4UN2B

Crystal structure of the uba domain of dsk2 in complex with ubiquitin
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
43
structure length
43
Chain Sequence
SPEERYEHQLRQLNDMGFFDFDRNVAALRRSGGSVQGALDSLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Designed Conformational Shift to Control Protein Binding Specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords UBIQUITIN
total genus 13
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2014-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 4un2B00
2JP7A 1OTRA 1VDLA 2H5XA 2DKLA 1TTEA 2DAGA 2DNAA 4F2LA 4R71A 2ZTCA 4DBGB 2MJ5B 1VEKA 1Y8GA 2LBCA 1OKSA 2OO9A 4GEWA 4HEOA 1EFUB 1WGNA 2R0IA 1PGYA 2EKKA 3T6PA 1QZEA 2JY7A 1WGLA 1VEJA 1VG5A 2HAKA 2JY8A 3IHPA 3F92A 3GLFE 1WJ7A 2L4FA 4Q7JA 1V92A 2QNJA 2KNAA 1G41A 1WR1B 2B3TA 2JUJA 1T43A 1DV0A 2EKFA 1C7YA 2BWBA 5DFLA 2LVOC 3BBZA 1WHCA 2DAKA 3GLHE 1DO0A 2K0BX 2DAMA 2MR9A 1ZV1A 2QSFX 1Q02A 2OOAA 3B89A 2CP8A 2QHOB 1YLAA 3K9PA 4UN2B 2LTUA 1UFZA 2LVPC 2LVNC 1NV8A 1ZMVA 1OQYA 1CUKA 1XB2B 1VQ1A 2O25A 1MN3A 2L2DA 1ZMWA 2HWJA 2LVQD 2OOBA 3K9OA 1HT2E 1HJPA 2KNVA 1G3IA 1A5TA 2DENA 1SG9A 3FRHA 2WZJA 1XXHE 3E21A 1R4GA 1G4AE 1VEGA 2EJSA 2JY6B 2LVAA 3FE3A 5JI2E 1BVSA 2DZLA 3GLGE 1OAIA 2DAEA 3MMPA 2BWEA 3FRIA 2JZ0A 2KNZA 4WP2A 1GO5A 2DI0A 1IFYA 1F4IA 3E46A 3H4JA 2MGWA 2JZ1A 3GLIE 1DO2A 2JY5A 1TR8A 2DAIA 2RRUA 1JR3E 2CWBA 1IM2A 2KHHA 1IXSA 2DHYA 1KYIA 1HQYE 4F1IA 3IECA 4G3OA 1WIVA 1NV9A 2ZTDA 2G3QA 3LCUA 3LCVB 1P3QQ 2K9DA 2L4EA 1HT1E 2JNHA 1T6OA 1ZMUA 1AIPC 2MROB 1E94E
chains in the Genus database with same CATH superfamily
2JP7A 1T3TA 4ITQA 2XFSA 1OTRA 3K1JA 3KP0E 1OFIA 1E9SA 1TTEA 4D81A 1G8PA 4LZJA 5C18A 2XZUA 3WHKA 3B7NA 1N78A 3HU2A 1VEKA 1OJLA 4LJ8A 1FNNA 1NHWC 4IJEA 1Q3CA 2QZ4A 1Y8GA 3JR5A 4DV2M 4HEOA 2LXEA 1EFUB 3W68A 2J7OA 3SHGB 3U6MA 3HX3A 3PNVA 1PGYA 4MM3B 1VDDA 1H6UA 1WGLA 1WXQA 3I4YA 4FVMA 5FTLA 1SXJE 1N33M 4NRWA 2QCUA 4HLQA 2F5QA 1X37A 2KNAA 2HKJA 1KSFX 3GPUA 2RGOA 8CATA 3TWMA 4GC5A 4L6V6 1HNXM 1DV0A 2DHRA 4BLCA 2BWBA 1DGHA 3BBZA 4IJFA 3L2AA 3SYKA 1ZQ9A 3GLHE 3GLFA 4GC9A 4A3VB 4QNRA 2K0BX 3K92A 3NBXX 3SASA 4LFCM 4P16A 3B89A 5EQTA 3SC3A 3T1HM 4DV4M 4JI5M 2ZAOA 3D8LA 5FTKA 2X4AA 3M0EA 3VDPA 1PJQA 3AL0C 2LTUA 5IWAM 1QANA 1UFZA 3GP1A 1NV8A 2CHGA 1ZMVA 4KHPM 1HNWM 5FTJA 3HY5A 1XB2B 3L26A 1VQ1A 2O25A 1GLNA 1MN3A 3AOEA 3U60A 3PVSA 5BPVA 4L78A 5DNYA 2M5ZA 2KEBA 1HJPA 3B7QA 1Z5BA 2KNVA 4RNAA 3L27A 4DV1M 2DENA 2EA0A 4B7FA 4DR7M 2LH0A 1DGGA 3SBJA 1IY2A 3Q8GA 4X62M 4NRVA 4IBFA 3EIEA 3PFIA 4CJ6A 2D7HA 4DR6M 4NSRA 4LF9M 3HJSA 3C3DA 4G4RA 1HQCA 4G4QA 1GKIA 5EP1A 2OQ4A 1BVSA 3FTEA 2F4VM 2M60A 2Q2EB 2CHVA 3GRRA 2DWMA 4JI7M 4PD2A 1LV7A 