TZVD 1TLKA 3MV9B 4MHHI 2DBJA 4QO1A 1JZ2A 3ZYZA 4PGBA 3UJJL 3RZCD 2CLRB 3O8XD 3RKDC 1EHLH 4M9PA 3IDJA 3ULUL 1MWAL 2BNQB 4H20L 1C12B 2ZUVA 3JUZA 4L29B 1R0AH 5BO1H 3EO0B 1KIPB 1MVFA 4ISVB 2IFFH 2W9DL 4GKNB 4I0KA 5DUBA 2HKHL 5H35B 1CDUA 3WLBB 1XGYL 4Z77A 3CJJA 3MV7D 4XAKE 4BSWA 2VLMD 5GGSB 1JBJA 1JRHI 4JFDD 5L9DL 4GG6A 1EMTL 3CSPA 5MEOA 1CGWA 1PYWA 1BFTA 1V7NL 3U36A 1BF8A 1A64A 4OZFG 1SQ2N 1MF2H 4U6YA 1V05A 5C71A 3VGAB 5I19H 2XG4A 1CDBA 1A7QH 5ENWB 3C6LB 5F9DC 5HHXH 1A4KA 2HN7B 3OR6A 1IC7H 3MBXL 4Y4FC 4PJHB 5A16B 2VAAB 4Y2OA 4JRXA 1IE5A 5IESH 5DD1L 2Q6WB 5HVWA 5TQ0H 1FORH 2BVQB 1MCJA 3IDGA 2XN9D 4N0UE 5FF6A 4HMEA 5TGBB 2Z93A 3SO3B 4PJAF 3T2QA 5DJ6B 2IQ9H 2YZ1A 3L1OL 3O41B 4XP6H 3RGHA 5T1KD 3RUGB 1LP9A 5C0CD 3SCMB 4FQ2H 4DKFH 4KHXH 4M9OA 2VDOH 3QDGB 4L5FH 3NCBB 1MUJB 4F9LA 4PREB 4IRSD 4YE4H 3T2NL 5KSAD 1RUPL 3QUZA 4N9OB 2Z8SA 3V0VA 2XWJA 4C83A 2R0KH 1ETZB 2QTEA 2AJZA 1URLA 2X41A 4OKVA 1EO8H 2W0KA 3ARBA 4XP5H 3WIIL 1VGKB 6CGTA 4PR5A 1B88A 4ETQA 3IDNA 4QHKJ 2FD6H 3CVIH 5GIRA 5IHLB 2G5BA 3MV9E 4ENEC 1KELH 3NCJH 2GJ6E 2AJYH 4LP5A 5FF6B 4TVPE 2EDYA 2OTUA 3QG7H 3QDMD 4Q9RL 2A0LC 3TCXA 1FL3B 2ZKHH 2HYMA 5IBTL 1DBJL 1IC4H 5A3IC 4PJFA 1B2WL 1G9MC 2OBGA 2QQNH 2A73A 1W0YT 1XIWA 4WI9A 5ICYA 3P9MA 5EO9A 4AIZA 5C3TA 5ENWA 5D2NA 5F9WB 2CGRH 5CGTA 4OCWL 3LIZL 3WDIA 5D7LB 1RPQA 3TV3H 1OWRM 4G42A 3H9SD 5FYKH 3O45A 1RULH 5CBEA 3U9UA 2EE9A 1QSEA 4R3SB 4ZXBC 5SWSB 3VG0L 1S9KC 1T66D 1AR1C 4LOUD 1AKJD 5C8JB 3WIHL 5HI4C 3VFNA 4XWOD 3V7AE 3HR5A 5L0QC 5E6IA 1JYNA 2X2YA 2BSED 4YFDB 3VI4E 4BQBA 1FGNL 1DCLA 2YK1H 4OLWL 1A7QL 1WEJL 3OV6A 4GXUM 3RNQB 2RFXA 2ZNXA 4HEPG 3DYPA 5D1XB 3CH1A 4OLVH 1JP5A 4FZEH 3MJ8A 5INDB 1AC0A 1VFBB 4IDLA 4POZC 4UINH 4RIRA 4Q97A 3MA7B 4FXLA 2F54B 1FC2D 4Q2ZA 5HYSG 5JW4R 3Q3GA 1ZLVK 4YGVA 2XKNA 1AXTH 4ODXA 4N0YH 1JWUB 5E95B 4I18C 4C55A 1YNTB 1DL7L 2IPTL 2CUMA 4X6CA 1D5BB 2Z8RA 4PJIE 1RZIB 5C9JB 3RVVC 3TT1H 4MAYB 4XTRC 1S9YB 1EGJA 5D1QD 1WC7A 2IH1A 4LPWA 1TITA 4X6EA 4MLIA 1Q9WB 4YHOL 3T2OA 3AMLA 1A9EA 5D1QC 3MBED 5E6IB 3IS1X 2A2QT 4XT1C 3WLBA 2PCPA 3U1SL 2CDFA 3T3MF 3QIBA 3MR9A 5CJ8A 1JGEB 4M6MH 3JZ7A 3NCCB 2PN5A 2A1WL 2DIAA 4J1UA 4AYFA 4JG1H 3WIFB 1J8HD 2EKSB 2EDXA 2ZUUA 2X6MA 3IU4L 3Q6GL 3MRFA 5ICZA 3M17B 1MCRA 4Y4KA 5I19L 2ZNWA 5H94B 2GTZB 3UC0H 2F19H 3GMRA 5T3XD 3N1FC 1QFUH 4BH8A 5FV1L 4LLWA 3SE8H 3VXMB 4NQSB 3TBVA 4NT6A 3BD5A 4O2FA 4UMGA 2APFA 3QHZH 3ARFC 3ULVE 2GT9B 5DFTA 4JO4H 5TPWH 4PRNB 3GO1L 5F21B 5SX4H 4RAHA 4F8TA 5IB3B 4QRRD 1DBKH 1KB5A 1AGBB 4LCYA 4MMXC 3GNML 4P3DB 2FJHB 4RGND 3KG5A 3TBYB 3N85L 1FG9C 2YZ8A 1D3CA 5ANMA 5T1DL 3TWCL 2VUOA 3MLZL 4PJ8D 1JWSB 1TJHL 1CDGA 2HWZL 3UJIH 4J3SA 1MUJA 5L6YL 1JV5B 1P7QB 2VSCA 5CEXB 5L2JB 1IEBB 2FEDD 3AREB 4XAKD 2B0SL 3EOAA 4KKCD 2J8UB 4GJTB 3V7MA 4YC2B 4I9WE 4HGWA 2CDGA 3LQMA 1Z9LA 3HE6D 2R1WA 1N5YH 3D3VE 5DT1H 1KLUA 4D0DA 2XRAH 3CAFA 5E6ZA 5I8CA 3OWEA 1GGYA 3TFKC 4HXBH 2AV1A 3BKML 5ILTL 3MGOA 4XP9H 3M1BB 2P47B 3MRPB 3ZL4L 2PXYC 1BFOA 2ZCKL 4NQXB 4I5BB 4R4BB 4G6ML 2DD8H 2PYFB 3SJVA 5DD3L 5IEHB 1RMFL 4GH7B 1JV5A 1P7QA 5CEXA 3DWTA 1U8IA 5DF0A 1S7UA 2YPKB 1GGTA 5DWUH 3CSYB 3H7LA 2YUXA 2XWBA 3QSKB 3VFPB 5IQ9A 2FLRT 1VADA 2M1KA 4RSVA 4J6RH 4XP4L 4FQ1H 4JHWL 2A6JA 4QTHA 3QEHB 4MDJA 1KTLA 3UYOD 3GKZA 4W81A 2C4FT 4JFZL 4U33A 2AKRB 3HG1D 4YDJB 3WFBH 5I6XC 1FSKC 4JFHD 1M05A 3TJEH 5KAQF 5CEZL 5I73B 1RZJH 5DJCA 4CVXB 1H3XA 4ZUVB 3L3GA 5D2LA 2DKMA 4LHUA 3DIFB 4CN6A 4MD0B 1INQA 1HZHL 2YWZA 1CGXA 4KDVA 3EYQD 3GBNL 