4UN2B

Crystal structure of the uba domain of dsk2 in complex with ubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
b'SPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUITIN
publication title A Designed Conformational Shift to Control Protein Binding Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4un2B00
2EKFA 1VG5A 2DZLA 2QHOB 2JNHA 3T6PA 1IFYA 1WGLA 4UN2B 2DAGA 2O25A 1DO0A 1IXSA 1F4IA 1BVSA 1UFZA 1ZMVA 2K9DA 1WGNA 2JZ1A 3LCUA 3IHPA 1GO5A 2JP7A 2JY7A 3FRHA 2LVPC 2KNVA 3BBZA 1G3IA 1IM2A 2OOAA 1Q02A 2DENA 3F92A 1WIVA 5JI2E 2MROB 1WJ7A 4F1IA 2BWEA 2B3TA 2MGWA 1T43A 3K9PA 1OQYA 1SG9A 1WHCA 2LTUA 1NV9A 1C7YA 1TR8A 4Q7JA 3GLFE 1TTEA 3FE3A 1NV8A 4DBGB 3E21A 1KYIA 2LBCA 3IECA 2KHHA 1YLAA 1HJPA 2MJ5B 4R71A 1VEKA 2JY5A 3B89A 1OKSA 1XXHE 2L4EA 2WZJA 4WP2A 2JZ0A 2KNZA 2LVAA 3LCVB 4GEWA 2LVOC 2DI0A 1G41A 1HQYE 2L4FA 2K0BX 1VDLA 1HT2E 2ZTCA 1Y8GA 1OTRA 1JR3E 2G3QA 1ZMUA 2DAMA 1XB2B 2DAKA 2L2DA 1OAIA 2CWBA 1HT1E 1PGYA 2DKLA 1AIPC 2LVNC 2QSFX 2QNJA 2ZTDA 2MR9A 3K9OA 1CUKA 2JY6B 3H4JA 1G4AE 2KNAA 1EFUB 3FRIA 3GLHE 2LVQD 2H5XA 1A5TA 1DV0A 4G3OA 1VQ1A 5DFLA 1V92A 2DAIA 1E94E 1VEGA 1DO2A 3GLIE 1P3QQ 2HWJA 2DAEA 3E46A 2JY8A 2BWBA 2CP8A 1VEJA 2HAKA 1WR1B 1R4GA 3MMPA 4F2LA 2DHYA 2EJSA 3GLGE 2RRUA 2JUJA 1MN3A 2EKKA 1ZV1A 2OO9A 2DNAA 2R0IA 1T6OA 4HEOA 2OOBA 1QZEA 1ZMWA
chains in the Genus database with same CATH superfamily
1VG5A 4FCTA 2FH0A 2Q2EB 1WGLA 1TH4A 2O01F 4FD2A 5A2QS 3VKHA 2O25A 7CATA 2CFOA 3SMPA 3IG5A 3SAVA 4IBIA 2UUAM 1BVSA 5C18A 1TDHA 5EXTA 3EIEA 5ITXA 1HNZM 3L27A 1SXJB 2K9DA 2CV1A 4OW0A 1IN7A 1R2ZA 4LG2A 3AV0A 3C58A 4I4LA 2KA6B 2JY7A 5H37D 1DGHB 1D0MA 3L25A 3PFIA 1IM2A 2OOAA 3UGJA 3I51A 3WHLA 3A42A 4MGYE 3W0FA 5ITQA 3TPZA 4NXMM 2DENA 5EP4A 4YHHM 5FTNA 1SXJC 3NBXX 4FVMA 3U60B 3KOZE 1WJ7A 1ZAEA 1Z6TA 3FUVA 1AUAA 1NHWC 2B3TA 1GABA 1T43A 1H6UA 4LJAA 4BBAA 4HL4A 2CEAA 2LTUA 2YNMD 3EIHA 1PJIA 1NY6A 5EP2A 1FJGM 1TR8A 1R2YA 2JXNA 5KQ8A 2W82A 1HQCA 2DZOB 3ZC7B 4PD2A 4NRWA 2Y21A 1TTEA 3FE3A 4GHLA 1IBMM 2LH0A 4JN6A 4JXJA 2K47A 1LV7A 2MH8A 4KHPM 4DV5M 3IG8A 3CF6E 3IECA 3MHVC 4LJ4A 4X62M 2UU9M 4IBCA 2MJ5B 1IXZA 1E32A 4DR5M 3KVWA 2C98A 2DXIA 4JV5M 1XXHE 3TE6A 4WP2A 3LW5F 4LFCM 4JI6M 2JA2A 1L2DA 2R62A 3J2PB 4GEWA 4NSRA 5FLXS 3JR4A 1IQPA 1J09A 3C3EA 3KS8A 2AHMA 2M60A 4I8OA 2K0BX 4AQYM 3FYDA 2L6OA 1D0LA 1XNQM 2ZTCA 4D81A 2VQEM 3KXEC 3OTOM 2R18A 4WW0A 1IY1A 4GKJM 3SC3A 3GLHB 1DGGA 4DV6M 1OAIA 4K0KM 2C9OA 1HT1E 3K2LA 2Y20A 2ZAMA 4L16A 1OIPA 2LVNC 1L1TA 3PVSA 1IN4A 3GPPA 3QYBA 1NSFA 2QENA 1K3WA 2D7HA 3U61B 2WSCF 3K9OA 1CUKA 2KZUA 3GLIB 1N33M 3LQQA 1G4AE 5LMNM 4NXNM 3LVWA 4LGYA 3HU2A 3KOXE 4QOSA 4QHSA 4RKUF 