3KOXE 2KNZA 3R9XB 2DI0A 3UK6A 1IFYA 1IY0A 2WSFF 1K82A 3E46A 4CHTB 4LJAA 2I7PA 1IN4A 2ZAMA 2C99A 3FTDA 4P17A 1Z6TA 3MJ5A 3VLFB 1TR8A 2X8AA 3GPPA 2C96A 2UU9M 1N36M 1IM2A 4REZA 2CHQA 4NL4H 1KYIA 1YE9A 2R4JA 1GL7A 4F1IA 5JI3E 2L09A 2XZFA 1IXZA 1ORYB 1QUSA 3IECA 1NV9A 1OIPA 2Z4SA 5L8RF 4L4UA 1QZMA 4DR1M 3J7AS 2YNMD 3L28A 4L15A 1R2YA 1GJSA 1MX0A 2JNHA 3U61A 5ITYA 4OVZA 1IXRC 4FCVA 4LJ9A 4PT5A 1OFHA 2V6ZM 3U5ZB 4PDIA 1ZMUA 2CV1A 3GPYA 3KS4A 3GLIB 3ZH9B 3Q8XA 1L1TA 4AKIA 1N34M 4AZFA 4GHLA 1LTMA 5LMNM 1PJSA 3JAMS 4LF8M 2DNAA 1KFVA 3HHWA 4FWGA 1HNZM 3UGJA 3VKHA 4DBGB 5EXXA 3HWSA 1GVNA 4XGIA 3TE6A 3QYEA 1G71A 4TUWA 3HU3A 2H1RA 2E5LM 1WGNA 1PM5A 3AOGA 3U6LA 2EKKA 2RGHA 3U60B 2QBYA 1QZEA 2UXDM 5ITQA 1VEJA 2JY8A 3UMMA 4GH9A 1K3WA 4M0WA 1L8QA 1GABA 4Q7JA 3KP1E 2P5TA 2KXEA 2VF8A 5C1BA 3GLGA 4DR5M 5EP4A 4WURA 1WR1B 2XGNA 2FFJA 2B3TA 2JUJA 4EIWA 4X64M 4QOZC 2FS1A 1L2CA 2EKFA 2DWNA 5F3WA 1NJFA 5IREB 3B7ZA 4LGMA 5ITXA 3I04M 1JR3A 4MGZE 4FD2A 3DZDA 4L8RC 5ITTA 4CISA 4LG2A 4II7A 1DO0A 3THGA 4JI1M 1NY5A 2CRUA 2DAMA 2MR9A 1ZV1A 2V1CA 4GRIA 3HZJA 1PJJA 1Q02A 2HCBA 4S12A 3W0LB 1IBLM 2KW0A 3QAUA 1D0KA 4FWHA 3GRUA 1JQJC 3K9PA 1YLAA 4B3RM 3AOEC 1N77A 2LVPC 1IN5A 1OQYA 2UXCM 4I8OA 4NXNM 3WHLA 2CEAA 3GLFB 2L2DA 3A45A 2UXBM 2LVQD 2OOBA 1QVRA 1W5TA 2C9CA 3K9OA 3KSXA 3KXEC 3ZC7B 3T1YM 3J27B 1N75A 1QDRA 1R7RA 2HL7A 3AFHA 3FRHA 4MGHA 3GQ3A 3BOSA 1XXHE 1QQWA 4OVZB 3TPZA 3U6DA 1VEGA 4KLNA 1Z5AA 3FUUA 5DYGA 2VF7A 2QENA 3KW6A 4DV3M 2JA2A 1SXJD 4R7GA 1DGHB 3GLIA 2C5RA 2KA6B 4XK8F 3KOWE 2DZLA 1QYRA 2Z8YM 4FWDA 3GLGE 3U6EA 3PNYA 2K6BA 2F5NA 3FRIA 4MGIE 2JXNA 1GO5A 2C9OA 1J09A 1SXJA 5GKNA 2DZOB 1IBKM 4B3MM 2LHCA 4IBBA 4LZZA 3KOYE 3PXGA 1PJTA 1Q3BA 4IIWA 4QNMA 2JZ1A 3GLIE 1AUAA 2DWZB 2QBYB 2R44A 3HJQA 2L7IA 2RRUA 4IBEA 4NSOB 4NXMM 4G4NA 2KHHA 1D0MA 1HQYE 3K2LA 3KOZE 5IZ7D 3GLGB 3V76A 3DOAA 3LCUA 3CF6E 3HHYA 2BJVA 2L4EA 4D82A 1V34A 4MGYE 4AI6A 4M0DA 1J7KA 2X49A 1D0LA 3IG8A 3FYDA 4G4OA 4I81A 4GMQA 4LFAM 1T6OA 3AJIB 2ZANA 1E94E 5H37D 2NQ8C 3CF0A 4JV5M 4JXJA 2H5XA 2DKLA 2XH9A 2DAGA 4FCWA 3ZQJA 5EP3A 4JI0M 4F2LA 2VDBB 2O5RA 2XLJA 3J81S 2MJ5B 3HU1A 1V33A 4LRSA 2F5SA 1TF0B 3C9PA 2K47A 2LBCA 3B9PA 4GEWA 7CATA 2F5PA 3LVWA 4AQYM 2V1UA 4FW9A 1YSYA 3LQQA 2DVWB 3GO8A 1MU5A 3T6PA 1L2BA 2JY7A 4G6ZA 4XBOA 1XHBA 2OPFA 4DV7M 2HAKA 3F92A 4RF1A 1WJ7A 4IBKA 1QAQA 2J7NA 2L6OA 1TH4A 2ERCA 1G41A 2DZNB 4M9ZA 4W5WA 1I4WA 5KPTA 2KDLA 1T43A 1Q39A 4Z6YA 3GPXA 4HL4A 4X66M 4BB9A 2LNHC 4CIZA 3LMMA 2LVOC 4GITA 4LGYA 4JI3M 1WHCA 4DV6M 3U5ZA 2W82A 3GLHB 4LF6M 2LHGA 1IN8A 1NO1A 4MB7A 1XMOM 3K8ZA 4B3TM 3T15A 2G8LA 2QSFX 3MHVC 4PCZA 2OOAA 4MH0E 2CUZA 1R2ZA 1W5SA 3FTCA 3HHZA 3M6AA 4NOOB 2D7GA 4GIPA 3U6QA 