5GHWH 2FR4B 2FDBP 1WIOA 3DV4A 4JPVL 3RWDB 3MLYL 1KN4H 3KPSE 1RIUH 5JPNA 2D2OA 5E9DD 1H0DB 4KI5C 3HN3A 3BDYL 3VMPA 5DJYB 4MXVF 4NT6B 4MA1B 1UZ6F 2OJZH 1T0PB 2CRZA 3X11B 1NCBH 5H37G 3VDBA 2BNUB 3P9WB 5CJXA 3VRLE 2G2RB 1ACZA 4ERSH 1F11B 4DFHA 3SDYL 1NH6A 2DQEH 3B2UD 4S10A 2PW1B 3QCVL 3HFMH 5HGAA 4NHUA 4BFEA 4OV5A 2L0DA 2CLZB 5CD3A 2DB8A 4P2QB 3NH7H 2APBA 2FBJH 3IYLW 2W0LA 4XP6L 5SWZA 4JM4L 3O6FD 5HXMA 5HHNB 1UM6H 4M62L 1I7ZA 1PY4A 4PUBL 4PJ9C 3ROLA 3SDDD 1AGEB 1FRGL 1A3LL 2YN5A 4E41A 1CGVA 2VDQH 3WNOA 2GW5A 1X5KA 1BVLA 2HWZH 4V1DD 3HR6A 1F58H 4KRPC 5KBNC 4PTUB 1NMCC 4RGOH 1JF5A 4XXCC 2VXSL 3B8YA 1P6AB 5EU4A 2IEPA 4GXVH 2EDTA 3IT8D 1OHQA 3VG9C 3UO1H 3EJYC 4OFYD 4RGNE 4O51A 3PWUB 2JTDA 3QI9A 4KUZH 3D39E 2ADGB 3VFSB 3CFCL 2DKUA 4APQC 4K3HA 4HPYL 4JO4L 1S5IL 3BIKA 4WTZA 4JLRB 4JRYB 1CLOL 4KROD 3O11B 1NC2A 3H3PL 5ITFA 4LP4A 4ZQKA 2PKDA 3ZMRA 3GMLA 2F5AL 3SPVB 5B38B 3QT2A 1WCBB 3T8XA 3CXHJ 5IW1B 5C09A 4H26A 5EUOE 5KSAA 3QUZB 3V0VB 4JZOB 4ORGB 1I7ZB 3ROLB 4HUUA 1U8IB 5IF0A 5GS3A 2J8UA 1I9RH 4FG6C 2IAND 2Y06H 4KK8C 5GGVY 3DTXB 2E7BA 4RA3A 1NEZB 4N5EC 5EU6E 1OOAA 1PG7H 4TTDC 5CEZD 1KLUB 5J1SC 3SKMB 1CVRA 1P9MA 1IL1B 3EDFA 3CDFA 1GOFA 2PETA 4D9QD 4MDJB 5DVKA 4GAGH 4Z8FH 2W07A 1MFBL 1TZIB 4F7EB 5DVNA 1TTFA 5E1AA 3O4OB 1FVDA 2APVA 3C8HA 3PJSB 3VFVA 1EUUA 4YEFA 3EZ8A 5CILL 2HT2D 5C09B 3R4DA 3QNYA 4PRPA 3S96A 6FABL 5TDNA 1KYOJ 4MJIE 1BREA 1K4DA 4H25B 1T7YA 4ZD3L 2A9NH 5BMFL 2HFFA 2YD5A 2EH7L 5ESVB 3OKKA 4HKZB 5IG7A 2UWEF 3O2VH 4KXZH 3RWGB 4ODSH 35C8L 3WKML 3QQ3A 4HWBA 1QA9A 2HG5A 3WFCH 4H0IA 4NWTH 1RHHA 1JZ8A 4XNYL 3QRGH 5C6TL 4WGWB 1GGIL 3ZT5A 4JM2C 2ATPB 1FFPA 4HX1A 1PGRB 4UILH 3MV01 3DHMA 4IHOA 4UUJA 3VRLF 1BOGB 3SHSA 3ZT7A 3PQYE 2NW3B 1INQB 3G6JF 5AD0B 5IJVB 3MBEB 2EEAA 2P5EA 2X4RB 4Q2ZB 1HWHB 3WJLC 3HZMB 5H2BA 3EDDA 3CFJA 4UV4H 2PYED 2C4FU 3TN0A 4J3OC 4PJ8C 1Q0YH 2WMPA 3FKUS 4YBQC 1I1CA 4X4YA 3HA0A 4L4TA 3CCHB 5FA3B 5GS2D 2XTJD 5HYIA 1R24B 4KKCC 2DAVA 2G2RA 4NFBA 3PWUA 4HWEL 1ODAA 2UVEA 1KEGL 3OJ2C 1HXYA 4GW5B 4ZFZA 1OCWL 4DUVA 3VH8B 4Z7OE 5EN2A 1RZGB 4ELMA 3QNZA 2P8MA 3REVA 5KSBB 3RAJL 2GTWA 3GIVB 1HK6A 3Q5YA 4YO0B 4GRWB 4LSSL 4P59L 4S1RL 4CJ1A 1WF5A 3GB7B 1J1XH 1G7IA 4JB9L 2CLVB 3CC5B 1CXFA 5KW9L 3ZE1F 3NFSL 4P57A 1SMAA 3TJEL 5IB5B 3G6AB 3OKMA 5E6YA 4NDMA 4N5UA 5I30H 4IMKA 3VXQA 5CZVL 2ITDB 1AQKL 2NY6B 4XPGH 4FFZL 1JPFB 4FQXC 2GIYA 1F90H 1WWBX 5D7JB 1MFEL 2VYRE 4X9FA 2LVEA 4JHWH 4X7SH 4X99B 5T1LA 4K7PY 4I18B 1N6UA 5JORA 4QNPE 1UADC 4J23A 3CK0H 4BM7A 2SEBB 4E42B 4HZLB 3GZKA 2UY7A 1ERNA 3LKOB 4LAJH 4RNRA 4C56D 4U6YB 1WAAA 4ZFFB 1EJOH 4NZRL 1JCKA 5CZXD 3VRJB 2QSQA 2G75B 3BPOB 3E6FB 3QDMB 4Y4HB 5DA0B 4KQ4H 1D6EB 1WT5A 1LO3H 3REWA 4NBXB 1OTTD 2KKQA 2IF7A 4ZMAT 4Q74A 1BZ9A 3F12A 4LCUB 1EFXA 3PWJA 1MCWM 1FNFA 3C8KB 2X5PA 1IJ9A 1Q9LA 4HLZH 2XY2A 3WN5B 4FA8A 4YZFE 4EVNB 4MCYB 1A14L 4M1CD 3QUML 3RL2A 4JY6A 1FVCA 4CMHC 3W5MA 2ADFL 2BMKB 2YR3A 3MRLA 3BJ91 5GGQL 2PYFA 4MS8D 4G6KL 2YD4A 4OLXL 5SX4I 5DTFB 5BZDA 4YK4C 4JKPH 4HXAH 4M1DL 3ARVA 4Z7UF 3UPRA 2FEEI 4XBGB 5EZLA 2XY1A 3ILQC 5T1KB 3VE0A 5ERWA 4Y4FB 4C83B 1I1AC 3KDMA 3RIAK 2ZG1A 5JLZB 4P57B 3RL1A 5DZOA 3HKFA 3VGAC 4NQEB 1U8PB 4HKZA 1MIMH 3IS0X 3SGEH 3E2HC 2IBBA 4DUXA 3ZYJA 1MJJB 2EECA 3QZWG 3S36L 1YY9D 3UZQA 1U41A 3CFKA 4RFEB 1GHFL 2I60H 3BN3B 5F7FA 4I77H 2VAJA 4KUCD 1UENA 1PKOA 1VESA 4RWYL 5EU6A 1JMZA 1M7DB 4NCC1 5MP6L 3CU7A 1BVKB 5HD8C 4FNLL 4DW2L 3HAEA 4F3FB 1LO4L 1HILB 3HG1A 5AAMA 4FQQA 1T5XB 5A2KH 