3CTWB 1G59A 5EXXA 1V92A 2KRUA 2R46A 4X65M 4B3RM 1JB0F 1UM8A 3KP1E 4NL4H 1JR3A 2M5ZA 2R45A 4AG5A 2HWJA 3FUTA 1YE9A 3Q8XA 2LHCA 2JY8A 1SXJD 3FTEA 3VDUA 2HAKA 1WR1B 3W67A 3SAWA 2JWSA 5IWAM 1PJJA 1NHGC 2DHYA 3AFHA 3HKPA 1QAOA 4RF1A 1IXRC 2XF3A 1PRBA 3DOAA 3L29A 3QYEA 2CRUA 2VQFM 5KPRA 2DNAA 2R0IA 3GRVA 3I4VA 4FWHA 4HEOA 2OPFA 3C3DA 3RFWA 3SBJA 3SMSA 2K6BA 1V33A 5FTJA 2DZLA 4W5WA 1QAQA 2JNHA 1QVRA 2LXEA 3T6PA 1IFYA 2V6ZM 2CUZA 4ITQA 2BJWA 4M0DA 2UXBM 1F4IA 3GQ3A 4AKGA 3FKEA 4PT5A 2XZUA 4OVZB 3L28A 4LJ9A 2WSFF 3U6OA 1J5EM 2XZFA 1WGNA 4MM3B 3GLGA 1HNXM 3KDSE 3RGPA 2EA0A 5FSWA 2JP7A 2J5YA 4MB7A 2HL7A 4NRVA 4DUYM 2DWLA 1NJFA 2KNVA 2A5YB 1Z5CA 2XFTA 2YR0A 3BBZA 3LQRA 2QCUA 5EP1A 1G3IA 4B08A 1IY0A 4IBKA 5IZ7D 3U6DA 4ANRA 1SXJE 1R5LA 3DA1A 1C1KA 2O5RA 3GLFB 2MROB 1HR0M 3KP0E 3B9PA 3U6PA 3MJ5A 3TWKA 4Y28F 1MU5A 4MGIE 3C9PA 3K9PA 1Z59A 1OQYA 1SG9A 2KXEA 2X4AA 1OFHA 5JI3E 2FNAA 1GL7A 2EUCA 2CHVA 4Q7JA 2UXCM 1G71A 2Z7JA 3L26A 1XMOM 4L4UA 2ZANA 3ZQJA 1K3XA 5IT9S 4IJFA 1ZQ9A 1K82A 3FUWA 4GH9A 1T3TA 5EJCA 4GRIA 2OQ4A 4YY3M 2XGNA 3PNYA 1XXHA 1QZMA 4IBGA 3SAUA 4RNAA 2QP9X 1IY2A 2ZAOA 3LMMA 4XK8F 1IN5A 1XC8A 4LJ7A 2L4EA 3J7BA 1EE8A 1ORYB 1D0KA 4D82A 4OU7A 2KNZA 2LVAA 3LCVB 4JI1M 2C9CA 2GNOA 3VFDA 4MGZE 3L2AA 4AZFA 2DI0A 3R9XB 1TH3A 2L4FA 3FTCA 4DV7M 2R44A 2F5NA 1HNWM 1QANA 1Y8GA 1OTRA 3M6AA 1QDRA 3K1JA 5ITRA 4DV1M 1XB2B 4MGKE 3VK8A 3HJ8A 2L2DA 4DR7M 2XSZA 1E9RA 3D8BA 3QWLA 1AIPC 5KPZA 2QBYA 1N34M 4B3MM 4NOOB 4QOZC 5EQTA 4M9SA 2G8LA 4P17A 2MR9A 3E4RA 3GPXA 5BR8M 2ERCA 3GP1A 1IBKM 3BXWA 3J80S 1EFUB 4I5SA 2V1UA 2X8AA 3GLHE 2J7NA 3AOEA 3U6LA 1DV0A 2LHGA 4G3OA 1VQ1A 4II7A 3GLGB 2DWNA 4AKIA 2DWZB 3B74A 1E94E 5L8RF 1VEGA 2R4JA 4KODA 3GPUA 3KSXA 3UZUA 4IJEA 4IIWA 3GLIE 4M0WA 4FWGA 1PJTA 4CGYB 5ITXE 3GRYA 4Z8XA 2Z4RA 2R6FA 2EJSA 2F5SA 1MN3A 3B7QA 3GQ5A 3GRRA 1XMQM 1IN6A 1QZEA 4GC9A 3R8FA 1XHBA 1X37A 5DNYA 4JI4M 4KLNA 3J7AS 1DO0A 2KW0A 4IBFA 2QZ4A 1IXSA 5KQDA 3AL0C 4DR2M 3QAUA 1Z5AA 4DR4M 1G8PA 5FTKA 1R6BX 3SYLA 1QYRA 1UFZA 4JI0M 8CATA 3A46A 1VDDA 4BB9A 4L8RC 1ZMVA 3HZJA 4IBDA 4I81A 4L78A 4TUWA 2CHQA 2JZ1A 2HCBA 2HKJA 2FOIC 4RF0A 3LCUA 4G4QA 4LF5M 4JYAM 2UUCM 1TDZA 4GITA 2XH9A 4REZA 3AKZA 4AKHA 2LVPC 4JI3M 1W5TA 4L6V6 3SHFA 3T1YM 1KSFX 1ZMWA 4IBBA 4M9ZA 3K92A 1PJQA 2C99A 1Q39A 3U6QA 3F92A 3KOWE 2R65A 5JI2E 3M7GA 1D2NA 1JR3D 5BPVA 1QAMA 2BWEA 4P16A 2MGWA 2G5GX 3U60A 1WHCA 4B3TM 1NV9A 2LWXA 2QBYB 3JR5A 3T15A 4AG6A 2FE8A 4GC5A 4LJ6A 3FUXA 2RGHA 3UMMA 1N32M 3GLFE 1EIJA 2V1CA 3FTFA 3PXGA 2C96A 1KYIA 4LJ5A 1QQWA 2P5TA 3KFUG 3RGSA 4JI7M 3ZCBB 1HJPA 1V34A 2E5LM 3WHKA 1GJSA 4R3DA 1N77A 1N36M 1VEKA 2F5PA 2JY5A 4LF8M 3B89A 4QNMA 1JQJC 2WZJA 