4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
4W89A 1J42A 1TUXA 2WBGA 1QNOA 5JBEA 4AZIA 4J3XA 5A8NA 4UZUA 1UUQA 1M7XA 2J7HA 1UWQA 2W66A 3RJYA 2CPUA 2WZEA 1UD8A 3WH7A 3TTQA 2O9RA 1PZ2A 5CPTA 1NARA 4B31A 2VZUA 3IGUA 2FDMA 3FHAA 4KGLA 2VURA 3B9AA 3II1A 4RE4A 4N0MA 3KEHA 2F1AA 2YA1A 3D50A 1TQVA 5A6JA 2XFRA 5FKYA 4AD4A 3THDA 4QAWA 1QVVA 2YKKA 2AMGA 1B3YA 1MXGA 3U7VA 1WP6A 1GVYA 4FNPA 3P9SA 4AULA 2OLHA 4N42A 3WY4A 1QBBA 4J3VA 1LQ0A 2HISA 3ZT7A 2UY3A 2XPKA 4DUXA 1GGHA 4GUDA 1HJQA 1OD0A 2ZIDA 4H2CA 3BAXA 1B3XA 1B31A 3GM8A 1EO7A 2ZX6A 3TONA 2AB0A 3WELA 2VVSA 1E70M 1DWIM 3I3EA 3QR3A 1NOUA 1U33A 4AZGA 4KH2A 1XYFA 1C8XA 2ALWA 1E15A 1MW0A 1NQ6A 3ZJ6A 2X2YA 3GRAA 3WD3A 4KGJA 2EXOA 4GQQA 2JF7A 4AMCA 4N0RA 3VIHA 3WD1A 2EJ1A 3L4WA 1B0IA 3CO4A 4D6GA 4AD2A 4QCEA 3T0AA 5E0CA 4ACYA 4W7WA 1B90A 1GVIA 2YDRA 3OLIA 3KL0A 1DWJM 1WDQA 3DC0A 5A3HA 1J10A 3WDRA 3W27A 4CVUA 1BYBA 1UKPA 2XJ7A 2QMJA 1OGGA 2PWEA 3N18A 4K2HA 2O92A 3VGBA 4P8XA 4Y0NA 1UWSA 3L2LA 1IZJA 2X05A 1CPUA 3L4XA 2J79A 1Q6GA 1KCLA 1UA7A 3VGHA 3WFZA 2WZHA 5C8BB 4LX4A 3VIFA 3PZGA 1I1QB 3WUFA 1FOBA 2WC3A 3IAPA 1X1NA 4AZ6A 3FAXA 2Z1KA 1Q4NX 3P9RA 3DX2A 4AY1A 2XVGA 6CGTA 3M6DA 4CN4A 7CGTA 1ITXA 3ZJKA 4GI9A 1KXJA 3ZQ9A 2DDXA 3TP4A 1N57A 3ARUA 4E5VA 4W7VA 4FLOA 1W9BM 3AMGA 2C0HA 1E6RA 4IPLA 1M03A 1TA3A 4R7GA 1G5AA 1UR8A 1HL9A 2NV2B 2ZUMA 4TVCA 4Y1EA 1VEMA 3VINA 4DM2A 4ENVA 3F5DA 2E9LA 3NSMA 4HZ6A 1JF6A 3ARYA 3WF1A 4XZWA 4L8FA 3N9KA 3GH5A 3ER6A 1UWRA 2YWCA 1JFHA 3WQVA 2BVTA 1UH4A 4Z2HA 4JQSA 3GXIA 2W63A 4J3TA 1CE8B 2F8QA 5AC5A 1EXPA 2OSYA 4X0NA 1GHRA 2CIPA 4MADA 1GGEA 3LRKA 2D23A 4D6HA 1KCKA 2D1ZA 2FYVA 4DO5A 4GE3A 3WY1A 1QVWA 2BVYA 1T36B 2YIHA 1QPKA 2R1VA 1E4LA 1IT0A 5FIPA 3ZIZA 3WNPA 3VM7A 3L4TA 1ZBKA 2X2HA 1VJZA 3RPMA 1BPLB 1KGWA 4D6EA 4JL2A 3APGA 1GJUA 1HX0A 3BVXA 1R7OA 5IFPA 2NSXA 1TVPA 3D4YA 