4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
b'HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
3ZO9A 4D71A 3WUEA 5A6BD 3I3DA 2WM0A 4A4AA 4OOZA 1Q2UA 4ACZA 5GPRA 1FP9A 1EO5A 3EZGA 4WK9A 3VPLA 1WL8A 1DWGM 3UGJA 3VD3A 2BVDA 2DGAA 4MNKA 1OX6A 1XH0A 1H0GA 1PV2A 3RMEA 3EMZA 4A3YA 1TR1A 3KE0A 2QV4A 4JKLA 2WAGA 2UY3A 4FNSA 4FMVA 5M3WA 1UD3A 2JFEX 1CGTA 2VRKA 2E9MA 3ZIZA 2CESA 5AYIA 1JDCA 4FNQA 4BA0A 1GORA 2WVTA 3EYPA 3GXPA 3VMNA 1H11A 1NWUA 3WFZA 2EXOA 1BGAA 4XLLA 3HN3A 3MSDA 2ABWA 5BV2P 1E0WA 2D2OA 1UG6A 2EQDA 1H3GA 2XVPA 4P35A 1E6ZA 2FGLA 2PBOA 2OSWA 4ENRA 2Y8KA 1NWRA 1A3HA 1OD0A 1UUQA 4CU7A 1E5JA 1QWUA 4UQ9A 3P9SA 3IGUA 3VIGA 3VVGA 4AC1X 3AZSA 4JZ5A 3L4XA 4OJYA 3WH9A 3T2QA 1ESWA 2GVYA 2VR5A 1OWQA 1G01A 3TA9A 3D4YA 3LXAA 1BFNA 5IXEA 1TMQA 2Y5EA 1FFQA 3CPUA 2GHRA 1P5FA 1H4PA 3VSTA 1KXJA 2XVKA 1UZ1A 4XZWA 3WFLA 1SOAA 1E0VA 1CTNA 3EJSA 1GUVA 1QWNA 1MW3A 3AS3A 2J7DA 4IUGA 4LX4A 1J01A 4FLQA 2VRJA 4CVWA 3AICA 5A2BA 4UOZA 1HKIA 5CPTA 4MB4A 4LXFA 4BQ5A 1TE1A 1E40A 5IFPA 3W53A 2QHAA 4MDPA 2UY5A 2WZIA 3M46A 4ENVA 3WF0A 3B8SA 1MWOA 3N11A 1H1NA 4DM2A 3BAWA 4Z2LA 3VGBA 2JALA 1Z32X 3CUFA 4NF7A 3HG5A 3HG2A 3UCQA 3W82A 4GI6A 1HTYA 4S0ZA 3HZ3A 1H49A 2EPNA 1E6XM 2W92A 1GOWA 1QX1A 4L78A 2VQUA 2V38A 1ONSA 2BV9A 4JFWA 1W1YA 2VKTA 2NSXA 1DWAM 1NQ6A 3P9QA 3EDEA 4WJXA 1W9DM 3AOFA 1G94A 4HA4A 1R86A 1HNYA 3AS2A 5HOSA 3EDKA 2DT0A 3A4WA 4W93A 1E73M 5A69A 4B3KA 2ZUTA 2X2YA 3ZSTA 1Y7VA 4OOUA 4AZBA 3BVUA 3VINA 2XPKA 3FIJA 1ZBCA 3BLBA 1LJYA 4D6GA 3RIKA 4FLOA 1RD6A 4MJ2A 1CXIA 1JFHA 1X6LA 3QHOA 3S5YA 1NWSA 4B40A 2XSBA 2EBNA 1HVXA 1C90A 3SCOA 3B9AA 4BQ2A 1CXKA 4NRRA 4CD6A 4AWEA 1WCGA 4UFKA 1NP0A 1TQTA 2F7RA 3BUQA 3U5UA 4P8WA 1M7XA 2PWGA 1E5NA 3WD2A 1UR9A 3BVWA 3CZNA 3AS0A 1ZBVA 1W9BM 2ZXQA 4U3CA 1UR2A 1WP6A 4PBGA 2VTFA 1E4LA 4B2YA 2J79A 2YDRA 2YKKA 5FKYA 4GPNA 4BZYA 1J0YA 4DUWA 3AZTA 3A5VA 1UH4A 1W3HA 1IZYA 2EABA 5CPSA 5AC4A 4JCMA 4W8AA 3NCOA 4JQSA 4PMVA 2AD5A 4J3TA 5D9OA 1LQ0A 4PMUA 2W5FA 1VEOA 1VFMA 1P6WA 3W24A 5CGMA 1JAKA 3PBGA 2XFYA 1IZZA 3EWNA 3PZNA 3A24A 1KXQA 1KEEB 3AI0A 1HJWA 3PQ5A 2XFFA 3TTWA 2DT1A 3W6LA 3MS8A 4XUYA 1EXPA 3ZJ7A 3K8KA 2F7QA 2PB1A 2VL4A 3WH8A 3AFBA 1ISVA 2XSAA 3L4ZA 3TTVA 4MAZA 4DO4A 1ZJAA 3A3HA 1VBUA 4RE2A 3EDJA 2XGBA 2OWWA 2WVVB 2UY4A 3UESA 3PZMA 1IPHA 3T08A 4IISA 3ER6A 1L0PA 3IAPA 4RKWA 4N0RA 1GOIA 2UY2A 1EHNA 3A22A 3WUFA 3S2CA 3WDQA 3HMCA 2WC3A 2Z1KA 5FL1A 1QHOA 1MW1A 3WEOA 1E1FA 2OWXA 4K68A 1VCOA 2O9TA 4J7RA 1XH2A 4BCEA 1GHRA 3RM4A 4GQQA 2XGIA 1CBGA 2WMHA 1LLOA 5A2AA 2VXOA 2OYKA 3VX0A 4GUDA 1S46A 3RJXA 2AMGA 4PSRA 3ALFA 3SCTA 1SMAA 1P81A 1OT2A 3M7SA 2GJXA 1WPCA 3PZQA 1KB3A 1PEZA 3VGHA 3MI6A 2R1TA 3AQUA 1LG1A 4MAVA 5A8QA 3VIPA 1EHAA 3JUGA 2A3CA 3ZR6A 4K2HA 1MYRA 4LGXA 1U2YA 3MGKA 2VUYA 3BVTA 4MJ4A 2ZX7A 5K4AA 1IV8A 3L2LA 4MB1A 4W85A 1GGJA 3N15A 1GOQA 3N9KA 1NARA 2XFRA 4B7AA 3FAWA 4LYRA 1MXDA 1JDBC 4LQ1A 3GXIA 1V0MA 5CJ5A 3N1AA 2D7JA 4AYGA 2RGLA 2CITA 2V5CA 1MQRA 2J47A 3NUKA 1C3OB 1V3JA 4PUEA 1QW8A 2BY2A 1M01A 1UKQA 5I78A 1JXJA 5GQBA 3AHVA 2YJQA 2D0FA 5E6ZA 5DO8A 4L8YA 3ZSSA 2EPKX 2TAAA 1CGUA 1EOMA 3I3BA 2J62A 3U7BA 2GK1A 1SYTA 4DO5A 1AMYA 3OGRA 2FH8A 1FHDA 1XGZA 1ZB5A 2E9LA 4LYQA 5FIPA 4JFTA 1MFVA 1B9ZA 4R7GA 1U30A 4HMDA 1GHSA 3UOWA 2J4GA 1KGWA 4GXPA 5CSUA 1CGVA 1M6VB 4I46A 4OBSA 1V3LA 4PXYA 1DWIM 3TOPA 4CCDA 5CXPA 3EDDA 2WZHA 2V3FA 3CZAA 2HISA 9CGTA 2WHMA 5SY4A 3FHAA 5A6LA 3M3PA 1LWHA 5BRPA 3HU7A 3MO4A 4Z2HA 1OINA 3ARSA 2W66A 2ZUSA 3AMGA 1OI4A 3DX2A 5ECUA 2V3GA 3WD0A 3W26A 3OGVA 1BYAA 3VIKA 3AYSA 1JZ4A 5BRQA 4Y1RB 2DIJA 2YL6A 3WNMA 1KQZA 5DT5A 2FGZA 1HL9A 2XM2A 1TCMA 5JUVA 2IXUA 3NSMA 3AMCA 1JDAA 2BY0A 1OGGA 1UKSA 3FAXA 4P34A 4PCTA 3CHEA 3B9EA 1D3CA 1PAMA 1GGEA 4ENTA 1OGSA 3LPOA 4RKYA 2JF6A 1Q6EA 3THCA 3ZJ6A 5CLWA 1GQLA 3VNYA 3SEPA 3OLDA 3ARRA 5AY7A 5HPCA 2OSXA 3WEZA 1GQKA 1N82A 3OG2A 1V6XA 3NVAA 3QHNA 1C8QA 3DHUA 2ZXBA 1PIFA 5M5DA 1B30A 2VRQA 3WDIA 4KGLA 1E3ZA 3BAJA 3DYPA 2ZUNA 2J25A 2WW5A 4HZ8A 1CEOA 4M8UA 3AIRA 3KL3A 1H41A 4U3AA 2X05A 2H2WA 1W2PA 3BHNA 1CNVA 3K46A 1NWTA 3AMLA 2IGTA 3MV01 2CBIA 3AIBA 1BVNP 3BAKA 3UR8A 1UWTA 5CG0A 1NM9A 2VT0A 1E6PA 2EPOA 4U5KA 1TFVA 2YFNA 4QP0A 5FD0A 3KLKA 1HX0A 2YA2A 5A8MA 4IM4A 3ZJ5A 5LIRA 2X2JA 1JVNA 1VF8A 4EKJA 1BHGA 2WLYA 1PX3A 4P7RA 4AZ5A 1QNSA 2GJPA 4Z2JA 2XWEA 1H5VA 2WPGA 1E6QM 2ZX8A 1K9EA 1TA3A 2DSVA 3WNOA 3DX4A 1O7AA 3EJRA 4H8VA 4E8DA 2C8NA 4DWSB 3D3AA 2CKSA 4ENSA 4XB3A 4JFVA 1HJUA 2CERA 1G5AA 3UJNA 3MUZ1 1YHTA 4D6JA 1JL8A 1HWWA 1J11A 1LF1A 4TTUA 2A9VA 2CXGA 3EJQA 4BQ4A 5JZMA 1MW2A 4W86A 3N04A 3KWXA 1ZBWA 3ZT5A 1JF6A 1H0IA 4OZOA 2J7GA 3BLKA 3F5LA 2D24A 5JZOA 4AD1A 2EO7A 2GDUA 3J7HA 2GJRA 1GPMA 4H2CA 1B3ZA 1UD8A 3FW6A 1V02E 3CHCA 1WDSA 5ABFB 5D4YA 2C7FA 2WBGA 3IANA 1T0BA 1PDWA 1J0JA 3E1F1 3WQWA 3AIUA 1UKTA 2O9RA 2XJ7A 3AHYA 1WZLA 2VO5A 1U33A 1V0NA 4GQRA 4E2OA 2CEQA 4PMYA 4A3HA 3M6DA 4ZDKA 3QOKA 4FLRA 2VQTA 2NT0A 3TTTA 3WENA 4GINA 1A9XB 2F61A 2YDSA 3PTQA 3W37A 3AMKA 5A2CA 3WQVA 5A6SA 4M80A 4U33A 1H09A 2DSWA 2ISSD 3CH9A 3BVXA 2D1ZA 