1J7KA 1DGBA 2JZ0A 2H1RA 1I94M 2GQFA 3HU1A 2KDLA 2CE7A 4IBJA 4XBOA 2LVOC 5EXSA 4Z6YA 4JI5M 4A3VB 2BNKA 3DFZA 3AOEC 1HQYE 2J7OA 4MH0E 5ITUA 1L2CA 1E9SA 1N75A 3T38A 1FNNA 1TF0B 3U6EA 3B7NA 4LZZA 1JR3E 1GLNA 3CF0A 2Z3XA 3SATA 3TWLA 3GQ4A 2CWBA 1PGYA 4DV3M 2DKLA 4LF6M 2XEPA 4JI2M 3KOYE 4PDGA 4AI6A 3GLHA 1IXSB 2JY6B 2XFSA 4FW9A 4DV0M 1MX0A 3E9SA 2FS1A 2CV0A 2KRKA 4GHAA 3U61A 1QDTA 1WXQA 3I4YA 3GLIA 2I7NA 1RU3A 1R7RA 2DHRA 4B3SM 3BOSA 3KS4A 1DO2A 1P3QQ 2L09A 1Z5BA 1GJTA 1NJGA 2DAEA 4OX9M 1KFVA 2BWBA 2CP8A 3GO8A 1R4GA 4F2LA 3GLGE 3SARA 3AOGA 2RRUA 2L7HA 2Z8YM 2F4VM 1IN8A 4CIZA 1ZV1A 2LNHC 3VDPA 3T1HM 3U5ZA 1YUBA 1NNUC 2NQ8C 4EIWA 4FCWA 3RE8A 2OOBA 3UK6A 2YFQA 3FYCA 3D8LA 4LRSA 4PCZA 3KSJA 2EKFA 3HHXA 4KO8A 4LY6A 2QHOB 3NWLA 4L15A 3W68A 5F3WA 2CV2A 3HX3A 4ZPXA 4UN2B 2DAGA 2DVWB 2KZSA 3H4MA 4LF9M 3PNVA 2Y0QA 4LGMA 5EP3A 3HY5A 1QUTA 3VLFB 4B7FA 2XSZD 1NO1A 3M0EA 1NVMA 2VDBB 2RKOA 3SASA 4LF4M 4G4OA 2ZBKB 1NNJA 2CHGA 3IHPA 5GKNA 1GO5A 4GMQA 4OVZA 3FRHA 3HHZA 3J27B 3HHYA 3B7ZA 2WSEF 4X64M 1IBLM 2X49A 1DGFA 3ILKA 4FCVA 3J81S 1PJSA 3GPYA 2XLJA 4B7HA 3SFZA 4LRTA 1Q02A 3HHWA 4D80A 2BJVA 4M9XA 2D7EA 3MK6A 1N78A 1WIVA 5E6JA 3A45A 3VK7A 5FTLA 1Q3BA 4F1IA 3AJIB 4IBEA 3U6SA 3DZDA 2DWMA 4DV4M 4LZJA 1PM5A 2F5OA 3CGWA 3NBIA 3THGA 2ZM6M 3GLFA 1C7YA 3KW6A 4MGHA 2YQZA 1XXHB 1TH2A 1NV8A 4DBGB 2VIIA 2HHHM 3E21A 4X66M 4LJ8A 2LBCA 1OFIA 4LFAM 2APLA 1SXJA 3TL4X 3SHGB 2KHHA 1YLAA 5EXPA 1MJGM 4R71A 2QQ8A 4S12A 1QUSA 1OIZA 3SYKA 1OKSA 3JAMS 4DR6M 1DGHA 3Q8GA 4DV2M 4G4RA 3HJSA 2Y0TA 2KEBA 4NSOB 3TQSA 1OAOC 3HWSA 4PDIA 1GL6A 2R4EA 4R7GA 4CHTB 4CJ6A 1G41A 1L1ZA 3HU3A 1OJLA 2DZNB 1VDLA 2FFJA 1HT2E 3FD9A 4DR3M 2L7IA 3U6CA 4BLCA 3U5ZB 2G3QA 3LVVA 4XGIA 5DYGA 4LF7M 1ZMUA 2DAMA 4G4NA 2DAKA 2VF7A 1GKIA 5ITTA 5ITYA 4FWDA 4KT0F 5FTMA 2QSFX 5DYIA 2QNJA 5KPTA 4CISA 3TWMA 3V76A 4LCBA 2ZTDA 1L8QA 3UJNA 2C5RA 3H4JA 2KNAA 3U6MA 3I01M 1L2BA 2UXDM 3A98B 2I7PA 3FRIA 4LFBM 2LVQD 4DR1M 5C1BA 2H5XA 1A5TA 1W5SA 4DUZM 3K8ZA 4WURA 1I4WA 5DFLA 2F5QA 5LMUM 2DAIA 1TGUA 3GRUA 4HLQA 3VKGA 5E26A 4B7GA 1XWIA 4GKKM 1NY5A 1GVNA 3FUUA 3HGIA 4GIPA 3CF2A 1LTMA 3E46A 4NC6A 4QNRA 2N35A 4QHTA 4G6ZA 3I04M 1VEJA 3MMPA 5KO3A 4JI8M 5IREB 2JUJA 2UUBM 1Q3CA 2EKKA 2Z4SA 3W0LB 2OO9A 4AW4A 2EO2A 3HJQA 1T6OA 2QPAA 3ZH9B 1YSYA 2RGOA 1S3SA 1XNRM 2D7GA 3FTDA 2VF8A
chains in the Genus database with same CATH topology