4UN2B 2R62A 1QAMA 2XSZA 1TDHA 2Z4RA 4IBJA 4DR2M 2KZUA 3GQ4A 1JB0F 1E32A 1ZMWA 4LJ7A 4LJ5A 4GHAA 4KODA 4QHTA 5DYIA 3TL4X 4JN6A 1G3IA 1A5TA 4D80A 5KPZA 4DR4M 3TWKA 3I51A 2A5YB 1SG9A 2VQFM 5EXSA 1SXJB 1GL6A 4QOSA 3RGPA 3A98B 3TQSA 3EIHA 2FNAA 4JI4M 3A46A 2FOIC 2WZJA 2KRUA 2JY6B 5KPRA 4M9SA 3BXWA 2LVAA 3ILKA 2FH0A 4DUZM 2D7EA 5JI2E 4KT0F 1OAIA 2DAEA 5KO3A 3ZCBB 2JZ0A 4B7GA 1QDTA 1N32M 4WP2A 4LF7M 3R8FA 2L7HA 3SHFA 4IBCA 3KSJA 2GQFA 4BBAA 3U6CA 1K3XA 2J5YA 4B08A 4RKUF 2CFOA 2Y0QA 1DO2A 3LVVA 3RFWA 1G59A 2DAIA 3KFUG 3UJNA 3QWLA 1R6BX 1JR3E 5KQDA 2CWBA 5FLXS 1Z59A 1IXSA 1NJGA 2DHYA 3HHXA 4DR3M 3TWLA 2ZBKB 2JWSA 2WSEF 4G3OA 3L25A 4Z8XA 3SFZA 1JR3D 2LWXA 2UUBM 2G3QA 5LMUM 4LJ6A 5EJCA 3FTFA 2R65A 1NNUC 1S3SA 4WW0A 4X65M 3OTOM 4GKKM 3SAVA 4L16A 3VKGA 1RU3A 3IG5A 4DV5M 4RF0A 3CTWB 1IBMM 5EXPA 4AKHA 1EE8A 3RGSA 4KO8A 3VDUA 5ITUA 5A2QS 1TH2A 1VDLA 1Z5CA 4OX9M 4R3DA 3H4MA 4LF4M 4M9XA 4R71A 2ZTCA 4QHSA 2AHMA 3GQ5A 3MK6A 3RE8A 5ITRA 3U6OA 2Y21A 2OO9A 1OKSA 2XSZD 2DWLA 3JR4A 2R0IA 2CV0A 2QPAA 1QAOA 4ANRA 4JI2M 4DUYM 1VG5A 1NHGC 1XXHB 3IHPA 5KQ8A 3NBIA 3GLFE 2F5OA 2L4FA 4IBDA 1XNQM 1V92A 4LFBM 4K0KM 2YR0A 2QNJA 3J80S 2XF3A 1D2NA 5E26A 3VK8A 3FUTA 1QUTA 1L1ZA 2APLA 2QP9X 2MH8A 4PDGA 3CGWA 3I01M 3LW5F 1ZAEA 1C7YA 3A42A 3HKPA 1NVMA 5DFLA 3W0FA 3FUVA 4GKJM 2DAKA 3HGIA 4JI8M 1XC8A 3SYLA 2KRKA 3DA1A 3C58A 2EUCA 2CE7A 3AV0A 3KVWA 2DXIA 1TDZA 2Z7JA 2EO2A 2KZSA 2CP8A 3CF2A 2QHOB 3D8BA 4IBIA 5ITXE 4AW4A 4YY3M 1DGFA 2LVNC 4B3SM 2UUCM 1CUKA 3FUWA 1IY1A 2WSCF 5E6JA 1YUBA 3DFZA 1MJGM 3GLHA 1FJGM 2HWJA 1IXSB 3VK7A 1IN7A 4I4LA 2BNKA 3SATA 4LF5M 1PJIA 1HT2E 2BJWA 2I7NA 1R5LA 4IBGA 3NWLA 3UZUA 5BR8M 4NC6A 2R6FA 3AKZA 1NY6A 2VIIA 5EP2A 1IN6A 1I94M 5FSWA 2CV2A 2N35A 1E9RA 3FUXA 2G5GX 3U61B 1C1KA 3E21A 3FYCA 1R4GA 1G4AE 2EJSA 4LCBA 2Z3XA 4JI6M 2Y20A 3FKEA 3T38A 1OAOC 1TH3A 3FE3A 3HJ8A 3E9SA 3W67A 2R46A 3GRYA 4YHHM 1SXJC 1XMQM 1EIJA 4AKGA 4LRTA 4LJ4A 5EXTA 5IT9S 3MMPA 2BWEA 2FE8A 1OIZA 4AG6A 1DGBA 1XWIA 3J2PB 1XNRM 3C3EA 4OU7A 4Y28F 1F4IA 2UUAM 3H4JA 3SARA 2RKOA 2GNOA 1NSFA 2MGWA 3L29A 2HHHM 4JYAM 3J7BA 1NNJA 1IQPA 3KDSE 3M7GA 3KS8A 1UM8A 2JY5A 4LY6A 3E4RA 3I4VA 4MGKE 4AG5A 4ZPXA 4DV0M 2VQEM 3QYBA 3U6PA 1HR0M 3SAUA 1L2DA 5FTNA 2R18A 2Y0TA 2YQZA 1J5EM 3B74A 4B7HA 3VFDA 1TGUA 2XEPA 4CGYB 2R4EA 1GJTA 2YFQA 1WIVA 4FCTA 2ZTDA 2ZM6M 3LCVB 3GRVA 2QQ8A 3FD9A 3LQRA 1P3QQ 2K9DA 4I5SA 2O01F 2C98A 1HT1E 1PRBA 3SMSA 2XFTA 5FTMA 2R45A 4OW0A 1AIPC 3U6SA 3SMPA 3SAWA 2MROB 1XXHA
chains in the Genus database with same CATH topology
