4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
2EAEA 1TZ7A 1JNDA 4OGFA 7A3HA 5IFTA 1E3XA 1FA2A 1ZBWA 5M5DA 1EA9C 2Z1SA 3GRAA 4WINA 1PPIA 1OT1A 5JZOA 3D4YA 2CITA 4DUWA 3L2LA 3SCQA 1HKKA 1XYZA 4B40A 4PMZA 5M17A 3SCSA 5ABEA 2RK6A 2XN1A 1NM9A 2WW5A 1OIFA 3WDIA 4PEEA 3NDYA 3TV8A 2NT1A 5DEZA 5HBFA 4RE3A 3ZO9A 4D1IA 2C0HA 3ZT7A 4JAWA 2UWFA 4LRUA 4PRWA 4KGJA 3A24A 2WPGA 2BHZA 3O9NA 1HL8A 3O2LA 1X6LA 3NORA 1UD2A 4IPLA 1V0NA 4ENVA 4WXYB 1G01A 4XZWA 1W3HA 3RIKA 1J0KA 3AMDA 1UD3A 3PZNA 4NI3A 1SY7A 1UA3A 3AISA 1P7ZA 2GJXB 2XWEA 1O6IA 2OWCA 3WUGA 5IHSA 4AZGA 1UWUA 2W91A 2WZIA 4M1RA 3W25A 5A6LA 1P5FA 2FGZA 3W27A 3AIRA 3POCA 2ZXDA 3WNMA 4OJYA 2ZUVA 1PX3A 4PMUA 2XYLA 3IGUA 4HOWA 3N11A 4L95C 3EDKA 2ZXQA 1UH4A 4P7RA 1PDWA 3IJ9A 1GUVA 1EXPA 4TX8A 4W7UA 3CYFA 3RM9A 4I46A 4F9JA 3K4AA 1TA3A 4Y1EA 4X9YA 2A3HA 3ARQA 1XSJA 1B3ZA 1VF8A 1KEEB 1VENA 4AMWA 1W3KA 1D7FA 3L4TA 1CGYA 4TX6A 1BQCA 1C30B 1UCFA 4QYTA 3UGJA 2W62A 3ZJ4A 1V6WA 4B9ZA 4KGLA 4MB1A 2WAGA 5A8PA 1JZ3A 3DYMA 3CZLA 1UH3A 4FNQA 2ZX5A 4ATDA 3ZOAA 3GNRA 1HIZA 1QI2A 5CSUA 1J12A 1E1EA 2D24A 2E3ZA 1AVAA 4BQ2A 2WHJA 2J62A 5CG0A 4J27A 1HP5A 1UKPA 3S2CA 3EWNA 2X2YA 1JFHA 3WUBA 2D0FA 3WEOA 1WB0A 2WMKA 3SURA 1P7YA 4AD3A 2WLZA 1HKMA 1KXHA 4M29A 2PWFA 3FIJA 1HF6A 2GJRA 1WZKA 2DT1A 3VDHA 1BSIA 1OGBA 5D4YA 1V0LA 3WFLA 3D51A 4EE9A 4ZDIA 2ZUSA 4QDMA 1W9BM 2WVUA 4AZ5A 2AB0A 2F1AA 2X2JA 3WDJA 3TQIA 1E6ZA 1E55A 3HMCA 3PZGA 1G2IA 3NOVA 1QNOA 4P2GA 3WMSA 1V0MA 2VX4A 4LYRA 4E8CA 1S1MA 1TA3B 4P5PA 3EDEA 5I77A 2EPLX 1FH7A 4RE2A 1FH8A 1JXJA 3AIWA 3MANA 2CNCA 2VQUA 3TTSA 2XVPA 2FHBA 4XX6A 1C93A 3D3AA 2ZE0A 1VCMA 3AOFA 4GINA 5A6BD 3BSHA 1HJUA 1O7AA 2GFTA 4HZ6A 5BROA 3POHA 1VCNA 1C90A 4QP0A 1K9DA 3GM8A 1JDDA 4F9DA 1NOUA 4GUDA 2XPKA 1WDRA 2W66A 3KKLA 3FHQA 4HPGA 4FLQA 2WVVB 1DWIM 1OX5A 1EOMA 2BNJA 4HA1A 1V3MA 2Y24A 4LPCA 5CZKA 4XZBA 4H8HA 1ODUA 1YHTA 2YKKA 3VIHA 3WD4A 3TTOA 2ZUTA 1XV8A 4GE0A 3VILA 2RGLA 3MUIA 4ZFMA 1FP9A 1OWQA 5AYIA 3KWXA 5BXPA 3B3AA 3VKKA 2PB1A 3PBGA 1EHNA 3CO4A 3WH5A 5BCAA 1PS3A 1FFQA 4DWSB 5A2BA 1V3HA 4QFUA 4IUGA 2QPSA 4R27A 1XH2A 2J7FA 1V02A 4JHOA 2WANA 3II1A 1B3WA 5CQ1A 1ISYA 4JFVA 1UA7A 3MIIA 2XIIA 2O9TA 3BUPA 1C91A 2VZUA 4IPNB 1FHLA 4NZJA 1XC6A 1V6YA 1ECEA 3RMEA 1B30A 5KEZA 2D1ZA 2XGIA 4LX4A 1UOKA 2QPUA 1A47A 4OUEA 5DF0A 2XUCA 3ZQ9A 1GG9A 1W9DM 2VX7A 3ZM8A 4HTYA 2OWXA 3IJ7A 3GNPA 3NDZA 4P7LA 4CN4A 3CHEA 1J0JA 2CKRA 1J0HA 2CERA 4Z2GA 1CXKA 5AC4A 1JIBA 3CUJA 1R75A 2VCBA 2EABA 1JZ4A 3OB8A 4OQ4A 5CLTA 3LRMA 3VGBA 4UCFA 2XSAA 2WMHA 1QX1A 4FNUA 3EMQA 3N13A 1I7SB 1EO7A 3VX1A 4K68A 1GHSA 3F5LA 3AS1A 3G6LA 1R47A 1UR2A 3AXXA 1D3CA 1GQKA 1B2YA 4H41A 5A1AA 2X0HA 4BA0A 3MV01 1XD0A 2PWHA 5A2CA 3BMVA 4WIWA 1W2PA 4E5VA 3SCNA 1DWAM 1JNEA 2YBTA 1ZBCA 3RO8A 3VIKA 1T36B 1W9UA 1TG7A 4A4AA 2QHAA 4AW7A 3B9DA 5D8ZA 2BXYA 4Z2JA 4PTMA 2DPEA 2WWDA 4MDOA 3P9SA 3SUVA 3AIUA 2VDJA 4HU8A 4X0NA 3AMGA 1OY1A 3A3HA 1Z32X 1FP8A 3GBEA 1Q6FA 2QMKA 2J7HA 3GDBA 1E1FA 3N1AA 1V6UA 4UZUA 5LA1A 3VMPA 2IXVA 3UG5A 5GNXA 5E9AA 2BY3A 4ZXOA 3AS2A 1K9VF 5LA0A 3FHAA 4AZIA 3HU7A 1BLIA 2ZWYA 3CY6A 3MU7A 3QHNA 1KR1A 3MSGA 4TXEA 3WF1A 2F8QA 1QVWA 3BLKA 3TOPA 1QNPA 1GOMA 4MB3A 1MXGA 2J7BA 4W93A 4DO6A 1UQYA 8CGTA 3BLBA 1OX4B 5A8OA 2YWJA 1VCOA 3ARPA 3SIMA 4H04A 2W7TA 1W9VA 2WWCA 3WELA 1EGZA 3VM7A 1V3IA 1GW1A 1W2VA 3MS8A 3CC1A 3FN9A 1KQYA 2CHNA 2EADA 2EPKX 1E56A 3KEHA 4HU0A 3PZTA 3B9EA 1NARA 2FH8A 3OG2A 1CGVA 3WF0A 3EJQA 4YPJA 2F7PA 1UG6A 5FL0A 3N18A 2J8FA 3VNZA 1OX4A 1RPKA 3WNKA 2XIBA 4P35A 2PWEA 1ODZA 1RD6A 4Y1RB 1QW8A 2DSUA 1W3JA 3ZIZA 2JEPA 2W67A 2GDUA 2YDQA 2WZHA 3WNNA 1M01A 3T09A 4URIA 5EBAA 2BFGA 2D3NA 4MNJA 2EPMX 2XVKA 1IZYA 3G6MA 2UY2A 4MGHA 2NT0A 6TAAA 2GDVA 1T0BA 3PHAA 1I1QB 3KZSA 1E0VA 4ACZA 2EO7A 4GPNA 3VTRA 1CEOA 4CKQA 5BXRA 2GJPA 3U57A 1CF9A 4FLSA 2XFRA 3U7BA 1HP4A 4GO9A 5E0FA 1DP0A 3KLKA 4B9YA 4WKFA 2XGBA 3WD3A 2XF2A 4TTGA 1J11A 1JG9A 3AHYA 3KL3A 1H1NA 3VD7A 1E5NA 2PBGA 2AD5A 1FHDA 3AICA 1JD7A 5HPCA 1TQTA 5M3WA 1T3TA 1FY2A 3BH4A 4AYGA 2CEQA 1DWJM 5GNYA 4AD0A 3UG3A 3CTTA 1L8NA 2RGMA 2WLYA 2FH6A 5LYRA 2F7RA 1L9XA 2YWCA 4AZBA 3TTUA 3W38A 4PUDA 3FAWA 4UQEA 2J7CA 3VD4A 5BV2P 1TQSA 2ZX7A 2OSXA 1MW1A 3HG5A 1EHAA 4FNPA 3LXCA 4HOXA 3T0AA 1PE0A 1JDBC 3VDCA 1JF6A 4Z2HA 4HCJA 3TONA 5I78A 1LQ0A 5E09A 1OI4A 2O92A 2FHCA 1QW9A 4AULA 3CHDA 2OR3A 3BLPX 4WLCA 3DX2A 4TVDA 4HA3A 3CZ8A 4DM1A 4U2ZA 3NSXA 2OLHA 5SY4A 4U3AA 5C70A 5BYWA 4MNMA 3AXHA 4AUNA 2X8RA 4B3KA 1XD1A 5CJ5A 1LG1A 2YJQA 2X2IA 3K4DA 2VNCA 3VIJA 5HNNA 4UFKA 1GORA 4UR9A 2V5CA 2D0GA 1QNRA 3AHTA 3A5VA 2PC8A 3UR7A 1CBGA 1CGXA 1SFSA 5C71A 4GO8A 2FHFA 1HJQA 3WDHA 3ZJ8A 1H11A 2YL5A 3QOKA 1M03A 2OYMA 3VU2A 5EMYA 1XSIA 1VFFA 3N04A 1JI2A 1MFVA 1MW0A 3K8KA 4UFIA 3GTNA 4U2YA 1M7XA 4OGZA 1B90A 2OW6A 3AIQA 4ATWA 5JIPA 1E6RA 3PN8A 4RL3A 4UFMA 1KCKA 1MQRA 3AMKA 3SF8A 4TOQA 2D3LA 1QI0A 4CVUA 2FGLA 1AQ0A 3AZSA 1ISWA 4PYSA 1EDQA 1CPUA 1I75A 3QHMA 1E4IA 3P9PA 2QF8A 3WDQA 3BSGA 4P7QA 3MSDA 4XV0A 3S5YA 3VOCA 4FNTA 5CGTA 2X2HA 2G4FA 6A3HA 2CBVA 1C8YA 3WMBA 1BPLB 