2C0HA 2XF2A 2G8ZA 1EDTA 1W9XA 2ZX9A 1CPUA 1E6SM 4URIA 1J9YA 2WVSA 1UR4A 1VFFA 3WY4A 1J0ZA 2Y24A 3TQIA 3GXFA 1UD2A 5I3DA 2BVYA 5I2UA 1K9DA 3K4DA 1OY1A 2BHUA 3SF8B 3MUIA 1OX4A 4W8BA 1FFRA 3GXDA 1JYVA 1P7ZA 2WSKA 4PSPA 4MNLA 1QVWA 4ENPA 4HA1A 1E0XA 1DP0A 1R85A 5CPQA 4D6HA 3OZPA 1B0IA 4AZCA 2WKLA 4WXYB 4CU8A 4PTVA 1CECA 4FNPA 4HZ6A 3VD7A 4QFUA 3WSUA 3SCPA 3VIFA 3VIMA 3KEHA 1E55A 4AMCA 4DWSC 5FL0A 3W27A 4W5UA 6CGTA 1JI2A 4HU0A 1V3MA 5CQ1A 2NV2B 3HJEA 2CHNA 4RE3A 1WZMA 2WYSA 3BUBA 3SUSA 1VRXA 2FHCA 3ZR5A 5DF0A 1XSKA 3UG5A 1GOKA 3CZSA 7A3HA 2YLAA 2EAEA 1FA2A 1ZS2A 2YL5A 4FF5A 5DMYA 1E72M 3AXXA 1HJSA 5LYRA 4CD8A 1ISYA 3POHA 3BWEA 4H41A 4J3SA 2W62A 3CUIA 1VENA 2YWJA 4C7GA 2YWDA 3RM8A 1W1TA 1NH6A 3L4WA 3LPFA 3WL0A 4CGTA 4YHEA 1YQ2A 2G3JA 1R34A 4MPKA 1UOKA 3GM8A 4J3UA 5LA1A 2XWDA 3NOVA 1UCFA 4WINA 1BXRB 4WKFA 4CVUA 3K1DA 1FH7A 2YA1A 1C7TA 3CV5A 4D1YA 4QCEA 1C7SA 4NZCA 4PUDA 4PMDA 4MNMA 3UR7A 1OGBA 3L4VA 4C7FA 3WF3A 4AUEA 4UOJA 4P2GA 3O9NA 1QW9A 3VD4A 2YWBA 5BXSA 1QNOA 1FY2A 4H8HA 5I79A 2RK4A 3BCFA 3CTTA 2DSZA 2PF0A 4ZFMA 4CCEA 3CY6A 4FLSA 2YL9A 3N13A 1NOFA 1AQHA 1JXKA 3T2PA 2F2HA 4UQBA 1ITCA 1R7OA 1TVPA 3QOMA 1GZJA 2VZTA 3D52A 4UOQA 4J27A 4MB5A 2YWCA 3ALGA 3L4YA 4Q7NA 2UWFA 2YBUA 4GZJA 1OCQA 3TTQA 1S1MA 2CETA 4AD5A 2D22A 1QI3A 1C93A 3GH5A 4PMOA 4HTYA 3AHXA 4MDOA 2NW0A 4MNJA 2F8QA 4NXKA 1FH8A 1TVNA 2BY3A 2JIEA 1GPFA 2WMGA 3AS1A 3AYRA 3CUJA 5ABGA 2FHBA 5CSYA 3VDBA 1EA9C 1NOWA 4JFUA 3DC0A 3WY1A 4CD7A 1SFSA 4PN2A 1KWGA 1C92A 3SF8A 4P8VA 4ZGGA 4HA3A 2WVUA 4AD3A 3MMDA 2D0HA 3WY3A 1QOXA 4TOQA 3WUGA 4HPGA 3WDPP 1KBKA 1JIBA 2WMIB 4U31A 4EK7A 2QF8A 1SMDA 1QPKA 1CS0B 5IHRA 3H54A 4KRUA 4HU8A 3BAIA 2ZWYA 1CXFA 3CHFA 3ZR4B 1FP8A 4CN1A 2BXZA 4MADA 5DEZA 3LRMA 1OSEA 5FCZA 2J74A 2W61A 5E0CA 2IUFA 1AQMA 1VFUA 3ZMRA 1CGXA 4JHOA 2GSJA 2VMFA 1GJUA 3WQ6A 3NONA 5M03A 4Q22A 1QBAA 2E40A 2E9BA 1W32A 4B3LA 3N7TA 4R5EA 1IT0A 3ARQA 2HVMA 3AXIA 1OIMA 4AUMA 1QVVA 1M04A 4ZE4A 1FYEA 3VD5A 1C30B 1VJZA 1QWSA 2QMKA 1GJWA 5A8PA 4CU6A 3D54D 3AIQA 1E6RA 1UZ4A 2AOSA 3GNPA 3CZLA 1HVQA 1B3VA 3IAQA 3NOQA 4WSJA 1QDLB 3OLEA 3AHZA 1UH2A 3BMVA 1V6WA 1OB0A 2WCAA 5KZ6A 4PEEA 3F5DA 2VZOA 4F79A 3EFEA 1R9GA 4JL2A 4D6EA 3CMGA 5SYAA 3PQ7A 1HT6A 2MANA 4R27A 2WKGA 5IFTA 1KXHA 3A21A 1Q4NX 1G9HA 3T0BA 2OSYA 1ISWA 5DT7A 5BWFA 2E4TA 3OLGA 3WQ5A 2G3MA 3RPMA 3TTYA 3GH7A 4RE4A 2YOCA 6TAAA 3BAYA 1IZKA 5HNNA 3SCWA 3CHDA 2VNCA 3BVVA 5I6SA 3SCRA 4OGFA 2EACA 4MTCA 2W91A 2BS9A 3CZKA 1F4AA 1EDGA 4JKKA 4CN6A 2J7FA 4E5VA 2VVNA 3D4ZA 3F5JA 4PTXA 1UQYA 2B31A 1TQWA 1XYZA 1P80A 3MU7A 2XHYA 2D3LA 1EH9A 3RILA 3WNNA 1K9VF 5JBFA 5FOOA 4U5IA 2EPMX 3H53A 4CUCA 3WH5A 3AROA 4M56A 4CKQA 4UZSA 3T0AA 1K9FA 4HMCA 2VX6A 2E0PA 4ATLA 4UFJA 3CMJA 6A3HA 2XN1A 2G41A 1ODZA 2Y4SA 4PMQA 2VZUA 3WD3A 2VPIA 2CBJA 3NORA 1HKMA 1N57A 1GCYA 4W7UA 5SY9A 4AZHA 3WH7A 3LRKA 1QVZA 3ARTA 4OKDA 2FE0A 1HF6A 4AMWA 3WEMA 4PTMA 4J3XA 1Q6GA 4IPNB 1JZ5A 2ZE0A 2QPUA 3SUTA 2DSUA 4PRWA 3VMPA 2VC9A 5BXPA 3PQ2A 3VSUA 3L18A 3AMDA 3GRAA 2WSPA 2F7OA 4ACYA 3CO4A 1E56A 1EO7A 3WMCA 1LL7A 3CUHA 3MANA 3WBAA 1JAEA 4B5KA 4NXSA 4YPJA 3MSGA 3CYFA 4OUEA 4AD0A 4EAMA 3KKLA 1GVYA 3FXYA 2JF7A 5GNYA 4P7LA 2ZUMA 3VU2A 3KL0A 4UR9A 5D9PA 2A3BA 3UEQA 1I7SB 2O92A 2VCBA 1E70M 1ZU8A 3MIIA 3LPPA 5HBFA 1B3WA 2IUZA 1R87A 5E6YA 2EEXA 3NDYA 1V3KA 1JZ7A 1FOBA 2CCRA 4F9DA 2J7HA 1GPWB 1GQJA 2FDMA 3PZUA 3W28A 4D6DA 1H2JA 1BG4A 1J0IA 4AZIA 1G2IA 4QYXA 2VOTA 5E9AA 4UFMA 4F66A 1BYCA 2V5DA 1K9TA 5HPOA 2ZXDA 4IPLA 1US2A 1CXLA 3VILA 4OIFA 3GXTA 3GNRA 1PX4A 1B90A 3EJ6A 3WBEA 3SCSA 4HMEA 1V3IA 1DWHM 3K8MA 1CENA 3A4AA 4TVDA 2WVVA 4V28A 2WBKA 4CD5A 4P7QA 3ZM8A 2DT3A 4KMQA 3PQ8A 1E4MM 1W9UA 4J28A 2CHOA 3POCA 5EBAA 5GNXA 1BVZA 1UR8A 2VZVA 1F4HA 1AVAA 1BPLB 3R75A 1WDPA 3PQ6A 3CZEA 3UERA 3WF2A 5TD4A 4AJ9A 2V3DA 4OBRA 2VDJA 3B9DA 1UA3A 4LYPA 3CZ8A 3A47A 2J78A 5BCAA 3GYCA 4AY1A 1HXJA 2ZUWA 4MTVA 1GQIA 3ZQ9A 4GE0A 4ACZB 2JEQA 2WLZA 4QLKA 1J10A 1D7FA 4YN5A 3LRLA 2VCCA 4ZDJA 1JF5A 3OIHA 4CCCA 1GGFA 4L95C 3UK7A 1JZ8A 3LX9A 4X0VA 4V2XA 4AW7A 1KGXA 4AIOA 1WAWA 3BSGA 1RH9A 3B3AA 4UZUA 2J7EA 4HZ7A 4YHGA 1UHVA 2WMJA 4D6IA 4GE3A 4TX8A 3IJ7A 1UR1A 4X9YA 2FYVA 2YA0A 2D20A 4DO6A 3EBVA 3PZIA 4E08A 5ABEA 5HXMA 1UD4A 1I75A 1E9LA 3F71A 3SUVA 2BHZA 1PS3A 3UG4A 3LXCA 1ZBKA 4TUFA 2ZICA 2WCGA 3EDFA 4MGHA 3CZGA 2OWCA 1ITXA 2R1UA 2DIEA 5D9NA 1TQUA 3CGTA 3MMUA 1CXHA 5JBEA 2FHFA 4QLJA 5IHSA 3OZOA 1Q6FA 1W1PA 3I3EA 3PQ4A 1HKKA 3VX1A 4AD2A 2VJXA 2WHKA 1UD5A 1JYNA 1WZKA 3GBEA 3THDA 2EADA 1PJ9A 3VGDA 5A8NA 1CWYA 4AULA 4NZFA 3VD9A 1OT1A 4ATDA 3BUDA 1NP2A 1M03A 3HG3A 3MV11 3VGGA 3KL5A 4GI8A 3DECA 2CIPA 4U2YA 3WD4A 3DX1A 4Z2KA 2ALWA 1W91A 3VGEA 3WN6A 1BYBA 1XC6A 5I5RA 1E3XA 4Y1RA 2WZEA 4NSBA 1ZL1A 1HL8A 2WMFA 4L4PA 4AMXA 1KGUA 2BVTA 4WIWA 1KA9H 2OW6A 5BXTA 1J12A 1WB0A 2VX7A 2XTKA 3WNLA 5JBDA 4D6FA 1RPKA 1MFUA 2F1BA 4WSKA 1KTBA 3DX3A 3SIMA 5C8BB 4W84A 4Y7EA 4GZIA 1SZNA 1OIFA 1UWQA 3AIVA 4BFLA 2WJZB 2OYMA 2ZIDA 1SR0A 1HJVA 2XM1A 2A3EA 4M24A 3EN0A 1M53A 1KXVA 2GFTA 2VI0A 2WXDM 4I2NA 1U9CA 1T36B 