4UN7G

The crystal structure of i-dmoi in complex with its target dna before incubation in 5mm mn (state 1)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
177
structure length
177
Chain Sequence
EEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGVYVLNISLRDRIKFVHTILSSH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HOMING ENDONUCLEASE I-DMOI
publication title Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.
pubmed doi rcsb
source organism Desulfurococcus mobilis
molecule tags Hydrolase/dna
total genus 58
structure length 177
sequence length 177
ec nomenclature ec 3.1.-.-:
pdb deposition date 2014-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF14528 LAGLIDADG_3 LAGLIDADG-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 4un7G01
3.10.28.10 Alpha Beta Roll Endonuclease I-creI Homing endonucleases 4un7G02
5AKMA 4Z20A 4UN7A 4AADA 3KO2A 5A77A 1T9JA 2AB5A 4UN8A 5A0MA 1UM2A 1LWTA 4D6OA 3HYJA 2VBNB 3MX9A 4UN7G 1JVAA 2I3PA 3OORA 4UN8G 2VBJA 3EH8A 2VBLA 2DCHX 3MXBB 3HYIA 2VBOA 2XE0B 2CW7A 4YISA 3QQYA 5E5SA 4LOXA 5E63A 5A74A 1DQ3A 1U0CA 3R7PA 1M5XA 3C0WA 4AAFA 1DFAA 4AQUA 5A72A 4UN9A 2EX5A 4D6NA 3FD2A 2VBNA 5E67A 4AAEA 3C0XA 4Z1ZA 1U0DA 4UNCA 4YITA 4UN9G 4Z1XA 4AQXA 2CW8A 2VBLB 4LQ0A 2QOJZ 4YHXA 1EF0A 1T9IA 1G9YA 2O7MA 5A78A 4UNAA 1AF5A 2XE0A 5A0MB 1N3EA 1LWSA 1B24A 3UVFA 1MOWA 2I3QA 1P8KZ 3MIPA 4UT0A 4AAGA 5E5OA 3MXAA 1N3FA 4UNBA 4EFJA 1R7MA 2FLDA 2VS7A 2VBJB 5AK9A 1VDEA 5AKNA 3E54A 3MISA 1BP7A 3MXBA 4AABA 5A0WA 2VBOB 5AKFA 2VS8A 1G9ZA 3OOLA
chains in the Genus database with same CATH superfamily
5AKMA 4Z20A 4UN7A 4AADA 3KO2A 5A77A 1T9JA 2AB5A 4UN8A 5A0MA 1UM2A 1LWTA 4D6OA 3HYJA 2VBNB 3MX9A 4UN7G 1JVAA 2I3PA 3OORA 4UN8G 2VBJA 3EH8A 2VBLA 2DCHX 3MXBB 3HYIA 2VBOA 2XE0B 2CW7A 4YISA 3QQYA 5E5SA 4LOXA 5E63A 5A74A 1DQ3A 1U0CA 3R7PA 1M5XA 3C0WA 4AAFA 1DFAA 2F4LA 4AQUA 4UN9A 5A72A 2EX5A 4D6NA 3FD2A 2VBNA 5E67A 4AAEA 3C0XA 4Z1ZA 1U0DA 4UNCA 4YITA 4UN9G 4Z1XA 4AQXA 2CW8A 2VBLB 4LQ0A 2QOJZ 4YHXA 1EF0A 1T9IA 1G9YA 2O7MA 5A78A 4UNAA 1AF5A 2XE0A 4KZSA 5A0MB 1N3EA 1LWSA 1B24A 3UVFA 1MOWA 2I3QA 1P8KZ 3MIPA 4UT0A 4AAGA 5E5OA 3MXAA 1N3FA 4UNBA 4EFJA 1R7MA 2FLDA 2VS7A 2VBJB 5AK9A 1VDEA 5AKNA 3E54A 3MISA 1BP7A 3MXBA 4AABA 5A0WA 2VBOB 5AKFA 2VS8A 1G9ZA 3OOLA