4HPHA 2BFGA 3WMBA 1JZ3A 1E0VA 1BYCA 4CUCA 2V5CA 3W29A 1CF9A 2G3NA 1WZMA 4LXFA 5D8WA 4BS0A 4W87A 4U3CA 3GNRA 2CITA 3U57A 1TQWA 4HPGA 2WVUA 1ISWA 4AYGA 4JKLA 2VMFA 2YL6A 2GJXA 4B9ZA 3WKZA 1KGUA 5JBDA 4GQRA 5BCAA 3BLKA 1J0KA 4MDPA 1DHKA 4PCTA 2ZUUA 4AZ5A 4GI8A 1MFUA 5LA1A 3FN9A 3S6TA 1CXFA 1IPHA 1QI5A 2J77A 5GNXA 3PQ4A 4NZJA 1E0XA 3TTUA 2UY4A 1FFRA 1B1YA 3L4EA 2YWBA 4QFUA 1KTCA 1SMAA 4CD5A 1KQZA 3T08A 1WZKA 3ZJ8A 4PMRA 5HOSA 3EMQA 3PZMA 2J8GA 4MDOA 4WKFA 1PX8A 3OG2A 3PZVA 3S5ZA 3K8KA 4BA0A 3WL0A 1VEPA 2XVNA 1KBBA 1WB0A 2WPGA 2WMIA 3FSEA 4D71A 3BLBA 2IXUA 1OIMA 3NYDA 1GCYA 2D0FA 1OY1A 1BVZA 3EBVA 5D4YA 1KB3A 4F79A 1M53A 5A8OA 1ODZA 1JZ8A 3T2QA 3WQ8A 3MUIA 1KR1A 3VDHA 3A3HA 4PN2A 4W5ZA 1H0IA 3LPOA 3P9PA 4P34A 1S1MA 2DIEA 1QVZA 1E56A 4H41A 4ACZA 1CGVA 4AEFA 4ACZB 1GONA 4H8HA 3UEQA 1GHSA 4U31A 2ZUTA 4IM4A 4PSRA 1GNXA 1VAHA 4WLCA 4ENWA 3WNOA 3IANA 2CYGA 1HN1A 4CCDA 2O9TA 2OYMA 3NOQA 3EDDA 3CZGA 3M07A 2D3NA 3EJPA 4HOXA 3DX0A 1O1YA 2XGIA 2PWHA 3IJ9A 3SCUA 2CBVA 3RM8A 1BF2A 4E08A 2CHOA 3VIGA 4QP0A 2YLAA 4AD0A 5I0DA 3TTWA 3HU7A 3KWXA 3W6MA 1OX5A 3VD7A 2GDVA 1A9XB 4RL3A 1WPCA 3AROA 2JEPA 3CZNA 3GXTA 2GVYA 1QWSA 1JZ6A 4D6JA 2TAAA 4PYSA 3A21A 3UCQA 1HWWA 1XSKA 1PX4A 1OSEA 4EANA 3NOVA 3WQ5A 3NSXA 3UJNA 2QPSA 3EDKA 1K6AA 1W3HA 3WDPP 1G9HA 3SCSA 4UFMA 1TMQA 3PBGA 1KWGA 3RO8A 2EPNA 1OIFA 1L8NA 3AIUA 3GTNA 3DHUA 1E3XA 4GINA 2OSWA 1GUVA 3SCQA 1E0WA 2FHFA 3MMDA 1CENA 5FL1A 4ZXOA 2A9VA 1M04A 1UWIA 2DSKA 3F4VA 2X09A 1FP9A 3GH4A 2GJPA 3WDIA 3VTRA 3WSUA 3PZ9A 2YFOA 3ZM8A 3WMSA 3KLKA 4DWSA 1W9DM 3SUTA 2V3EA 2X2JA 1R8LA 3A4WA 5M5DA 2W61A 4QYTA 2G41A 2YFNA 1E5NA 1RD6A 3UR7A 5BYWA 5D9MA 1H0GA 1LL7A 3I3DA 1BTCA 3VIKA 3ZMRA 4HMEA 1C3FA 2V4UA 3EJ6A 2DSUA 3GXPA 1HIZA 2R1VB 4JIEA 3CV5A 1CIUA 1UKSA 4P7OA 3ARXA 4FLSA 1JXJA 1P81A 1E40A 3F5KA 1W9UA 2XHYA 2V38A 2CESA 1KWKA 