2EKFA 1VG5A 2DZLA 2QHOB 2JNHA 3T6PA 1IFYA 1WGLA 4UN2B 2DAGA 2O25A 1DO0A 1IXSA 1F4IA 1BVSA 1UFZA 1ZMVA 2K9DA 1WGNA 2JZ1A 3LCUA 3IHPA 1GO5A 2JP7A 2JY7A 3FRHA 2LVPC 2KNVA 3BBZA 1G3IA 1IM2A 2OOAA 1Q02A 2DENA 3F92A 1WIVA 5JI2E 2MROB 1WJ7A 4F1IA 2BWEA 2B3TA 2MGWA 1T43A 3K9PA 1OQYA 1SG9A 1WHCA 2LTUA 1NV9A 1C7YA 1TR8A 4Q7JA 3GLFE 1TTEA 3FE3A 1NV8A 4DBGB 3E21A 1KYIA 2LBCA 3IECA 2KHHA 1YLAA 1HJPA 2MJ5B 4R71A 1VEKA 2JY5A 3B89A 1OKSA 1XXHE 2L4EA 2WZJA 4WP2A 2JZ0A 2KNZA 2LVAA 3LCVB 4GEWA 2LVOC 2DI0A 1G41A 1HQYE 2L4FA 2K0BX 1VDLA 1HT2E 2ZTCA 1Y8GA 1OTRA 1JR3E 2G3QA 1ZMUA 2DAMA 1XB2B 2DAKA 2L2DA 1OAIA 2CWBA 1HT1E 1PGYA 2DKLA 1AIPC 2LVNC 2QSFX 2QNJA 2ZTDA 2MR9A 3K9OA 1CUKA 2JY6B 3H4JA 1G4AE 2KNAA 1EFUB 3FRIA 3GLHE 2LVQD 2H5XA 1A5TA 1DV0A 4G3OA 1VQ1A 5DFLA 1V92A 2DAIA 1E94E 1VEGA 1DO2A 3GLIE 1P3QQ 2HWJA 2DAEA 3E46A 2JY8A 2BWBA 2CP8A 1VEJA 2HAKA 1WR1B 1R4GA 3MMPA 4F2LA 2DHYA 2EJSA 3GLGE 2RRUA 2JUJA 1MN3A 2EKKA 1ZV1A 2OO9A 2DNAA 2R0IA 1T6OA 4HEOA 2OOBA 1QZEA 1ZMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EKF A;  1VG5 A;  2DZL A;  2QHO B;  2JNH A;  3T6P A;  1IFY A;  1WGL A;  4UN2 B;  2DAG A;  2O25 A;  1DO0 A;  1IXS A;  1F4I A;  1BVS A;  1UFZ A;  1ZMV A;  2K9D A;  1WGN A;  2JZ1 A;  3LCU A;  3IHP A;  1GO5 A;  2JP7 A;  2JY7 A;  3FRH A;  2LVP C;  2KNV A;  3BBZ A;  1G3I A;  1IM2 A;  2OOA A;  1Q02 A;  2DEN A;  3F92 A;  1WIV A;  5JI2 E;  2MRO B;  1WJ7 A;  4F1I A;  2BWE A;  2B3T A;  2MGW A;  1T43 A;  3K9P A;  1OQY A;  1SG9 A;  1WHC A;  2LTU A;  1NV9 A;  1C7Y A;  1TR8 A;  4Q7J A;  3GLF E;  1TTE A;  3FE3 A;  1NV8 A;  4DBG B;  3E21 A;  1KYI A;  2LBC A;  3IEC A;  2KHH A;  1YLA A;  1HJP A;  2MJ5 B;  4R71 A;  1VEK A;  2JY5 A;  3B89 A;  1OKS A;  1XXH E;  2L4E A;  2WZJ A;  4WP2 A;  2JZ0 A;  2KNZ A;  2LVA A;  3LCV B;  4GEW A;  2LVO C;  2DI0 A;  1G41 A;  1HQY E;  2L4F A;  2K0B X;  1VDL A;  1HT2 E;  2ZTC A;  1Y8G A;  1OTR A;  1JR3 E;  2G3Q A;  1ZMU A;  2DAM A;  1XB2 B;  2DAK A;  2L2D A;  1OAI A;  2CWB A;  1HT1 E;  1PGY A;  2DKL A;  1AIP C;  2LVN C;  2QSF X;  2QNJ A;  2ZTD A;  2MR9 A;  3K9O A;  1CUK A;  2JY6 B;  3H4J A;  1G4A E;  2KNA A;  1EFU B;  3FRI A;  3GLH E;  2LVQ D;  2H5X A;  1A5T A;  1DV0 A;  4G3O A;  1VQ1 A;  5DFL A;  1V92 A;  2DAI A;  1E94 E;  1VEG A;  1DO2 A;  3GLI E;  1P3Q Q;  2HWJ A;  2DAE A;  3E46 A;  2JY8 A;  2BWB A;  2CP8 A;  1VEJ A;  2HAK A;  1WR1 B;  1R4G A;  3MMP A;  4F2L A;  2DHY A;  2EJS A;  3GLG E;  2RRU A;  2JUJ A;  1MN3 A;  2EKK A;  1ZV1 A;  2OO9 A;  2DNA A;  2R0I A;  1T6O A;  4HEO A;  2OOB A;  1QZE A;  1ZMW A; 
#chains in the Genus database with same CATH topology