1FBIH 1QLFA 3PF2A 5IV2B 5DQDH 3TH3T 2RAMA 4HZLA 1JNNH 3VFTB 2KBGA 3MTRA 3HNTL 1BAFH 1DQJB 5AEAA 4IDJH 3GJFB 2ADIB 4QGYA 4MAYC 3UTTB 4WU7A 4KKBD 2YUVA 4M7KL 1YMMB 4D0CA 1UM5L 2BNRE 4U1NA 1N64H 3RZWA 5DMGD 3FT3A 3KLAB 4GXVL 3E1F1 4YQXL 4PJ9B 1XEDA 3LS4L 4WI4A 3EYVB 3IJYB 1S9XA 4S1DD 2MCPH 5FYJD 5EBWA 1KJ3H 1VERA 1Q9LB 2QSCH 3FQUA 1T7XA 2VDPL 3NN8B 1R3JB 3EFDH 1FNGB 4NO5B 1CLYH 2OXHA 4BZ1L 5D6CA 3QAZC 2VLJA 1MREH 1SBBA 3GJEA 4NJAL 3N1MC 3SE9H 1OT1A 3MLXH 4YR6B 4Z7QF 3RVUD 4ONGH 3S36X 3S98A 5LWYL 4LEOB 1N8ZB 3DUSA 1DQJA 2J8OA 1MCQA 5IUSA 3PQYB 1MVUA 3ARDA 2H32B 4V2BA 4IS6A 1CXKA 2NY1C 3MMEB 2XG5A 3OF6A 4N0CD 1OAYH 1DBAL 3MXVL 3PABB 4N1EA 1UJ3B 3MPCA 4OAWA 5HBBA 3ET9F 1MHEB 1YEFH 5C86A 3RAJH 1V3JA 1YNTA 3IXAB 5C07A 5E8PB 4HKJB 4KY1H 4NRYB 3CFKB 2X1QA 4ZOEA 1FV1A 4I2XE 2ZG3A 3LQZB 3RDTB 2I24N 3L5IA 1DUZB 5IQ7L 3TZVA 3CLEL 3UTQA 5E08H 5INCA 2Q8AL 1H3PH 3MC0A 3T0EA 3KPLA 4X7SL 5FA4A 3G5VA 2VZOA 1Q72L 4BKLB 5B39A 4M5YL 5I1CL 5TDOA 3HMWH 2A74A 4TNVF 3KGRA 4RZCA 3PDGA 3VFWB 4OGYL 5JOPD 5HHOE 4M93C 5CD5D 2AJ3B 3MROB 2HLAA 3DURA 5JNYA 1UEYA 4ZAKC 4QOKA 1SJVA 2DWEA 2GAZA 2NX5B 4LNVA 5IVZB 4LNRB 5IEKA 4M61B 4K7FB 2B2XL 2G60H 2Q86A 3K46A 1FYTE 4HJ0D 4J4PA 3DI2B 3P4MB 2DLEA 1QO3A 4J7RA 4LCUA 4U1SA 2P7TA 3W9DB 2L7JA 4QHUB 4BELD 3BT2L 3GSNA 3CDYA 1X5AA 5DR5L 4OD1L 3WEXB 4XGZA 1LE5B 4J3XA 4JFHE 2A6DA 1JI2A 1VB9A 4QHMB 3V4VL 1NBZA 1NMAL 4HJJL 3FONA 3VXRE 2P45B 2OTWB 3V8OA 2IADB 5D1ZB 1F6FB 2XZQL 3KYKH 5T33L 3MLTB 1UGNA 4UU9B 2C3WA 3MOQA 1EO7A 2XQBL 1IGTB 3LEVH 4HPOL 4JY4B 4K94H 1EO8L 1ZT4A 3WO4C 4X80L 3QHZL 5DQDL 4JQVA 4MSWB 1EEUA 3WD5L 1A6TA 3CX2A 5T1KA 3PHOB 4FTVB 4FFWD 2ESVB 1MCCA 4G8FA 4WHTB 3AS0A 5JUEH 1Z9OA 2N56A 5BXFA 5GS0L 8FABB 4OZHE 5J13C 1X3DA 3QUZD 4HKXB 3SKNA 2QR0A 5D93B 1ZV5A 4BJLA 3VFMA 1RUMH 1KGCD 2VITB 5J6GB 2VDKL 4PREA 4XXDA 4QHMA 2IALB 2P43B 3BQUA 1YY9C 1Z2KA 3MRIB 4LKCA 4LCCC 4K9EL 3QUYA 4KUCF 5C6TH 2UZIL 3DRQA 2HLAB 4HJGA 2DQTL 4LVOB 2PO6C 4RAUA 2DQCH 3QJFA 4JREB 4X5LA 1FLRL 1A9BB 1M71A 4OGZA 2ESVA 4F15B 4JFEA 3SKJH 2OK0L 1A4JB 1L0XA 4J2XA 3V6FA 2EDOA 2J4WL 4R4ND 3LAFA 1G7QA 4GS7C 2YA1A 4G6JL 3QQ4B 4PG2C 2WM0A 1K5NA 4PGCB 4RA0C 2H45A 1GGBH 4CAGA 5JOFB 2DLGA 5CKGA 3RVWC 2BVTA 4Q9QL 1MCDA 3FMGH 4XCYA 5DZNA 5J13B 1KG0A 1K9TA 3FB7A 1ZANL 3DSNA 3BX7C 1FNGA 2CUIA 5C9KA 1TDQA 3DMMD 1NBZB 4MAUL 4QHNB 3P9MB 5EO9B 2VLJB 7CGTA 3NFNB 2BFVH 1QSED 2X4TA 5JOPE 4IJ3C 1NGXA 3Q2CA 3MUZ1 1OTTC 1DEEB 1V7MH 3RVTC 1S7RB 3NPSC 2FGZA 4Y5XB 2P5WA 3OX8B 4U7SA 5L2KD 4XX1G 5EU7E 1U8JB 3RJQB 4PJAB 5F7DA 4NBZB 4D94A 3V6OE 2VDKH 12E8H 1J05B 4NUGL 2AJSL 2FEDC 4CL7A 4F15C 1HKFA 3ULUF 4PJ5B 3BEWB 5C0DA 2C1OB 4X8JB 2LAAA 4OCWH 2H8PB 4I13B 3DPBA 3GK8H 4WU5A 5L7XL 1WK0A 3U0WL 5HJ3A 3U46B 1C5DA 1UB5A 4LGPB 3EOTH 4JDVA 2J4WH 2OJZL 1LO0H 3EOBB 3SDXA 1ZT7A 1YEDB 4QHLB 1S7WA 2C1PB 5D7LE 3DVGA 2IBZY 3AY4A 3GSQA 3CVHL 4MA3B 1EXUA 1N0XH 5KVEL 1C5CH 4H8WC 3CFDA 4XVSL 2EIEA 3BYYA 4LCWD 4Z7VE 1M4KA 1MQ8A 4M7LH 4XCYB 3OKDA 4FFYH 3VWJB 1LQSR 4U0QB 4Y4KD 4UIKL 3DXAA 2YRZA 2VQUA 3LZFH 4KZEL 4L9LB 5EU4B 1P4LA 2COQA 1T20B 4FQCH 5INDA 3MGTB 5A2LH 1IGYB 5E4IA 4QRUB 4EJ1C 4JFYB 4WUKH 1JF1A 4IEFB 3SE9L 3RIFF 2B4CC 1TQBC 1JGUL 1HWGB 4NQDD 4XBPA 1NC2B 5GRVK 1GC1C 4CNIA 1LK2B 2VN4A 4AL8H 5EDXA 3HHRB 1IAIL 4ZG1A 4ZXBB 3LHPH 4NC0B 1T6WA 1QRNA 4PJ8A 2HTKD 2I9TA 4WO4C 4XAWL 2K7QA 2BJML 3G5XB 1X6LA 4WUUD 2F74A 2C3GA 2H8PA 3LCYA 1WTGT 5EFIB 1P4BL 4X4XB 3MRHA 4LPUA 1T21B 2ZPKL 3AY4C 1EIBA 2R4RL 1A6VH 1C5BL 