1GZJA 3EDFA 4WKAA 4HZ7A 3ARXA 1GVIA 5DT7A 3J7HA 3MO4A 1W32A 2WMIB 4PSPA 5CLWA 3ZJ6A 4HMDA 2WC7A 4W85A 1US2A 2V3EA 1WDQA 3M7SA 3DC0A 3GXTA 4IISA 1H3GA 2ZX6A 2O9RA 1VRXA 4P8UA 3QR3A 2G41A 3CZSA 4LYQA 1H0GA 1Y7VA 1Q6DA 5K4AA 3CIVA 2ZUWA 1JYNA 1QDLB 1TQUA 5BXSA 1EQPA 3LMYA 1G0CA 1VAHA 3A4WA 4PTXA 1LL7A 1CYGA 1ZJBA 2V4UA 1JXKA 5BXTA 1UKOA 3D5HA 1QVVA 5A6SA 1LWJA 2WHLA 2VZSA 2WMIA 3AZRA 5C8BB 1NWTA 3SCTA 3WNLA 3FXYA 2F1BA 1V03A 4UFLA 3GXDA 2DSZA 3BAYA 4NRRA 1XCXA 3GXMA 5BRQA 2FYVA 3WNPA 3UK7A 3HJEA 2DT2A 3LPOA 1GQIA 3OT1B 3BUQA 1TUXA 2H2WA 2WK2A 4E2OA 1BYAA 2ISSD 1CXFA 4B7AA 4MAZA 5ABGA 3U5YA 3NSNA 2WCAA 5LIRA 1WZMA 3B9AA 4P7NA 1H41A 1ITXA 4DO5A 3WY3A 4NSBA 2DGAA 1PIFA 3OGRA 1E9LA 5GPRA 4CU6A 2E9LA 2BVYA 2XJ7A 2V3FA 3BVWA 4W88A 1WO2A 1E4NA 1TFVA 1V02E 1QOXA 2WXDM 4W5UA 2C8NA 7CGTA 4J3XA 2VCAA 1HWWA 4ZENA 1W91A 2J75A 2Y4SA 1UR1A 4TTUA 3S6TA 1EOKA 2B31A 3FY1A 3WL1A 3WY1A 4AZHA 4MB5A 5JZMA 1NWRA 4B5KA 2W63A 2VJXA 1PAMA 4JCLA 2XG9A 3P9QA 5E0CA 3NOQA 2VRJA 1HXKA 2CBIA 2GHRA 1OIMA 3IK2A 3N7TA 3OLEA 4RKYA 2CXGA 2VMFA 4H2CA 1WCGA 1E40A 4L8FA 5SY6A 3BAWA 3VM5A 4GZEA 4MADA 4W7WA 3MGKA 3EDJA 3TTTA 4LQ1A 3CPUA 1WDPA 4YN5A 5AY7A 3WBEA 4AIOA 3WL0A 4M8UA 1CLXA 2WVVA 1B3YA 4AD2A 2VOTA 4Z2IA 4UQDA 3AIBA 1E71M 3OLIA 5A69A 5I3DA 3BUIA 4UQAA 1AQHA 1JZ7A 2YA1A 1R86A 1S46A 3K46A 4H8UA 2XHYA 1B31A 4PMDA 3NOOA 1WPCA 1ZJAA 2BY0A 3MV11 1PEZA 1W9XA 1C7SA 2YBUA 1ZU8A 2FDMA 3ECQA 4QYXA 1XH0A 4HZ8A 5F7UA 4JKLA 4WKHA 1FOBA 1QI4A 1SR0A 3CUHA 2GSJA 3R75A 2DSWA 5ABFA 4KWUA 3WQ6A 4GZIA 1GVYA 2VC9A 3RILA 3T2PA 4L8WB 2WYSA 3UMMA 3WQ4A 3HG3A 1MVYA 1GOKA 3EJPA 5ECUA 1JYWA 2D7JA 1JYVA 2G3MA 3ZR6A 3NVAA 1RP9A 5JBDA 1JZ5A 3UG4A 3IAPA 3UEQA 3MMUA 1XSKA 3BVVA 2XVLA 2DH2A 2YFOA 2R1UA 2O9OA 3OGSA 1HKIA 3VO0A 2Y8VA 2VRKA 3BWEA 1UR4A 4ACYA 2ESCA 4GI9A 3HZ3A 3EDDA 3W4RA 4S3JA 2CHOA 3ARUA 3AYRA 5EFFA 2XFYA 1KR0A 2R1TB 2EQDA 4MTVA 2YL8A 5D9NA 3AFBA 3VU3A 3L18A 1VEPA 3EJUA 5IP5A 2D73A 2YWDA 3PZOA 2EBNA 3LPGA 3ARSA 3UESA 2OSWA 3W6LA 1OD8A 3CHCA 3WF4A 4ZDJA 3VGFA 3VIPA 1BGAA 1H5VA 1GQJA 4Y1FA 3WY4A 1JDAA 1B3VA 1TQWA 1BXRB 3OLGA 2IXUA 3ARRA 3L4YA 4B16A 4PTWA 3AS3A 3SCVA 4DUXA 1ZBKA 4EKJA 1CXEA 4PMNA 1V3KA 4AWEA 3RPMA 4WSKA 4OFWA 3LXAA 1VFUA 2E8ZA 1CLVA 3GH5A 3KE0A 1UYQA 3RCNA 1BVZA 3TTXA 4PXYA 2XM1A 3WQ8A 2X09A 4ZGGA 1CGUA 1P6WA 3WFZA 4U3CA 1BYBA 3W26A 5JIWA 3MUZ1 2V5DA 1QVZA 1FH9A 2VZVA 1CXIA 3WUFA 4BQ3A 4DWSC 1QI3A 3PZQA 3TTQA 1EO5A 2X0YA 3LXBA 4MNLA 8A3HA 2CPUA 3F5DA 3QHOA 1E6XM 4Y1RA 1EIBA 4V28A 2VXOA 4UOJA 1HXJA 1NWSA 3RDKA 2GK3A 4FLRA 5AC5A 5A6MA 2YDSA 1QHOA 1I7QB 2DT0A 1C8QA 4JCMA 2FE0A 3AHVA 2BY1A 4EANA 1HJSA 4A3HA 1R87A 4AY1A 2WHKA 3A23A 1UZ4A 1OSEA 3CV5A 4XLLA 4FLOA 4BFLA 1UR0A 2IUFA 3W0KA 1JAKA 3CBWA 4ACZB 4F8XA 1TVNA 3GNOA 5HOSA 5I2UA 2VRQA 2W4XA 2XWDA 4XB3A 4D71A 5E70A 1HX0A 4UFHA 3D50A 4Y0NA 1W3LA 3M46A 2DQXA 1VFMA 1E70M 5A2AA 1UWRA 3VD3A 3A21A 3L4XA 2O9PA 5A8QA 3R74A 3WN6A 1SYTA 5LA2A 1QBAA 3SCOA 3AXIA 4AMXA 2PBOA 1UWQA 3ZR5A 4FNSA 1OD0A 3I3BA 4XUYA 4PMVA 4DWSA 2GK1A 1PX8A 3L7NA 1H09A 1R7AA 2YDRA 1OX6A 5DO8A 1DWFM 1VJSA 1IZZA 3SEPA 5TD4A 1BHGA 4ENSA 1WP6A 2ZOXA 3TP4A 4P36A 2D0HA 2DH3A 2WSKA 3BUBA 1YQ2A 3WD1A 4AD4A 4L8YA 1CS0B 2DIEA 1LG2A 1M6VB 4PTVA 1HJXA 2BHUA 2TAAA 3GXPA 1J10A 3L4ZA 1RP8A 3U5UA 1QNSA 1CE8B 4M82A 4J7RA 4D6FA 1VJZA 3WY2A 1CNVA 3K1DA 5CXPA 3BAXA 5A94A 1EQCA 3NUKA 4PMRA 3WF3A 4U31A 4W5ZA 1UD8A 5KZ6A 5E6ZA 2EJ1A 1GJUA 5ABFB 1GPFA 4AZCA 2YLLA 2XTKA 3EJTA 2ZIDA 2VCCA 3EMCA 1JF5A 1MXDA 2WBGA 2XVNA 4F66A 4W8LA 4CN1A 5IXEA 1VHQA 1VEOA 4OZOA 4CD7A 2NW0A 3ER6A 4MPKA 1CTNA 2E9BA 3MUY1 3O6AA 1C92A 1XGZA 4S3KA 2W92A 3E1F1 2D22A 4E8DA 3AIVA 1HL9A 3CNEA 4J3TA 1XH1A 1LL6A 3OIHA 5M03A 1SMAA 1E3ZA 4JFWA 4P34A 4NXSA 2NSXA 1ITCA 4OBRA 2J8GA 3AROA 1GPWB 1E0XA 4ATLA 3M07A 2HISA 1QWSA 1PDVA 1DEDA 2YA2A 3SUTA 1NP2A 2AMGA 2PWGA 3M6DA 2MANA 3ARZA 2GVYA 3GXFA 3B38A 2WNWA 1GGEA 4D6GA 4DUVA 3WDPP 4OIFA 4CGTA 2F18A 5FL1A 4AD5A 1QNQA 1NH6A 3VD9A 4Z2KA 3NYDA 2OW7A 3VGGA 2V3DA 3SUSA 2DIJA 1N57A 5BWFA 2J79A 3A4XA 3WEMA 1B3XA 4V2XA 3AI0A 3ZMRA 3L3BA 4MAVA 1KBKA 3ARYA 4BCEA 3K8MA 2QV4A 4QLJA 1UQZA 2ZUNA 1PBGA 3DHUA 3RHTA 4JHZA 1P80A 1R34A 1OGGA 3WF2A 2ZWZA 2PF0A 4QAWA 1BGGA 1ZBVA 1LL4A 1NWUA 3IJ8A 4CD6A 5HDRA 1UR8A 4L7QA 1K9TA 2GUYA 1V0KA 1LWHA 4KH2A 2ZXAA 3W37A 3FW6A 3TTYA 4TUFA 4W86A 3GBDA 2Y2WA 3WEZA 1Q4NX 1E43A 3BMWA 1QPKA 3ZSTA 3F4VA 3N15A 1ZL1A 4E4PA 4GKLA 5E1QA 1KBBA 2WHMA 1B0IA 4RE4A 1E72M 4GQQA 1QBBA 2WKGA 2WKLA 4AYSA 3D54D 1DWGM 2WSPA 3VIMA 3EZGA 3VNYA 3WD2A 1BVNP 1KTBA 1G94A 3A4AA 1OB0A 3VD5A 4U33A 4B31A 3PZMA 1JAEA 4W84A 3KL5A 5E6YA 3GH4A 5FD0A 5IFPA 2VR4A 1E4LA 1HN1A 2J77A 1VFOA 4YHEA 1BG4A 3ZJ5A 3LRLA 4UOZA 3CZKA 4LXFA 1MQPA 4Q22A 3BAIA 4P8WA 3VGHA 4UQBA 1E0WA 4PCTA 1V6VA 4L78A 3A22A 1WDSA 3H54A 4ZE4A 3MI6A 5DMYA 1OCQA 1G9HA 3CZGA 1F4AA 1SMDA 1U2YA 3BAJA 4U5KA 7TAAA 9CGTA 4LGYA 3ZT6A 4AXNA 3TTWA 4AIEA 3PTMA 1F4HA 2YA0A 3VSTA 3EYPA 2LXNA 2XVGA 3TA9A 1E73M 3UR8A 2ALWA 1QWNA 4PUEA 4W8BA 2IUZA 4PMXA 3AIEA 1UKSA 3UETA 3HN3A 