chains in the Genus database with same CATH topology
5AKMA 4Z20A 4UN7A 4AADA 3KO2A 5A77A 1T9JA 2AB5A 4UN8A 5A0MA 1UM2A 1LWTA 4D6OA 3HYJA 2VBNB 3MX9A 4UN7G 1JVAA 2I3PA 3OORA 4UN8G 2VBJA 3EH8A 2VBLA 2DCHX 3MXBB 3HYIA 2VBOA 2XE0B 2CW7A 4YISA 3QQYA 5E5SA 4LOXA 5E63A 5A74A 1DQ3A 1U0CA 3R7PA 1M5XA 3C0WA 4AAFA 1DFAA 4AQUA 5A72A 4UN9A 2EX5A 4D6NA 3FD2A 2VBNA 5E67A 4AAEA 3C0XA 4Z1ZA 1U0DA 4UNCA 4YITA 4UN9G 4Z1XA 4AQXA 2CW8A 2VBLB 4LQ0A 2QOJZ 4YHXA 1EF0A 1T9IA 1G9YA 2O7MA 5A78A 4UNAA 1AF5A 2XE0A 5A0MB 1N3EA 1LWSA 1B24A 3UVFA 1MOWA 2I3QA 1P8KZ 3MIPA 4UT0A 4AAGA 5E5OA 3MXAA 1N3FA 4UNBA 4EFJA 1R7MA 2FLDA 2VS7A 2VBJB 5AK9A 1VDEA 5AKNA 3E54A 3MISA 1BP7A 3MXBA 4AABA 5A0WA 2VBOB 5AKFA 2VS8A 1G9ZA 3OOLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AKM A;  4Z20 A;  4UN7 A;  4AAD A;  3KO2 A;  5A77 A;  1T9J A;  2AB5 A;  4UN8 A;  5A0M A;  1UM2 A;  1LWT A;  4D6O A;  3HYJ A;  2VBN B;  3MX9 A;  4UN7 G;  1JVA A;  2I3P A;  3OOR A;  4UN8 G;  2VBJ A;  3EH8 A;  2VBL A;  2DCH X;  3MXB B;  3HYI A;  2VBO A;  2XE0 B;  2CW7 A;  4YIS A;  3QQY A;  5E5S A;  4LOX A;  5E63 A;  5A74 A;  1DQ3 A;  1U0C A;  3R7P A;  1M5X A;  3C0W A;  4AAF A;  1DFA A;  4AQU A;  5A72 A;  4UN9 A;  2EX5 A;  4D6N A;  3FD2 A;  2VBN A;  5E67 A;  4AAE A;  3C0X A;  4Z1Z A;  1U0D A;  4UNC A;  4YIT A;  4UN9 G;  4Z1X A;  4AQX A;  2CW8 A;  2VBL B;  4LQ0 A;  2QOJ Z;  4YHX A;  1EF0 A;  1T9I A;  1G9Y A;  2O7M A;  5A78 A;  4UNA A;  1AF5 A;  2XE0 A;  5A0M B;  1N3E A;  1LWS A;  1B24 A;  3UVF A;  1MOW A;  2I3Q A;  1P8K Z;  3MIP A;  4UT0 A;  4AAG A;  5E5O A;  3MXA A;  1N3F A;  4UNB A;  4EFJ A;  1R7M A;  2FLD A;  2VS7 A;  2VBJ B;  5AK9 A;  1VDE A;  5AKN A;  3E54 A;  3MIS A;  1BP7 A;  3MXB A;  4AAB A;  5A0W A;  2VBO B;  5AKF A;  2VS8 A;  1G9Z A;  3OOL A; 
#chains in the Genus database with same CATH topology