3D69A 2HT2C 1T20A 5FYJL 1NUGA 2XFXB 4YHIA 1VKXB 1OM3L 3C60A 3OR7A 2D4DA 3MRFB 3ZKMD 3FCTA 5ICZB 4HMCA 2EH7H 2NCMA 2GEEA 4Y4KB 1UACL 3GM8A 2R2EA 1J12A 2C26A 2GJJA 3JVGA 1ZGLA 4L3EB 1ZWIA 4XP9L 4KJYB 5E5MB 1I8MB 1FFOA 5A40E 1S5IH 4U6XB 3VXRB 4PJBB 1CWVA 5C0BD 1SY6H 3EZJB 4P2QE 4ZS7L 3GFUA 1NAMA 3QUXA 4NUJB 4IIQB 4LLMB 4EZMA 1C12A 3QNYB 4NCC2 2H2PD 1ZAGA 2WWKO 3MZGB 1LEIA 3DECA 4Z8FL 1NCDL 2VXTH 1Q94B 3MRPA 1T6VN 3F6LA 3TBYA 1W0VB 2IH3A 3B2UC 3D1MC 5M94B 3L5WB 1V3LA 3QPXL 3SY0A 2NR6D 2GJZA 4Q6IB 1EBAA 5IFJA 4U6VH 1C08B 1U91A 1QYGL 4EOWH 1BFVL 1MFCL 3FN0L 3Q6FA 4M00A 4QRPA 3DVNA 1HI6A 3NA9H 1PKQE 2QHLA 1KLGA 5JA9A 3B9KD 1A1MA 4MXVE 5E99L 2A77H 4GW1B 5EBMA 2AJUL 2X4TB 1MLCA 1D5XA 4R8WL 2FX7L 4CNIB 2F5AH 3M17A 2C5DC 1XGPB 4H88L 3VXTB 3DROA 4KRMB 4AEFA 5LBSL 5HGDB 3QDAA 2WBJD 5CSZA 3UTZA 3LSOB 4HIXH 1WJ3A 4R4FL 4QRTB 4RMTA 4M43L 2YXMA 2XKUA 1W72B 1A6WL 3JV5A 5FYJU 4D3CH 1EHLL 3KYOB 1DE4B 1F8TH 2VQ1B 2X4SA 3OR7B 4CKVX 5FOBB 1G9NH 4U6TA 3R06B 3SGKA 2V2XB 4UI2A 1BQHA 3D39A 3B4NA 1AGCB 1NSNL 4L9LC 5E9DA 3OAUH 2LV4A 3STLB 3PDDA 4MQXD 2F53E 2F9BT 4L8SA 2CH8A 2BY1A 3I6LD 5BQ7B 5I73C 3BH9B 1AKJB 4OB5L 5L2JA 5EUOB 3GMQB 5I17B 3FJTA 4EDXA 1A7BA 3OXSA 2KZWA 4D9RD 4IRSC 4XMKL 1DVFC 3PGDA 4GRWH 2NZ9C 3KLHC 5DYOB 3CLFL 3LKSA 5FYKU 2V6HA 3NCYP 3SY0B 5HHMD 2WAHA 3CFCH 1U6AH 1T03H 4XNXL 3MGOB 2JB6A 2XOTA 1BPVA 1KGCE 1YJDC 2V2XA 4XC3L 1X5XA 3SBWC 1UZ8B 3K8MA 1B4JH 4Z78B 5D1XC 1RZ8A 2CKBL 2HJKB 2OJEB 1F2XK 3K0WA 5BRZA 4M8QA 1U3JA 3OKEB 4W70A 4OCSH 4BQCA 1T0MA 4XVUC 3HI6H 3O45B 4AQOA 1AO7B 4LCCA 2FH6A 5CS7A 2QLVB 4L8BA 4Y1AD 3BP7B 5F6IC 3QIWC 1CCZA 5DI8A 1HHGA 3QI9D 5DRZA 3BFOA 3S35L 4NYLB 1JHTA 3SGJA 4AMKL 1NFDB 3T0AA 2YUWA 4RX4D 1OAUL 2H41A 1JTOA 4FXGA 1AI1H 3TH2T 2R9HC 2CUHA 1FPTH 1ZLWH 1GC1L 1FH5L 3WNKA 4LLUA 2WNGA 2CO6B 4JO1L 4X4XA 3ILPB 3T65A 1QZ1A 3F12B 4LARH 4UIKH 2NYYD 2AEPL 2VLKB 1CICC 2OX5A 1NANH 1CT8B 5F3BB 5FO7B 1J0JA 4N8PA 4Q6IA 5CWSB 4UT7H 4ZTOL 5HYJB 2OL3H 1DQDH 4EN3D 1XT5A 2GTZA 3IDYC 1C16B 1UQSA 2YWYA 3D85B 4MNQA 4GG6E 3VGDA 5D2NB 1AGEA 2GQHA 2JK5A 1EJOL 1LNUB 5ISZE 3ALXA 5A2IH 1JN6A 1QNZH 3HE7B 4XNXH 4Z7VA 1IGJA 5SWSE 4H8WL 2Z8WC 1D5ZB 4CUCA 35C8H 2VZTA 3V4UH 4NN7B 1CI5A 5KOMC 3S3JA 3ZHDA 4YXLL 1B9ZA 3EJZC 3HNVL 5K93A 2A9NL 2K9UA 1YEJL 3NMEA 4W4OA 1F42A 2DN7A 4G5ZL 5C08B 5DHVA 1L6XA 4IMLB 3SGEI 3HCVB 4ZAKA 5T1MB 4RGMB 2FYYA 3GKWL 5HVHC 1AIFB 1DQQA 1TXKA 4LPVA 5DVOA 4KU1A 5KW9H 5TQ2H 2NY2C 4U1KA 4WTWA 3H6JA 5DGRA 4F58H 3CMGA 1PX4A 4TPRL 1QHPA 4F7TA 3W2DH 4HIJB 4LF3A 3RWIB 1NFKA 1A1NA 5ICXA 5IESL 1K2DA 5I8OL 5L88H 3GSVB 4M1DH 3SDXF 5FV2A 5T1DH 3TWCH 1TJIL 1JF6A 4ESKA 2BCKB 3I3EA 4H5SA 2AXGA 2XA8H 2GFBB 2BNQE 3TEUA 2OCFD 3KYAA 2YKLL 2MOVA 1KIPA 3LEYH 4NZDA 2R2BB 3FB5B 1IKFL 3KWWB 2VB5A 4L4VD 5BV7C 1WTLA 4LSUL 2FX7H 1GGBL 5KSUB 4FXKA 1WAAE 5TF0A 3U4BH 3GEWB 5IGXH 1U3ZA 1AGCA 4PS4L 2M2DA 5JW3H 4CJ0A 3V8CA 5CP7A 4S2SB 3WUWG 4KQ4L 3OJVC 5SX5H 1IGCL 2I07B 3ZSSA 1JHLL 2VLLA 3MA9L 5H2BB 1QACA 1R3IL 4P2RB 5F7EL 1Q0XL 2NW2B 2HFGH 2W60B 1MAKA 2XTLA 4JJ5B 5IK3A 3TCLA 4AZ8A 2ZSWB 4AG4H 3DTXA 3W0WE 2VDMH 5JZ7C 2HAZA 4NC1E 5C1MB 1GGIH 4XMPL 5HYQA 1XZ0A 5FKAB 2DTMH 4PJ7A 2D7NA 4FMKA 4JKPL 3IFPB 5DHVB 3BZEA 2R2BA 2HMIC 5MENE 5C08D 4ONHA 4DQOH 1LEKA 2Q8BH 5ADOL 4H1LH 5T3ZH 4AH2A 2Y06L 1F4XL 1T0NB 1ZKAA 4XB7A 5EZJA 2IPTH 2G5RA 2IQAB 2PR4H 3IXTA 2WW8A 2AJXH 3FT4A 2V17H 4P5TB 2FO1A 1ITBB 3KYNA 4OLZL 2Z31D 1K6QH 4EI5C 5EU5A 4AEIL 2FO4B 5CP7B 5J3HD 3OKEA 4HDIB 4YK4B 