1KA9H 3EZGA 3AS2A 4ZE4A 1MYRA 1CGYA 1W3JA 1XH0A 1TR1A 1NM9A 3KL3A 1CWYA 4KWUA 2XVKA 2VZSA 1V0NA 3N13A 1GOKA 4W7UA 3UK7A 1V6WA 2DPEA 2O9OA 3CZJA 3VNZA 3K8MA 3N7TA 3ARQA 1AQHA 1T0BA 1R47A 4P2GA 3PQ3A 4UCFA 2Z1SA 1W1VA 2JIWA 3VIOA 4IISA 1JNEA 1EQCA 5LYRA 1UOKA 3WH6A 4AC1X 4J3SA 1C8YA 2F7PA 2PBOA 3T2OA 3DYMA 1FYEA 2J75A 1FA2A 1OI4A 1QWNA 3UG3A 3PHAA 3SCNA 2GK3A 1C8QA 1LLOA 2GDUA 1NOWA 1AMYA 1QNRA 1DWFM 3VGFA 4EE9A 4BIMA 4IPNB 2IUZA 3PQ2A 4OIFA 1L0PA 3NCOA 3THCA 1W9PA 1IZZA 2JF6A 1Z32X 4QLJA 4H8VA 2JALA 3B9DA 4IUGA 5AYIA 4WF7A 1TZ7A 4ZDIA 3G6LA 3CY6A 3F71A 5ABEA 3R76A 4BFLA 3AICA 1QVBA 3CUGA 1GJWA 4U2ZA 1JAKA 2E3ZA 2ZXAA 1MQRA 1W3LA 1AVAA 4OZOA 1UD6A 4OQ4A 2VQUA 4UNIA 1UCFA 3TTSA 4JFVA 1UZ1A 3WFLA 3AYSA 3A22A 1FHDA 4EK7A 3WUEA 1BQCA 2X0HA 4XB3A 3PZOA 4AZHA 4UQ9A 5CGTA 4ZDKA 4AD3A 4V27A 2VRQA 1P7YA 3OGSA 2BNJA 2J62A 2VOTA 3B9EA 4KRTA 4LYPA 4WIWA 3CZLA 1TFVA 2ZUSA 4AZCA 1FHLA 1I7SB 4AZCB 3IJ7A 2XM1A 3D51A 3S5YA 2WMFA 3AYRA 2Y8VA 3WMCA 5EBAA 4Y1RA 5E6YA 1OX4B 2CCRA 3M46A 3IK2A 4F66A 3CUJA 3MO4A 2VUYA 4ZENA 2XUCA 3G6MA 5GQBA 4JKKA 3MANA 4V28A 4L95C 1M6VB 5CZKA 1P5FA 8A3HA 4W8BA 1C91A 2Y4SA 7TAAA 4BQ3A 3VVGA 2WJZB 4BTEA 3VO0A 1OWQA 2ZWYA 1OD8A 1TE1A 1C93A 4M29A 1LG1A 4HP5A 3NJ3A 2WKGA 2EO7A 4PUEA 5I5RA 2YA0A 1CZ1A 3N1AA 3BAJA 3VMPA 1BAGA 2ZXQA 2VTFA 2IGTA 1EOKA 7A3HA 1W1TA 2E8YA 4B7AA 1HT6A 2BHUA 4RE2A 1GOIA 5BXTA 4PTWA 4TTUA 2DT0A 3CLWA 4ZEPA 3TTVA 1US2A 1QBAA 2D7JA 2DQXA 4U33A 1GQKA 4P7RA 4M24A 1GGFA 4HOWA 1R75A 4Y1GA 3AI0A 3EJRA 3AHXA 5KEZA 4E8DA 2F2HA 5E9AA 4J27A 1HP4A 2PC8A 4Z2GA 1GOWA 4YHGA 3ARTA 4B9YA 3FHQA 5JIPA 3MUZ1 1CLXA 3EMZA 3BH4A 1JZ5A 3AMKA 5CSYA 1PBGA 3CNEA 1UKQA 3PTKA 1VB9A 2BY2A 3ZO9A 2PWGA 3N04A 2F7QA 4ATLA 4OGFA 1ZB5A 4D6DA 3BUPA 3CZKA 5A2AA 3EYPA 4JZ5A 3EDFA 3T2PA 3EMCA 3ARSA 4ZDJA 3AS1A 4OGZA 4GXPA 1S46A 1C3OB 1H41A 3D52A 3S2CA 