2JP7A 1OTRA 1VDLA 2H5XA 2DKLA 1TTEA 2DAGA 2DNAA 4F2LA 4R71A 2ZTCA 4DBGB 2MJ5B 1VEKA 1Y8GA 2LBCA 1OKSA 2OO9A 4GEWA 4HEOA 1EFUB 1WGNA 2R0IA 1PGYA 2EKKA 3T6PA 1QZEA 2JY7A 1WGLA 1VEJA 1VG5A 2HAKA 2JY8A 3IHPA 3F92A 3GLFE 1WJ7A 2L4FA 4Q7JA 1V92A 2QNJA 2KNAA 1G41A 1WR1B 2B3TA 2JUJA 1T43A 1DV0A 2EKFA 1C7YA 2BWBA 5DFLA 2LVOC 3BBZA 1WHCA 2DAKA 3GLHE 1DO0A 2K0BX 2DAMA 2MR9A 1ZV1A 2QSFX 1Q02A 2OOAA 3B89A 2CP8A 2QHOB 1YLAA 3K9PA 4UN2B 2LTUA 1UFZA 2LVPC 2LVNC 1NV8A 1ZMVA 1OQYA 1CUKA 1XB2B 1VQ1A 2O25A 1MN3A 2L2DA 1ZMWA 2HWJA 2LVQD 2OOBA 3K9OA 1HT2E 1HJPA 2KNVA 1G3IA 1A5TA 2DENA 1SG9A 3FRHA 2WZJA 1XXHE 3E21A 1R4GA 1G4AE 1VEGA 2EJSA 2JY6B 2LVAA 3FE3A 5JI2E 1BVSA 2DZLA 3GLGE 1OAIA 2DAEA 3MMPA 2BWEA 3FRIA 2JZ0A 2KNZA 4WP2A 1GO5A 2DI0A 1IFYA 1F4IA 3E46A 3H4JA 2MGWA 2JZ1A 3GLIE 1DO2A 2JY5A 1TR8A 2DAIA 2RRUA 1JR3E 2CWBA 1IM2A 2KHHA 1IXSA 2DHYA 1KYIA 1HQYE 4F1IA 3IECA 4G3OA 1WIVA 1NV9A 2ZTDA 2G3QA 3LCUA 3LCVB 1P3QQ 2K9DA 2L4EA 1HT1E 2JNHA 1T6OA 1ZMUA 1AIPC 2MROB 1E94E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JP7 A;  1OTR A;  1VDL A;  2H5X A;  2DKL A;  1TTE A;  2DAG A;  2DNA A;  4F2L A;  4R71 A;  2ZTC A;  4DBG B;  2MJ5 B;  1VEK A;  1Y8G A;  2LBC A;  1OKS A;  2OO9 A;  4GEW A;  4HEO A;  1EFU B;  1WGN A;  2R0I A;  1PGY A;  2EKK A;  3T6P A;  1QZE A;  2JY7 A;  1WGL A;  1VEJ A;  1VG5 A;  2HAK A;  2JY8 A;  3IHP A;  3F92 A;  3GLF E;  1WJ7 A;  2L4F A;  4Q7J A;  1V92 A;  2QNJ A;  2KNA A;  1G41 A;  1WR1 B;  2B3T A;  2JUJ A;  1T43 A;  1DV0 A;  2EKF A;  1C7Y A;  2BWB A;  5DFL A;  2LVO C;  3BBZ A;  1WHC A;  2DAK A;  3GLH E;  1DO0 A;  2K0B X;  2DAM A;  2MR9 A;  1ZV1 A;  2QSF X;  1Q02 A;  2OOA A;  3B89 A;  2CP8 A;  2QHO B;  1YLA A;  3K9P A;  4UN2 B;  2LTU A;  1UFZ A;  2LVP C;  2LVN C;  1NV8 A;  1ZMV A;  1OQY A;  1CUK A;  1XB2 B;  1VQ1 A;  2O25 A;  1MN3 A;  2L2D A;  1ZMW A;  2HWJ A;  2LVQ D;  2OOB A;  3K9O A;  1HT2 E;  1HJP A;  2KNV A;  1G3I A;  1A5T A;  2DEN A;  1SG9 A;  3FRH A;  2WZJ A;  1XXH E;  3E21 A;  1R4G A;  1G4A E;  1VEG A;  2EJS A;  2JY6 B;  2LVA A;  3FE3 A;  5JI2 E;  1BVS A;  2DZL A;  3GLG E;  1OAI A;  2DAE A;  3MMP A;  2BWE A;  3FRI A;  2JZ0 A;  2KNZ A;  4WP2 A;  1GO5 A;  2DI0 A;  1IFY A;  1F4I A;  3E46 A;  3H4J A;  2MGW A;  2JZ1 A;  3GLI E;  1DO2 A;  2JY5 A;  1TR8 A;  2DAI A;  2RRU A;  1JR3 E;  2CWB A;  1IM2 A;  2KHH A;  1IXS A;  2DHY A;  1KYI A;  1HQY E;  4F1I A;  3IEC A;  4G3O A;  1WIV A;  1NV9 A;  2ZTD A;  2G3Q A;  3LCU A;  3LCV B;  1P3Q Q;  2K9D A;  2L4E A;  1HT1 E;  2JNH A;  1T6O A;  1ZMU A;  1AIP C;  2MRO B;  1E94 E; 
#chains in the Genus database with same CATH topology