1G1YA 1MYRA 3PZ9A 1JD9A 1JI1A 4H7VA 3CZJA 4MDPA 3W81A 4JKMA 1IPHA 3ZT5A 1UD4A 4JZ5A 1ZS2A 4J3WA 1X1NA 2OSYA 4X0VA 3THDA 5I0DA 3CUFA 4BQ5A 4C7FA 1J0IA 1SZNA 4CU8A 2R1TA 1ISZA 2J7GA 4ZXLA 4WK9A 1XRVA 4NRSA 4D6JA 3BHNA 3EJRA 4TVCA 2DEPA 2D20A 2JEQA 5A6JA 1VEMA 4M56A 3WDRA 1Q6EA 1EH9A 5JUVA 4GI6A 1XCWA 2AAAA 4A3YA 2J74A 1EDTA 5JBEA 3VIIA 4L4PA 2CBUA 1R7OA 3VGDA 3W6MA 2J25A 4DM2A 4W89A 2J4GA 4ENRA 5CGMA 3OZPA 3ZJKA 4HMCA 3THCA 3BC9A 2OYKA 2ZX8A 3FNDA 4AD1A 3KLLA 1KXTA 3H55A 3KL0A 2Q8XA 4DWSD 1B9ZA 4Z2LA 1LF1A 1KA9H 3WQ5A 2VTFA 3GYCA 1GOWA 2JIEA 2YL6A 4J28A 2VO5A 3GH7A 1BAGA 3L4EA 4ENUA 2J78A 2A3EA 3W53A 4AMCA 1P81A 4ENWA 1PIGA 2VPIA 4OGGA 5SY9A 1U33A 1N82A 4JFTA 2DDXA 3ZJ7A 3UJNA 5FOOA 3DX0A 1R85A 3R76A 4M24A 3H53A 4JIEA 1VBUA 3SCPA 3VVGA 3ZR4B 1E6PA 4EK7A 4AEEA 3RJXA 4GE3A 2WC3A 3F71A 2G3IA 2WVTA 1UZ1A 1RH9A 4QLLA 4PCSA 2UY4A 1CGWA 1VB9A 4WSJA 3OT1A 1MW2A 4L4OA 1BG9A 4QCEA 1MFUA 5A6AA 4AJ9A 1KQZA 5HPOA 4JFSA 5A8NA 4I2NA 3WH6A 3VIOA 4D1YA 3L4UA 3WKZA 3VIFA 5I79A 1CENA 3UERA 2J7DA 2YWBA 1QWUA 1V6XA 3EJSA 2CYGA 4UQ9A 2OWWA 3VPLA 2OYLA 3IANA 5GNZA 4GZJA 3HG4A 1W9PA 2BVDA 3CGTA 2CIPA 4JFUA 3ARWA 3T2OA 4ENQA 2ZICA 1GOIA 2V3GA 2Z1KA 1XHGA 2WJZB 1UKQA 2WCSA 1PZ3A 1IZKA 1WL8A 3W24A 3F5JA 2NV2B 1UD6A 3NJ3A 4P8VA 2DT3A 3U7VA 1BFNA 1H4PA 3LPFA 2ZUMA 5BRPA 4W7VA 3OBAA 5JBFA 2A3BA 3VGEA 1AQMA 1R8LA 1IT0A 3BCDA 1DWHM 2CKSA 4U5IA 5D8WA 5A3HA 3CZ9A 1U9CA 1R46A 3CUIA 1MQQA 1QVBA 4PSRA 1V08A 4CCCA 3VSVA 2G8ZA 2F7OA 2WM0A 3QOMA 2G3JA 4KRTA 4LGXA 3SF8B 5DFAA 2G3NA 4MB4A 2QMJA 3APGA 1UWTA 4PN2A 1X6NA 4N12A 1M04A 1OINA 1W1TA 2WMFA 4K2HA 2C7FA 4CCEA 4JL2A 4FMVA 5A8MA 1G5AA 2X05A 2WVSA 4ZDKA 4N0MA 2Y8KA 3WSUA 4GI8A 2JFEX 5FCZA 4N42A 1T0OA 2VZOA 2R1VA 3AS0A 2CBJA 2PI6A 5I23A 3CHFA 3CUGA 1R9GA 4ML4A 3GXNA 3F5KA 1M53A 2JIWA 3NSMA 4EAMA 3N17A 1R33A 4B15A 1GPMA 4MJ4A 3WQWA 5D9PA 3L4VA 4UZSA 2XN0A 4CUCA 4B2YA 2EPNA 1NP0A 3WMCA 1V3JA 4FF5A 2JF7A 3LX9A 2GK1B 2VVNA 1UUQA 1Q7RA 4J3SA 4CD8A 2VT0A 2E9MA 4ENTA 2RK4A 3PQ7A 3OGVA 1HNYA 2VL4A 1PJ9A 2VRNA 2CETA 3I3DA 2A9VA 3OA5A 4AUEA 3W82A 3AHZA 1IV8A 4HMEA 2VX5A 2YL9A 4WF7A 3WQVA 4PMOA 5D9OA 1I1WA 3ALGA 1JVNA 3MKKA 5I24A 1KB3A 1OBAA 3EFEA 3CLWA 1SOAA 3CZAA 2WBKA 3W29A 3ARVA 4NF7A 2E4TA 3SCWA 4OKDA 4FK9A 3RM4A 1KGWA 1HVQA 3SUWA 3CMGA 3WUEA 4AEFA 2WZEA 2ZXBA 1C8XA 4LYPA 2XN2A 3MMWA 1GCYA 3P9RA 5SYAA 1C7TA 1FFRA 3DHPA 4CD5A 4OOUA 1H49A 5IHRA 5D9MA 4ADSG 2BXZA 4J3UA 3W28A 4RKWA 3LRKA 3BAKA 1HJVA 1UR9A 1H2JA 4W87A 3SOZA 4UTFA 3T08A 4R7GA 1J0YA 2E40A 4AZ7A 4S0ZA 2X1IA 1O1YA 1GOQA 1IZJA 2BY2A 3AJ7A 1JGIA 3PQ8A 1KGXA 2YFNA 3SCUA 2BVTA 4PMQA 2VI0A 2DSVA 2VR5A 4QLKA 2J7EA 2VKTA 3L4WA 2AOSA 4ZEPA 3AZTA 3FSEA 1AMYA 4Q7NA 1NOWA 4D72A 3DDGA 4AISA 1ISXA 1C3FA 1JYXA 3BUDA 1QF7A 5AYBA 1V3LA 4E08A 1C3OB 2EEXA 2HVMA 4H8VA 3BVTA 3DECA 4Y7EA 1LJYA 5FIPA 5A6BA 2J47A 4AUMA 4BQ4A 1W1YA 1E6SM 1CGTA 1QHZA 3JUGA 1PZ2A 1KCLA 3PZVA 1GJWA 1KXQA 3OZOA 1GGFA 2Y5EA 3CZEA 4Y1GA 4NZFA 4GIAA 2R1VB 1EDGA 1BYCA 3SUUA 1UWIA 5ABHA 1MW3A 3GXIA 1W1PA 4AZCB 4CD4A 2E8YA 2EACA 3N12A 3ZSSA 3AMLA 1UHVA 4NXKA 2VURA 5FKYA 3PQ6A 3K8LA 3IAQA 3D4ZA 2VVSA 3VDAA 2E0PA 4CN6A 3BVUA 5CPQA 5DT5A 1GGKA 1KWGA 1TCMA 2F61A 1WZLA 3A47A 2BS9A 3WENA 3PZIA 4CCDA 2VUYA 2W61A 1O7DC 4AZ6A 2CESA 4ENPA 2F7QA 4WJXA 3DYOA 1I1XA 3LPPA 4D6HA 3DDFA 1NQ6A 1WKYA 3NCOA 1OGSA 1UWSA 2ZUUA 4D6CA 1GOOA 4D1JA 1WE5A 1U30A 2ABWA 2XSBA 2NV0A 4BS0A 4B3LA 5I5RA 1J9YA 4NX0A 2RK3A 1J18A 4UNIA 4GQRA 1CXLA 1US3A 1Q2UA 4C7GA 5EFDA 2JF6A 1VBRA 3CH9A 1JL8A 1XYFA 4D6DA 3N9KA 3OLDA 4FNRA 3PZUA 3AHXA 3TTVA 1B1YA 2BHYA 3GZAA 3FAXA 5HXMA 3T2QA 4TVUA 1E15A 1HKJA 2JE8A 4D6EA 1PX4A 5CPTA 1FYEA 1JZ6A 3NONA 4CU7A 2XFFA 4M81A 4V27A 2JALA 1A3HA 1HVXA 5EB8A 2WMJA 1BYDA 1PV2A 3VX0A 2XM2A 2WC4A 1OT2A 1CECA 3BGAA 2PWDA 1GGJA 1ZB5A 1WNOA 3QGVA 4M80A 1QHPA 3WH9A 4HP5A 3T0DA 4YHGA 1QI5A 1TVPA 2A3CA 4KMQA 1J0ZA 1GGHA 4JL1A 4PMYA 2YOCA 4MTCA 3D52A 3PQ2A 3VSUA 1ESWA 4CVWA 1GONA 3UOWA 1JFXA 1K6AA 4GXPA 4J3VA 3VUPA 4F79A 3EMZA 3BVXA 1OM0A 4D6IA 3DX1A 3I3EA 4BF7A 1D2KA 1J42A 2YIHA 4MNKA 3WBAA 2F2HA 4ZE5A 2EPOA 4I4NA 3WNOA 2D2OA 3PQ3A 4R5EA 3ARTA 2VX6A 4IM4A 1TMQA 1DHKA 1E5JA 1VIWA 3CZNA 1TE1A 1HTYA 3VMNA 3SCRA 6CGTA 4UQCA 4MJ2A 2CCRA 4OBSA 2VZTA 1ISVA 3MUAA 2A3AA 3BCFA 4HOZA 2VQTA 2D23A 3WH7A 1E6QM 1HJWA 4JKKA 3M3PA 1L0PA 3VDBA 4W8AA 1JZ2A 1TQVA 2DSKA 3S5ZA 1JZ8A 4C7DA 2WB5A 3EBVA 3WIJA 1UKTA 4HPHA 4N0RA 3VINA 4BTEA 4P8XA 1NOFA 3B8SA 2EXOA 3PTQA 1BF2A 2UY5A 1CDGA 2BV9A 2W5FA 4PBGA 1KGUA 3AMCA 1UASA 3ALFA 1UH2A 3DX3A 1ONSA 3CMJA 3T0BA 1UD5A 5CPSA 3RJYA 5GQBA 5I6SA 1TR1A 2WMGA 4NZCA 5A6KA 3PQ4A 1GHRA 1E4MM 5CSYA 3HG2A 1A9XB 1CXHA 1KTCA 3A6OA 4QCFA 4BIMA 2YLAA 1KFWA 1KXVA 1MWOA 2WCGA 4DO4A 2UY3A 4AIUA 3B36A 3AQUA 3EJ6A 1BTCA 4KRUA 3VMOA 2V38A 1E6NA 1K9FA 1K9EA 3EN0A 1GNXA 4P7OA 3PQ5A 3UCQA 3AYSA 1DTUA 5A95A 2ZX9A 3PTKA 3WD0A 1J01A 4MNTA 3DX4A 5IDIA 1H0IA 1HT6A 1W1VA 1KXJA 1Q6GA 1CWYA 2GJXA 1WZAA 1CZ1A 1LLOA 3BXWA 1KWKA 2QLYA 3VIGA 4OOZA 3NIYA 1Q6CA 4HA4A 4UOQA 3WH8A 1WAWA 3RM8A 3L2MA 4JQSA 1JDCA 4BZYA 4AC1X 2IGTA 1GQLA 3MMDA 4UFJA 2FEXA 1CIUA 3DYPA