2QV4A 3W0KA 4MGHA 5CLTA 1HXKA 1JVNA 3AIQA 5FD0A 3CHFA 2WK2A 1GPFA 4PMQA 5SY4A 2BY1A 3OB8A 1GGKA 1JL8A 2XTKA 1V0KA 1E4MM 1UYQA 4UOJA 3QOMA 5C70A 3BC9A 1EQPA 2Y2WA 1GORA 4D1JA 5D8ZA 3VMNA 5F7UA 4S0ZA 1B9ZA 3SUSA 2YA2A 4HZ7A 3DX1A 1ISXA 4NI3A 1C7TA 4D72A 1PS3A 3FAWA 3RIKA 1D2KA 1WDPA 1B2YA 2WMKA 2OR3A 3L7NA 1BXRB 3F5LA 1PPIA 2UY2A 1PJ9A 1Q2UA 1Q6FA 5I24A 1QWUA 2LXNA 3AIVA 1V6YA 4PEEA 2WCAA 4L78A 4NZCA 4UFIA 1QNQA 3RM4A 2YBUA 5BXPA 1LWJA 1XSJA 4MB5A 3ZR4B 3L18A 1PE0A 2ABWA 1JD7A 1HNYA 1BGGA 3KZSA 4F9DA 1PV2A 1B30A 1KFWA 4W84A 4UOZA 1CXEA 3SURA 4NRSA 3ZJ4A 3H54A 1UHVA 4EAMA 1H09A 1UASA 3GNPA 4BQ5A 2XWDA 1T3TA 4L8YA 2J7GA 3A4XA 1X6LA 4RKWA 1JD9A 2WXDM 2WW5A 2XN2A 3N17A 5A8MA 2WAGA 3AHYA 2WWDA 2GJRA 3B3AA 4A3YA 3HG4A 3GBEA 3WEOA 4CD7A 4JAWA 5CPSA 3AXXA 4UQAA 1TCMA 4PBGA 4FF5A 4PXYA 1BSIA 1DWGM 4M82A 1R34A 1ZJAA 2CBIA 2FGLA 2WVSA 4RE3A 4BQ4A 2JIEA 4P8UA 4M8UA 4U3AA 4UFJA 1E1EA 3NSNA 4CD6A 2XIBA 1UG6A 4HA4A 3R75A 3BVWA 4R5EA 1J01A 4MJ2A 4GO8A 2R1TA 1HJUA 1J18A 1G01A 1RH9A 1NP2A 4NXKA 3PZIA 2XVPA 1WCGA 1JI2A 4CKQA 1NOFA 2X1IA 1E6QM 1FH7A 2OW7A 2VRNA 3SCOA 4S3KA 3D54D 4Q22A 1EO5A 1G2IA 4FNQA 4TOQA 3LPPA 4PTVA 3WUBA 1ZJBA 4URIA 4Z2JA 3SCPA 4LGXA 4JKMA 5A6AA 3O6AA 2Y24A 4WKAA 4WJXA 4F9JA 4W85A 4Y7EA 1CGUA 4LYRA 4QLLA 2JE8A 1JDBC 5BXSA 3WN6A 2WHMA 4W88A 1SR0A 5AY7A 1P7ZA 2DH2A 1OGSA 5JIWA 4B40A 4Z2LA 2C7FA 3BMWA 2W92A 2DEPA 1QI3A 3VKKA 2PWFA 4ENTA 3B8SA 2GSJA 3MV11 4CN1A 4UQBA 1GOOA 4P8WA 3HG5A 1VFUA 2Y5EA 2EPMX 1W9XA 3BSGA 3PQ6A 2CHNA 4ATWA 5GNYA 1CS0B 1VF8A 3AIBA 1E9LA 1K9VF 5CSUA 2V3DA 3EJTA 1OCQA 3EDJA 1E43A 1EDQA 3KE0A 4P35A 3CZ9A 1MFVA 4AYSA 1TQTA 3AZTA 4AMWA 1NWSA 2UWFA 3LXAA 3MGKA 1US3A 3W24A 4NF7A 4DUVA 1QW9A 3UETA 1OX4A 1BGAA 1V3JA 3VSVA 3ALGA 3POHA 4Z2KA 3H55A 3ZSTA 1BG9A 1OT1A 1EA9C 1UH3A 1KR0A 1GQIA 3K4AA 3DX4A 3AISA 4P7QA 1E6ZA 1H49A 