 2JP7 A;  1T3T A;  4ITQ A;  2XFS A;  1OTR A;  3K1J A;  3KP0 E;  1OFI A;  1E9S A;  1TTE A;  4D81 A;  1G8P A;  4LZJ A;  5C18 A;  2XZU A;  3WHK A;  3B7N A;  1N78 A;  3HU2 A;  1VEK A;  1OJL A;  4LJ8 A;  1FNN A;  1NHW C;  4IJE A;  1Q3C A;  2QZ4 A;  1Y8G A;  3JR5 A;  4DV2 M;  4HEO A;  2LXE A;  1EFU B;  3W68 A;  2J7O A;  3SHG B;  3U6M A;  3HX3 A;  3PNV A;  1PGY A;  4MM3 B;  1VDD A;  1H6U A;  1WGL A;  1WXQ A;  3I4Y A;  4FVM A;  5FTL A;  1SXJ E;  1N33 M;  4NRW A;  2QCU A;  4HLQ A;  2F5Q A;  1X37 A;  2KNA A;  2HKJ A;  1KSF X;  3GPU A;  2RGO A;  8CAT A;  3TWM A;  4GC5 A;  4L6V 6;  1HNX M;  1DV0 A;  2DHR A;  4BLC A;  2BWB A;  1DGH A;  3BBZ A;  4IJF A;  3L2A A;  3SYK A;  1ZQ9 A;  3GLH E;  3GLF A;  4GC9 A;  4A3V B;  4QNR A;  2K0B X;  3K92 A;  3NBX X;  3SAS A;  4LFC M;  4P16 A;  3B89 A;  5EQT A;  3SC3 A;  3T1H M;  4DV4 M;  4JI5 M;  2ZAO A;  3D8L A;  5FTK A;  2X4A A;  3M0E A;  3VDP A;  1PJQ A;  3AL0 C;  2LTU A;  5IWA M;  1QAN A;  1UFZ A;  3GP1 A;  1NV8 A;  2CHG A;  1ZMV A;  4KHP M;  1HNW M;  5FTJ A;  3HY5 A;  1XB2 B;  3L26 A;  1VQ1 A;  2O25 A;  1GLN A;  1MN3 A;  3AOE A;  3U60 A;  3PVS A;  5BPV A;  4L78 A;  5DNY A;  2M5Z A;  2KEB A;  1HJP A;  3B7Q A;  1Z5B A;  2KNV A;  4RNA A;  3L27 A;  4DV1 M;  2DEN A;  2EA0 A;  4B7F A;  4DR7 M;  2LH0 A;  1DGG A;  3SBJ A;  1IY2 A;  3Q8G A;  4X62 M;  4NRV A;  4IBF A;  3EIE A;  3PFI A;  4CJ6 A;  2D7H A;  4DR6 M;  4NSR A;  4LF9 M;  3HJS A;  3C3D A;  4G4R A;  1HQC A;  4G4Q A;  1GKI A;  5EP1 A;  2OQ4 A;  1BVS A;  3FTE A;  2F4V M;  2M60 A;  2Q2E B;  2CHV A;  3GRR A;  2DWM A;  4JI7 M;  4PD2 A;  1LV7 A;  3KOX E;  2KNZ A;  3R9X B;  2DI0 A;  3UK6 A;  1IFY A;  1IY0 A;  2WSF F;  1K82 A;  3E46 A;  4CHT B;  4LJA A;  2I7P A;  1IN4 A;  2ZAM A;  2C99 A;  3FTD A;  4P17 A;  1Z6T A;  3MJ5 A;  3VLF B;  1TR8 A;  2X8A A;  3GPP A;  2C96 A;  2UU9 M;  1N36 M;  1IM2 A;  4REZ A;  2CHQ A;  4NL4 H;  1KYI A;  1YE9 A;  2R4J A;  1GL7 A;  4F1I A;  5JI3 E;  2L09 A;  2XZF A;  1IXZ A;  1ORY B;  1QUS A;  3IEC A;  1NV9 A;  1OIP A;  2Z4S A;  5L8R F;  4L4U A;  1QZM A;  4DR1 M;  3J7A S;  2YNM D;  3L28 A;  4L15 A;  1R2Y A;  1GJS A;  1MX0 A;  2JNH A;  3U61 A;  5ITY A;  4OVZ A;  1IXR C;  4FCV A;  4LJ9 A;  4PT5 A;  1OFH A;  2V6Z M;  3U5Z B;  4PDI A;  1ZMU A;  2CV1 A;  3GPY A;  3KS4 A;  3GLI B;  3ZH9 B;  3Q8X A;  1L1T A;  4AKI A;  1N34 M;  4AZF A;  4GHL A;  1LTM A;  5LMN M;  1PJS A;  3JAM S;  4LF8 M;  2DNA A;  1KFV A;  3HHW A;  4FWG A;  1HNZ M;  3UGJ A;  3VKH A;  4DBG B;  5EXX A;  3HWS A;  1GVN A;  4XGI A;  3TE6 A;  3QYE A;  1G71 A;  4TUW A;  3HU3 A;  2H1R A;  2E5L M;  1WGN A;  1PM5 A;  3AOG A;  3U6L A;  2EKK A;  2RGH A;  3U60 B;  2QBY A;  1QZE A;  2UXD M;  5ITQ A;  1VEJ A;  2JY8 A;  3UMM A;  4GH9 A;  1K3W A;  4M0W A;  1L8Q A;  1GAB A;  4Q7J A;  3KP1 E;  2P5T A;  2KXE A;  2VF8 A;  5C1B A;  3GLG A;  4DR5 M;  5EP4 A;  4WUR A;  1WR1 B;  2XGN A;  2FFJ A;  2B3T A;  