chains in the Genus database with same CATH superfamily
1Z0FA 1GPNA 3KPQA 1F4YH 1X9RA 4XZ9A 3BP6A 1CDEA 5CDFE 3BVDB 5E08H 1YADA 4R0LC 3OIWA 4C4XA 4LSTL 1OLZA 3TM6A 4UE3S 3HSKA 3MJEA 4B5VA 1Q57A 4UFOA 2NX5A 1MBZA 2X1MA 1G7PA 2DW6A 4YT4A 1GR7A 1M0TA 1FWIC 3RVKA 4HFRA 3X1MA 1OIFA 3MOAL 3N25A 2H4HA 4Y4FA 3V0FA 2ZJ0A 1WBHA 4XHQA 3WX7A 4JAWA 2X3FA 1E30A 1GL3A 1ZJYA 1S3SA 3AUAA 2H47C 4KGJA 1S7RB 3P9CA 1G5GA 3OKYA 3OA3A 4KXCA 1V0NA 3ARDA 2VCOA 4PJBF 1S5MA 3CLMA 1WZEA 4ORZC 3LGSA 1IZ7A 1W3HA 2GI7A 4YR6B 4Y9OA 2NX5B 3PZNA 2LDXA 2PH5A 3Q3JB 5D8JH 2XA8L 5EIXA 2WVGA 4XODA 1KB5L 4MULA 3KZOA 4BK5A 2XWEA 2HJHA 1AUQA 2C9DA 2LDBA 4WZZA 1MZPA 5K3EA 3AUWB 3BUYB 3DPBA 2QS8A 1FG2B 2ZUVA 2A85A 3E0XA 5LDSA 4HOWA 1WRBA 1MKFA 5C0FB 3I02A 3IJ9A 1Z7EA 3BISA 2DM4A 1L3BA 5FBZA 1P1CA 1BG6A 2Q3JA 4O58H 1B3ZA 2OD9A 4NABA 1MZVA 4ERSH 4DJED 4FGSA 5FO1A 3KD4A 2ZB3A 1QSFE 2HLDD 4KZEL 4DTGH 4MM1A 5DTFB 4AL8H 1KY7A 3M8KA 3F9CA 4FJYA 3W5SA 4OLZH 4MCZA 3VXRA 5I7UA 3BH9B 1MENA 3UXHA 5KTKA 3L9XA 2H6UA 1IZ9A 4I5EA 2PUVA 4RPHA 1H5BA 1HP5A 3WN5B 5C6PB 1TM5E 2VXQA 4DR4B 4PC1A 4GI3A 2F00A 3AB3A 3G9VA 3S2CA 3OF3A 2XQKA 4OO3A 5EQFA 2RAPA 5HGBB 4NZPA 3JAMA 2V68A 3HQ4O 1ZSDA 3QPCA 1NF8A 2TODA 3EWUA 5I82A 4QNRA 4E94A 2CVFA 3KZVA 4I9HA 3QNXA 2HPMA 5IWAB 3EFHA 2VTVA 4JGGA 2IADB 3W06A 2EU8A 1O5QA 1RQ5A 1OW3B 2ZRNA 5DBGA 3P2BA 5F9OL 4X6DB 1RLDA 3TCEA 3AM8A 3QJFB 1OAZH 3U7FB 4NBZB 4TYPA 4LARL 4YMUA 4PN3A 1H23A 3GG2A 3EYUH 3OOQA 1E6UA 1I10A 3U82B 2X2JA 5CGQB 2NW3B 2VUKA 4N2FA 1E55A 4AITA 1H1LB 2NY0D 4OQFA 4X6BB 5KYXB 3W73A 4AG4L 4U4AA 2V2WB 4V2BA 1GVEA 5DA0B 2QCCA 1IB0A 5KZCB 4JM2B 3IRSA 3FR7A 1WQ4A 4MNGE 1FE8H 4QULA 5CRIA 4J8PA 2V67A 4E12A 2WZ5A 5K8TA 1V1RB 2BP1A 4FALA 3LOUA 1L7DA 1PTDA 2CLKA 3UG8A 2P35A 4G23A 1XIWC 2ZCHL 4KBGA 3D31A 2QJWA 4Z86A 2TPSA 2PCPA 5FTMA 3MXWL 2Y24A 5FSEC 2ZWIA 3S5LA 4M5SA 3CUSA 3ZKAA 1YHTA 5F2EA 4BFJA 1G1OA 4APQC 2QSYA 2EG6A 2HA4A 4DGWC 2V98A 2CRIA 5EMLA 1I6WA 4QYSA 5KBPA 2JK0A 1W48A 3VKKA 3G0BA 2BNQE 4ZAKA 4OZHB 4WI9A 3GT0A 1CD1A 4DK3A 1PS3A 4ZW6A 2E7ZA 5ETJA 2OX5B 3KTAB 4OMCA 1X5HA 4W9LC 1E62A 4HL6A 3OJMB 2WQWA 5KG9A 4DUZB 4NO3B 2UUDK 2AQOA 3UZYA 3A4JA 3FPKA 1EZ1A 4Z7UF 1L4FA 1M2EA 4AYWA 4K94L 5F78A 2HV5A 4KK8D 2FYYB 4Z42C 4BZXA 4JFDB 5IY5B 5MHTA 2QIIA 1MJ7H 4YXHH 2VZUA 1XC6A 3FQWB 1R5NA 3GHRA 4Q9AA 3BWZA 2DQDH 4HJJL 4A8JC 4PG9B 1A47A 4NCC1 5LDHA 2K6ZA 5EHZA 4UTBA 4AT1A 4WCFA 4ZHSA 2G75B 3C5JA 5AVYA 1BCIA 4HTYA 3RS4A 2OBFA 5HDBB 1XTRA 4A0HA 4DSAA 4LO9A 2I24N 3QXUA 3AR7A 1FCBA 4DWJA 2P4QA 5AC4A 1AI1L 1CL7I 4LFHD 2NY3D 5TH2B 1XA0A 1HO4A 3N91A 1K9SA 4EMSA 1Z07A 5T9BG 4AKOA 5TIMA 1PVNA 3GI8L 4LXTA 3G6JB 5EEZA 1CP3A 2YFYA 3IP7A 3O3EA 2R1WA 5T4BA 3FN3A 3W2LA 1A5MC 3T6VA 2B0SL 2VDKB 4LKXB 1HFKA 1IWPA 1IUOA 4QNWA 4XC3L 3PGKA 1U8NB 4YRRA 4KRMB 4AYXA 3MMZA 2UDPA 2Z8XA 4G37A 4XPIB 5JVDB 1JPMA 2J85A 1KLFA 2J8HA 2ZF8A 2B7CA 2I2BA 3SS8A 3NIFF 5IDYA 1GY2A 3OJEA 3QEJA 2ENQA 4C6BA 3CVJA 4WW1B 1X5LA 1DWQA 1S7QB 5I19L 2V0GA 4C4RA 4MW1A 3BXPA 3HRIA 3IQIX 4FZIA 1BOFA 5C35A 3W0WE 1CUZA 5JPNC 1FP8A 4HS8H 4IHAA 3T9WA 4CHTA 2OOFA 5GNXA 1U95A 1K4CB 3E48A 5DD1L 3T7JA 2V5MA 5FOXA 4QWWD 4RK8A 4EN2A 3X17A 2ADIA 3CY6A 1YY8B 5FAKA 3O4LD 4P93A 5BV7C 4AZ0B 2PD6A 3CPSA 5AAMC 1F3LA 2FU5C 1W0YT 5HQEA 2I9PA 5FEMA 1CF4A 4PY2A 5BOSB 5E5CA 3G02A 4X9IA 1CUBA 3VXNB 3NNTA 5L0QC 3RHWF 5BXFA 5LPNA 2C3VB 1EGZA 1UPAA 3EXHB 4KKCD 3ZE8A 3CC1A 4ES4A 1EQWA 1HORA 3FUKA 2BZ0A 4YDZA 1R9NA 2XCUA 3SDCB 4FQJL 3SCMD 1CTQA 4KR9A 4C4BA 1L5QA 1XTUA 3Q1SH 5ALOA 4F15C 1SOQA 4OTXH 4FKHA 3TJRA 4AC2A 3GSUB 2HRGA 2PWEA 4QUGA 4OIMA 3QEUB 4QOKE 5LBIA 3NALA 4YP6A 4YUEH 3VR5H 1QQAA 3VNQA 1W3JA 1N1DA 3S5OA 4XA8A 2OORA 3HC0B 1E9ZB 2J9YA 1OCBA 3MJ4A 3KQPA 4GI7A 5I19H 3VR2D 3IMEA 2BFGA 4LSRL 1O58A 4B4DA 2IXEA 5A5WA 3ABLB 1RAGA 3P9NA 2B1IA 3WNBA 2PDXA 5HYSA 2J0SA 1E4XL 2XPGB 2DT5A 1SW7A 3Q37A 3PZRA 1ZAIA 2ZM5A 5EUQB 4FZEH 4OTKA 4OZHE 1RULH 3QHZL 2XFRA 1HDCA 1ZK0A 4HFNA 4TQPA 3WV5A 2BWIA 4GO9A 4XBGA 2G1JA 4JR0A 1KENL 1KM5A 2QS9A 4F2HA 1QP4A 2HT6A 4MS1B 4NNCA 3AHYA 3S8YA 2IYTA 3BJIC 2FIKB 4D4MA 3VR5A 1U2TA 3PNLA 2RGXA 1XF1A 2L3BA 1NV8A 4LSSL 3U9SA 3PPVA 2V6BA 5M3WA 5T4FA 4L72A 4RLIA 1S8OA 5C07D 3VGAB 2E6JA 3OJ2C 4NS0A 2Z1PA 4H6EA 3CKLA 5A7HA 3H18A 2FXVA 2AXEA 3N7UA 3ARFB 3D0KA 3CVIH 1E63A 2X0WA 3OCUA 5C7IO 5CSBA 3DKIA 2CZGA 3MT9A 2EZ0D 1MW1A 3PF9A 1EHAA 4US5A 3HO6A 3LXCA 3GLAA 1ADQL 3JS3A 2FF5A 3FZYA 4Q4PA 3N2IA 5C08B 3SY5A 3VDCA 1MREH 1ZH6A 2OO7A 4QT4A 2R2HB 1JCMP 1OM9A 4BGUA 4HWOA 2W8ZA 1E1NA 5AVWB 3A0UA 1R0RE 1DIBA 1KOAA 1SBYA 1N2HA 1EGAA 3UTSB 3KEDA 2C18A 1ZM2A 1N6OA 3QLEA 4TTDD 5LXGL 5DI9A 5LAXA 3O2NA 2CKBH 2D9QB 2AJUL 1GOHA 1M2VA 5FM8A 1RI3A 2VNCA 3T2NL 1UB5A 4U28A 3UWQA 5DTJA 2P5EA 1YZZA 2DQIH 2IE8A 3FIUA 3NWOA 2E4FA 2UBPC 1QNRA 4JTLA 5DHXB 2I6XA 1HDIA 5HTKA 2XNDA 3CSDA 4MUXA 3WDHA 2AK2A 3JV5A 3QOKA 1KA9F 2X1LA 4AO6A 1Y82A 2PUEA 4HFUH 3QQDB 5E00A 4DEFA 3ZE7A 4N82A 3QNZB 3PHBE 3ND6A 4NT6B 5D8DA 2DMHA 5GRVK 3UIEA 5EU6D 