4WWKC 4NQED 3PHQB 2W0FB 1EEYB 3O2DA 5FYJH 4Q58C 5KVDH 5I1DB 2BVEA 4KH2A 5EZOH 4HV8A 4DGIL 3MODH 5M7QA 3D25B 3QJHB 4AEEA 1S7QB 4PIRF 4U1JA 3B6SB 5KS9A 3U6RB 1QFHA 5IKCA 2H9GA 3M8OH 1SMOA 3OKNB 4DK6A 5TGBA 3FO0L 5EOQH 4NKMA 5GZOC 4JN2A 3VG0H 5CSBA 4PJGA 1JTPA 2J6EL 1B0RB 5DJDA 1T1WB 1JJUA 2NY4B 5J56B 3EAKA 5BS0B 4OBSA 5DD6A 1JK8A 2FJFA 4XRCB 3PUCA 4FQCL 2MSPA 4MWFA 4G5ZH 5TE4L 1D5BA 3ABZA 1ETZA 3F7YA 3L9RA 3E0GA 5F71A 1MI5A 1OAQL 1U8HA 1P2CB 3BH8B 3ZKND 4XPTH 4NRZA 3STZB 4HS3A 2AP2A 1Q72H 3IU3A 1P7KB 5FUCC 4Z0XA 2VISA 4CW1B 3IFPA 3BZEB 2P46B 3JBG7 4K94L 5D5MB 4DJMA 3ZKXB 5IBLD 1OPGL 5E4EB 4WWKB 1HXMB 3KPMB 3VWJC 4JQIH 1Y0LA 2V7HA 2YD3A 1JGEA 3IXTB 1ZT1B 2YD1A 1UH4A 3X3GH 4IRZH 4JPVH 4OZIE 5B3NA 2ZCLL 3KPRD 2OM5A 4UT7L 3DUUA 3L7EA 3T0VA 4NQEE 4X9BA 3VE0B 4NPYA 2UWEE 4JVUA 3F5WA 1E28A 1A7PL 1NGWB 15C8L 5FHAL 2PF6A 1YZZA 3RY6C 3QQ9D 5K59F 2CLRA 3WFDL 4MCZA 1FDLH 3S3PA 4OF8A 2DWDB 2GK2A 4ODUA 2DQEL 3DHJA 5C0AA 4NC1C 4WVRA 3S5LG 3HMWL 2AXGB 5CINL 2CK0L 4JN2B 1RZKC 3ZKXC 4K9EH 2ITDA 4J6RL 1N7ML 3OKOB 4JFQA 2X4OA 1NANI 1CXEA 2R0ZH 5HDQH 3UCRA 4OM0L 2FHFA 2ADJB 2I9LA 1A0QL 3OBAA 3MBXH 2XZCH 5DWUL 1J1OH 5E00A 1V3KA 3MLZH 2OSLA 3QUXC 3AFLA 4U7KA 3T0EE 5A2FA 2IAMA 4NO2A 4OV5B 4UQ2B 3GSOA 4TRPH 1N6VA 4NRZB 3RQ3A 5E7BA 4OCYH 5T3XL 1G7HB 2N7BA 4BK5A 4G6MH 4TUKL 1K4CB 2FECI 3IAGC 4EIZC 4ODUB 5D4QA 1RZJL 3ZL4H 1H3WM 4HH9A 3SO5A 4M1CC 2XQBH 3LEVL 4HPOH 4NSKA 5F6HJ 1BVKA 4A2MA 3LDBC 2X4OB 3AM8A 5GPRA 4FQLL 2FATL 3ZTJG 5FGCE 1G6RA 2Q8BL 2X9XA 2YPVL 3RWJA 3FOLA 2HH0L 3DUUB 3L7EB 4ZFOA 8CGTA 4V1DE 5B22A 4ZSOB 3RU8L 3KXFD 1OTSC 4PV9B 1IC5L 5KTEL 5BVJB 1F6LL 4H0GA 3ETBF 3CVHA 4OKVB 3HLAA 1GL4B 3EYVA 1RUML 4QY8A 2D0GA 3QDJD 4P46C 2PW2B 4G6KH 4OLXH 2H1PL 5DUPH 4NO3A 2VQTA 2Z4QB 3R1GL 4I3SH 1KUMA 3HUJA 2DLIA 4HS3B 1SVCP 3HAEG 4OLUL 1FNSH 4POYA 1D6VH 5JIPA 3U4EB 3O3BA 5CHNB 2EDNA 2QL1A 2V5TA 4KK9C 4WWKA 1EV2E 4X80H 1L4IA 4GAJH 4U7MA 3CZJA 5GGTL 4N9GA 1KCVH 5D71L 1IILE 2QSTA 3IDXH 4AIZB 4MA8L 4WI7A 2I60L 5E1AB 2ZG2A 4M5ZL 5D8JH 2GUOA 1G7JA 3NTCH 4ZXBD 1JNHB 4PRIB 1EUTA 4OD1H 1NDMB 1HSAB 3WUZA 4JM2D 4O9HH 4U6HB 1A7NH 4QXTB 1I7TB 1L6ZA 1SYVB 1NDGB 3OR6B 5IM7B 3MRGB 5K9QG 3MV7E 5KJRH 5TQ2L 4UOW0 1N4XH 3I2CH 5CEZH 4JCMA 4KPHL 1VSCA 1MFEH 2NY3C 3X3FL 5F7LB 4E41E 1S3KL 3H0TB 2D9CA 1D9KD 3WS6A 2D7MA 4X0KB 4JVPA 5EFIA 3O3EA 5FA4B 1KJVA 3FRUA 3HFML 4ZFOB 3QFJE 3CXHK 4X99A 3IJHA 1ZS8A 5EC2B 3RY4A 4Z7UA 1NKRA 4XB8A 1F00I 1F45A 1C1EH 1VPOH 3UMTA 3CZFA 3EFDL 3IFOA 1YEHL 3C08H 1JGLL 1NCTA 3EJJX 4V1DB 3WFEL 4ELKA 3P0VH 5FM4A 2EIZA 2YBRB 1EH9A 1IGFH 3U0PA 3E3QE 2NY4D 4APQA 5HSFA 4F33A 3P4MA 4PJGF 3BMWA 4NQCA 5AG9A 3QIUB 4PJ5E 4HKJA 4NRYA 3CK0L 2Q87A 4XP5L 1JWMA 4QWWD 1ND0B 3I02B 2CRMA 1EGJH 2VE6B 1IAOA 3HC0B 3CCHA 4XCFH 1F3DJ 4K8RC 4ZDHB 3AU1B 2BC4A 1CDYA 2I9LB 1BIHA 1AQDB 4HT1H 5DQJA 3TZVC 4QRSA 4AENA 1PG7W 4GO6B 5KSUA 2H1PH 5DHYB 2VSDA 2R15A 5ACLA 2PTTB 3GSWA 4LCIL 3LZFL 2YRPA 4RDQF 5JW4N 2FH8A 1PDKA 3FO1B 3VGBA 1T5WB 3RX8A 1I75A 5EORH 4WTXA 1K5NB 4PGCA 5D7IF 1B2WH 4WGVB 5EOQL 3DMMC 4LAQH 4HIIB 4ODXB 3TO4D 4Y4HC 3QXWA 3DV6A 1QSEB 4Q9RH 3SKOB 4D0BA 3FTGA 5DJ2A 4KTEH 2VZ1A 5FUOL 5SWQB 5JTWA 3WFCL 2LE9A 3RDTD 1JGDA 1RUKL 3F8UB 2X4SB 4ZO9A 3BXNB 4JREC 1MJUH 2E6JA 1KB5H 3PXJA 4KK8D 4HUNB 3CD4A 1P4IH 3IFLH 4LU5L 5KVGH 4JR9H 3FFCA 4PD4K 1LDPH 4TVSa 4P0DA 3QJFB 3ARGD 1RULL 2Z31A 4JGMA 1A6ZB 4G6JH 4PTTB 4UNTA 4RFOL 4NQEA 4KHXL 1TQCC 4LFHG 5IW1A 1EVTC 2QJDA 1YDPA 3F7VB 1B0WA 1DFBH 1EO5A 1G9MH 