 1VG5 A;  4FCT A;  2FH0 A;  2Q2E B;  1WGL A;  1TH4 A;  2O01 F;  4FD2 A;  5A2Q S;  3VKH A;  2O25 A;  7CAT A;  2CFO A;  3SMP A;  3IG5 A;  3SAV A;  4IBI A;  2UUA M;  1BVS A;  5C18 A;  1TDH A;  5EXT A;  3EIE A;  5ITX A;  1HNZ M;  3L27 A;  1SXJ B;  2K9D A;  2CV1 A;  4OW0 A;  1IN7 A;  1R2Z A;  4LG2 A;  3AV0 A;  3C58 A;  4I4L A;  2KA6 B;  2JY7 A;  5H37 D;  1DGH B;  1D0M A;  3L25 A;  3PFI A;  1IM2 A;  2OOA A;  3UGJ A;  3I51 A;  3WHL A;  3A42 A;  4MGY E;  3W0F A;  5ITQ A;  3TPZ A;  4NXM M;  2DEN A;  5EP4 A;  4YHH M;  5FTN A;  1SXJ C;  3NBX X;  4FVM A;  3U60 B;  3KOZ E;  1WJ7 A;  1ZAE A;  1Z6T A;  3FUV A;  1AUA A;  1NHW C;  2B3T A;  1GAB A;  1T43 A;  1H6U A;  4LJA A;  4BBA A;  4HL4 A;  2CEA A;  2LTU A;  2YNM D;  3EIH A;  1PJI A;  1NY6 A;  5EP2 A;  1FJG M;  1TR8 A;  1R2Y A;  2JXN A;  5KQ8 A;  2W82 A;  1HQC A;  2DZO B;  3ZC7 B;  4PD2 A;  4NRW A;  2Y21 A;  1TTE A;  3FE3 A;  4GHL A;  1IBM M;  2LH0 A;  4JN6 A;  4JXJ A;  2K47 A;  1LV7 A;  2MH8 A;  4KHP M;  4DV5 M;  3IG8 A;  3CF6 E;  3IEC A;  3MHV C;  4LJ4 A;  4X62 M;  2UU9 M;  4IBC A;  2MJ5 B;  1IXZ A;  1E32 A;  4DR5 M;  3KVW A;  2C98 A;  2DXI A;  4JV5 M;  1XXH E;  3TE6 A;  4WP2 A;  3LW5 F;  4LFC M;  4JI6 M;  2JA2 A;  1L2D A;  2R62 A;  3J2P B;  4GEW A;  4NSR A;  5FLX S;  3JR4 A;  1IQP A;  1J09 A;  3C3E A;  3KS8 A;  2AHM A;  2M60 A;  4I8O A;  2K0B X;  4AQY M;  3FYD A;  2L6O A;  1D0L A;  1XNQ M;  2ZTC A;  4D81 A;  2VQE M;  3KXE C;  3OTO M;  2R18 A;  4WW0 A;  1IY1 A;  4GKJ M;  3SC3 A;  3GLH B;  1DGG A;  4DV6 M;  1OAI A;  4K0K M;  2C9O A;  1HT1 E;  3K2L A;  2Y20 A;  2ZAM A;  4L16 A;  1OIP A;  2LVN C;  1L1T A;  3PVS A;  1IN4 A;  3GPP A;  3QYB A;  1NSF A;  2QEN A;  1K3W A;  2D7H A;  3U61 B;  2WSC F;  3K9O A;  1CUK A;  2KZU A;  3GLI B;  1N33 M;  3LQQ A;  1G4A E;  5LMN M;  4NXN M;  3LVW A;  4LGY A;  3HU2 A;  3KOX E;  4QOS A;  4QHS A;  4RKU F;  3CTW B;  1G59 A;  5EXX A;  1V92 A;  2KRU A;  2R46 A;  4X65 M;  4B3R M;  1JB0 F;  1UM8 A;  3KP1 E;  4NL4 H;  1JR3 A;  2M5Z A;  2R45 A;  4AG5 A;  2HWJ A;  3FUT A;  1YE9 A;  3Q8X A;  2LHC A;  2JY8 A;  1SXJ D;  3FTE A;  3VDU A;  2HAK A;  1WR1 B;  3W67 A;  3SAW A;  2JWS A;  5IWA M;  1PJJ A;  1NHG C;  2DHY A;  3AFH A;  3HKP A;  1QAO A;  4RF1 A;  1IXR C;  2XF3 A;  1PRB A;  3DOA A;  3L29 A;  3QYE A;  2CRU A;  2VQF M;  5KPR A;  2DNA A;  2R0I A;  3GRV A;  3I4V A;  4FWH A;  4HEO A;  2OPF A;  3C3D A;  3RFW A;  3SBJ A;  3SMS A;  2K6B A;  1V33 A;  5FTJ A;  2DZL A;  4W5W A;  1QAQ A;  2JNH A;  1QVR A;  2LXE A;  3T6P A;  1IFY A;  2V6Z M;  2CUZ A;  4ITQ A;  2BJW A;  4M0D A;  2UXB M;  1F4I A;  3GQ3 A;  4AKG A;  3FKE A;  4PT5 A;  2XZU A;  4OVZ B;  3L28 A;  4LJ9 A;  2WSF F;  3U6O A;  1J5E M;  2XZF A;  1WGN A;  4MM3 B;  3GLG A;  1HNX M;  3KDS E;  3RGP A;  2EA0 A;  5FSW A;  2JP7 A;  2J5Y A;  4MB7 A;  2HL7 A;  4NRV A;  4DUY M;  2DWL A;  1NJF A;  2KNV A;  2A5Y B;  1Z5C A;  2XFT A;  2YR0 A;  3BBZ A;  3LQR A;  2QCU A;  5EP1 A;  1G3I A;  4B08 A;  1IY0 A;  4IBK A;  5IZ7 