3G6MA 1RP9A 4F8XA 3BCDA 3GXNA 1VEMA 1XYFA 1R46A 2YFOA 4JIEA 3ARPA 4D6CA 2RK6A 4ENWA 1KR0A 1T0OA 1TQSA 4TXEA 1WDQA 3CNEA 3RJYA 1JZ3A 5M17A 4UCFA 3WIJA 1QI2A 3VO0A 1KBBA 2VCAA 2YLLA 3WF1A 3IJ8A 2IXVA 4QYTA 5C71A 3GTNA 3T2OA 3WKZA 1IZJA 3ECQA 3KLLA 3WD1A 2CPUA 4S3KA 2PWFA 2A3AA 4MNTA 1MXGA 5I23A 3G6LA 3DDGA 3ZJKA 2JEPA 4DWSA 5I24A 1OX5A 3TP4A 1JD7A 4B9ZA 1XV8A 3RHTA 4L8WB 1V6UA 5BROA 3AHTA 3OA5A 4ENQA 2PWDA 1QI5A 1BTCA 4OGZA 3CBWA 4DM1A 1QNPA 3SCNA 2FEXA 4JFSA 4W7WA 2NT1A 4GI9A 1CXEA 3EJUA 1HN1A 2ZUVA 4WF7A 1JDDA 3EMCA 1UKOA 3NSXA 1XRVA 3VM5A 2ZX5A 4AIEA 5CZKA 3CLWA 1KTCA 1OD8A 4Y1FA 2D73A 4HCJA 4P8UA 3NIYA 2V4UA 4P7OA 3L7NA 1PBGA 3L3BA 1JZ2A 4AEEA 3BC9A 3ZJ4A 3GNOA 1HP4A 5ABFA 1GOOA 3BGAA 3NSNA 1VEPA 2Z1SA 1V6VA 1SY7A 2W63A 5BYWA 4Y1EA 3AIEA 3DYMA 5LA0A 4ENUA 1G1YA 2G4FA 1DWJM 1HXKA 2BFGA 1W3JA 2XN2A 2WCSA 1J42A 4NX0A 1WE5A 3L2MA 4UQEA 2VURA 3LPGA 1W3LA 4XZBA 5D8WA 3L4EA 1VFOA 2WB5A 1L8NA 2BNJA 1A47A 4L7QA 2WNWA 1QNRA 4D72A 3PZVA 3AISA 1TG7A 4UFLA 1MQPA 2W67A 3WMBA 4BTEA 1W9VA 3KZSA 3VTRA 2DH3A 3SCVA 1UYQA 3PZOA 1UH3A 1CLVA 2NV0A 2J7BA 5C70A 3VKKA 4W88A 5A6MA 3APGA 5A3HA 4ZDIA 2WHLA 1GVIA 2XIBA 3AZRA 3ZT7A 1CYGA 1GG9A 1PZ3A 1BSIA 5EMYA 2PI6A 4OGGA 3B36A 1MVYA 2E8YA 2VR4A 3BAXA 1JD9A 4U2ZA 3VDAA 3A6OA 1XSIA 3BSHA 1I7QB 1QI4A 4HOXA 1E4IA 2Y2WA 3O6AA 4TVCA 2J77A 3N17A 2GK3A 2VVSA 1LWJA 4S3JA 1B31A 3UMMA 1CZ1A 3SUUA 1KR1A 3RO8A 1HKJA 5E70A 1MW0A 4JCLA 3FHQA 3K4AA 5CLTA 1PX8A 1Q7RA 3WUBA 1ISXA 3RM9A 2D3NA 4L4OA 3U7VA 3L4TA 3II1A 2WWDA 3IJ9A 4H8UA 3N12A 2GUYA 2OYLA 1T3TA 3AIWA 2GJXB 3R74A 2QPSA 4UQAA 4AEFA 4M82A 2R1TB 5CGTA 2PBGA 4PTWA 4DUXA 4AZ6A 3T0DA 1PIGA 3VM7A 4UFHA 3EJTA 4KRTA 3ARZA 2WHJA 4M81A 4J3VA 2F7PA 3VMOA 4ZXOA 1KCKA 3BMWA 4N42A 1VHQA 1K6AA 3PZTA 5BXRA 5A8OA 3WDRA 3S6TA 2O9PA 4RL3A 2WK2A 1DTUA 1J18A 4HOWA 4QCFA 2QLYA 4TVUA 4TTGA 3P9RA 1W9PA 4M29A 5SY6A 5JIWA 1JNEA 1V0KA 4Z2IA 4GKLA 2O9OA 2J8GA 2XVNA 8CGTA 1E15A 2GK1B 5A1AA 1TQVA 4P36A 2W4XA 5GNZA 5IDIA 5A6KA 5F7UA 1XSJA 5A6JA 4AXNA 3LMYA 1UQZA 1UD6A 2J7CA 4PYSA 4WKHA 2X0YA 2CNCA 3W38A 2E3ZA 4FNTA 4UNIA 3WELA 1GW1A 3R76A 1NOUA 3U57A 2R1VB 2OLHA 1XD1A 3PTMA 5E1QA 1UWSA 2X2HA 3VUPA 1WDRA 4PMRA 1ECEA 5I0DA 4J3WA 2DSKA 3W0KA 1C91A 5ABHA 1JYWA 3VNZA 4KH2A 2W7TA 3WDHA 1PPIA 1BF2A 3DDFA 3FN9A 2DQXA 4UQDA 1WO2A 1LG2A 4JHZA 1UR0A 4W7VA 3EMQA 1CDGA 2BY1A 4NI3A 4BQ3A 1PDVA 3O2LA 4PMNA 2WC4A 2CYGA 1X1NA 3OB8A 4FNUA 3WNKA 1EOKA 3WDJA 1CIUA 1X6NA 2BHYA 8A3HA 3RCNA 4AIUA 3ARXA 1E4NA 2YDQA 2XIIA 4EANA 3K8LA 3P9PA 3CZ9A 3CZJA 3F4VA 2WMIA 1DEDA 4DWSD 4H7VA 2G3NA 4W8LA 5D9MA 1I1QB 3WY2A 2X2IA 1VBRA 4N0MA 2XVGA 1E6NA 4CD4A 2WC7A 4GO9A 3SCUA 1HIZA 4EE9A 5A94A 2F1AA 3TV8A 4XX6A 5E09A 2J8FA 3RDKA 1L9XA 4GZEA 3U5YA 4ZXLA 2JE8A 4P5PA 3OT1B 2VZSA 1XCWA 4E4PA 1JNDA 1BG9A 3DHPA 4B15A 3BLPX 5A6BA 2OR3A 3OBAA 4KGJA 3H55A 2ZWZA 1DWFM 1B3XA 1QF7A 2ZUUA 4WKAA 1VAHA 3BH4A 3CIVA 1TZ7A 1UKPA 2D23A 5HDRA 1OM0A 1VCNA 2DT2A 2G3IA 5A95A 3N18A 1WKYA 2DPEA 3WQ4A 1CE8B 3VIHA 3PTKA 1B3YA 2F18A 3AJ7A 4M1RA 3ARYA 3W81A 2X09A 1TA3B 3VIIA 1KFWA 2DH2A 1R33A 4DUVA 3W4RA 4PCSA 1EDQA 4QLLA 4KWUA 3W25A 1O7DC 4BF7A 3GXMA 2LXNA 2XN0A 1O6IA 2EPLX 2Y8VA 3FNDA 2ESCA 5E0FA 1BGGA 2XYLA 3FSEA 3D5HA 3A23A 2YL8A 1Q6CA 1TUXA 2ZOXA 1DHKA 2WWCA 3BUPA 3WF4A 4GIAA 2R1VA 4B31A 3A4XA 3GZAA 1GOMA 2GDVA 3PZ9A 4ZEPA 1LL4A 3SURA 1CF9A 1CLXA 4AISA 1VB9A 2QMJA 2D0GA 5EFFA 4QAWA 3WQ8A 3ZT6A 4HP5A 1VIWA 4AD4A 3AXHA 4PMXA 1VCMA 2ZX6A 3WMSA 2VRNA 1CGYA 3OGSA 3W6MA 3PZGA 3CC1A 2RK3A 1JG9A 4E8CA 4PMZA 1JYXA 1V08A 1V03A 4P7NA 2J75A 4GO8A 7CGTA 2V3EA 2WANA 4MB3A 5EFDA 1W1VA 3ZOAA 3M07A 3NYDA 2BXYA 1MQQA 3VDHA 1JI1A 4ADSG 4ZE5A 2Q8XA 4UFIA 2VX4A 1E43A 1EGZA 1OBAA 1PZ2A 4NZJA 1XD0A 1QHPA 1G0CA 5DFAA 4AZGA 1KQYA 3MUAA 5IP5A 4NRSA 1ZJBA 2CBUA 1BQCA 1C3FA 3B38A 1EQCA 3QHMA 1LL6A 5LA2A 1V02A 1B2YA 2WMKA 3EJPA 4B16A 4L8FA 1VJSA 2PWHA 1J0HA 3WNPA 3PN8A 4C7DA 4WLCA 2YBTA 2AB0A 1GONA 1C8YA 2RGMA 2X1IA 1EIBA 1OX4B 4Y1GA 2ZXAA 3T09A 1GNXA 4X0NA 3TTXA 3D50A 1HJXA 3F5KA 2E8ZA 3OT1A 1I1XA 4CN4A 4UQCA 4W87A 2X8RA 3QR3A 1W3KA 4AYSA 3VGFA 3MMWA 3ZJ8A 3VIJA 5EB8A 4AZCB 1V3HA 3VDCA 1RP8A 3W29A 4F9JA 4I4NA 4P8XA 1PE0A 1EQPA 1UWUA 1HP5A 3UETA 3MKKA 3PHAA 1QVBA 1KCLA 1KWKA 1XHGA 1W2VA 1UWRA 1JZ6A 4LRUA 3TTUA 4V27A 4Y0NA 3HG4A 2VX5A 1XH1A 4XV0A 1FH9A 4B9YA 1O1YA 1Q6DA 2A3HA 1QNQA 3LXBA 3NDZA 3ARVA 3PQ3A 1KXTA 4D1JA 5JIPA 4BIMA 2DDXA 2X0HA 3TONA 3SCQA 4JKMA 3QGVA 1E1EA 4QDMA 1QHZA 4W5ZA 4FNRA 1GGHA 3OLIA 3L4UA 1D2KA 4OFWA 3SOZA 3VU3A 3IK2A 4FK9A 1R47A 1US3A 4ATWA 1BYDA 1XCXA 1C8XA 2AAAA 5A6AA 3GH4A 1FHLA 1JFXA 3NOOA 2PC8A 2CKRA 5AC5A 1I1WA 4LPCA 5D8ZA 3VSVA 4D1IA 1BLIA 5KEZA 1B1YA 3WH6A 4UTFA 2EJ1A 1UASA 7TAAA 1ODUA 1R7AA 3ARWA 2CBVA 4N12A 3TTOA 4TX6A 3ARUA 1AQ0A 3VIOA 3S5ZA 1P7YA 3GDBA 1CGWA 3D51A 1R8LA 4HPHA 1J0KA 1UA7A 2XVLA 2DEPA 3VOCA 4OQ4A 1V6YA 3SUWA 3GBDA 2OW7A 2XUCA 1UWIA 4BS0A 1WNOA 4HOZA 4W89A 4ZENA 4LGYA 3DX0A 3BUIA 4ML4A 4H04A 1WZAA 2XG9A 5I77A 3MUY1 1HJQA 3DYOA 3NJ3A 3TTSA 2PWEA 3FY1A 4AUNA 4Z2GA 1R75A 3UG3A 5AYBA 4AZ7A 2FH6A 1QI0A 1E71M 4JL1A 1QBBA 2JIWA 1JGIA 3BXWA 3CUGA 1GGKA 1ISZA 4JAWA 3WL1A 1BAGA 1V0LA 2YIHA