 5AKM A;  4Z20 A;  4UN7 A;  4AAD A;  3KO2 A;  5A77 A;  1T9J A;  2AB5 A;  4UN8 A;  5A0M A;  1UM2 A;  1LWT A;  4D6O A;  3HYJ A;  2VBN B;  3MX9 A;  4UN7 G;  1JVA A;  2I3P A;  3OOR A;  4UN8 G;  2VBJ A;  3EH8 A;  2VBL A;  2DCH X;  3MXB B;  3HYI A;  2VBO A;  2XE0 B;  2CW7 A;  4YIS A;  3QQY A;  5E5S A;  4LOX A;  5E63 A;  5A74 A;  1DQ3 A;  1U0C A;  3R7P A;  1M5X A;  3C0W A;  4AAF A;  1DFA A;  2F4L A;  4AQU A;  4UN9 A;  5A72 A;  2EX5 A;  4D6N A;  3FD2 A;  2VBN A;  5E67 A;  4AAE A;  3C0X A;  4Z1Z A;  1U0D A;  4UNC A;  4YIT A;  4UN9 G;  4Z1X A;  4AQX A;  2CW8 A;  2VBL B;  4LQ0 A;  2QOJ Z;  4YHX A;  1EF0 A;  1T9I A;  1G9Y A;  2O7M A;  5A78 A;  4UNA A;  1AF5 A;  2XE0 A;  4KZS A;  5A0M B;  1N3E A;  1LWS A;  1B24 A;  3UVF A;  1MOW A;  2I3Q A;  1P8K Z;  3MIP A;  4UT0 A;  4AAG A;  5E5O A;  3MXA A;  1N3F A;  4UNB A;  4EFJ A;  1R7M A;  2FLD A;  2VS7 A;  2VBJ B;  5AK9 A;  1VDE A;  5AKN A;  3E54 A;  3MIS A;  1BP7 A;  3MXB A;  4AAB A;  5A0W A;  2VBO B;  5AKF A;  2VS8 A;  1G9Z A;  3OOL A; 
#chains in the Genus database with same CATH homology
 5AKM A;  4Z20 A;  4UN7 A;  4AAD A;  3KO2 A;  5A77 A;  1T9J A;  2AB5 A;  4UN8 A;  5A0M A;  1UM2 A;  1LWT A;  4D6O A;  3HYJ A;  2VBN B;  3MX9 A;  4UN7 G;  1JVA A;  2I3P A;  3OOR A;  4UN8 G;  2VBJ A;  3EH8 A;  2VBL A;  2DCH X;  3MXB B;  3HYI A;  2VBO A;  2XE0 B;  2CW7 A;  4YIS A;  3QQY A;  5E5S A;  4LOX A;  5E63 A;  5A74 A;  1DQ3 A;  1U0C A;  3R7P A;  1M5X A;  3C0W A;  4AAF A;  1DFA A;  4AQU A;  5A72 A;  4UN9 A;  2EX5 A;  4D6N A;  3FD2 A;  2VBN A;  5E67 A;  4AAE A;  3C0X A;  4Z1Z A;  1U0D A;  4UNC A;  4YIT A;  4UN9 G;  4Z1X A;  4AQX A;  2CW8 A;  2VBL B;  4LQ0 A;  2QOJ Z;  4YHX A;  1EF0 A;  1T9I A;  1G9Y A;  2O7M A;  5A78 A;  4UNA A;  1AF5 A;  2XE0 A;  5A0M B;  1N3E A;  1LWS A;  1B24 A;  3UVF A;  1MOW A;  2I3Q A;  1P8K Z;  3MIP A;  4UT0 A;  4AAG A;  5E5O A;  3MXA A;  1N3F A;  4UNB A;  4EFJ A;  1R7M A;  2FLD A;  2VS7 A;  2VBJ B;  5AK9 A;  1VDE A;  5AKN A;  3E54 A;  3MIS A;  1BP7 A;  3MXB A;  4AAB A;  5A0W A;  2VBO B;  5AKF A;  2VS8 A;  1G9Z A;  3OOL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...