2JUJ A;  4EIW A;  4X64 M;  4QOZ C;  2FS1 A;  1L2C A;  2EKF A;  2DWN A;  5F3W A;  1NJF A;  5IRE B;  3B7Z A;  4LGM A;  5ITX A;  3I04 M;  1JR3 A;  4MGZ E;  4FD2 A;  3DZD A;  4L8R C;  5ITT A;  4CIS A;  4LG2 A;  4II7 A;  1DO0 A;  3THG A;  4JI1 M;  1NY5 A;  2CRU A;  2DAM A;  2MR9 A;  1ZV1 A;  2V1C A;  4GRI A;  3HZJ A;  1PJJ A;  1Q02 A;  2HCB A;  4S12 A;  3W0L B;  1IBL M;  2KW0 A;  3QAU A;  1D0K A;  4FWH A;  3GRU A;  1JQJ C;  3K9P A;  1YLA A;  4B3R M;  3AOE C;  1N77 A;  2LVP C;  1IN5 A;  1OQY A;  2UXC M;  4I8O A;  4NXN M;  3WHL A;  2CEA A;  3GLF B;  2L2D A;  3A45 A;  2UXB M;  2LVQ D;  2OOB A;  1QVR A;  1W5T A;  2C9C A;  3K9O A;  3KSX A;  3KXE C;  3ZC7 B;  3T1Y M;  3J27 B;  1N75 A;  1QDR A;  1R7R A;  2HL7 A;  3AFH A;  3FRH A;  4MGH A;  3GQ3 A;  3BOS A;  1XXH E;  1QQW A;  4OVZ B;  3TPZ A;  3U6D A;  1VEG A;  4KLN A;  1Z5A A;  3FUU A;  5DYG A;  2VF7 A;  2QEN A;  3KW6 A;  4DV3 M;  2JA2 A;  1SXJ D;  4R7G A;  1DGH B;  3GLI A;  2C5R A;  2KA6 B;  4XK8 F;  3KOW E;  2DZL A;  1QYR A;  2Z8Y M;  4FWD A;  3GLG E;  3U6E A;  3PNY A;  2K6B A;  2F5N A;  3FRI A;  4MGI E;  2JXN A;  1GO5 A;  2C9O A;  1J09 A;  1SXJ A;  5GKN A;  2DZO B;  1IBK M;  4B3M M;  2LHC A;  4IBB A;  4LZZ A;  3KOY E;  3PXG A;  1PJT A;  1Q3B A;  4IIW A;  4QNM A;  2JZ1 A;  3GLI E;  1AUA A;  2DWZ B;  2QBY B;  2R44 A;  3HJQ A;  2L7I A;  2RRU A;  4IBE A;  4NSO B;  4NXM M;  4G4N A;  2KHH A;  1D0M A;  1HQY E;  3K2L A;  3KOZ E;  5IZ7 D;  3GLG B;  3V76 A;  3DOA A;  3LCU A;  3CF6 E;  3HHY A;  2BJV A;  2L4E A;  4D82 A;  1V34 A;  4MGY E;  4AI6 A;  4M0D A;  1J7K A;  2X49 A;  1D0L A;  3IG8 A;  3FYD A;  4G4O A;  4I81 A;  4GMQ A;  4LFA M;  1T6O A;  3AJI B;  2ZAN A;  1E94 E;  5H37 D;  2NQ8 C;  3CF0 A;  4JV5 M;  4JXJ A;  2H5X A;  2DKL A;  2XH9 A;  2DAG A;  4FCW A;  3ZQJ A;  5EP3 A;  4JI0 M;  4F2L A;  2VDB B;  2O5R A;  2XLJ A;  3J81 S;  2MJ5 B;  3HU1 A;  1V33 A;  4LRS A;  2F5S A;  1TF0 B;  3C9P A;  2K47 A;  2LBC A;  3B9P A;  4GEW A;  7CAT A;  2F5P A;  3LVW A;  4AQY M;  2V1U A;  4FW9 A;  1YSY A;  3LQQ A;  2DVW B;  3GO8 A;  1MU5 A;  3T6P A;  1L2B A;  2JY7 A;  4G6Z A;  4XBO A;  1XHB A;  2OPF A;  4DV7 M;  2HAK A;  3F92 A;  4RF1 A;  1WJ7 A;  4IBK A;  1QAQ A;  2J7N A;  2L6O A;  1TH4 A;  2ERC A;  1G41 A;  2DZN B;  4M9Z A;  4W5W A;  1I4W A;  5KPT A;  2KDL A;  1T43 A;  1Q39 A;  4Z6Y A;  3GPX A;  4HL4 A;  4X66 M;  4BB9 A;  2LNH C;  4CIZ A;  3LMM A;  2LVO C;  4GIT A;  4LGY A;  4JI3 M;  1WHC A;  4DV6 M;  3U5Z A;  2W82 A;  3GLH B;  4LF6 M;  2LHG A;  1IN8 A;  1NO1 A;  4MB7 A;  1XMO M;  3K8Z A;  4B3T M;  3T15 A;  2G8L A;  2QSF X;  3MHV C;  4PCZ A;  2OOA A;  4MH0 E;  2CUZ A;  1R2Z A;  1W5S A;  3FTC A;  3HHZ A;  