chains in the Genus database with same CATH superfamily
4TN9A 3KLHC 2X1HA 3RY6A 3WA6A 4LHWA 4OQVA 1Q2UA 4M6UA 3I39X 2WLIA 5AAWC 4BF5A 5JMWA 5HFJA 2VXSH 3NDZE 1SKYB 4U1JB 1OX6A 4H9YA 2A1IA 5SX4H 3VYPA 5IUCA 2GHIA 3KD2A 4YRAA 5CJQL 5DYYA 5I3HA 3L16A 4ZGYA 1ZD8A 5EINA 3ZLUA 1CU4H 4PX3A 2BBWA 1SN0A 4YN3A 4FNSA 4ZS7L 4LC1A 5B8CA 3MJWA 2JW5A 4ADUA 1S2DA 3MRIB 1PG7H 4S1DC 4DV5B 2XZTA 4Z1MA 1I7DA 1SCKA 1XHEA 1BFTA 2AZMA 4HDOB 3AHHA 2EXOA 3OEWA 2YZGA 3MR9A 2UYCA 1YECH 2FGLA 1V5GA 2FFJA 2X8LA 4ZALA 2WHPA 4WBXC 3BJZA 5JRZA 4QI3A 4IX1A 4Q9IA 3BMOB 1EJWC 5DCEA 2X5PA 3IGFA 1GG0A 1TWZA 1O9GA 3DZHA 3TCNA 4HLZH 2ANBA 3A4JA 1UOEA 4DPBX 4LEXL 2VUUA 5D04C 2FW0A 2PBZA 3LN3A 3JWPA 4BB0A 5IT2H 1TSRA 4DC0A 1JH9A 4OGYH 4ACPA 2IBZY 5GONB 1YC5A 3W7IA 2AQ2A 2GEVA 3CPUA 4O4JB 1SQ0A 5FACA 4Z7WE 1YZGA 3G6WA 4N26A 1LRKA 3KVLA 4YL4A 4JK0D 2NSOA 1DQRA 2JLRA 4WCDA 5JSZA 4B3CA 1UT5A 1Q7TA 4HJFA 2ZE6A 3Q3HA 1P4BH 2C2GA 2FQGA 3PXDA 5DO2C 3GPSA 2QHAA 4AE0A 2OTCA 2V74B 3A4EA 2BSRA 4OLWL 4XEHA 4HOMA 3LZFH 3QI9B 4DKXA 1F48A 4LYFA 4ZSTA 4XNXH 1I9JL 5DX1A 1AHMA 4AXWA 3HS3A 5L4SA 3P3UA 4XGRA 1EB9A 2R65A 2I78A 2FGJA 3SYAA 1BIIA 3D1JA 1MG0A 3UPUA 1IEAB 4RISH 2O6DA 1MOSA 4L78A 5LU9A 2I14A 3EB2A 5K9QI 2W93A 4NMLA 1W1YA 4F72A 2PYEB 1SXBA 2IE8A 4NBLA 1MJ8L 4PTZA 1UZ6E 1W9DM 1QHSA 3EFOA 4O2AB 5BMWA 4IVPA 3GD5A 2CL6X 2DR2A 2OMUA 1JGLH 4IU2A 5CCKL 2F38A 3LC2O 3SVLA 3P4OB 3BM5A 4ZYVA 2OFFA 2VFEA 4MUIA 2FJFB 1U9IA 3ZSTA 3E9DA 3B2DC 3UL4A 3HN2A 3OURA 3DOPA 2XPKA 1W0VB 4APQD 4JYFA 5FFGA 1A6AA 4YONB 1HVXA 1U42A 1KYOJ 1T8QA 3GJRA 3PT9A 1SDAB 4BQ2A 3ATDA 2AQ8A 4AWEA 1JR1A 1NCDL 2ZJ7A 1MNSA 3JV7A 2G9VA 4DIMA 32C2A 4B3GA 4Q4IA 3QZAA 4M1CD 3OZAA 4N01A 2WAXA 4GG6E 2WSDA 1VACA 3V6OC 3MMNA 3AS0A 4C04A 1EQWA 4OM0H 1JILA 1QIGA 1PBNA 4P2RD 2B20A 4WFIA 3DR3A 5EJFA 3ZYJA 4D9IA 3K5WA 2MTAA 1P19A 3RYHB 4NQEE 4EVNA 3BPLC 1QYCA 3RGWS 1E61A 3KW7A 2BSTB 1H8HD 3AZTA 5SX5H 2QT1A 1X6UA 1R0ZA 3SDBA 1Z0SA 2CFOA 1RBMA 2VDWB 3NCJH 1QGUB 4F58H 3WTSA 1NQWA 1SUSA 4XRRA 3X14A 4J3TA 2C9XA 2FWSA 3I9NA 4M7LH 2WSYB 1ONPA 4JJ7A 2HTFA 4A21A 4X98B 1F51E 1I3GH 5DBGA 1P6FA 3TM6A 3O1NA 2QUNA 1IZZA 2ENQA 3C98A 2PUQT 1NLBH 5DNCA 3PQ5A 10MHA 1KYXA 5I8CA 3HUFA 3AEYA 5ENLA 3GAFA 2FKPA 3C8KA 2L0XA 2VUOA 1L5OA 1PAUA 2X15A 4NM4H 3TJZA 2X0DA 4WI1A 4GRMB 2B8JA 3K8KA 4HPYL 1A5BA 3CXUA 1K6IA 1ISVA 3QPBA 3V8OA 1XSEA 3TTVA 2R29H 4UEWA 2WVHA 5F1KA 1YJDC 2AN4A 2B69A 2B2XA 2Z3WA 1XX6A 4BI6A 3C2QA 3ROEA 2WJWA 5AWNH 1X7QA 2YHGA 4K68A 4J7RA 4PA8A 1XLMA 1WUZA 7XIMA 1P1KA 4KH0A 2ZIEA 3P0IA 4NILA 2X3FA 3RJXA 1DJQA 2W2TA 1EXBA 1OXMA 4M54A 3L3DA 4IFKB 1HM5A 3W84A 3IETB 4K71C 2VDNL 5G5DB 2R1TA 2I26N 4NPKA 4LEFA 5D32A 2NPIA 4KK3A 3SYMA 4E5DA 5CBBA 3EE6A 4M0CA 4K88A 4LF9B 2AC2A 4C06A 2ZRFA 4FA6A 1SDDA 2ORWA 1EZ1A 1QYDA 2JDID 1KTRL 3BVTA 1ACYH 1ZISA 4BR1A 3MGBA 5IZCC 5F4SA 3N15A 2VJDA 4IYKA 2IADB 2J13A 2JK0A 1GZ7A 2EH7L 3GD1C 3HFSA 2EH8L 1U04A 3HNVL 4CC4C 3GQBA 5LLTA 4NU7A 5IB1A 4MXVE 3RWCA 2J47A 1J8RA 4JTFA 1QANA 2QD5A 1S5MA 3OO0A 2G50A 2QUUA 3TLAA 3AHGA 1GITA 3RARA 3EVGA 3RBGA 1QCCA 1P4JA 4WZBB 2QLJA 2ARJB 1CLOL 2BB0A 2XW6A 4GGOA 1SBIA 3PGDB 3B53X 2B2NA 4HVTA 1FHDA 4OJEH 3I62A 5AM2A 3MJ8A 4E32A 1GR0A 4YHZL 1MFVA 1TKWA 3ML8A 1JIUA 4LO9A 4GWGA 2W48A 4M93B 1ZGLB 3AY4C 3ZWAA 1DWIM 4X6CB 3TOPA 3KJNA 1IX2A 1TO1E 2AJSL 1C9KA 2Q7NA 3EEGA 3N2BA 2VPPA 1U41A 3KFXA 3TG8A 3ZE2E 5J12B 1XTJA 3M3PA 1G20E 3RR1A 2F62A 2FTWA 2AABL 4XB2A 3GAZA 4HIJB 1RBAA 1IC7H 2GWGA 1J05B 3ROLA 2LGJA 5I4CA 4FZ5A 4UOW0 3F49S 1BQHG 1TKRA 5A7HA 3W26A 4PCYA 3FBWA 4PJEE 1OIVA 1C0KA 4MR7B 2NDGA 5KNBD 3I5YA 4X93A 2G1PA 1KIUB 4PP2B 1XGPB 1SWWA 1TEHA 3L5IA 5IG2A 4AZ0A 4CF4A 2Y61A 3O6LH 3CHQA 4M9PA 4D8YA 2E25A 1MX1A 3BRWD 1MN6A 2V1XA 3W5SA 4OLAA 3MLWH 2CHGA 3WN5B 2I4MA 4BQFA 1RK1A 2YWEA 4IIJB 4ENTA 3N0XA 4U10A 3FYCA 3PXBA 5JHDE 3D25B 3WFIA 1M8FA 5MENA 4HWBA 3FMFA 2MCPH 3THCA 2GRJA 3MNWB 4P38A 4MAFA 3LD8C 1E6UA 2WZ0A 2UZYB 5DJXA 3CKMA 1L6ZA 3LCJA 5GXBB 1Z6QA 4JAMA 1JHZA 4LHYA 4KR6A 4UQ3A 3I52A 2YHUA 2FF7A 2YXNA 3WDIA 2NXYC 1QAOA 2QE7D 5F73A 3AOGA 3DYPA 2YHSA 3EEBA 3PFKA 5HQ3A 4JI4B 4J4KA 3RUIA 1DVFC 2H2WA 5KDDA 2QP4A 2ODTX 4O2BB 4REMA 1PLLA 3VA6A 1WK0A 1WMDA 4BFFA 2YAMA 3QBDA 2A74A 2DEXX 5HIAA 3ULUC 5GV7A 3RUGE 4U6NA 4C0KA 1DDHA 3HMWH 1MRFH 4TTJA 1KBGL 5ECJE 3U8GA 2X2JA 2RGYA 5HKLA 4M2LA 4ZX4A 2I4LA 3E84A 5KWSA 4ZGBA 2DSVA 1NMCB 4FYSA 4E9WA 2NCMA 1BGXH 1PYMA 3ORWA 3UBPC 3KPTA 5IC5A 4ZQRA 4H8NA 4XB3A 3CWNA 2BMVA 3T5MA 4IGKA 1CY6A 5C9UA 1Z9AA 3ABOA 1XZDA 1CQYA 2I99A 4M9QA 5HMMA 4QS6A 4FA8A 1W0WA 4PZYA 4PRBB 2FB3A 4PRAB 2OECA 1ZBWA 3N0RA 5KAPA 1QLHA 1E8MA 2OCDA 4PXAA 5D2NB 1ME9A 2OKTA 3BLKA 3K5IA 3GRZA 2NWSA 4M02A 2MYNA 4FS0A 3R5XA 3QK0A 4QICA 3KPSE 4OLJA 4WWKB 5IB4A 4DBVO 1AMOA 2H9IA 3QULB 2Z2KA 3MCKA 5IVZB 4DA8A 4IDOA 4XP6L 4C0HA 4V0RA 3P2OA 3IANA 4YFVA 4JRFA 2F6KA 2DORA 2BH9A 2L7JA 5A5VA 1XEWY 1H15A 4ZYYA 4JY4A 2HQ1A 1OAXH 6AT1A 4A1RA 4HWKA 3BX7C 4KTTE 