1PG7X 3VJ6A 3KNBA 4HIEA 2DQTH 3FQUB 1NJ9B 4IOFC 4L4VB 1AD0A 4C59B 4HV8B 4JFFE 2B4CL 2I25N 4MAYA 3MFGB 3GI9L 1VFOA 1TIUA 5DS8B 1VCAA 1IC4L 4WENB 5GS2H 4K7PH 4FZ8H 4OF0A 1HSBA 4PGJA 3OG4B 2CK0H 1NBQA 2Y6SD 4MCYA 3QXAA 4ZS6C 4YXHL 1DLHB 4G9DA 1CK0H 4XNQA 4DKAA 4L3EE 3LDBB 3GSWB 5CZVH 3GSQB 4PJ9D 3GO1H 4JFOA 3WKMH 4NHCH 4DGYL 3NIFE 3DRQB 1MCPH 4PRHB 4KVNH 1XR9A 2O93L 4XTRD 1Z6JT 1NDMA 2EYRA 4H26B 1AO7A 4LCCB 3VXNB 4LLQB 2EE3A 2QSVA 5AUMB 4QTIL 1FV1B 1DVFA 2VC2L 2J5LB 1CD1A 2VAAA 5CILH 3IU3B 3K7UA 1U8OA 3QXUA 1HSBB 2HJLB 3LB6C 2BDNH 5C08E 5IFAH 1NC4D 3BUYA 3BKJH 3CDGA 4GW5A 5CBAB 3FOMB 1S7WB 4NQVB 2JJVA 4ZTPL 4GKZA 3TVMB 3QIBC 4JAMB 3EO9L 4K2UL 4XCCL 4Y2DC 1S7RA 5T5FL 1FAIH 1UFUA 3EJZD 5ISZD 2DL2A 4U3CA 1WT5C 1NAKL 2IANE 5GJSL 4O02L 4P46A 2KPNA 2P4AB 3NCEB 1JYXA 4PB0L 1AXTL 4XCNB 1LK3H 3D2UA 3MJ9H 3O41A 1JGVH 2ED8A 2PUQT 1IGIH 5F6IB 2J8UF 2W91A 3A67L 2EC9T 4GBXD 5E2JA 5D7IE 5GGUA 1BIIA 3JV4B 4L4VE 4YDLC 3C60C 1FGVL 4TVPD 2D7PA 4ZUTB 1CE1L 3MNZA 4OQTH 3HRZA 2E7CA 5EU3B 2BJMH 5E24E 1BF2A 1X6NA 2PXYB 5AWNL 5IB2B 2NXZC 2EDFA 2AJ3A 3MROA 4YDKH 4PBVC 1FLTX 5D1QB 5E6IC 1CIUA 1OGAD 4J8RB 4HQQH 4MXWH 3DVGB 5DLMH 5DEGA 5DJXB 3KJ6H 3OXRB 5F96L 1KFAH 4BSVB 1HHIA 4KKLC 1E4WL 4YUEL 2A6IA 1AC6A 1QSFD 3TV3L 5J6HB 5BOZG 4G8GD 2X70A 2JJSA 2E5EA 4K23H 3KR3L 2H3NB 4HUXB 1DQMH 3QEHA 5JUEL 4HWUA 4Y5VA 3DXAB 4QXGH 4PJCF 5AZ2L 3ARFA 2XN9E 3G6JB 3SGDH 3BP4A 2G9HA 2Y7QB 4GW1A 4OQTA 2IFGA 3QULA 1B0GB 1KN2H 4YAQB 5DRWB 5LCVL 1NCBL 4DOHE 1M05B 3H3KA 1OARL 1WQVT 4X6DF 3TO2B 3NAAL 4N0FA 4RMWA 4RFNB 5D2NE 3VFGH 3MFFA 3O6MH 1DQLL 3FQRB 2D7QA 1U95A 3TN0C 2O5YL 5KZCD 1WBXB 5KG9B 1EHXA 3FFDB 3H9SB 1T2QH 3LOWA 3RGVD 3DV4B 4XP1H 4M6AA 4IMKC 1FHGA 3TYGH 3FHQA 4ZTOH 1ZANH 3UTSA 3QDJA 3P4OB 3B9DA 5JDSB 5FO8B 3NGBC 4Z76A 1UXSB 3Q5OA 4OD2B 4U1SB 3W9DA 3BQUB 4HXBL 1G9NC 1KOAA 3QXAB 4DGVH 4Y19D 1ZOXA 3VFSA 3H42H 4B41A 3KYMA 1GHFH 1AI1L 1NGPH 3PGFL 2Y36L 4I18A 5DJAA 4FQIH 4GUPB 3S6CA 1A9BA 2BRQA 2P8LB 1K3ZA 2IANA 5K9OA 1VACB 3EO1B 1N6QL 4YBHA 3GJFK 3IRZA 4EIGB 5IHZA 2X7LA 3CPLB 2VL5B 3AROA 4HK0B 3GMRB 5C92A 3BGMA 1V7ML 3SE4A 3KHOA 5I76A 1FYTB 3TVMD 1LE9A 1D6EA 5FYJE 2FBJL 4MB5A 3SQOH 1CD1B 5IBUB 2B5IC 2WP3O 1N64L 4P5TD 1E0OB 1RVFH 1I7UB 1T80A 2DQHH 4O00A 2J6EA 3QCVH 3SCMD 3QWRD 4KK5C 4YWGL 1OVZA 4IHOB 4G43A 4Q7DA 4YEEA 1D5IH 2BOBA 1ZA3A 4LU5H 3RWEA 4NWUH 5GXBB 1C7SA 5L2KE 4PRPD 1SJEB 3BSZL 1MCPL 1QKZH 4GKSB 4NQVA 1T1WA 4XNZB 2OS7A 3CDCA 2ZZUT 1DBMH 2IAMC 3D0VA 5ETUA 1SVZA 5KZCB 1W72H 5I8KL 2R69H 2WUCH 4PRHD 5DQ9B 4FXGB 4AT6A 4Z7OF 3TA3D 2ZCHH 4OZHF 3CSGA 2VXSH 1MFDH 3C6LD 2BVOA 5J12B 1ONQA 3D48R 5LAXB 5C2BH 3GMMA 3I6KA 4YBLB 1KCSL 1BVZA 1HZHH 1NEZA 3P2TA 4NQCD 4WO4D 4Q9CA 4GG6B 2VDLH 1FVEA 2VLJE 4MQ7A 5HHVL 1SHMA 4EI5A 1CYGA 3DO7B 2ZUQB 4LOUC 4GMTL 4L1DA 3IETA 5TF1H 1ZHNB 1C16A 1S7XA 4RFOH 1TNNA 1RZGA 3ZE2E 4L8BB 3OAYH 5I71C 4Z7WA 1B0GA 4DVBA 2F8OA 4I3RL 2IANB 3DOSA 5K9OB 4HX1B 1IBGH 3O8XB 4XPBH 3RVVD 3IF1A 1XCQB 3WD5H 1L9NA 4E0RB 3GJFH 2VH5L 4Q6YA 1J87A 1T2XA 1P9MC 4OZFA 5GGSY 5K59E 4OIIL 5HGHA 3UBXA 3FO1A 1KPRA 1A6VL 1C5BH 1BGXH 4LLAA 3BDYH 4PJCB 4LSRL 4KRPB 3ZT6A 4HG4K 1MCOH 4OLEA 5F7UA 3TNMA 4YX2L 1AE6H 3GSNB 3IDYB 5J0BA 2AK1H 3LPGA 4ONFH 3T4AA 1NCWH 3TT3L 3RDTA 1ZWIB 4ZODA 2BY3A 3NIGE 5FGSA 3C5JB 3ZKQD 1ZGLM 5CZXC 5I75C 2CPCA 4MJIB 5GRVL 3TYFB 1TVHB 2FWOB 2IGFL 1DTUA 5EPMA 5AZEL 2DQGL 3MO1A 3BI9X 5I71B 1HDMA 1RIHL 2VXVL 3GSVA 5ISZB 5IQ9B 5LWYH 2XIDA 3GSUB 1AD9B 4N8VB 4RZCB 3VFWA 4XHJD 