3M6A A;  4NOO B;  2D7G A;  4GIP A;  3U6Q A;  4UN2 B;  2R62 A;  1QAM A;  2XSZ A;  1TDH A;  2Z4R A;  4IBJ A;  4DR2 M;  2KZU A;  3GQ4 A;  1JB0 F;  1E32 A;  1ZMW A;  4LJ7 A;  4LJ5 A;  4GHA A;  4KOD A;  4QHT A;  5DYI A;  3TL4 X;  4JN6 A;  1G3I A;  1A5T A;  4D80 A;  5KPZ A;  4DR4 M;  3TWK A;  3I51 A;  2A5Y B;  1SG9 A;  2VQF M;  5EXS A;  1SXJ B;  1GL6 A;  4QOS A;  3RGP A;  3A98 B;  3TQS A;  3EIH A;  2FNA A;  4JI4 M;  3A46 A;  2FOI C;  2WZJ A;  2KRU A;  2JY6 B;  5KPR A;  4M9S A;  3BXW A;  2LVA A;  3ILK A;  2FH0 A;  4DUZ M;  2D7E A;  5JI2 E;  4KT0 F;  1OAI A;  2DAE A;  5KO3 A;  3ZCB B;  2JZ0 A;  4B7G A;  1QDT A;  1N32 M;  4WP2 A;  4LF7 M;  3R8F A;  2L7H A;  3SHF A;  4IBC A;  3KSJ A;  2GQF A;  4BBA A;  3U6C A;  1K3X A;  2J5Y A;  4B08 A;  4RKU F;  2CFO A;  2Y0Q A;  1DO2 A;  3LVV A;  3RFW A;  1G59 A;  2DAI A;  3KFU G;  3UJN A;  3QWL A;  1R6B X;  1JR3 E;  5KQD A;  2CWB A;  5FLX S;  1Z59 A;  1IXS A;  1NJG A;  2DHY A;  3HHX A;  4DR3 M;  3TWL A;  2ZBK B;  2JWS A;  2WSE F;  4G3O A;  3L25 A;  4Z8X A;  3SFZ A;  1JR3 D;  2LWX A;  2UUB M;  2G3Q A;  5LMU M;  4LJ6 A;  5EJC A;  3FTF A;  2R65 A;  1NNU C;  1S3S A;  4WW0 A;  4X65 M;  3OTO M;  4GKK M;  3SAV A;  4L16 A;  3VKG A;  1RU3 A;  3IG5 A;  4DV5 M;  4RF0 A;  3CTW B;  1IBM M;  5EXP A;  4AKH A;  1EE8 A;  3RGS A;  4KO8 A;  3VDU A;  5ITU A;  5A2Q S;  1TH2 A;  1VDL A;  1Z5C A;  4OX9 M;  4R3D A;  3H4M A;  4LF4 M;  4M9X A;  4R71 A;  2ZTC A;  4QHS A;  2AHM A;  3GQ5 A;  3MK6 A;  3RE8 A;  5ITR A;  3U6O A;  2Y21 A;  2OO9 A;  1OKS A;  2XSZ D;  2DWL A;  3JR4 A;  2R0I A;  2CV0 A;  2QPA A;  1QAO A;  4ANR A;  4JI2 M;  4DUY M;  1VG5 A;  1NHG C;  1XXH B;  3IHP A;  5KQ8 A;  3NBI A;  3GLF E;  2F5O A;  2L4F A;  4IBD A;  1XNQ M;  1V92 A;  4LFB M;  4K0K M;  2YR0 A;  2QNJ A;  3J80 S;  2XF3 A;  1D2N A;  5E26 A;  3VK8 A;  3FUT A;  1QUT A;  1L1Z A;  2APL A;  2QP9 X;  2MH8 A;  4PDG A;  3CGW A;  3I01 M;  3LW5 F;  1ZAE A;  1C7Y A;  3A42 A;  3HKP A;  1NVM A;  5DFL A;  3W0F A;  3FUV A;  4GKJ M;  2DAK A;  3HGI A;  4JI8 M;  1XC8 A;  3SYL A;  2KRK A;  3DA1 A;  3C58 A;  2EUC A;  2CE7 A;  3AV0 A;  3KVW A;  2DXI A;  1TDZ A;  2Z7J A;  2EO2 A;  2KZS A;  2CP8 A;  3CF2 A;  2QHO B;  3D8B A;  4IBI A;  5ITX E;  4AW4 A;  4YY3 M;  1DGF A;  2LVN C;  4B3S M;  2UUC M;  1CUK A;  3FUW A;  1IY1 A;  2WSC F;  5E6J A;  1YUB A;  3DFZ A;  1MJG M;  3GLH A;  1FJG M;  2HWJ A;  1IXS B;  3VK7 A;  1IN7 A;  4I4L A;  2BNK A;  3SAT A;  4LF5 M;  1PJI A;  1HT2 E;  2BJW A;  2I7N A;  1R5L A;  4IBG A;  3NWL A;  3UZU A;  5BR8 M;  4NC6 A;  2R6F A;  3AKZ A;  1NY6 A;  2VII A;  5EP2 A;  1IN6 A;  1I94 M;  5FSW A;  2CV2 A;  2N35 A;  1E9R A;  3FUX A;  2G5G X;  3U61 B;  1C1K