1VFLA 1NATA 2DQ4A 4GINA 3QGKC 4R6XA 3WHKA 2DLIA 4HISA 2IXDA 1WG3A 2DSWA 1GW9A 1U6IA 5C08B 2RQEA 2RHJA 4MRBA 3CQQA 3GA5A 2LIVA 1CPUA 1ED3A 5LCVH 1WYIA 5I0VA 4PLJD 4OCXH 4D3SA 1J0ZA 1GGBL 2ZWAA 1L7XA 3KHJA 5T8IA 1E2MA 2NY6B 4A2LA 2C9SA 4U3XA 1OX4A 3GXDA 4GEGA 1V05A 3LS9A 2PZMA 4WESA 4DEPB 2CV0A 2UVFA 3TN3A 3R3JA 1T6WA 5ALDA 5TFSL 2G9HA 3MZNA 3F74A 4MRAA 3RS7A 4PS1A 2IOYA 3SE9H 3WSUA 1WX0A 4TNFA 5AXAA 5IHUL 3SJ3A 1ZJJA 1TTAA 2KI6A 4GYFA 2WHQA 5FCUL 3VFVB 2WP0A 4NUPA 4XIIA 1WETA 2ZC1A 5EIIB 3DLIA 3BL5A 1XR8A 2OGUA 1NXVA 2ITDA 2G5BB 1ESOA 3ZIAA 2OKMA 5M2FX 2EVHA 4HEQA 2C97A 1JIJA 1OXUA 3DXAD 3P8IA 1SIUA 2PTWA 4MDFA 3UH0A 2R87A 3SSAA 3EO1A 4CU2A 3IUSA 4IBVA 3MYYA 2B1AL 4FYXA 3IVSA 1ZGDA 3LPFA 1N5YL 1KYFA 4ZUTB 1B4KA 2WKPA 2WLTA 5LSMA 3P77B 4UB0H 2EDWA 1IHDA 4UXIA 1CDJA 4M48L 3LTYA 3NK3A 2FZLA 2VLRE 2VC2H 1MHHA 4M6WA 1QFOA 2XLBA 1SHLA 5COBA 3UYLA 3FTZA 2HVKA 3OT5A 1OWWA 5FYKU 1X74A 4BQ9A 3BPLB 1KO8A 2GPBA 5JMTA 4G7RB 2A9RA 2EEAA 1R3LA 1S8OA 4BKOA 4BNGA 2DSZA 1JHKH 1TPH1 1UWEL 3PDOA 1TYZA 3FYTA 1E3TA 4I0KA 3DL7A 1UBNA 2OMWB 3QJTB 2QCCA 2QNIA 4HNAA 4YFLI 3MDUA 4C3VA 1W80A 2PDCA 1L9TA 2PUAA 3CBJB 5HYJD 1EJFA 3EF0A 3L4YA 2IDTA 1SFJA 1A6PA 1S1MA 2MTPA 1W4ZA 3EXSA 3GBNH 3TBKA 4W5RA 2EFYA 3A27A 1HOEA 3NHSA 5LM3A 1FH8A 3HXKA 2J5QA 1ZSVA 2G5RA 3C2AL 3FQ1A 4IV8A 5CJBA 2AZUA 3RDTA 4TX1A 4FMCB 2W9DL 3QEBZ 3AP1A 3RL2A 4DT1B 4TSFD 3ZTNH 3NIDB 4OHYA 4U2BA 4NOJA 2D2JA 1N5RA 5H8PA 3FO1A 1P3JA 5L51A 4JZJC 1J0XO 1SZFA 3KCWA 4JM2D 2CKBH 4XB8A 3LV5A 1CS0B 3FEMA 4ESVA 4KRUA 3UC2A 3RRXA 3FG9A 3ZDWA 3QJFB 3TECE 4CN1A 4PCAA 2AXHA 3P0WA 3R5FA 3X1DA 5KNDH 2WSLA 2VLIA 4XH2B 2QRQA 3OG9A 2V1UA 4KHPB 1ICPA 4XD6A 4BI7A 1VYSX 2ZJ1A 3U6RA 2ZZ7A 3W00A 1IARB 1DCFA 5AD1A 1QBAA 5I1HH 1U8LB 1GUFA 4OH2A 4ISCA 5IM7A 2E9BA 3OG3A 3VYRB 2ZATA 1IVYA 1XQXA 2ATEA 3X3HA 2EGZA 1VBMA 1R88A 4K8HA 2HD4A 3PIQA 2WHVA 1VKXB 5CM9C 3BKCH 1XU7A 3IBSA 2N0MA 4TV6A 2YWRA 5DURB 1ONWA 2CNOA 3WKML 5DZVA 2R5WA 1REIA 4K6AA 1TYDE 1RAHA 4JEUA 1RK7A 1IGCL 2HXTA 1DKQA 3EVEA 3KWMA 5EWJA 3GCGA 1V6WA 4HDRA 4NAFA 2Q8LA 2J9YA 5GIOE 2EEDA 2FJKA 5DEIA 4NKQB 3DI3B 4PI0A 1FPMA 5B7MA 3CMGA 2EG5A 5C07A 4LAMA 4ME6A 3BF7A 3MCWA 1O1HA 4MRPA 2WTNA 5T9CE 1B4DA 3U48A 1E9BA 1A0EA 3KR2A 1CZ8H 3KCQA 1ZHBA 2CHRA 3VA2C 3PDGA 4QE5A 2PV0A 3ABRB 4ZRGA 4ZBCA 4HVLA 3EGXB 3AF1A 5HJBA 5I8EA 2J5WA 3EVBA 4L4TB 2OC9A 3QDJE 3ZD9A 4ODUA 3EY4A 4OF8A 4FYHA 1AS7A 4INAA 3JVUA 1UJ3C 1T5KA 2RHMA 2EACA 5EMKA 5HNTA 4RK0A 1O1ZA 2IVZA 4E5SA 1NF9A 1EDGA 1T40A 1O6SA 2QJHA 1B0UA 1IEWA 1CUSA 1BD2A 1ACLA 1H2YA 2X9QA 3Q40A 2WY3B 3MNVA 3SBQA 1YNOA 2VQDA 3LTPA 1MI3A 5U4NA 3TU9A 3G2MA 1I8IA 4C6TA 3RILA 3WNNA 1FXPA 4ZQPA 3WIBA 1TTBA 4LGSB 4W9JC 2NZYA 5E5MA 3KYJB 1MAMH 1P2FA 3UZVA 1D5BA 1L3NA 3FOLA 4LBEA 3L6EA 3WYGA 3LD8B 4W70A 4XNMB 2AEOA 1Z38A 2D00A 4HYVA 3SQRA 1G9MC 8FABB 1S5TA 1FJGB 4ER7A 2YJLA 3LC1O 1PEKE 4KQ2A 3I9OA 2NXYB 4R7VA 2B4CH 2FP4B 1AKJA 1CL7H 4ARSA 2FJUB 1DVFB 2IAMB 3VTMA 4DN4H 2ORIA 3UTSA 3HV0A 5IWAB 4GXQA 3UBMA 4I9FA 4TKMA 5H3HA 3T1FB 3L18A 3O6FD 2ZTJA 3TIDA 2G76A 3GFTA 1TAUA 1G5GA 1OSZA 4ZNCD 1GKIA 1VG1A 4K9RA 3V7NA 4GS5A 4BTVA 1H69A 3PF2A 2GEQA 2W58A 3W78A 4I66A 3CPJB 4XMLL 5FJTA 5DYNA 1A1MA 3MSGA 2B8NA 4R9RA 3FNQA 1BW9B 2R4TA 3EODA 3TW0A 2JF7A 4CUZA 4O9HH 3DZKA 5D3QA 3IGXA 2R29A 3UJ6A 3JYBA 3SZKC 5IROA 2A73A 4L73A 4B3BA 4K15A 2BP8B 3GJFK 5BN3A 1QG4A 2BEUB 2FHSA 4Q8TA 4OK5A 4F9DA 5HJ3A 1G7IB 1BRTA 1EAPA 4KW7A 2FDMA 1H2JA 4F5YA 4KVAA 5D7JA 3EUAA 1RV8A 4QAMB 3QDGB 4ZAKD 5JXEA 4KTEL 2CVHA 2R86A 5MP6L 3RSHA 4PR0A 4YHLH 2H57A 3PY2A 2O0JA 2P69A 4MOWA 1OFAA 2XY2A 5HPOA 3CG4A 2QZZA 1JS1X 3D48R 4X4XB 5EBMA 3LY0A 1HHHA 5EUOB 2I5QA 3GNRA 3IDOA 4P57A 1Q1JH 3IVGA 3FHCB 2IG2H 1DWHM 2CXSA 1Z5YD 1IBBA 3TQTA 1EFAA 2AQHA 4Q4AA 3M4YA 3HB5X 3LTNC 3G0SA 4M51A 1ZSDA 1J5XA 2XUFA 3NACH 4R2IA 3C8NA 5JZBA 3ASOB 3DOFA 1AJ7L 5SX4I 2VN3A 3FWYA 1G21A 3LPWA 5BW4A 5ICXB 1N2OA 1SJEA 4K37A 3JWOC 3ANTA 4NP4L 3JWNC 1WHSB 4XWWA 1DSFL 4KUGA 5IF9A 4GUJA 3E5HA 1WMEA 2HKFL 3CZEA 4H2AA 1S6NA 2V3DA 3MTXA 2WXFA 3T41A 2B82A 4NYYA 1EX7A 4BP8A 1I9RL 5GVRA 1JPSL 1E9RA 2X4IA 1OAAA 4FCTA 5KSBF 2NO4A 1ZWKA 2CWNA 1P8JA 1VKRA 2OZLA 4AW9A 1JDVA 1FUIA 1YAHA 2ZJZA 2X6TA 3NJFA 2HUHA 1UP3A 4H40A 3BXXA 1KT2A 1GRNA 2V5VA 3QEQA 1DAOA 4JY5L 4MBRA 3HPSA 1T9AA 2VSXA 3PZBA 4XH9B 1T1IA 3P71T 4XVSH 4Q6IA 4JE4B 1C7ZA 4FBLA 1ZRHA 5IJ9B 4X9YA 1UR1A 3G08A 2E59A 3PWKA 5TV2A 5BYAA 2DUNA 1UMBA 2PDPA 2Z8RA 3PPYA 5HXMA 4G1CA 3X1GA 3U9PH 3LQAC 3SUVA 1UEJA 3PG2A 3K2KA 3UG4A 5LA6F 4I1NB 1N8FA 2Z1MA 1T1XB 2ZICA 3AALA 2ZJFA 4X9HA 4MGHA 3D8UA 3EX7C 1RQGA 3TKYA 4APQC 3HTWA 3RK8A 4OJNA 2WD9A 3NHYA 5A3ID 2R0KL 1FP5A 2FA9A 1A6ZB 4UV4L 4TIMA 3OZOA 1OXSC 2NTEA 4PHHA 2C8LA 1WZ1H 2CXNA 4B46A 3KBJA 3CHPA 2NMSA 1J0EA 5ELXA 4WJ8A 1G1KA 1WZKA 1KP2A 2W83A 3HC4L 5D30A 3SDAD 4GXVL 4M1CC 1XTMA 1DAIA 1NLDH 1L9WA 2G5GX 3VHXA 1A8PA 4G09A 4AULA 3WS3A 4E9RA 3GG9A 1M1YE 5IAGA 2VYCA 4MZIA 2W5PA 4D8PA 1D9KA 3FHEA 5ACMA 4MFHA 4XWAA 4LU0A 1H2WA 5C2UB 4G81A 1UFQA 1CDOA 1QWGA 1F1GA 1L5GB 4UUIA 2F74A 