5JIPA 2UVPA 4GP5B 3ET9F 1KCKA 5B4UA 1F8YA 4UHEA 4E7OA 4R98A 5E9DD 3LDBC 2Y05A 4K39A 3BPOC 1HQTA 4M1OA 4ZMPA 3TOSA 3QXGA 3COYA 1A9XA 2C1IA 3V35A 2G9KA 1NPUA 1KFEB 4ZSOE 4XV0A 1R3WA 1ZG3A 1RPAA 3K4ZA 3RSCA 4QT0A 1H3XA 1EX1A 1EVYA 1I6NA 4EI5C 3DHVA 3QUXA 1WZIA 4RSHA 1F5NA 1A14H 5AKZA 4KMRA 5KPDA 3RWOA 3V1NA 2CLIB 5FPKA 4PNEA 4F5ZA 1NFAA 1FUYA 3EDFA 3JZIA 5IAGA 2L17A 3MJ7A 1ID8A 4YONB 1HHHB 1WCYA 4YZWA 3BP4B 3QNYB 4ZQGA 4LG1A 1YZKA 5K0SA 4GXQA 4IISA 1G8PA 3HB3D 3KYDB 1TIUA 1U1HA 2O9RA 1YJXA 3T1VA 1B54A 3CZSA 3RVUC 3KYCB 4WECA 4NU6A 4YO0A 5JH1A 2GUOB 5EC8A 2DTSA 1CQJB 4W9DC 3H26A 1LJUA 1P2VA 1H85A 5FS5A 4PRPE 1DX9A 3TBTA 2INZA 2K7FA 5TDPB 2JI2A 2VZSA 3L4KA 3WHE0 2WMIA 4EPWA 1S7XA 3SKNA 1U0RA 3EZ2A 3U4AA 3L0PA 3VWKB 1V03A 1I5OA 4UFLA 1RQNA 4PN7A 5I17A 4UUIA 5JTTA 1EM8A 4W4NA 1A4LA 2FB3A 2HAEA 2PL1A 3I7SA 3U09A 4U7SA 4OQVA 1DAKA 5AECA 1ZLXA 1G3IA 3PC4A 5L4MA 1IBCA 1P1ZA 1G6CA 1G0OA 2I56A 3WJZA 1VIYA 1XBXA 3RS5A 3HZHA 3ADDA 5DD6A 4DGIH 1EAJA 3ZZLA 4JROA 1B0WA 4HBCH 1YI8A 3B3DA 4NSBA 5E7BA 4JT4A 1E9LA 5LUBA 2Y6VA 4LVCA 2BVYA 4RD4A 2V3FA 5EP1A 5K9JH 1H6AA 4W88A 1ZINA 1M6OA 3IAS1 4ICIA 4LX8A 3H2MA 4QFMA 1XBYA 4ISCA 5HCUA 3WHLA 2MH4A 4R3WA 1NEZA 2C3VA 1CQIA 3Q7RA 3IPRA 4HYQA 2WWYA 2VDRH 1JRLA 4CMIA 3IKMB 1FU4A 2R79A 1TZJA 3QI9D 3LA6A 1R66A 1CLEA 2NU7A 5LKAA 2R25B 4HGWA 4I4TA 1ZPUA 4KRXA 3VNIA 2UXTA 1ORHA 3PABB 4KEUA 3DA8A 4B50A 4M3KB 5HDQL 3K0AB 2HMTA 3MOAH 2OHJA 4JKWA 1P9RA 1F6LL 2JIMA 1JULA 2ZDGA 3GJEB 3E80A 4YDLC 4HPNA 3MWJA 4I0KA 4ALMA 1OTUC 2EFEB 1YNKL 4XBMA 2J7KA 1OC7A 1JB1A 2GKIA 1CZ8H 2VCYA 4ZUTB 3AOGA 2VOTA 5DRIA 2JS7A 5C9KA 1E71M 4ZK6A 4C3ZA 3DETD 4GRLC 5D6DA 4LCCA 3ZLGA 2ZR7A 3OQEA 4XVUA 1A1OB 5AZ1A 4NKDB 2IH3B 1WA5A 4GL2A 5D6NA 3P14A 3QJGA 5GIOE 1C7SA 3C5CA 2EHJA 3SYLA 1A8QA 1CK0L 2P45B 1JKXA 1WQ1R 3ICWA 3UAEA 4J9UE 3U7YH 3BP6B 3WQOA 3ADKA 3EHBD 2J9FB 3VKJA 4UTXA 4NJMB 3AADB 4RY2A 5HTSA 1SXPA 4K5QA 4TRNA 3M8OL 2HWGA 5HHXL 5D04C 4GS7C 2X53A 1TJPB 1BKHA 1J8KA 3ITCA 3AW5A 2TMDA 1CW2A 4E5PA 2FEOA 3EJPA 3K0EA 1JCXA 4D9LL 1TPB1 4FOMA 2QLNA 3NXKA 1CLKA 1NJGA 3FBGA 1LM1A 2JIOA 3IBCA 2BY4A 2CMDA 5AM5A 1H6FA 3N0RA 5DDIP 4ZAXA 4GP9A 3VOJA 4Q18A 2HJPA 2HL6A 4R2KA 2QVXX 3SHSA 4KMOA 4I3SL 3MCOA 4RGBA 4D8WA 4HDRB 5IMLA 3REVA 1ILEA 3SPHA 4WEBH 4ZMWA 1H3FA 3ITNA 1HIMH 2EBHX 2WRZA 1JI3A 2ZT8A 3ARSA 4K7YA 3PFRA 4LPKA 1RHFA 2V5BA 1P7QB 4B81A 5AFAA 3C4VA 3DOUA 4IBTA 5DBTA 3VTTA 4LX0A 2GTWB 1P4AA 4WO4A 4D9BA 3PUZA 2HO5A 4XE5B 1XLFA 1WPGA 4DUXA 2NVDA 3THRA 3OR7B 1U92B 5FUZH 4QGFA 3G8RA 1DE6A 1H2AS 5CCEA 4HLZG 5D93B 3HG1D 4XCCH 2CZEA 3QFEA 4ESKA 4BF9A 1BXNA 3TTXA 1C9SA 2R85A 2EP6A 4TV3A 3G8YA 1LRKA 4US1R 1DBVO 1ADFA 2EX0A 4LHZA 3BIOA 1P6WA 3KLNA 5D7LE 3BE1H 3RRZA 1NMAL 1DQQB 3PWNA 3F65A 5TAOA 4GLEA 1JEQA 3IUHA 1OWWA 3RU8L 1EIZA 4PLTA 3OD5A 1A3RL 7REQA 3TPKA 5HIMA 4BZZA 1S1CA 5IHZB 4Q9RL 4CT5A 1YEWA 4ZX4A 5XIMA 3LI2A 4E15A 1PHRA 1I7QB 1NCBH 3CV3A 1A3CA 5MHSD 4KCVA 4JG5A 5TMBA 3VZRA 4XP6L 3VH4A 3OKDA 5EEYA 4L56A 2W6OA 4NE2A 5IFHH 3WNVA 3ESQA 3CVUA 3GT3A 5M5BA 3ISIX 3HV8A 3LQAH 4ZFCA 1WWBX 3ARGA 3N87A 2IH5A 2J46A 4O2BB 1VFMA 1Y1TA 3FOFC 2D5BA 3LCRA 4WESB 1QBAA 2HA2A 2A4EA 5F1OB 4NPKA 4XUYA 3RWEA 2KMLA 5TS2A 3ZWBA 3WMRA 1GKRA 4FN4A 1IZZA 5KU1A 4E36A 4AJJA 3BRCA 1WP6A 3OZUA 3TP4A 4DR1B 4FMFA 3O3UN 2RH9A 5KS9E 2WSKA 4ZQCA 4L8YA 1CZUA 1XMEB 2AX3A 1RC1A 1OPGL 1KYYA 4X6DA 1JLLB 3UXIA 1TO3A 3EG9B 1SU7A 5C0CB 3IF1A 1EFPB 3BDVA 4D6FA 5AKKA 4X2RA 3UB2A 4R8SA 1HHKA 5CJJA 1YEKH 4EIVA 4BV3A 1W5TA 1GJIA 3UBXI 3NEXA 4HT1L 3UP8A 5BN1A 1SOMA 1JF5A 4XQCA 5TIIA 1DJWA 3NR0A 4NQEA 3UA4A 2Z1MA 1L5YA 1H0KA 3MRJB 1GL6A 2VJCA 2BC4B 5HS4A 3M5WA 1QP7A 4N18A 5DURD 1ZCOA 3FJTA 4ZMNA 5IUKC 2NYYD 2H3KA 2IEIA 5IKXA 2BTQB 5AL0A 1T10A 2ZJAA 2BOCB 5JAPA 3QEQE 3NB0A 1VKZA 2JFQA 2BEKA 4G89A 4CLRB 1GPWB 3RV4A 4JQYA 2OMNA 4X60A 4O53A 2RAGA 2P77A 1KFKA 4GYWA 1VZWA 1MV8A 8AT1A 1DQIA 3TW7A 1K6XA 2PR4H 4NKMB 3OXRA 1CZ8L 2AMGA 4OQ1A 1QATA 3BMQB 1KCRL 1F8XA 3NNSA 4CG1A 4M1KA 2IO5A 4A7VA 4N25A 3W86A 1U58A 2OTPA 3GXFA 1PIIA 1HAUA 1SOUA 4EUPA 3MW7A 2BDNH 1NOJA 2VEKA 1U8XX 5T3YA 5DRYA 4XBPA 3SB0A 3SXUB 4EIWA 2HK9A 2X9WA 4YR6A 5EG5A 3RUAA 2X6UA 2XKNA 5C0IA 1AXTH 5E6IB 4XD4A 1F42A 3FOMA 1IQWL 4LY6A 2Q3RA 2PZLA 3KBOA 1AXEA 4Y5VC 2Z95A 4I77L 4QCIB 3OZAA 1HSBB 4IG2A 3PPFA 3MGAA 2JIXA 1KYOJ 3EJYC 2HRLA 4YO0B 3V8NA 5FGBC 3TO4D 3UBTA 3IACA 3I6IA 1KDOA 1XD9A 2KLSA 1DOSA 2EFGA 2YNMC 4JLBA 1R34A 3H7UA 1U8FO 4CD6A 1RLIA 4CVXA 8XIAA 1WCV1 3KBBA 1PKQE 2Z2KA 1B3IA 3H21A 3EWIA 3B12A 4P3CH 1MB2A 1YRAA 4RZXA 2ZS9A 1GGIH 3WMLA 2XXGA 4OM7A 4DPBX 4N1EA 3OQHA 3BI9X 1VI6A 2WXOA 4QRSA 1VG9B 1DBQA 5ALQA 2WKLA 1N9GA 2F90A 4A8TA 4OD3L 3AOEA 2ACRA 2OSLB 4MO2A 1JAEA 3V46A 4S2CA 5CB4F 1X1ZA 3KCOA 1H3EA 2ZRQA 2XD9A 3S8FB 1T1JA 1T21A 4IGHA 3GGOA 1I1AC 1MI3A 3O7UA 5IK3A 3AU1B 3QXSA 5F2KA 3NYZA 2IFGA 1DANT 1HYQA 3KS0H 4LE2A 1YYML 4MKMA 2FBJH 5KZDA 3PYXA 5JC8A 1WFMA 1O96A 3M34A 4DB2A 4O4JA 3EFOB 2LOEA 3VRLE 4AUUA 1Y8AA 3BAJA 3A6DA 5A03A 2PZKA 2G4GA 3L6UA 1A9EA 3FUHA 1W4ZA 3PPHA 