4LSDA 4P2CG 5EOCJ 2C3XA 3MMEA 2F74B 3SOBH 2UZXB 3MRKB 2PO6B 1CD9B 1UACH 2J7LA 3OG6B 3QIWB 1U92B 4LVEA 5B4MD 1T7WA 1YPZE 3L5WA 3BD3A 2MPAH 2VMFA 2ZUXA 4J3VA 4EDWL 4LLUB 1L7TL 1WZLA 4M7LL 4DVRL 1UM4L 5D72L 1MELA 4N8VG 3UEZA 1FO0H 5T1LD 3EYSL 4ZFOL 1ZHLB 2ZJSH 4KJYA 3L3GB 1KJMB 3BGFC 5D2LB 3WNNA 5IVXB 3RBSA 1CD0A 5ID1B 5CGYC 4RMUA 1KELL 3NCJL 5IWLC 5B8CA 1YNKL 4QRUA 4MJ4A 5FYLE 2P1YA 5ICXB 2ZOLA 3CUPB 1JPGA 4R4FH 2ERJC 4E0RA 3HC3L 1DDHA 2IBGA 3BSZH 3EFFB 1IM3B 2O26U 4J4PC 5GJTH 2FZ3B 4XZUB 4RWYH 1AO7D 1T4KA 3V6BR 4WCYH 5J1AB 1CFQA 1TPXB 3L6FB 4ZUWA 5IMMA 5D5ME 1ORQB 1NMBL 1T1XA 2V2WA 2ED9A 4YPJA 4R7DA 3VXQB 1EFXB 4NN7C 1MFBH 2CD0A 2YD6A 4AEHH 3EO9H 4UBDD 3C60B 1FORL 4S1RH 4Q6IC 1I3GH 2Y07H 4X5WB 3BESR 3DYMA 2EDQA 5FK9B 3I50H 4G7VH 4KI5F 1FNEB 2NR6C 3BIKB 1X9QA 2AJYL 1U8MB 5JORB 1BP3B 4WHCA 3WKNA 4D0CB 4AM0A 2WIMA 4RQQA 3CVIL 3BRFA 2WUCL 3QNXB 1U2CA 1QD0A 3IDXL 5GSRB 3QJHA 2HLFD 1FGVH 4MJ5B 1O0VA 3VRJA 3WFDH 1UXWB 3WUWB 5K9KB 3ULVD 3NVQA 2MHAA 3VD7A 1A7OL 4KZDL 2EXWC 3OKNA 3WV0A 5F88B 3RTQA 1R3HB 2QADB 4BSWB 4OLZH 5LQBH 1ZHLA 4TRPL 3EIFA 2DQHL 1VFMA 3QEUA 1CU4H 2VN7A 4JG0L 5CUSH 3P11L 3GGWA 5DZLA 2ICCA 1MIML 3CGTA 1J1OL 1EAPB 4HWBL 4PJXF 4IOIA 2EXYC 1MLCB 4RFNC 1YUHB 4F7CA 3TBVB 4Z0BH 1J5OH 5AG8A 2YD7A 1NBYA 3BKCH 3CFDB 4XZUA 4U31A 5D1ZD 5DEFA 2DBLH 1CFVL 1RJZB 5IR1A 5TFSH 2NY1B 4NM4H 1U8JA 2X4NB 1NGPL 5JA8B 3V5HB 4B5EA 2DQFB 3P73A 3T0XA 1HNFA 1B0RA 3PXHA 2KDGA 1OSZA 1QQDA 1KPUA 4JB9H 4OCXH 4Y5VB 1XH3B 3LH2H 4BKLA 4PGZA 2X05A 4M7ZC 3MLVH 4M7LT 3O2DH 1XGRB 4ZDHA 2VIRA 1UCBL 5I8EB 4YR6A 2A9MH 4K3DL 1C5DB 4WNQB 3TVMC 43CAA 4PYGA 5DC9B 4YHKH 3TNNB 3Q1SH 4UUJB 4GLRI 4G7YH 3F7QA 1MCNA 4P5KB 4PJCE 3U79A 1RJZA 5I1GH 5EIIB 4YHYB 1CFNA 1MLBB 1Q9OB 4GQPH 4NGHH 1ZLUH 1MRDH 1S9WB 4FQXD 2AV1B 1MCIA 4PLJC 3MRKA 2E9WA 3RGVA 4DZ8B 3TC9A 5JW4M 1T21A 1QEWA 3P73B 4TSAH 2OYPA 2XWTB 4XPTL 1CT8A 5F3BA 3S37L 1D9KB 1ZSDA 2Y5TB 3V6ZA 1UXSA 1JZ6A 5FB8A 5DFVC 1XIWB 2FL5A 4DK3A 1DSFH 5D6DA 4PJGB 2IADA 3F5WB 1FFOB 2JJUA 1CICB 3AM8C 2VIRB 1ED3B 2VXVH 1XGUA 1U93A 3EHBD 3RA7H 5FGRA 1JN6B 5C0FB 3CU1A 4OSUL 4JPIB 5CP3A 4IOFD 1IGJB 4O2CB 2N7AA 1V5JA 3HZMA 1CLZH 3P0GB 2G5BB 1X44A 3T3PF 4EQ2A 5LGHL 3WS6C 5E2VH 1B90A 4PJHA 1NCAH 5A16A 2J88L 2OTUB 4PV8B 4QXWA 4MJ5A 1R5IA 5IVZA 1OQXA 3MV7A 3BRGC 3WHXB 4KDTC 5IMKA 5C0AE 5ALBL 2A9ML 3MNVB 4JDTL 3D9AL 1FFRA 3IAQA 1HYSD 3ILPA 1WBYB 1P1ZA 2IALA 1H8NA 1JGLH 2NXYD 4WJ5A 4UTAH 3W11C 2EDBA 3VWJD 2APTA 4A6YH 3EKCA 5BRZD 4JO1H 1KT2B 4K8RD 1H8SA 5LVEA 5KANG 5FK9A 1YC7A 1XCTA 4OB5H 4UB0H 3LRSB 5D7LD 2QQLH 2AJZB 2MKLC 3QEQA 2DTML 4PRHA 3W0WD 3RX5A 4YFLF 4LNRA 3U9PH 2MFNA 3GM0A 4OZHA 5FAAA 2HFGL 3O8XC 5IQ7H 5DD0H 4AEHL 4PB9H 3UJIL 3MJ7B 1T1ZA 3OHXB 4ZNCD 3E8UH 3TIDA 4JM2A 3GBMH 3A6BH 4NKDB 4KY1L 4PJEE 3BEVB 2I5YH 3T08A 5D2LE 4M43H 3D0LA 4LPCA 5LQBL 5E00B 1X5GA 1P5VA 4QY8B 5BQ7A 2OMBA 3MLTA 4EDXB 3LRSA 1XF5A 1YEKL 4E41B 4WWID 5ID0B 1AXSB 4S1QL 4DGYH 1QTYT 4U1JB 4KGLA 4YHPA 1AR1D 3O3DA 4Y4FA 5C0DB 3OZ9L 4N90E 1KSRA 4OZFB 3L3JA 2VDRL 4HJJH 2DI9A 2YA0A 2HT3C 1NLDL 3V5HA 1AGBA 3MOBL 1OY3B 4PJIB 5GGRB 4G80B 2QV2A 4WU5B 3MRQA 3V6OC 4XNZC 4MNHA 4S0SD 1OGTA 5J7CC 1JPTL 2OJEA 3DX7A 4L4JA 1QFOA 3VFOB 2XN9B 3G6JE 2VLME 3FOLB 1TTUA 3QUKA 3H2WA 4PRIA 5FYKD 3RNQA 4NCDA 4F8QA 3CH1B 1F4WL 4PV9A 4FTVE 2VLRA 4MJIA 4MA3A 1OP3H 3VWKD 1JHTB 2R1YA 2F54D 2P5WE 1OD7A 5CEYA 1FP5A 1LMKA 4BA8A 2DJSA 2E8YA 5AZEH 2Q6WA 3GSUA 4GRMB 4NIKB 1GZQA 4M5YH 2P5ED 3H3PH 5D7JD 1S9WA 