A;  3E21 A;  3FYC A;  1R4G A;  1G4A E;  2EJS A;  4LCB A;  2Z3X A;  4JI6 M;  2Y20 A;  3FKE A;  3T38 A;  1OAO C;  1TH3 A;  3FE3 A;  3HJ8 A;  3E9S A;  3W67 A;  2R46 A;  3GRY A;  4YHH M;  1SXJ C;  1XMQ M;  1EIJ A;  4AKG A;  4LRT A;  4LJ4 A;  5EXT A;  5IT9 S;  3MMP A;  2BWE A;  2FE8 A;  1OIZ A;  4AG6 A;  1DGB A;  1XWI A;  3J2P B;  1XNR M;  3C3E A;  4OU7 A;  4Y28 F;  1F4I A;  2UUA M;  3H4J A;  3SAR A;  2RKO A;  2GNO A;  1NSF A;  2MGW A;  3L29 A;  2HHH M;  4JYA M;  3J7B A;  1NNJ A;  1IQP A;  3KDS E;  3M7G A;  3KS8 A;  1UM8 A;  2JY5 A;  4LY6 A;  3E4R A;  3I4V A;  4MGK E;  4AG5 A;  4ZPX A;  4DV0 M;  2VQE M;  3QYB A;  3U6P A;  1HR0 M;  3SAU A;  1L2D A;  5FTN A;  2R18 A;  2Y0T A;  2YQZ A;  1J5E M;  3B74 A;  4B7H A;  3VFD A;  1TGU A;  2XEP A;  4CGY B;  2R4E A;  1GJT A;  2YFQ A;  1WIV A;  4FCT A;  2ZTD A;  2ZM6 M;  3LCV B;  3GRV A;  2QQ8 A;  3FD9 A;  3LQR A;  1P3Q Q;  2K9D A;  4I5S A;  2O01 F;  2C98 A;  1HT1 E;  1PRB A;  3SMS A;  2XFT A;  5FTM A;  2R45 A;  4OW0 A;  1AIP C;  3U6S A;  3SMP A;  3SAW A;  2MRO B;  1XXH A; 
#chains in the Genus database with same CATH homology
 2JP7 A;  1OTR A;  1VDL A;  2H5X A;  2DKL A;  1TTE A;  2DAG A;  2DNA A;  4F2L A;  4R71 A;  2ZTC A;  4DBG B;  2MJ5 B;  1VEK A;  1Y8G A;  2LBC A;  1OKS A;  2OO9 A;  4GEW A;  4HEO A;  1EFU B;  1WGN A;  2R0I A;  1PGY A;  2EKK A;  3T6P A;  1QZE A;  2JY7 A;  1WGL A;  1VEJ A;  1VG5 A;  2HAK A;  2JY8 A;  3IHP A;  3F92 A;  3GLF E;  1WJ7 A;  2L4F A;  4Q7J A;  1V92 A;  2QNJ A;  2KNA A;  1G41 A;  1WR1 B;  2B3T A;  2JUJ A;  1T43 A;  1DV0 A;  2EKF A;  1C7Y A;  2BWB A;  5DFL A;  2LVO C;  3BBZ A;  1WHC A;  2DAK A;  3GLH E;  1DO0 A;  2K0B X;  2DAM A;  2MR9 A;  1ZV1 A;  2QSF X;  1Q02 A;  2OOA A;  3B89 A;  2CP8 A;  2QHO B;  1YLA A;  3K9P A;  4UN2 B;  2LTU A;  1UFZ A;  2LVP C;  2LVN C;  1NV8 A;  1ZMV A;  1OQY A;  1CUK A;  1XB2 B;  1VQ1 A;  2O25 A;  1MN3 A;  2L2D A;  1ZMW A;  2HWJ A;  2LVQ D;  2OOB A;  3K9O A;  1HT2 E;  1HJP A;  2KNV A;  1G3I A;  1A5T A;  2DEN A;  1SG9 A;  3FRH A;  2WZJ A;  1XXH E;  3E21 A;  1R4G A;  1G4A E;  1VEG A;  2EJS A;  2JY6 B;  2LVA A;  3FE3 A;  5JI2 E;  1BVS A;  2DZL A;  3GLG E;  1OAI A;  2DAE A;  3MMP A;  2BWE A;  3FRI A;  2JZ0 A;  2KNZ A;  4WP2 A;  1GO5 A;  2DI0 A;  1IFY A;  1F4I A;  3E46 A;  3H4J A;  2MGW A;  2JZ1 A;  3GLI E;  1DO2 A;  2JY5 A;  1TR8 A;  2DAI A;  2RRU A;  1JR3 E;  2CWB A;  1IM2 A;  2KHH A;  1IXS A;  2DHY A;  1KYI A;  1HQY E;  4F1I A;  3IEC A;  4G3O A;  1WIV A;  1NV9 A;  2ZTD A;  2G3Q A;  3LCU A;  3LCV B;  1P3Q Q;  2K9D A;  2L4E A;  1HT1 E;  2JNH A;  1T6O A;  1ZMU A;  1AIP C;  2MRO B;  1E94 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...