1EEYA 4TLTA 4IXNA 4ZFOB 4ETYA 3EOEA 3U3JA 2YA0A 3EYPA 3K31A 4TWRA 2HA1A 3UR8A 1S89A 3P1JA 5MHSE 3BIKA 2IUZA 4MBRA 3FCEA 2I4MA 3OBEA 4J6IA 2AV7A 1JI1A 3BKCL 3JQAA 3THMH 5T1KD 4PQRA 1YR6A 2REQB 1E9QB 1U8IA 4BMXA 5J56B 1YMUA 1PR9A 3FVRA 2WN2A 1K5HA 1ZM9A 2J30A 5EO0A 3I4LA 2X8BA 1OWLA 4PZEA 2VPTA 1FYDA 3CW8X 3M6FA 1MNQA 1OQXA 1Z2AA 1VPOL 5KIAA 2WBLC 3ZHZA 5E1AB 5JUVA 2JXMB 2ARJA 2Y76A 5ACZA 3HI1A 2XUFA 3B83A 5IVIA 1Q2SA 4RV5A 1F20A 4KKQA 4I6KA 3E0QA 3QFTA 3TR5A 3L84A 2QN8A 1I0ZA 4JFPB 2J5LB 4R3SA 4PC3A 1VACA 1GCOA 1HI6B 4UDUB 2FVYA 1F0NA 3DWGA 1XRSA 2Q8XA 2ISVA 5DJZB 3QY9A 2GFQA 4LALA 3TDNA 3QW2A 5D7IE 4MFEA 2IC5A 1S3KL 1RK0B 1Q6QA 3ZJ7A 2EHHA 3BO8B 3MV9E 3N6XA 3FGPA 1RSYA 3KQKA 2IS7A 3TYZA 4G5DA 1YXYA 2Z8YM 2CLRB 4JIEA 2KKQA 2LHAA 2CJ3A 5TE7L 1YS6A 3ZD6A 2PO7A 3WLLA 5BQ7B 1KXZA 3RRQA 4YWGH 3SC4A 3F71A 1GGMA 2WVTA 3AG1B 4MO9A 1ZONA 3NRQA 2DWPA 2F55A 4UTAH 3D8SA 1MFUA 5DA4A 4ZVSA 4IW4C 4C88A 4E70A 4PJ9A 5CLIA 2DL2A 3AU1A 2D1YA 1TGYA 4K6FA 2ZR9A 3CPLA 5CFHA 1WF6A 4BO7A 3R8FA 4O2FB 3PULA 3LCGA 5DH9A 1AFVH 4OZGE 2XHZA 2NPLX 4IVPA 2PE4A 1DQTA 3BXGA 2NY7H 3WS6A 3D3JA 1P39A 1O7SA 4CVNA 3NLLA 3GZ3A 2P53A 2WLIB 2VXUL 2Z1KA 1XQLA 1AHWC 2Z5LA 3BVNA 5IFLA 1DJNA 7YASA 1PJ3A 4NN7B 1GZPB 1G2OA 4LHYA 1RULL 3C6QA 4B96A 5AKYA 5IQ7L 1RACA 3CZ9A 2R1PA 1FWDC 1MH5A 3M1CA 3VXSE 4P4RB 4M6WB 4EOWL 4Z95L 1ZCCA 2ZVQX 1OAAA 4KRTA 3E61A 5CX1A 2ZCLL 3SDAA 4KK4A 2D2FA 2YPKB 4GVPA 5BNFA 1WFTA 4N12A 4GKSA 1OINA 3I75B 3A9VA 3ROTA 3ETNA 4CCEA 1PL9A 4JL2A 2VDWA 2Y07L 2GMWA 5LXXA 4EYOA 1SKQA 4Y1SA 4KR6A 3B0PA 5HKBA 3CUGA 4CMAA 2G5UA 3F5KA 4BO8A 1INDH 3AJEA 3D02A 4HWZA 1M53A 2JIWA 1UDWA 1HZZC 1KV3A 3NM3A 4XISA 1LEHA 4CBPA 4MW2A 2X0SA 1H05A 1HQRB 3WQWA 3I50L 3CIQA 4B2YA 4GMTL 3B04A 1F6AA 4HNSA 1BS1A 4XQGA 2QZSA 3E9RA 1QEWA 1E5LA 3QISA 1UUQA 1NCUA 3VU8A 4JDTL 4WAFA 4OQMA 2H2FA 3EXLA 2XBLA 1H8OA 4OU4A 1QSGA 2CIKA 1TTTA 4KKLC 3VYNA 1YNTF 1YUNA 1XDGA 5A05A 3GQBB 3MK31 4IRXA 4C4YA 4HMEA 5GJPA 2FSFA 2GN4A 4KWHA 2RDUA 5IB3B 4PMOA 1YFKA 5D9OA 3O21A 3TNOA 1KYUA 1ZHOA 1KB3A 3MTBA 2APFA 1JU4A 2ZWOA 5D93C 3CRMA 1HOCB 3W29A 1KZ9A 2FT7A 3DXAD 5JW4N 5BQFA 1AKJB 2Y5QA 4RTLA 2BHRA 2XTAA 3ICOA 4FX2A 4EL0A 5HJ3B 2H4XA 3W88A 5KNLA 1RR2A 3VKWA 3OETA 3E0IA 2DDQL 1CBVH 4K9PA 2JCCA 1ZVYA 4G4IA 5FF4A 3RX8A 2V03A 4IIFA 3MI2A 3D3FA 4DG9A 3HR7A 2WWKT 1SCNE 4WGKA 5D51S 3PNVA 3V7AE 5BSMA 5HDOA 3C6BA 3KJEA 4HSAC 1IB6A 3LQAC 3K6FA 2HRZA 4PBWD 1LPPA 4R5VA 3NM5A 3O9WB 2ATIA 3T0WA 4KQNA 5FB3A 4PLOB 3ABSB 4J49A 1SK8A 1I2CA 4ERXA 1ZV2A 4YSDA 3IOCA 1OSZB 4L1DA 2GGIA 2OZNA 2DBYA 2YJTD 4WQ6A 2TSAA 2F6XA 2QD1A 1LK3H 4S3FA 1X97A 5C0EA 1GVOA 1T03L 1QSEB 1XRSB 4AY4A 5A62A 3H2EA 3RFZC 4HDNB 4N8VB 1AI1H 3OU8A 3DB1A 1XNQB 1VL1A 4DMFA 4G84A 4Z0JA 1M33A 2FMFA 3PEEA 2YJZA 4LUSA 4CLOA 2H0PA 1IAIH 1ELOA 2OFXA 2I4NA 2CJWA 4F3RA 2VSNA 4Y1GA 5ARCA 4IMRA 1KAHA 5IIEB 2Z28A 3AF5A 3WIBA 3G2GA 2VSMB 3W1MA 1OKKA 1F1JA 4DLTA 4L4LA 2VHQA 3ZSSA 1PEAA 1DKUA 5I16A 3TLKA 3QOYA 3D4ZA 5I8EB 2JIXD 5IR1A 4IS6B 4TKMA 3I6MA 3KB1A 1JN6A 3BB1A 2DOCA 3OPMA 1B0RB 1BQSA 4S1SH 3UYRL 1B0UA 2F1JA 2HA6A 2XDHA 1Y9DA 4Q24A 4IH3A 1VLMA 4J3BA 4K7VA 5DQ9A 3I7RA 1XL0A 1SQMA 3DYOA 1A02N 1JTEA 3DJFA 1CJCA 2XMSA 1NGZB 2N56A 4E33A 3GRWH 3MRQA 3NIGB 2YD3A 4P57B 5ALMA 3NT4A 2XV2A 4YXWA 4IL0A 1EUCB 4B3XA 4AVOA 4WOPA 4X7DC 4LS0A 5AW6B 2D7TL 1I51A 4P3PA 3PPYA 4CR6A 3EOUA 3TA3C 1RUQH 2Z1VA 3VFSA 2UZ9A 4EPKA 2LD4A 2DZSA 3ORFA 2IYPA 3M82A 5IKEA 4JQOA 3MJRA 4GIPD 1UPUA 4TYMA 3I23A 4EEKA 3ZVLA 4JY4A 1ULTA 1NAIA 2OCGA 3WQBA 3UT5B 3QYAA 3EGJA 1EGMB 4BQOA 1VCAA 4NNPL 4GVHA 2J32A 5EB8A 1AD9A 3FHOA 5KU7A 1FFXA 4TT8A 4KDWA 2AF2A 1A6WH 1SVIA 3NH7L 2V6JA 4LYGA 5I1HH 1H2ZA 2QAJA 2X5XA 3U9LA 4GQ9H 2A5YB 1EMDA 5IULC 5TBOA 4YHGA 5KVVA 4NL4H 2VL7A 4AG4H 1J0ZA 4S3CA 3CLHA 3FYUA 4WHBA 1S8DA 4NBUA 4Y9NA 1UUSA 3S8WA 2C9ZA 3O8LA 4NUJB 2ATEA 3UOWA 3HSYA 3BURA 3FDGA 4P3DB 3MTXA 1Y5VA 3TJZA 3DULA 2DKUA 3WSQL 2P3LA 3DPBB 5KAQF 4QBHA 1U9IC 1FKXA 5DBEX 4FR1A 5CJMA 5I4KA 2PCFA 4X24A 4O33A 3GC2A 3RVSA 1W6TA 3W8EA 2X58A 2F2HA 4TNVF 3EXJA 4NKQB 4LZNA 5DLMH 3F1LA 4JL8A 4PQYA 1N5RA 4APQB 4GBXA 5DLQC 3H5WA 3IXLA 4NQDA 4HYVA 4RPQA 1H6CA 3H3FA 1D04A 2QOEA 1R3KB 3Q43A 4RIRA 5DRZA 3VMNA 3SCRA 3L8QA 3LHIA 3UZZA 2J56A 5JW6A 3L8FA 2E4XA 3ZZTA 1IUPA 5ANMA 3AINA 4YC7A 2OWDA 1YC7A 1KDPA 4ABVA 2I65A 4LS3A 1BX2B 3Q3VA 5BRZB 3W3AH 2ISFA 5FHQA 2GK6A 4AROA 4H7CA 1F7VA 2JEYA 2BZGA 1FL6A 4O5OA 3TF5A 4IDDA 1MVUB 3MNZB 1C1DB 1TQVA 4RTKA 5T33H 1Q1EA 3IBSA 1PT9A 1VRWA 2C3OA 2PMZA 3FQTB 3HMXL 1R0AH 3CNHA 3PF2A 1WG3A 1BF2A 4XH2B 2B14A 5L95A 4J7UA 4P83A 2XVZA 1UH2A 2WZCA 3C97A 4LK3A 2YAFA 4ODUA 3GMRA 3MLBA 3RJYA 4A0GA 5BNZA 1R3JB 2VVTA 2YDYA 4JP8A 1YXMA 4ZAKD 4NFHA 4EXKA 4MRMB 3PE6A 4IJWA 2CUNA 4JO4H 2CDNA 3O6LH 4EI5A 4MA8H 3A6OA 4BIMA 4X9BA 2DWEA 1KFWA 4WTXA 1JJKA 4LXHA 1G7HB 4ZXBC 3SD7A 2QCEA 4CC0A 1JHKL 3SADA 4LCWB 3I1YA 4ZOLB 3OXSA 2JKSA 5B7PA 4D26A 4IHQA 2WVHA 4UU0A 3QPEA 1Y4DE 3VMOA 1X4ZA 1K9FA 2X4RB 2FJHB 2ID7A 3LUCA 4M1EA 5ILQA 1W94A 3PTKA 2N1BA 3GMRB 1W8EA 3SDAC 