D;  3U6D A;  4ANR A;  1SXJ E;  1R5L A;  3DA1 A;  1C1K A;  2O5R A;  3GLF B;  2MRO B;  1HR0 M;  3KP0 E;  3B9P A;  3U6P A;  3MJ5 A;  3TWK A;  4Y28 F;  1MU5 A;  4MGI E;  3C9P A;  3K9P A;  1Z59 A;  1OQY A;  1SG9 A;  2KXE A;  2X4A A;  1OFH A;  5JI3 E;  2FNA A;  1GL7 A;  2EUC A;  2CHV A;  4Q7J A;  2UXC M;  1G71 A;  2Z7J A;  3L26 A;  1XMO M;  4L4U A;  2ZAN A;  3ZQJ A;  1K3X A;  5IT9 S;  4IJF A;  1ZQ9 A;  1K82 A;  3FUW A;  4GH9 A;  1T3T A;  5EJC A;  4GRI A;  2OQ4 A;  4YY3 M;  2XGN A;  3PNY A;  1XXH A;  1QZM A;  4IBG A;  3SAU A;  4RNA A;  2QP9 X;  1IY2 A;  2ZAO A;  3LMM A;  4XK8 F;  1IN5 A;  1XC8 A;  4LJ7 A;  2L4E A;  3J7B A;  1EE8 A;  1ORY B;  1D0K A;  4D82 A;  4OU7 A;  2KNZ A;  2LVA A;  3LCV B;  4JI1 M;  2C9C A;  2GNO A;  3VFD A;  4MGZ E;  3L2A A;  4AZF A;  2DI0 A;  3R9X B;  1TH3 A;  2L4F A;  3FTC A;  4DV7 M;  2R44 A;  2F5N A;  1HNW M;  1QAN A;  1Y8G A;  1OTR A;  3M6A A;  1QDR A;  3K1J A;  5ITR A;  4DV1 M;  1XB2 B;  4MGK E;  3VK8 A;  3HJ8 A;  2L2D A;  4DR7 M;  2XSZ A;  1E9R A;  3D8B A;  3QWL A;  1AIP C;  5KPZ A;  2QBY A;  1N34 M;  4B3M M;  4NOO B;  4QOZ C;  5EQT A;  4M9S A;  2G8L A;  4P17 A;  2MR9 A;  3E4R A;  3GPX A;  5BR8 M;  2ERC A;  3GP1 A;  1IBK M;  3BXW A;  3J80 S;  1EFU B;  4I5S A;  2V1U A;  2X8A A;  3GLH E;  2J7N A;  3AOE A;  3U6L A;  1DV0 A;  2LHG A;  4G3O A;  1VQ1 A;  4II7 A;  3GLG B;  2DWN A;  4AKI A;  2DWZ B;  3B74 A;  1E94 E;  5L8R F;  1VEG A;  2R4J A;  4KOD A;  3GPU A;  3KSX A;  3UZU A;  4IJE A;  4IIW A;  3GLI E;  4M0W A;  4FWG A;  1PJT A;  4CGY B;  5ITX E;  3GRY A;  4Z8X A;  2Z4R A;  2R6F A;  2EJS A;  2F5S A;  1MN3 A;  3B7Q A;  3GQ5 A;  3GRR A;  1XMQ M;  1IN6 A;  1QZE A;  4GC9 A;  3R8F A;  1XHB A;  1X37 A;  5DNY A;  4JI4 M;  4KLN A;  3J7A S;  1DO0 A;  2KW0 A;  4IBF A;  2QZ4 A;  1IXS A;  5KQD A;  3AL0 C;  4DR2 M;  3QAU A;  1Z5A A;  4DR4 M;  1G8P A;  5FTK A;  1R6B X;  3SYL A;  1QYR A;  1UFZ A;  4JI0 M;  8CAT A;  3A46 A;  1VDD A;  4BB9 A;  4L8R C;  1ZMV A;  3HZJ A;  4IBD A;  4I81 A;  4L78 A;  4TUW A;  2CHQ A;  2JZ1 A;  2HCB A;  2HKJ A;  2FOI C;  4RF0 A;  3LCU A;  4G4Q A;  4LF5 M;  4JYA M;  2UUC M;  1TDZ A;  4GIT A;  2XH9 A;  4REZ A;  3AKZ A;  4AKH A;  2LVP C;  4JI3 M;  1W5T A;  4L6V 6;  3SHF A;  3T1Y M;  1KSF X;  1ZMW A;  4IBB A;  4M9Z A;  3K92 A;  1PJQ A;  2C99 A;  1Q39 A;  3U6Q A;  3F92 A;  3KOW E;  2R65 A;  5JI2 E;  3M7G A;  1D2N A;  1JR3 D;  5BPV A;  1QAM A;  2BWE A;  4P16 A;  2MGW A;  2G5G X;  3U60 A;  1WHC A;  4B3T M;  1NV9 A;  2LWX A;  2QBY B;  3JR5 A;  3T15 A;  4AG6 A;  2FE8 A;  4GC5 A;  4LJ6 A;  3FUX A;  2RGH A;  3UMM A;  1N32 M;  3GLF E;  1EIJ A;  2V1C A;  3FTF A;  3PXG A;  2C96 