1LOQA 3CMFA 1NMSA 1ADSA 2EP5A 3GH3A 1UXKA 3FQRB 1O0SA 4ZVNA 4BMPB 2WUGA 1OD7A 1EHXA 4TMXA 1I10A 1Q12A 3KKQA 4S1WA 2PTZA 4NQRA 3BMQB 4B7LA 3WYDA 2ZJ0A 4WSKA 3SIMA 1WZEA 3ZDXB 2SECE 4U6YB 1JNYA 3RNLA 2X10A 1PFGA 1OIFA 4N87A 3CLEL 1IH8A 1AG1O 4N1EA 4KHXH 4F7MA 2YCKX 2IS1A 4LLUB 4P0PB 3WUWA 2R62A 4L4SA 3BFKA 5JO0A 3PG9A 1IIRA 3F8UB 4Z4FA 3HTXA 1LQTA 5DRIA 4E5XA 4R5XA 4X2UA 1RTKA 4TKZA 1KR0A 1T0OA 3CVVA 1TQSA 1EVJA 3DOSA 5AWFC 2FMIA 3NHMA 3X2FA 1H6AA 3NQ41 2VCAA 4NVRA 3UYRH 1A1NA 2YRZA 1GZHC 3BUTA 3GLCA 3ECQA 3KLLA 4S3KA 1QEWB 2PWFA 4ALNA 1T83A 1E1NA 3R7BA 3M1BA 3FB6A 3G6LA 2JCVA 3DZGA 1RBOB 3LDBC 1DANU 3A6PC 3GMDA 2EU8A 3KJXA 4AI7A 4O2CB 4QPZA 1IGWA 5BO1H 1P7VA 1YDWA 3BYTA 1W3NA 2SHKA 3EGWA 1SK9A 1X86B 3EJUA 4A8HA 2IKJA 1UVQA 1BTMA 2Z31A 3B89A 1EA0A 3RAFC 1UKZA 4QHUB 2IXAA 4WF7A 1TA4A 3WCZA 4KBFA 3BIWA 3SB3A 1R0BA 3HNTH 3LV6A 1WHOA 5DULA 4YO0A 3TCXA 1AXTL 1RPXA 3SSNA 5CZKA 5COQA 3PSWA 4F12A 2GSGA 2BI8A 2BKEA 3C6ZA 2CVFA 5LCVA 2V4UA 2XUIA 2XFXB 3I2YX 3A6EA 1QK4A 2C31A 5BW7C 2B5IC 2Q8ZA 1G7TA 3QJQB 1GVEA 3Q06A 3MT8A 2P5WB 3ZHOA 5E7BA 1NFBA 4H4CA 4HGWA 1AFVH 3WRYC 1V54B 2B8EA 3IM1A 1YZLA 1RERA 1JOIA 1NDGB 2FECI 4WGVB 4GG6A 3HB3D 1MQPA 1PZGA 2E55A 2Q2VA 3KBHE 5JLZA 3LLDA 1FHGA 4NN5C 1RJLB 1T7WA 3K2EA 3IDNA 5LNK6 3P82A 5K1JA 4U1RA 1JCYA 5LDHA 4HYEA 2JHCA 3ITYA 5AHWA 3NHBA 3G3MA 2IW3A 3HFYA 1JHVA 3K0SA 1BEYH 3HRZA 4QE1A 3NC1C 1PF3A 3KPRA 4NQEA 3KJGA 3VR6A 4X2PA 1VF5C 1WG8A 3M6WA 1FYTE 2NSQA 4KTDH 4Q34A 3IIOA 3QLDA 4N0UB 3T0IA 4LZAA 5HAOA 1P2CB 3DMGA 3V79C 3A6OA 4RZCB 4E46A 2FK9A 1KY3A 4MGXA 5CEZE 2F9BT 5C1MB 4QVGA 3GSOB 5E03A 2HJFA 2KBFA 3WRXC 5BUAA 5I3GA 4MLRA 3AWGA 5FYJH 3I72A 3PHQA 5CW2A 1XZ0B 1DDOA 3L0GA 3BWMA 2OXHA 1K92A 1SFDA 4NS4A 4ELMF 1KU6A 4NV3A 4G0XA 3CEUA 3WUBA 1BKSA 2I5YL 4XBJA 2CE7A 1O60A 3ISIX 4LL4A 1EVEA 2G04A 1U8PA 4KDWA 1GAWA 4DY6A 3K5HA 1P7QD 1PF7E 2OPHA 1PQZB 4RGMC 2VNIA 2PQ6A 1Z0MA 1RZKC 3PPSA 4QHLB 2C5HA 4N4PA 1KMNA 1W4LA 3S99A 1F8TL 2KZHA 3VMOA 3B6JA 4X6BB 3PCTA 5FLXA 4UR8A 1ATZA 3W04A 2D2IA 3JVGA 3S6TA 1AHPA 1JGVL 1D1TA 1Q16A 4N7RA 4QULA 4HLUA 1M7UA 1SHWA 5ELLA 1R8QA 2A7BA 2DQZA 3MAAC 2YVQA 2QRNA 4ENED 3HS8A 4WVXA 4RGOL 1EJVC 3ATYA 3GCWA 3O4OB 1MGPA 4Z2IA 4TVSa 4GM4A 2HAZA 3N4EA 7PTDA 4UM9B 5CBKA 3ZBQA 3T3DA 3CIWA 1RYNA 3K94A 3LMYA 1KIPB 2OZ8A 1QLEL 2DPKA 3KPQA 3PFIA 4Y2QA 2PS2A 3KAOA 5GRJL 1PCWA 3QYJA 4X3ZA 1JX6A 4YR9A 2OLHA 2DQTH 2WHYA 4TTPA 4YXLH 2FLKA 2JGEA 3NL2A 5MEPB 1QIEA 4LFHG 4I1UA 4NNPA 2NZ8A 2CY0A 2ZT6A 1POKA 1CNFA 2P2CA 1S7XA 2CKBA 1RWBA 5CDYA 1XICA 4KH2A 2H1LM 1VZWA 3QIAA 1EF3A 1BF2A 2DQXA 3T0TA 2G0NA 3T2LA 1UC8A 4MUEA 1SELA 3LQMA 2UZIH 3RB5A 3KEMA 3DV0B 1IO4C 5EXTA 2RKOA 1FB5A 5KNDA 3UGTA 2WOBA 3K13A 4FNUA 4K3EL 3AT1A 1X2EA 4UC0A 2DWSA 2GH1A 1SVZA 1ND5A 1OOEA 3EEIA 4Z4CA 2YXXA 1VR6A 5K9KB 4OQPA 2QCLA 1F20A 4EANA 1KMIY 4BE6A 1OWOA 1YHYA 3WJZA 2EE3A 2R69H 5BQ7B 3THXB 4GOAA 4B2DD 3D6MA 4HAFA 1M41A 3QE9Y 4YY3B 2RFXB 2WWTA 3IDIB 1INDL 3OCWA 3MZ2A 1G20A 4U28A 2ZDSA 4W9NA 3U9LA 1F74A 4JDTL 4PLJC 1HIZA 2YGNA 3TV8A 3RDKA 2AWNA 1E1LA 1E0DA 1PZFA 1XJCA 2I4IA 4PGGA 3LNDA 1P1ZA 2B98A 3OT1B 3TQFA 2WQWA 3MWEA 3DDMA 2D3TA 4L1SA 5FQOA 1JGUL 2Y25A 1JNDA 4FTVB 4N25A 3BLPX 3PV0A 1LPPA 4E41D 3FYSA 2K5UA 3N70A 1VAHA 5I8OH 3F2IA 3O21A 3FX4A 4RK6A 3RANA 1GAJA 3M4ZA 2P3QA 5JHDA 4G2AA 3NURA 1E0JA 4JLMA 3AG3B 3ZWMA 4Y9SA 3NFPB 1FUNA 1EX1A 5K05A 1NXPA 4GRIA 3I2CL 3ESVF 1J8KA 3VIIA 2H2GA 1VYTA 4HN4A 3WIHH 1Z07A 3IXTB 1ZWLA 4LHUG 3OL2A 2AOWA 4BQNA 3QWBA 4I3SH 4KWUA 4Q97A 2H00A 3W25A 4KUEA 4RXMA 3GLDA 1GSHA 4YJ2F 4M7OA 1QZXA 4KQ6A 5I4BA 1UM8A 2QYHA 3LVQE 2Y8VA 4ZW5A 2XADA 5KWYC 3PB0A 1CK4A 4MP8A 1M7BA 5FCSH 3NKVA 2F1JA 5A4MS 2JFWA 3Q11A 3WJ2A 3BZ4A 3PPEA 1FLRL 5KTYA 2B37A 3RUGA 2YW9A 1NE7A 3M5ZA 1A9YA 4NJAL 4LJKA 4HWEL 4PJGF 3CIAA 4PJAE 4MVWA 1G1MA 5A4FS 3TWAA 1HG0A 5LBSH 4ZFOA 2WWXA 2CEAA 4XGQA 3GAMA 2A6DB 2VW6A 1VG0B 3OGSA 4QTFA 6XIAA 5E8EA 5G0WA 5H4GA 2WSRA 3OPMA 4LUSB 3NHLA 3UMYA 4RW0A 1KLGA 2WANA 4OFVA 3KVMA 4HWRA 3BDAA 3F83A 3DKRA 2IBBA 2IU3A 1PU2A 5MF6A 4HKBB 2D0PB 3MUEA 1XKQA 5LIPA 2E7MA 4XZUB 4ZE5A 3ZKWB 3SEQA 1WRFA 3DMFA 2GUWA 1U3HB 1X4YA 2R9HD 5JY6A 1CP2A 3CVDA 5BU9A 4GLJA 1E50A 3JRXA 1RZGB 4P3DA 4XVRA 3NTCH 4XBEL 4PIVA 5FWDA 1MCOL 5FYKD 3BW9B 5EWIH 3DNPA 5F2GA 1YEIL 1C16A 2J48A 3PXXA 4IS2A 1R74A 4G0QA 1RL1A 1DQQB 1UFOA 3IIKA 3C6YA 5L3QB 5IBUG 2E37A 3D3VE 2H7XA 2EE2A 2RGMA 1U1CA 3H9HA 2ZXAA 3NFSL 5K69A 4QLAA 5G2OA 3TTXA 2Q2QA 5F52A 1N68A 3OAAA 5LOVB 3IMFA 3BIKB 3GB7A 5BORA 1JG3A 2OKCA 1SXCA 2EYSB 3F78A 1Q0QA 4OU5A 5DQDH 4MV9A 5IHXA 5EIEA 2V2CA 4B8WA 3C16C 5F3RA 1LEIA 1Z2CA 2J5LB 3F58H 3NVQA 4MJIA 1XF5A 3CC5A 1WQVT 4JM2C 4X6DF 5KYTA 4AUBA 1GZHB 2VEIA 4JX5A 4PR5A 4DVJA 2DI7A 2PXHA 2P67A 3HKBB 5A3RA 3PQ3A 4HALA 1YRWA 2VP0A 1A4XA 4GH5A 3LDBB 2OZ4L 3TPUA 3MYJA 1OUMA 3VU3A 3WJMB 3KKNA 1MKFA 4NRYA 4QRNA 2F1KA 4WLNA 3I7QA 4DBUA 3RI5K 1I7RA 3HA1A 1U5BA 2FX8L 1CLKA 3LG2A 3VNLA 4ONHA 3B6KA 7TAAA 2LU3A 4EAEA 3WGUA 4RQAA 4ZSOB 4LYGA 1KBPA 5FEWA 3WIFB 1QMLA 3IQZA 3W9EA 4HUTA 3LLUA 3GI8H 