3HRPA 5DEGB 5DJXA 5C0ND 2QEJA 3EGSA 4N68A 5JQ6L 1TPXC 3VXME 1BFOB 4JFDB 1B4RA 1A5FH 2XWTA 5GRWA 3MV7B 1JL8A 2PYEA 2DQIH 3GIZH 2BC4B 2GJ6B 5DUPL 4TUJB 1KLFA 5JOEA 1T83A 1CQKA 5BRZE 4NKOB 2BXZA 3ARBC 2B0SH 1YEFL 2R39A 4XH2A 3ULVC 4NZJA 3RZCB 4XX1E 1A22B 1FRGH 4KHTH 1BHGA 1BZ7A 1BQLL 3LKPA 3SO3C 4XWGL 3MOBH 4PY8I 4Y5VC 5IP4A 1LWRA 1D5MB 4FN0A 4CW1A 1ZVYA 1S7SA 4NP4H 1WLHA 1E6OH 3M1BA 3MLSL 4PGDA 4XHQA 5F1IB 1RJYA 2Y5EA 3FFCD 1Q8MA 3UTTE 1IEAA 5F9AC 4YUEH 2XFXA 2XTJE 4YHIB 1FQ9C 5CGMA 5C7XL 4UV7H 5DRXA 1KJVB 3L5XH 3MXWL 2CRYA 4M4PA 3T65B 4P59H 4OV6F 4X6BB 2QKIA 4ZUUA 4O4YL 3FB8B 3EYOB 5F89B 3WJLA 5I1HL 1HKLL 1RIUL 3BP5A 3LMJH 4RMQA 2XWBB 4QXUL 3HE7D 1BMGA 2XZCL 3A6CL 5E2VL 2E6PA 1V3MA 1CFBA 2ARJA 2VO5A 2WZPD 4Y5YC 4WUUA 2AXHA 4QGTA 1ORSA 1VACA 1AXSA 1OARH 1OAXH 4GMSL 4IRSB 4EN3B 3STBA 3IRPX 3MRJA 4HK0A 1D5ZA 3M07A 3QFDB 3EO0A 1JPST 3WNPA 4XPAH 2NY6C 2W1NA 4W6WB 3FRPG 1DBBH 1IM9A 3QEGL 3GMOB 4RWHA 4N0CC 4HMDA 1FH5H 3I02A 1GJIA 2Z93B 4JHBA 1G9EA 3HZKA 2E8ZA 4BQ8A 5GGRA 5JQHC 1F4YH 2MJWA 4PJDA 4I5BA 5FKPB 3PIQA 1X4XA 4I0PD 3RNKB 3O0RL 4W4OC 4Y16B 5MEOB 1VKXA 3TESA 5C0BA 2AGJH 3PV6B 4P9ML 2X4PA 2UY6A 4HUWB 4P2RD 1KCSH 2ESVE 2DWEB 2AW2A 3HE6A 1UWEH 1D5MA 4P4KD 4S1SH 1B3JA 4HQQL 4KKLD 4UU9A 4LEXH 2JLLA 4NZTL 1NC4A 4XNMA 4I0CC 1BQHG 5T3ZD 4P2OD 2DMKA 4ONOA 3O2WL 4CGTA 5CJ5A 5J8OA 3NPSB 2CDEB 2ZUWA 4DKEL 1CLZL 1AJ7L 5GRZA 1S5HB 2ZUTA 3W5NA 4W68A 1L9MA 3HNSL 3QO1B 1OAQH 2JF1A 4RISL 1UVQB 3O11A 2W65A 4L5FL 4M8VA 3T3PE 2EDHA 3D2UD 2I5YL 5B3JF 3FQXA 2DYPA 4L3AA 1SM3H 4YIQB 3Q3GB 3VI3F 3BPCA 3T1WA 1I9IH 1M7XA 2RCSH 1KULA 5EC1A 2HJFA 1E6JH 1A2YA 2KZ1B 3O4OC 3BGAA 4OFDA 5MEQA 4PRHE 4NQSA 2LU3A 5DMKB 4X7EC 1JZ3A 3BQUC 2HT3D 5HGBA 2RIKA 1IAIH 4LPXA 1WIPA 1A6AA 1KN2L 3OPZH 5I16B 5DUBB 1GOHA 3VXSD 1KBGH 4NKIH 5I1GL 3C87A 1E27A 4OZGF 2XQYG 1KTKE 4ZS6D 4DZ8A 1FZKA 4CU7A 4JZNB 1A6WH 1G9ML 3MODL 5MEPA 3MNZB 4QKXB 4KKNA 5D7JC 1ZXQA 3ZE0E 1GRWA 3RKPA 3VWKB 1TCMA 5I30L 1FVDB 3VXUD 5GS0H 3ARXA 1KCRL 1T2JA 5FB8B 4D8PB 1A14H 1G1YA 5I1JH 5I18L 1BQHB 2AQ3A 1EMTH 2H2SD 4GAYA 1M71B 1A2YB 4PP1C 3SEPA 5EO0B 4Y5YA 1VENA 4P3CH 3IGAB 5IW6B 3MA7A 2VR5A 3QQ4A 4FFVC 5ESVA 1HN1A 1MH5A 5FCUL 5CBEB 2P5WB 3RWGA 3ARDD 3RP1A 2B39A 4MQTB 4QRTA 3MRBB 3OXSB 4DAGH 3MJ9A 5TDPB 3FRUB 1A0QH 2VE6A 3IDMB 4EUPB 3QDHA 4L29A 2NMSA 5EC2A 4LIQH 4PJDE 3HRZB 3G9VA 2H32H 5DRNB 2N1KA 3TBSB 4JZJB 1RU9H 4X6DE 4YPGB 2GHWB 1I1AB 3CDGB 1J0ZA 5DDHA 2Y36H 4GAFB 5CEZE 5IWLA 4J8RA 1ZLSL 4OFKA 1WAAF 1NQBA 5TDNB 3RWHB 5E4EC 5MEQB 3O4LB 4F2MB 4K23L 5CLWA 4JAMA 2VKXA 4X7DC 3CSYA 4OF6A 3B2VL 4OTXL 1E4WH 4R90L 5BVPH 3QCUL 1YQVH 3JWOC 5FHAH 4ETQB 2F58H 5KAQG 1OB1B 5DK3A 2D0HA 4FFYL 5I8CB 5SV3A 3C5ZD 2FB4L 3TN0B 4XWOC 1MHPL 3S35X 4X7TA 3WLWD 4IRSA 1RFDL 4HF5L 4G9FD 5EBLB 2ICEA 3NBNA 3AS1A 1CTNA 4YBLC 4HS8L 2KQMA 4R4BA 4UT9H 4YDVB 1C5CL 1Q38A 2E9JA 5HHQB 4PJAE 43C9A 5EU7C 5DQJB 2VXUH 3MLUH 2GI7A 4L8SC 5F8RC 3PWLB 3P4NA 3HB3C 5BZWB 3ZE0F 4P3DA 2HTLC 4HLJA 2V7HB 2XXCB 3U7AA 1IC1A 2YSSB 3T1FB 5LKNA 4FABH 4L9LA 1IQWH 5DHVH 1PKQA 3REVB 1DBAH 2RJMA 3R0NA 5BRZB 3IGAA 3W82A 4AJ0A 2OI9B 5IHZB 2HVJB 2X4PB 2R29L 4YDIH 2BSSA 2NXYB 3ALWA 4N8CH 5CIPB 1NMBH 1S9VB 3N9GH 1IRAY 3SKOA 4XBPB 4AM0B 3WFBL 4S11A 2MTPA 5EOCH 5FUCE 4A6YB 4LPYA 5FO8A 1F02I 4PLKD 2D31B 1U42A 1NFDA 1KEML 4JKWA 4XI5C 5TDPA 1M7IA 5DS8A 2FECL 3C2SA 1QRNB 4HS6B 3VW3L 4R26H 5EG6C 4XCFL 3LQAL 5HYEA 2DDQH 1I1AA 3F65A 3IFNH 4YXKH 3P4NB 4YHLL 2YMXL 3QWOB 5B39B 4H8WH 2XTJB 1A6PA