A;  1KYI A;  4LJ5 A;  1QQW A;  2P5T A;  3KFU G;  3RGS A;  4JI7 M;  3ZCB B;  1HJP A;  1V34 A;  2E5L M;  3WHK A;  1GJS A;  4R3D A;  1N77 A;  1N36 M;  1VEK A;  2F5P A;  2JY5 A;  4LF8 M;  3B89 A;  4QNM A;  1JQJ C;  2WZJ A;  1J7K A;  1DGB A;  2JZ0 A;  2H1R A;  1I94 M;  2GQF A;  3HU1 A;  2KDL A;  2CE7 A;  4IBJ A;  4XBO A;  2LVO C;  5EXS A;  4Z6Y A;  4JI5 M;  4A3V B;  2BNK A;  3DFZ A;  3AOE C;  1HQY E;  2J7O A;  4MH0 E;  5ITU A;  1L2C A;  1E9S A;  1N75 A;  3T38 A;  1FNN A;  1TF0 B;  3U6E A;  3B7N A;  4LZZ A;  1JR3 E;  1GLN A;  3CF0 A;  2Z3X A;  3SAT A;  3TWL A;  3GQ4 A;  2CWB A;  1PGY A;  4DV3 M;  2DKL A;  4LF6 M;  2XEP A;  4JI2 M;  3KOY E;  4PDG A;  4AI6 A;  3GLH A;  1IXS B;  2JY6 B;  2XFS A;  4FW9 A;  4DV0 M;  1MX0 A;  3E9S A;  2FS1 A;  2CV0 A;  2KRK A;  4GHA A;  3U61 A;  1QDT A;  1WXQ A;  3I4Y A;  3GLI A;  2I7N A;  1RU3 A;  1R7R A;  2DHR A;  4B3S M;  3BOS A;  3KS4 A;  1DO2 A;  1P3Q Q;  2L09 A;  1Z5B A;  1GJT A;  1NJG A;  2DAE A;  4OX9 M;  1KFV A;  2BWB A;  2CP8 A;  3GO8 A;  1R4G A;  4F2L A;  3GLG E;  3SAR A;  3AOG A;  2RRU A;  2L7H A;  2Z8Y M;  2F4V M;  1IN8 A;  4CIZ A;  1ZV1 A;  2LNH C;  3VDP A;  3T1H M;  3U5Z A;  1YUB A;  1NNU C;  2NQ8 C;  4EIW A;  4FCW A;  3RE8 A;  2OOB A;  3UK6 A;  2YFQ A;  3FYC A;  3D8L A;  4LRS A;  4PCZ A;  3KSJ A;  2EKF A;  3HHX A;  4KO8 A;  4LY6 A;  2QHO B;  3NWL A;  4L15 A;  3W68 A;  5F3W A;  2CV2 A;  3HX3 A;  4ZPX A;  4UN2 B;  2DAG A;  2DVW B;  2KZS A;  3H4M A;  4LF9 M;  3PNV A;  2Y0Q A;  4LGM A;  5EP3 A;  3HY5 A;  1QUT A;  3VLF B;  4B7F A;  2XSZ D;  1NO1 A;  3M0E A;  1NVM A;  2VDB B;  2RKO A;  3SAS A;  4LF4 M;  4G4O A;  2ZBK B;  1NNJ A;  2CHG A;  3IHP A;  5GKN A;  1GO5 A;  4GMQ A;  4OVZ A;  3FRH A;  3HHZ A;  3J27 B;  3HHY A;  3B7Z A;  2WSE F;  4X64 M;  1IBL M;  2X49 A;  1DGF A;  3ILK A;  4FCV A;  3J81 S;  1PJS A;  3GPY A;  2XLJ A;  4B7H A;  3SFZ A;  4LRT A;  1Q02 A;  3HHW A;  4D80 A;  2BJV A;  4M9X A;  2D7E A;  3MK6 A;  1N78 A;  1WIV A;  5E6J A;  3A45 A;  3VK7 A;  5FTL A;  1Q3B A;  4F1I A;  3AJI B;  4IBE A;  3U6S A;  3DZD A;  2DWM A;  4DV4 M;  4LZJ A;  1PM5 A;  2F5O A;  3CGW A;  3NBI A;  3THG A;  2ZM6 M;  3GLF A;  1C7Y A;  3KW6 A;  4MGH A;  2YQZ A;  1XXH B;  1TH2 A;  1NV8 A;  4DBG B;  2VII A;  2HHH M;  3E21 A;  4X66 M;  4LJ8 A;  2LBC A;  1OFI A;  4LFA M;  2APL A;  1SXJ A;  3TL4 X;  3SHG B;  2KHH A;  1YLA A;  5EXP A;  1MJG M;  4R71 A;  2QQ8 A;  4S12 A;  1QUS A;  1OIZ A;  3SYK A;  1OKS A;  3JAM S;  4DR6 M;  1DGH A;  3Q8G A;  4DV2 M;  4G4R A;  3HJS A;  2Y0T A;  2KEB A;  4NSO B;  3TQS A;  1OAO C;  3HWS A;  4PDI A;  1GL6 A;  2R4E A;  4R7G A;  4CHT B;  4CJ6 A;  1G41 A;  1L1Z A;  