4Q4CA 1QW7A 1NFIB 4KIUA 5CEZH 1E5TA 2XDWA 2W0LA 4Y2YA 3IFNH 1EC9A 1XKTA 3P2YA 2PR4H 4JZNA 3V7AG 2X7HA 3ZWYA 4AWAA 3UG3A 1F2TB 3PWPD 4F2BA 1BWWA 5H8WA 1ZY2A 1AG0A 2VLRA 1ADYA 1MIEH 1ISZA 4JAWA 4Z7VA 3GEWB 3SX2A 2G30A 3OCCA 4LRWA 1FKXA 2CHFA 2QCMA 1XQ6A 4LQFH 4ZS6D 1WWAX 4JPKL 5K1VA 4C6LA 1R17A 3OE7D 4RH4A 5HR5A 3NEHA 4WK9A 1YI1A 2ZEJA 2CLCX 3QVLA 3ODGA 1EXVA 1YB2A 2XRMA 4QUAA 4MW7A 1RR2A 1ORIA 2RBKA 2Z92B 2EVGA 4YCMA 1RULH 5IKOA 2E9MA 3P0FA 4XZIA 4QGAA 2X4SB 5F4BA 4WXHA 3JAKA 4OHMA 4IGBA 2X5NA 3R09A 1W8IA 1Y18A 2VYVD 4FHZA 4KBYA 2XWBF 2O72A 3KZXA 2FMOA 1DVZA 2CM5A 4CADB 3FCUB 4LNUB 1IL0A 1MZHA 1AAJA 4JOBA 4Z86A 2JAHA 2B4KA 3PVZA 5AUOB 1E5CA 5ALHA 5DK2A 1BROA 3TLGB 4FPSA 4RGMB 4XX5A 3PHHA 5JW5A 4DRYA 3ZW3A 5JS1A 2PX5A 3A6FA 5FI0B 3BK0A 3WH9A 3BDVA 4LSRL 4HN9A 1ESWA 4EMBA 5AW7A 3SHTA 3CFIC 4QXVA 3L7EB 2FL5A 3D4YA 3R0UA 3AAZB 1CLYL 3N3EA 2AF3C 3B3JA 3BPCA 1DWQA 3VFNA 3NYZA 4LJ5A 3E2HC 1V6AA 1ODFA 4OZFH 5AR1A 1YUHA 1CTNA 5FXMA 3TJRA 2QR0A 3SCMA 5DWUL 4UHBA 1NY6A 5C4GB 1J86A 3B3IA 3T9BA 3MV9B 4N9GB 4I99A 1U65A 2HT1A 1UAGA 1YXYA 2OQLA 4KG7A 3W53A 4ZQFA 3KHSA 5CP3H 2Y7GA 2EFCB 5LNDA 4MXQD 4OVKA 3M46A 5C2BL 5DJDB 5H37H 4PJDF 4YXHH 3ASNB 1GAFL 3C6LB 2F1RA 3ONNA 3EOOA 3JWDH 4P4LA 1NBME 5AVSB 4YCLA 2IFFL 1D1SA 1P9NA 2AJBA 3ZTWA 1DCTA 1W0KA 4DP0X 3QSRA 1GPDG 2BGKA 3W82A 4ZAKC 4OD3H 3RFZA 3LZNA 3WL4A 5IK3A 3SGKC 4M1DL 2ZDGA 4ZD3L 2X3BA 1H49A 4INJA 4M61B 3RZCD 2IJ0C 1W49A 1ONSA 3F2LA 4RIIA 2R1YB 3I4CA 2P80D 2NR6D 1YPZF 4WJXA 4B3XA 4K26A 2YQGA 1BXBA 3KRUA 4FD2A 1OI7A 1SAYA 3B8EA 4HGXA 5AW9A 3HRKA 3VI3F 2FFHA 3B9NA 3BLOA 1E73M 4R1SA 4IHJA 1CD1B 4C4KT 1CL7I 4HNHA 3F4CA 4R69A 1ZRUA 2YPIA 2Q28A 3MUJA 3R06B 4BYGA 1S2GA 4BFTA 1HUQA 1QMUA 3NN8A 3QY0A 3TV3H 3OKKA 4F2MB 3TAHA 1FBAA 5IMLA 1I8KA 5EU4A 4D6GA 2I17A 1R3SA 1DKRA 1XGRB 4TMKA 1IM3A 5DD1L 2Z29A 1AR1D 4WK6A 1S9HA 3T7TA 2EBNA 1JT2A 5B1DA 3ZY3A 3SGGA 3QDJA 3FNHA 3KVDD 4NQDB 3C5HA 1FWIC 3GGJA 4NRRA 4WW2F 3TQPA 1T6MA 2QS9A 4D6XA 2GBAA 1NP0A 1F42A 1W44A 1U3ZA 1TQTA 4BP3A 1K6WA 3O7MA 4LCIH 2VAWA 5BUSA 3LZOA 3UAWA 2NY2D 4BWWA 1ZR4A 4TVOA 2D62A 1KV8A 2UV8G 4RY9A 5AXDA 4BUCA 1VZ3A 4O0KA 3FQUB 5CIPB 1A6UH 2BTOA 4DR6B 4NBYB 1WP6A 2VN4A 2PPLA 1LBHA 1YQEA 1T9HA 2D59A 2Y99A 4F2UA 2OC4A 4OD1L 3A4VA 3HDQA 4GRLA 1WB4A 4NRDA 2WXNA 4JG1L 4OGXL 2WMYA 3DZJA 4ODTH 3Q6IA 4JXCA 4JOMA 4PREA 4MYTA 4PLNC 1MR3F 1VTKA 5A3IC 4REQA 5C0IB 2GOKA 1E60A 3QH4A 1AJZA 4UOW1 3E9RA 5EBWA 5EOTB 2OTUB 1V0JA 2ILTA 3H65A 2AQ1A 2P6OA 4OUUB 3HMQA 4YMUA 3EWNA 1G16A 1RAGA 1TMHA 3GRWH 4DGYH 3IS0X 4LZLA 1NBVL 3TTWA 2JKIS 4J2TA 2XLLA 4GRDA 1QDEA 3ZKSD 3V1NA 2NSYA 1EFUA 3NFYA 4ERIA 2X5OA 1EXPA 4JYAB 5EZPA 3B0XA 1F2UA 4WKZB 3LKOA 5CD3A 1V7YA 2IYXA 1T9CA 3KSDO 1HTIA 5JW4R 2QG6A 4M1WA 4D7AA 5AVQA 4FN0A 1IPHA 2VR9A 3VRIA 1ZSHA 3HLKA 4FYRA 5AKKA 5HIMA 5HDOA 1FXUA 4WEVX 4C6EA 1JKIA 1B2LA 1EHNA 1M6WA 2L0DA 4W4QA 4XP4H 1USQA 3GJYA 3AEQB 3G9XA 2PLNA 4I4WA 3AF0A 4LX0A 3IRPX 2WQPA 3RC9A 5EWLB 4LMAA 1G7RA 4WGWB 4QXAA 4DCJA 1KA9F 1XMPA 1P1FA 1FWNA 1IM5A 5TT1A 2AMGA 2WNGA 4LCYA 3VPFA 1UJTA 2FSHA 3NFRA 3OOJA 1OLXA 5JNSA 1E3SA 3L41A 5IQNA 4KFTA 3EIQA 4EI8A 4AVKA 5FQNA 3AX6A 5I17A 4OXXA 3WSWA 5F64A 4XIJA 1DBIA 1SVSA 4PIMA 3PB3A 4YDIL 3AUKA 2HPIA 1JDFA 2RD0A 4GQBA 3GKFA 5EUCA 3H21A 3OHMA 3A9BA 5B3AA 1E1KA 2QL7A 5E38A 2NW3A 3LCGA 3TR2A 3FKQA 1KNWA 4NSKA 1S89A 2WZMA 4B92A 3BD3A 3WSQH 1FG2B 2VDLL 2PDXA 5GQBA 3D7RA 2D0FA 1E65A 1TUIA 2ODIA 4YUEL 2ZSHA 3N8IA 1EM8A 2Y6TE 3MBEA 2HBZA 4JJAA 2E74C 5JXIA 4EF3A 1ZB5A 2GPWA 4D8TA 1OGAD 3HA2A 2DBJA 1OCOB 4XP1H 4XWTA 1MJ7H 1CR2A 3R8HA 2G6TA 4R7GA 1U30A 3PBVA 3V4VL 5JMOC 3KJ4B 2IH1A 4RPJA 1ZT4A 1BSVA 4QE3A 3LUDA 1K02A 3GRCA 4BLPA 1X5KA 3HXOA 5DP1A 3OC6A 1KTVA 5TAOA 4FQXD 2R69A 3NBAA 2V3FA 1XBVA 5ADOL 3QXBA 3W5BA 4WNAA 5KTSA 1N5DA 5K0SA 2MIZA 2VMEA 1MCHA 2QAGC 1XXXA 3WE1A 1IY9A 2BEVA 2F3SA 1E4XI 2WIMA 4G6FB 1FDLL 5F9MA 5GMOA 1ZGBA 2WZ5A 4BXOA 2X7JA 1SM9A 4EAQA 2GABA 5FECB 1KRXA 1U3TA 4PJCE 4DKEH 1QKZH 5HTSA 1M54A 3B85A 4MKRA 2QCEA 3VXUD 3G8CA 3T0EE 1FMJA 2RJGA 2FRVA 3K09C 1TV4A 4P34A 5G4HC 1DIRA 4JTAA 1J96A 2QG9A 4FF7A 5FOBA 3VFTB 3HB3C 1BEEA 3K1AB 1TZIA 2JL1A 2GVZC 1CF1A 3MK31 4O2RA 1OA1A 3LPOA 1M1YA 2PXCA 2AR0A 2BKLA 2W95A 4EG0A 4P46D 3SEPA 2O2HA 1AVTA 1Z4NA 1F6FB 4RIRA 2ICAA 2VF5X 1RBQA 1OYVA 3NO1A 2XPCA 3WIHA 3M6AA 4Z2YA 3LI2A 4FZ8L 1GUBA 3V16A 3SZ3A 3UMJA 4X54A 4HZLA 2F53E 1M1NA 1LE5B 4HIBA 5DMXA 3ZS9A 3UTQA 4AZWA 2J25A 4ELKA 4GQ9L 4FEYA 4P4SA 3INYA 1DV7A 2XYHA 2NSDA 3N3TA 1R5JA 2EPOA 3PL5A 4JUSA 3VTKA 1M2NA 1HZHL 5A8MA 2R2EA 1T4KB 2JELL 2AOVA 1T9DA 4RJ2A 1YS4A 4Z2JA 3KBOA 4RK4A 1L6XA 1BIHA 4MW6A 4YB8A 2DTEA 5LBSA 1NIFA 4TUOB 4EA6A 3TK7A 1O7AA 2C8NA 2FI1A 5FFLA 5EZQA 2JLYA 1KFLA 3UW3A 2NLOA 1Z4LA 2CERA 5EI5A 3BJMA 3UJNA 1JV5B 2GI0A 1H2EA 2YEZA 1GCIA 2VPWA 2QN2A 3KB8A 4QU9A 4PV9A 1RLCL 2ZXUA 1V48A 1AD0B 2UXVA 2PZNA 4AURA 2QM7A 1NFKA 4QHPA 4PH6A 1JQDA 1T2UA 5AW4B 4H9ZA 1WB5A 2R4SH 4JKPH 2KX9A 4BE9A 2NLJA 2VDPH 2Q5EA 4R16A 4NJMA 1CJTC 3QEMB 5E08H 5ABFB 4MLZA 5IBTL 4ENEC 4G07A 2OCAA 