5IFAL 3NATA 1KXJA 3I6GB 3P2DA 1QRAA 2OXCA 3C5XA 2AK3A 4FBGA 1JPSL 2QLYA 3KHKA 5DELA 1RUPL 3BW2A 1Q6CA 3WH8A 2H2IA 3SC6A 3HJRA 3DV6B 4G6AC 1EVJA 3LTNC 3P9ZA 3C5SB 4UBDD 5LLIC 3TBSB 1QBLH 4JRFA 5CXSA 2PGNA 4JRXD 4D9FA 3OPSA 4L6CA 3SP1A 3WA6A 1ZA1A 1H2HA 4GT0A 4PRYA 1P6BA 2NY5H 2Y06L 1JZEA 2OUKA 1PKNA 2Z1SA 3V7FA 1HYSC 1M6UA 2NO4A 1H4QA 3EHBB 3P4LA 5CN1A 4H1LB 4JQCA 4AO7A 1JPFB 1ILWA 5F7JA 4WY0B 5ABEA 5T3XH 2XN1A 3ILQD 1NM9A 2FSVC 3NDYA 1THZA 3RVPA 2C5FA 4BX8A 3NH7H 3T0FA 2HY7A 3FMIA 2BHZA 3KTXA 3O2LA 2X0JA 1QRSA 2APVA 5AHWA 3I45A 3ULAB 3USCS 4UTPA 1W0VB 3PWGA 4I3FA 1U2GA 1PR6A 3G1UA 5CO1A 2BIPA 1FYTB 3VFRB 3K74B 1H0SA 3O0FA 4KPUA 4V3BA 4YRGA 5HZMA 1UA3A 3EYWA 3RT7A 5B7FA 2FWJA 3WXVL 2CFFA 2UZ0A 1T1WA 1E2JA 4KL8S 3CGWA 3KUKA 3ZZSA 2G75A 2PGXA 3AIRA 2VN4A 6ALDA 5I1AB 5EHFA 2J20A 2EVFA 1OHLA 4M8VA 4RGNC 3WE1A 2GN6A 3K9HA 3EDKA 4NHEA 4AKGA 3FLEA 4XAKE 3IP3A 4GXNA 3UBFA 4GRSA 2DW7A 4HIJB 1CRPA 5T5FL 3ZVNA 4IU2A 4G9DA 1VENA 2WFMA 4DEUA 3S2ZA 4AN0A 3NQGA 3L4TA 3WLKX 4PHGA 4OHXA 4MB1A 4GRLD 1ZSXA 5J11B 1JZ3A 2IQTA 1UWEL 1H9BA 3KCPB 1D0IA 5T8KC 2I62A 1EJOL 1HC7A 4QUJA 5ACLA 4LLYB 1U8CA 5CG0A 2CXTA 4J27A 3KX2A 1Z12A 2W9DL 4HNAB 3QFFA 1NQUA 4LCIL 4YGAB 1HSAA 3PVFA 1UODA 4IG4A 5D4QA 1JFHA 1G6VK 2LW7A 4WDIA 3TLRA 1VE5A 4AD3A 1AV6A 1BBDH 3WUWA 4RWHA 3WP1B 4Z7JA 4LCJA 4CIVA 1HF6A 4RZQA 4PUMA 1ZKMA 4WV1C 4JUSA 1FZKB 4MV8A 4HCDA 3TJMA 2NZIA 1SU4A 1QPGA 4OD2A 2AAMA 4NCXA 2VLIA 4BQNA 3ZE1F 5CP8A 3FNGA 3KPYA 3BWUF 2ANUA 5LCVA 2BONA 3V4ZA 1RYMA 1EVQA 3U7GA 1U8OB 2P49B 4EMZA 1FLNA 4DKFL 3PB3A 2WB2A 2GYWA 2JFZA 3FTDA 4KESA 4PNZA 1RRVA 3V0IA 1XQYA 1KI6B 4R0VA 1GPH1 3LY5A 1PS0A 3T6XA 3CVHH 1JKMA 3QAZB 3AIWA 1J5IA 3RU7A 1KJIA 2CNCA 2CU0A 1R4MA 4G9GA 4N3UA 4QOKB 2HO4A 3RUGB 4S0HA 1C93A 2B6HA 2TYSB 4N2OA 4O1IA 5INTA 2CBTA 3HVRA 3ZHXA 3TW4A 3TMQA 5K69A 1XLDA 5KX5B 1RS0A 4BCBA 3U36A 2EBUA 4FQXC 4S1VA 4YAWA 1ZWIB 4WWKC 4J0KA 3IIPA 1T9GS 5EPEA 5C53B 3U4KA 4DSYA 4XGZB 1Q7TA 3MC5A 1XGPA 1K7XB 4K3DH 3FU6A 3OCVA 3WLQA 2L18A 1UM9A 4O25A 1K72A 2A7NA 4PE5B 2QG4A 2I6GA 3MAJA 3GNTA 3SBPA 4UBNA 5C5EA 4N0YH 1KBVA 3B3AA 5ICEA 2ZRCA 4MKRA 5F9JA 5C92A 3WH5A 3CCHB 1E4HA 2ARKA 2EX1A 2LLEA 1RK1A 5JXWA 2AYYA 1GKPA 2WQRA 4FFWC 1S38A 4ZD3H 5MGNA 3GG8A 3Q65A 3T4AC 4QHUB 5SWQB 2N7SA 4QYOA 3TN7A 1KN4H 4QAJA 1QRNB 2D5AA 2ZCVA 1FKWA 3TYBA 3Q8MA 2QCLA 2IH1B 1QNVA 3U2EA 5FBQB 5HK9A 3ICCA 2ZTUA 1IC6A 3SN0A 2V9QA 3MIIA 2G60L 2EG7A 4YMVA 4F7TB 1J39A 2HMVA 5EXSA 3FTZA 5I6NA 5KTMA 3TLAA 1I9JH 5CSGA 5IMMB 4BSJA 2QJDA 2H2PC 4Q7JB 5HVNA 5C0BB 3E7FA 2BSTA 3SQRA 2NZUG 3KUCA 1RPQA 2DF8A 3K92A 5IWCA 4FEAA 2EF9A 1YBVA 1JIBA 5MFPA 2AKZA 3OB8A 4LEIA 3H1PA 5ERGB 1U1CA 3WU1A 2X0FA 3B5JA 1TUBB 1UK7A 5JCZA 4PRNA 1WWWX 1ZE3C 4PJGF 4J0IA 2EGHA 2C91A 4UEQA 1GHSA 4FNGA 1PGQA 4S1FA 3TPUA 5C9XA 1UGKA 2Y27A 4CJ0A 4ZEMA 1O94C 4LCYB 4BA0A 3BMVA 3NAVA 4MG4A 4R4JA 4WGGA 4L8CA 3TNYA 2X2FA 5EDSA 5C86A 2F3RA 4JUTA 4A39A 1L6GA 2WD9A 4MKHA 4KR3A 4K8RC 4EKXA 4O1EA 5F7LB 3OTQA 3TI7A 1RZ7H 1IVNA 3S1UA 5TPWA 5C6TH 2HBZA 2FZKA 4UR8A 3LZPA 1AV7A 4MDOA 1T1ZB 4JGBA 4J3OC 3G8BA 1DBRA 2C5LA 1YDFA 3GDBA 4L9AA 2V9CA 5JNYA 1I1YB 4ZXBB 1DYSA 5BURA 2CLIA 5E9AA 3H2AA 1XR2A 2J57A 4EJSC 4P5DA 1QGED 3E23A 4MS4A 2ZTKA 2YUWA 3TBYB 1Z9SA 3HU7A 4GECA 3LKNB 1EFVA 2AJVL 3HMXH 3F4CA 1K7YA 4LC8A 4XNYH 4YAJA 4F7WA 3CCBA 2FX3A 1FAKT 4C7XA 1O5PA 1OQFA 3LNMA 4K1GA 3QIWC 3BLBA 4J35A 4UB0L 1IYXA 3UC0H 4NZZA 2WZQA 3NV9A 4ACBA 4NK5A 1H3TA 2EJUA 3IODA 3QUCA 4EDHA 3MNWA 1LW7A 4IP4A 3N0PB 1Z6YA 4PZ0A 4Q3LA 4MZDA 1ND0A 2HLDA 4F72A 1IUZA 1AVTA 1KNOB 4LJKA 1INQA 1C1XA 3AM8C 2OPHA 2E37A 2QLLA 4JXXA 4WFKA 5INDA 5FL0A 1NJ5A 1HXYA 4OBEA 2XA1A 1KJ2A 3SMVA 3U4GA 4ES9A 2VZ1A 3BD3A 1SN5A 5JZBA 3E3HA 4FNLH 2B4QA 4XR9A 1RYYA 3STZA 3MLZH 2O3TA 5LNDA 4DLKA 3UJIH 1UDAA 1S9KC 2YKLH 1UADA 4X5LA 2IHJA 3PE3A 4L27A 3O95A 4J0HA 3KEFA 3OCJA 4LGPB 1WIOA 3ZDEA 1FVFA 1KLUB 2D3NA 3M0MA 3KBVA 3TVYA 1ZP6A 2E1RA 1IZYA 1VMEA 4R7VA 1EZLA 4BGEA 1N9PA 1KACB 4HXAH 4JOSA 1XCTB 3MKVA 3GUFA 1PTAA 2G1AA 2DICA 1U1IA 3UQYS 2J3DA 1IDOA 2PCPB 4ZW8A 2EG5A 5EN2A 5E0FA 4BQFA 1HE5A 4F7PA 1NE7A 1KORA 1FWFC 1JQXA 4N8DA 1PZGA 4WN9A 1QMUA 2QDDA 3H99A 1PJAA 3W7NA 4HBKA 3BOVA 2GM5A 4Q74A 5L9FA 4OU3A 2OXNA 2INFA 3PBYA 3B48A 4J90A 3SY0A 2YCLA 2DZWA 1OAXL 1W5EA 1EJFA 3K6OA 1ZK2A 1L3CA 3HP1A 2N75A 4AT6B 1KGCD 4F6CA 4TUUA 2O4MA 1ECBA 2PK3A 3UJIL 2RFXB 1PTJA 2DGDA 4MKGA 2VAPA 5AALA 4QXMA 4UULA 3VD4A 2A0WA 1NTDA 3ZGXA 4DYJA 1T24A 1NDTA 3WK4A 4ZCMA 1SM3H 5EA2A 4LLDB 2VSFA 3SZ8A 2P8JA 1BKDR 5F1KA 1YX1A 3C08H 1WC7A 2J1XA 3C2SA 5AHXA 2Y6SC 1NYTA 2RG7A 4NFCA 4MLRA 3CF4A 2WNGA 4EQ2A 1ZIPA 1Z6XA 4C91A 4MQXC 1HTBA 3PGA1 5ADOL 4AG0A 3PPIA 3MHUA 2EKPA 3HFYA 5E2TL 1Q9LA 4R9SA 4ZVRA 2FQDA 4NJAL 2APXA 2XRAL 3W84A 4N03A 5AK3A 5JEEA 4PUWA 1Z6PA 2FPIA 4BO5A 3K4DA 2YAQA 3VFNA 4WGXA 4JRXB 1JWSA 1U21A 1W5MA 3Q9PA 4EJMA 3EWCA 4PJ8A 4AGQA 3A0OA 4G3YL 3RWJB 4I89A 4ZS7L 3GFBA 4F7MA 3OSZA 4QVGA 3TEXA 4TTRA 3R7MA 1WHSA 4I6JA 3IU4L 4H83A 1JEDA 1AU9A 1KVUA 4AYMC 1FTSA 3JTSA 2DXIA 1VB5A 3MJWA 