3HU3 A;  1OJL A;  2DZN B;  1VDL A;  2FFJ A;  1HT2 E;  3FD9 A;  4DR3 M;  2L7I A;  3U6C A;  4BLC A;  3U5Z B;  2G3Q A;  3LVV A;  4XGI A;  5DYG A;  4LF7 M;  1ZMU A;  2DAM A;  4G4N A;  2DAK A;  2VF7 A;  1GKI A;  5ITT A;  5ITY A;  4FWD A;  4KT0 F;  5FTM A;  2QSF X;  5DYI A;  2QNJ A;  5KPT A;  4CIS A;  3TWM A;  3V76 A;  4LCB A;  2ZTD A;  1L8Q A;  3UJN A;  2C5R A;  3H4J A;  2KNA A;  3U6M A;  3I01 M;  1L2B A;  2UXD M;  3A98 B;  2I7P A;  3FRI A;  4LFB M;  2LVQ D;  4DR1 M;  5C1B A;  2H5X A;  1A5T A;  1W5S A;  4DUZ M;  3K8Z A;  4WUR A;  1I4W A;  5DFL A;  2F5Q A;  5LMU M;  2DAI A;  1TGU A;  3GRU A;  4HLQ A;  3VKG A;  5E26 A;  4B7G A;  1XWI A;  4GKK M;  1NY5 A;  1GVN A;  3FUU A;  3HGI A;  4GIP A;  3CF2 A;  1LTM A;  3E46 A;  4NC6 A;  4QNR A;  2N35 A;  4QHT A;  4G6Z A;  3I04 M;  1VEJ A;  3MMP A;  5KO3 A;  4JI8 M;  5IRE B;  2JUJ A;  2UUB M;  1Q3C A;  2EKK A;  2Z4S A;  3W0L B;  2OO9 A;  4AW4 A;  2EO2 A;  3HJQ A;  1T6O A;  2QPA A;  3ZH9 B;  1YSY A;  2RGO A;  1S3S A;  1XNR M;  2D7G A;  3FTD A;  2VF8 A; 
#chains in the Genus database with same CATH homology
 2EKF A;  1VG5 A;  2DZL A;  2QHO B;  2JNH A;  3T6P A;  1IFY A;  1WGL A;  4UN2 B;  2DAG A;  2O25 A;  1DO0 A;  1IXS A;  1F4I A;  1BVS A;  1UFZ A;  1ZMV A;  2K9D A;  1WGN A;  2JZ1 A;  3LCU A;  3IHP A;  1GO5 A;  2JP7 A;  2JY7 A;  3FRH A;  2LVP C;  2KNV A;  3BBZ A;  1G3I A;  1IM2 A;  2OOA A;  1Q02 A;  2DEN A;  3F92 A;  1WIV A;  5JI2 E;  2MRO B;  1WJ7 A;  4F1I A;  2BWE A;  2B3T A;  2MGW A;  1T43 A;  3K9P A;  1OQY A;  1SG9 A;  1WHC A;  2LTU A;  1NV9 A;  1C7Y A;  1TR8 A;  4Q7J A;  3GLF E;  1TTE A;  3FE3 A;  1NV8 A;  4DBG B;  3E21 A;  1KYI A;  2LBC A;  3IEC A;  2KHH A;  1YLA A;  1HJP A;  2MJ5 B;  4R71 A;  1VEK A;  2JY5 A;  3B89 A;  1OKS A;  1XXH E;  2L4E A;  2WZJ A;  4WP2 A;  2JZ0 A;  2KNZ A;  2LVA A;  3LCV B;  4GEW A;  2LVO C;  2DI0 A;  1G41 A;  1HQY E;  2L4F A;  2K0B X;  1VDL A;  1HT2 E;  2ZTC A;  1Y8G A;  1OTR A;  1JR3 E;  2G3Q A;  1ZMU A;  2DAM A;  1XB2 B;  2DAK A;  2L2D A;  1OAI A;  2CWB A;  1HT1 E;  1PGY A;  2DKL A;  1AIP C;  2LVN C;  2QSF X;  2QNJ A;  2ZTD A;  2MR9 A;  3K9O A;  1CUK A;  2JY6 B;  3H4J A;  1G4A E;  2KNA A;  1EFU B;  3FRI A;  3GLH E;  2LVQ D;  2H5X A;  1A5T A;  1DV0 A;  4G3O A;  1VQ1 A;  5DFL A;  1V92 A;  2DAI A;  1E94 E;  1VEG A;  1DO2 A;  3GLI E;  1P3Q Q;  2HWJ A;  2DAE A;  3E46 A;  2JY8 A;  2BWB A;  2CP8 A;  1VEJ A;  2HAK A;  1WR1 B;  1R4G A;  3MMP A;  4F2L A;  2DHY A;  2EJS A;  3GLG E;  2RRU A;  2JUJ A;  1MN3 A;  2EKK A;  1ZV1 A;  2OO9 A;  2DNA A;  2R0I A;  1T6O A;  4HEO A;  2OOB A;  1QZE A;  1ZMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...