4BV1A 2QL5A 2QTEA 1WKEA 1AF4A 3GJ5A 1UEMA 2CEQA 2GC4C 3FQYA 4YUWA 2OQVA 3T44A 4MS3A 2C99A 4FLRA 5ETUB 1PNRA 3DEQA 1E28B 3BWWA 3IRUA 3CLFL 3MHFA 3CMOH 3EFFB 4UU1A 2R23B 1T3FB 3QUXD 2DWXA 3CIXA 3FVTA 4RMGA 1R3IH 4YDSA 1O95D 2CG9X 3F5FA 1E6SM 3MA9H 2IHUA 1UG9A 4DA0A 1O0CA 1I8LA 4OJAA 4TULL 3TYCA 4N22A 2J8ZA 5LP1A 1BOGB 3APDA 4GICA 5HVWA 3H4VA 1N8SA 3IJHB 3CH1B 2Z83A 3SE7A 1E59A 2L42A 3G1DA 1QBKC 3DLCA 1Z5VA 3AW5A 4PSPA 1ULUA 4FHGA 2ODBA 1R3RA 4D57A 4GKVA 3KPMB 2AXGA 1IC1A 1CC3A 5KG9B 3NBQA 2XN9A 4F9PA 1BZ9A 4GKZB 1XLTC 4C4ZA 1DZIA 5HHPA 3W86A 4NUGL 5A0FA 3M7FB 2C00A 3PP4L 2QA5A 4K28A 1E1MA 4XPFH 1QRND 3RAPR 1MJJB 2JHFA 5TQ0L 1PZ0A 3TO4B 5AM5A 3AXXA 2M1ZA 1MY7A 1BQ4A 4URFA 2V7GA 1E94E 1B4RA 2MQ0A 5TEVA 4UBJA 5JEEA 3P2DA 4NABA 1RIUL 2VMCA 4OIIH 5F7MC 5KTEH 2P3ZA 4UEJA 3NJVA 4OM1H 2FPOA 4PJ7F 4WCFB 4YHEA 1R9FA 3P40A 4N2YA 4P32A 5T8KA 2XWDA 1X7WA 5JLAA 4NCIA 3QZMA 3SADA 1QFSA 3WYFA 1EVIA 4FZRA 1UACH 1WGOA 4NQCE 4HDSB 5ANMB 1N8ZB 2R91A 2VPXA 2VZ9A 3GLRA 4YQXH 3ROPA 3DOEA 4WE3A 3BD5A 1O6GA 5KC8A 3QMWA 3MO1B 4JI2B 2V2WA 1D09A 2BLLA 5IMKB 2UVDA 4RDXA 2XZQH 4YUXA 4NZUH 3U46B 3EX2A 3PJSA 2RG1A 2WYWA 4G7QB 2Y77A 1GZJA 2B21A 5JYDA 2ZTVA 3GOHA 1WEJL 3B2XA 1NQUA 1IWBA 4G1UC 3RU2A 3THWB 5GJCA 5TDPA 2X1PA 1GVQA 2CKNA 4EIBA 5J57B 3FWKA 2D22A 4BCXA 2FSUA 2NW0A 3DKPA 3F5WB 2C04A 4DUGA 2DWTA 2LOEA 2F8QA 4PHGA 3S88L 3HA5A 3FT3A 4OLUH 4PB4A 2XB6A 4NJOA 4LHQB 2H9AB 2R8SH 3VDBA 1YOBA 4CM9D 5LVEA 4A2FA 3W79A 3RWDA 4ZGGA 4W5OA 4DXVA 1RSZA 2DS4A 5LL6P 3KR3L 4HPGA 1GQSA 1RQPA 4JNCA 2R9HC 1PTZA 3P4XA 4I18B 1U91B 3TQSA 3A3NA 5E00A 5HUJA 4LGCA 4DMMA 3ZVIA 5IHRA 2AH5A 5LZ9A 4GW3A 4FR5A 4W9FC 1T6NA 3C8UA 3D34A 1Q45A 4U2EA 3W7JA 4R51A 1J1XL 1Z29A 2GUUA 3LRMA 43CAA 4FR0A 1KN2L 1F1AA 4RLIA 3UZZA 1UFKA 1P53A 1VDGA 5B3JF 1TA0A 4JQZA 2R7MA 1M6NA 2V2XA 1Q6QA 1G60A 5F9WB 2H11A 4MJJA 5CP3A 5HINA 5J2UB 1OIMA 4XAWL 1M04A 2F3UA 4CI9A 4HJGB 3WKAA 2HP4A 5IJKC 3AINA 1PWLA 3MODH 5G2WA 2H48A 3IVCA 4MVJH 3QIWA 2A92A 4L18A 4GNVA 4RVOA 3CZLA 3DTTA 4AWSA 1W4RA 4KDEA 5K33A 4NXMB 1QDLB 5JISA 3AHZA 1DC3A 3K9HA 2P9GA 1X7GA 3OZWA 5B7NA 2OJZH 1EWDA 2PZAA 3ISYA 2YXEA 4KUZL 1N2IA 3RSZA 3TE7A 4LAOA 3LFHA 2GGJA 2EEZA 5CC6A 4KETA 3CB2A 3RD5A 1F2XK 1LRJA 2OD9A 1BE6A 2AVGA 4O02L 4C56E 2A9PA 5HDQH 4XNZB 2IQ5A 4PB0L 3IU4H 1USZA 4CLXA 4BJ1A 4KPEC 4RZSA 3VVWA 1DIDA 4DDHA 4V1DD 3ENEA 2OTPA 1SOXA 2VM8A 5PCYA 4KXLA 1ZONA 2QAGB 2XCMC 1Q9OA 5DHXB 4RE4A 1L8XA 3EG9A 5XIAA 3P2KA 3T7DA 2OXNA 2Q3OA 2ZI4A 3BAYA 4C87A 3IIZA 3I0NA 3BLIA 3SNKA 1W6TA 5I1AA 4WOPA 3O0RH 4OZGB 5AIAA 3RCBA 4KRGA 4RCVA 2B59B 4Y2DD 5F1OA 1AOZA 1UQYA 1QTIA 3O9WA 2RAMA 3CF6R 3N86A 2A14A 4BZWA 4ZOEA 3HB3B 3V8PA 3U5TA 3WH5A 1NKRA 2ZBTA 1R0AH 2PAAA 5TJHA 4C6SA 5FLVA 3MLYH 5IF3A 2FAXA 4ATLA 2W0PA 2YJ6A 3B20A 5A2KH 4ZS6C 4FOOA 3O11A 2Y1HA 3F7VA 1ODZA 4MUYA 1Q94B 5KOHA 3RU6A 4EL5A 4M7KL 3W73A 2Z24A 4FI4A 5C5YA 2BP7A 1IY0A 3JV4A 2QV0A 4GC4A 4DDUA 3LIPA 5EE9A 2QKIC 3Q6NA 3ARDB 4PTMA 4WW0A 3RVKA 2B0SL 1NMYA 3SUTA 5I26A 2AJXH 3ZGYA 1E2NA 5C07E 3GRWA 2PX4A 4XNDA 2IU6A 4MA0A 5E23A 2B4YA 4JUAA 5FULA 4ZFGL 1QBLH 3UNXA 2ZKLA 2R56L 5CYFA 3QA3E 3GPDG 4FXKA 4B5KA 3V3WA 1EJSC 3UZEC 1L5NA 1ZHKB 4JHUA 5AW6A 2XU9A 4YUAA 5CD1A 2VK2A 3U1SL 3BWDD 1CS4C 3LPPA 1XMWA 4LBVA 2PMWB 1T5TA 4PLCA 1ULHA 1FOBA 4OZ4B 3MXWL 4IMRA 2J7HA 4BZPA 3B51X 1L8PA 4BATA 4Y5YA 1GQJA 2NXHA 3PZUA 3UT6A 5G2NA 1RW4A 2IDJA 2Q8QA 3MRSA 1I4OA 2NY5H 1SO5A 1V7AA 3A6KA 4P08A 3GHYA 3TN5A 3R7QA 3GLGB 3FO0H 3Q2OA 1K9TA 1M76A 2W0KA 5SICE 2Q0ZX 5E4JA 4B3MB 4NQZA 2VQ1B 1N2RA 4AQ1B 1KJMB 1P4CA 3CMMA 4GUPA 5KZCB 1Z6KA 4J9VA 4Q4PA 1E90A 3TF5A 1EWHA 1N10A 4BZ1H 3QHZH 1DJNA 2PBRA 3CDFA 2DT3A 2VTKA 3G2JA 3RLUA 4KV5F 1Y07A 4TKVA 1COWA 3O3DB 3HCDA 2XMRA 3FBKA 4MXQC 2C92A 2PU0A 2JTYA 3A10A 3ICJA 4BZZA 2X9XA 3AR3A 2A86A 2AOUB 3G0BA 4GL4A 2G9QA 4E42A 1M0SA 3G13A 5DWQA 2KZBA 1HCZA 2NZUG 3UTSE 2XHEA 3SBEA 4RMQA 2QADD 1XUOA 3GP3A 4XOCA 4GI3A 4NAQA 3RGVD 3CZMA 4G4SP 3RZCC 3MBWB 3V0VA 4S1QH 2ZAGA 2QKSA 5I2IB 2FR8C 4EP1A 1A3WA 3W02A 2JKYA 3PL1A 1ZZGA 4I55F 2NR6C 1F9AA 3TO2B 4IPIA 2PW2B 5GJMA 1N2XA 5I15L 2UXGA 2H5LA 1KZQA 1SVKA 3LX9A 8ATCA 2X0WA 4IIZA 1Q0YL 2QCDB 3DFNA 4BASA 1WMSA 3KJHA 2LABA 2WC1A 1O7DE 1Y6KR 3R7RA 4PSVA 4PQYA 4R05A 4D6IA 1OLOA 4BV2A 2HRPH 1NXSA 4OQYA 3D8RA 1R5WB 1T03H 5JDCA 4BNFA 4FYYA 4JYZA 4YGAB 4R3SB 2RI6A 4QTHB 3PZIA 5EXEA 5CNHA 2Q2OA 2Z5VA 1E27A 1RUKH 3QUQA 4TUJB 2W00A 2WZBA 4G6ZA 4QGGA 1OXXK 1STOA 1AR1C 1RLBA 4YP6A 2R1UA 2QV2A 4TQIA 2C7GA 3MMUA 3DBHB 1C5KA 1AUSL 3I9V6 2PAFA 1T41A 3ZXYA 3RNKB 4DIAA 1SIWA 5FW7A 5IYZB 1SQFA 3I9IA 2EGUA 5HYQB 4RY8A 5BSUA 4HG4J 1DQDH 5MHSD 3C6BA 2QLBA 3P32A 3GBEA 5BUPA 3TE9A 4AQZA 1H8EA 3B7PA 1F73A 3MT0A 3NVKI 2UWEF 3CWQA 4RHEA 2E4XA 1NU5A 3Q0IA 2BFDA 4HUUB 4ZGWA 4LLMA 1FX0A 1CX9B 2DZSA 3KM1A 1R3HA 5A03A 2GEFA 3AUWB 3I6SA 3O3MB 1NDWA 4UMDA 3CQIA 1AD9A 1EDOA 2XSZA 1QC5A 3GGSA 1NGYA 3SU8A 4MNQB 3HDGA 4R97C 3KG5A 2JLXA 3AW9A 4JROA 1PFKA 3VHQA 3IIXA 4U1LB 4NB7A 1BYBA 5JMPA 3CUVA 3SZ6A 2Z7UA 4LX8A 4FIZA 1XNQB 3H1GA 4Y9UA 1A64A