2QFRA 4L4TB 5HBBA 3M1BB 3AZQA 3PSVA 5JMUA 2Y5TA 1YB1A 4U4MA 1XSIA 3MLYH 5ADPL 1RBMA 3QCUH 5HGJA 3HEBA 1OZQA 4OHQA 4CNUA 3SDYL 5T64A 5AYZA 4RUBA 3EJCA 1OXVA 4HTBA 2BCMA 2GSEA 2BBOA 3W5UA 1YBMA 4MYPA 1CB7A 3B1WA 1GY8A 3BH7A 1AQ0A 4G7YH 2EGZA 4QPEA 1MAKA 1CPUA 3IOMA 1NFGA 1NPDA 1OHHA 1IN6A 3LAWA 3BSGA 3D2LA 1ML4A 2WJFA 1XNHA 3AL2A 2WHEA 1M1XB 5F73A 3APTA 3GHBH 1VZ3A 2W2LA 4BUZA 5TMPA 1IOVA 1BW9A 3V5HB 1NGXB 3J2PA 1NBAA 4Y2NA 4C76A 3R9WA 4Z7VB 1V6AA 2EDBA 2I3GA 2KX7A 4P3XA 3QZEA 3T5CA 4BDTA 3T1TA 2ZIXB 3UCFA 3FNRA 1OE0A 3AUFA 5LVAA 3EAKA 5EE3A 4JD5A 3Q0EA 3QDGB 4G42B 4NP9A 4G0ZA 3SGJC 2ZAYA 5DK0A 3W9DA 3ANYB 3TPFA 1KJMA 2BGNA 2PQ6A 4FQJH 3DO6A 5MI0B 4R5HA 3QEZA 4I7VA 4KIEA 1KFBB 5DE3A 5BXSA 4PI0A 3DZFA 2VNAA 1UC8A 3LMYA 4PJIF 2Z26A 5ESQB 3SFKA 1HLPA 4W6XB 3S0PA 3EIQA 1Z5HA 3IXTB 1VFNA 2E09A 8OHMA 4ZGBA 3PFHA 3VXTB 5C8BB 4FZJA 4M6MH 2D6FA 3K9FC 3WNLA 3T9DA 3PNMA 4NV0A 1N3BA 4GSDH 1HEHC 4FQXB 3PXLA 2ZVRA 1A1SA 2ORIA 5BRQA 2W9EL 1HNFA 2QZRA 4LC6A 4DJDA 5JXEA 2VISB 1DIRA 5JJIA 4DZ8A 3E3OA 4IZGA 5J13C 3U5YA 1UPCA 3OMXA 2ZIFA 5D7IF 2R39A 3B9AA 1HYGA 5DJYB 5D38A 3D6MA 2GSIA 4BRSA 3SNKA 3CNLA 1AO7D 3G5WA 4XMLH 4J0FA 4X93A 4CU6A 4C7JA 4WCYL 4QM7A 1ROWA 1N4DA 4LIQH 3Q5OA 2E7CA 4PAOA 4L5JA 3EH5B 3KPMA 1WPRA 1EM8B 2A9PA 4RFSB 3ECAA 4Z95H 3W4IA 3L1KA 1OJLA 3KJ6H 5LQKA 1W1IA 4NKRA 1KEML 1I2PA 3IJSB 2EGUA 3DNPA 5BSRA 1WCBB 3LCMA 1ODKA 4V0QA 4MB5A 2QXYA 4RGQA 3O2VH 4JHVA 2C13A 2ZB4A 2G8LA 4QOKD 3QW3A 4LN1A 1YIDA 4XYEA 3OWHA 3RVTD 2X8LA 4KHZA 2O9JA 4IIBA 4A1OA 3MLVL 4N0UE 4JQIA 3WLWD 2QD5A 2IU0A 2H41A 2VMFA 4BE6A 2RDWA 3PUHA 4RMJA 2GC7C 1F9CA 3OEED 4DUGA 5SY6A 2HIHA 1AGDB 2QNRA 3OM0A 1I36A 4UR7A 2VXUH 2B25A 4Q5IA 5F96L 4JW3A 3DFQA 1NBYB 3P0RA 1G17A 4GCXA 3I6BA 4QGTA 2NX5E 2NSQA 5AZ0A 1F4VA 4AD2A 4Z2IA 4UQDA 1ZESA 4CETA 5I3DA 5DUJA 4MWAA 3BE1L 4FEIA 4RMNA 1R86A 4L6OA 2P2LA 5GGUB 5GGSY 3R7FA 4H6KA 3WNIA 3B40A 4OQTA 1X96A 4XD7A 4B9CA 2OC4A 2BNRE 3KGTA 4ARZB 3CG0A 3N53A 3VA2C 4WKHA 4Y2GA 2O30A 4Q7LA 3CS2A 3BZFA 3AYVA 3GA7A 3DN5A 3GDCA 1RUSA 2ZBDA 4HIHB 2PUAA 1EJOH 2AK4E 4RS3A 4US5D 1T89A 1TO2E 4XPZA 3WQ4A 3DPUA 4JHWH 2Z29A 1PIWA 1T89C 2Q9OA 3KQQA 4KJWC 2IGFL 4F58H 3NVAA 2QDKA 1JZ5A 4N76A 1WXJA 2A57A 3NC0C 1XSKA 2AQ3A 4I1IA 2L0XA 2XVLA 1EFDN 3FRUB 3ED1A 3WGJA 3C5EA 3DE4X 4YBQD 1QT1A 1T80A 2ILVA 4PB4A 2YL8A 4BFZA 1MF2L 3UJTH 1J20A 1W88B 2PBLA 1OLXB 1C1XB 1FDTA 5GMOA 1R5WB 4EXPX 3OX2A 5UKDA 1HILB 3W6LA 3S1WA 4HVXA 3ZE1B 3TO2B 1IGJA 1HR0B 1PO9A 3D5TA 1W93A 3ECWA 2PKWA 2JIRA 2P67A 2J41A 4R1TA 2IXUA 5DK2B 3CIOA 2GRAA 4WZAE 5HMLA 1E2DA 3PNWA 2HEIA 5HMMA 3V6OA 4EX4A 4AJOA 4YGVB 4ICMA 5KEIA 1V3KA 4AWEA 1VZHA 4PXAA 4ABWA 2ZKIA 2NZYA 4DLRA 3ORHA 1XWIA 1BDIA 1W0VA 1V54B 2NYYC 3HVNA 4KCTA 4MYRA 1PS8A 1YQWA 1MY7A 1C1EH 3K70D 2P5SA 4RCYA 5ICUA 1FH9A 3CAKA 1YECH 2VZVA 1FQ0A 5CB0A 2ZKHH 3Q7PA 2NVUB 2A5JA 3JQAD 2Y06H 2B4CH 1NCWL 1YAZA 1FEZA 4KI1A 3KJZA 4XFKA 1IVSA 1IGCL 3QUXD 3FEQA 5G3YA 2DM3A 1BQEA 2BOVA 1GAFH 1WICA 3RG6A 2EF0A 3FB5A 1KJWA 3CNNA 3P60A 1C16B 4MAYD 1B8PA 4BY3A 4ALKA 3WJMA 3PDUA 2R5NA 4AG6A 1K5GA 1D5RA 4MWGA 2VPQA 4FR6A 2GJZA 2EP7A 3F3SA 1IG0A 4XOAA 3B6JA 4S1NA 3UHAA 1GR1A 5BWOA 3AH8A 4IMIB 1ZA3B 4WNYA 5HYSB 3A9IA 2GB2A 2DQXA 3MUEA 3VJRA 4TVPD 4FRWA 5SV2A 4P54A 4P4SA 3DO3A 3PSAA 4B75A 3F4LA 3EPRA 4X6CB 4ND8A 4F9FA 1NXPA 3WLRA 3QF0A 4BFVA 1A6UH 1DIEA 1VJRA 1U9ZA 2FZVA 3OP4A 1BDMA 3SQOL 2V6GA 4G5XA 4Q8QA 4L8DB 4NUQA 3SBFA 2E86A 1OX6A 5AW7A 2R69A 3O91A 4ENSA 3DTDA 1M1ZA 3E6FA 3W2UA 3NFYA 5IF0A 4F0JA 5F9DC 1M4KA 3V5OA 2PKCA 4MIYA 1PFOA 2Q7OE 1RI5A 3S70A 2A7PA 3IRPX 2BYTA 4UQPA 1JFQH 1PLGH 3QR2A 2YJ6A 3SEQA 3TOXA 2Q49A 2R2GA 2AMFA 3U8GA 5IT0A 2I2DA 2W4QA 1NQVA 3Q85A 1QPZA 2JLLA 5JS8A 4R68A 5G5IA 3HGRA 5ABFB 3Q0TA 1ACCA 3GV0A 5JS1A 1QKZH 3LLVA 1ZHNA 2WA2A 1IIBA 2VCCA 3PDIB 1ISIA 1MXDA 1THAA 4X20B 4ADTA 4M1MA 4BMDA 4MPKA 1A9YA 5F9JB 1C0EA 1MDLA 1DDHA 3O6AA 2GBVA 4AJNA 2RKXA 4TLEA 3KRTA 2Q8LA 1Q6YA 5GRZA 3IF1B 4ZGWA 2J43A 3T4WA 1LB1B 3S2NA 2QRMA 4DZIA 3B4UA 3UO1L 4JFFA 1S3TC 5DLML 1SMAA 3G1YA 2KLHA 3ZEIA 4DP5X 3QT2A 2E87A 3T1QA 2GJLA 5BRZA 4P34A 3WEXB 4YAIA 4YR9A 3TBKA 3KYKH 3ADOA 2HISA 1UPMB 1UFQA 1P48A 3W2GA 4F21A 1NXXA 3TN0B 1CQXA 3ZCQA 3DU0A 4KJQD 4LSDA 4LB3A 3LF2A 1HCVA 3AIIA 4G8GA 5KVEH 2FSUA 3QK7A 1SVCP 3IP5A 3KZ8A 3SSNA 3FUIA 4U0JA 4B6SA 1SYVB 2VO8A 2B2XA 4K5OA 2BSTB 2L2QA 4Z2KA 4NIYE 4MD5A 3QV9A 2OMTA 4YDJA 3VGGA 2P8BA 3TYUA 2Y0PA 2F5BL 3R94A 3SFTA 2Y7DA 4HLEA 5LIWX 4AF0B 4ZANA 3KPTA 3RAOA 2HTMA 1ISRA 3CIFA 3JQRA 4FFVA 4ZO4A 3VXUE 2X8JA 3NHBA 1XLMA 4RF2A 1YMHB 4U5XA 5DDHA 4QSHA 3DHUA 2BUAA 4H9MA 4I9UA 2Y62A 2HKFH 3BGOS 4DXXA 2QQGA 1P80A 4P7FA 3CPLB 2GVGA 3BC1A 4B7LA 1MF2H 1JVLA 2GUYA 3CFMA 2R8XA 1LWHA 2DC1A 2PA0A 3A0RB 1XQWA 3EZLA 3UVIA 1YOVA 2R9HD 4FYSA 4W6ZA 4EN3D 4UUBA 4NFLA 1HILA 2AXQA 4GQQA 1FQJA 3TXVA 1QZ1A 3VNYA 2EO1A 3SDDC 5I3CA 4PV8B 4QA9A 1NYLA 1QRRA 3NW9A 5FPSA 3PZMA 2KZBA 2FX7L 1P5VA 4WVXA 4UMBA 5FW8A 4F9PC 2V7EA 5LXGH 2VR9A 3GH4A 3Q01A 3UY8A 3PEWA 1S9VB 4HK3J 2FR4B 2C07A 3F6EX 4MVJD 2EKDA