2GK1B 2DT3A 4P8VA 1ZBWA 1WO2A 1QDLB 2CKSA 1UR2A 4ENQA 1J9YA 4UR9A 2XSBA 3LMYA 1O7AA 2WM0A 1JG9A 3PQ7A 3AOFA 1CXLA 4ENSA 3T09A 5M03A 3WQ6A 1UR4A 1V3IA 1T0OA 4UOQA 1E55A 4MNKA 4DUWA 1LL6A 1FH8A 3EJUA 3CMJA 2A3EA 2ZX5A 3BHNA 5A1AA 3WNKA 3VU2A 4B3LA 1ZBVA 5ABFB 3AJ7A 4PMXA 3CZEA 4CCEA 3PQ5A 3GBDA 3VD5A 3DYOA 1EOMA 5IDIA 1ZL1A 1YQ2A 1D7FA 1DWHM 1DEDA 2WBKA 4AMXA 3ALFA 3A47A 3W82A 4LQ1A 1CXKA 2O9PA 2ZUNA 4HU8A 2VR4A 3CHCA 4PMOA 3CUIA 1CNVA 2D22A 1E6SM 3LXBA 2X0YA 2RGMA 1G0CA 3VGDA 1V6VA 4OOZA 2ZX8A 5SYAA 1EHAA 3W28A 3W6LA 3VGEA 2XN0A 2DT2A 3UGJA 5AC4A 1J0JA 1VFOA 4ML4A 3ARRA 1HJVA 4K68A 4DWSD 3HJEA 2H2WA 1CDGA 3L4UA 1A47A 1XSIA 1PEZA 2VI0A 3CHEA 3MUAA 4CCCA 4GE0A 2F61A 1CTNA 4OUEA 4AUNA 2VT0A 3L4ZA 3AS3A 3OZPA 2ZICA 2GFTA 1P80A 1LJYA 3K1DA 3WF2A 3CIVA 2OYKA 3TA9A 1MXDA 4W93A 1H11A 1L9XA 3AZRA 3BAYA 4E4PA 1JYNA 2XM2A 2CERA 4Z2IA 1ONSA 3OBAA 4I46A 2QF8A 4NSBA 3OLGA 3ZSSA 4TTGA 1UQYA 4MPKA 3VIPA 3WF4A 4AIUA 4AJ9A 1JNDA 4MAVA 2BY0A 1D3CA 4W86A 4CU6A 3AMCA 1R87A 4XV0A 1ZU8A 4YN5A 1GZJA 4C7DA 1TA3B 5HBFA 2XSAA 4JCMA 5ECUA 2CEQA 2BHZA 1EH9A 1F4AA 2D24A 1QOXA 2DGAA 4FK9A 5LIRA 2W91A 2EACA 3RJXA 3POCA 4AZ7A 4M81A 4QCFA 3BMVA 5HXMA 1UKOA 4B16A 2VXOA 2G3MA 3EDEA 1MQPA 3GXNA 3WNMA 1WE5A 2FHCA 1WL8A 3N11A 4M1RA 4PMNA 3L4YA 1G1YA 4GZJA 3WH9A 4MAZA 3VNYA 4A3HA 2E9MA 3BGAA 2E8ZA 5K4AA 1Q7RA 4ZE5A 3TV8A 3VD9A 4TUFA 1XRVA 3AS0A 1XH2A 3WH8A 3UOWA 3O9NA 3AIEA 1QNSA 4UFHA 1QF7A 2ZE0A 2WHKA 2UY5A 1GQLA 6TAAA 1HVQA 3PZNA 1ZS2A 2EADA 3DYPA 4ZXLA 4MNJA 2D3LA 1RPKA 3D4ZA 4YHEA 1UD3A 3VSUA 1WAWA 4PMZA 1IZKA 1NWUA 2YLLA 3BWEA 2XN1A 4GKLA 5DFAA 1XCXA 5DF0A 5D9OA 4UQEA 2YOCA 5TD4A 3R74A 2WYSA 4OBRA 5E0FA 4AIOA 2VCCA 3KL5A 5ABFA 1VCOA 4PSPA 2R1TB 4GZEA 1CGWA 3SUUA 2XFFA 3WD4A 4L4PA 1VCMA 3QOKA 3VIJA 4NRRA 2D20A 1V3HA 4CU8A 1JGIA 4CD8A 5HPCA 1EDGA 1JXKA 2GK1A 5A94A 2DSWA 5E6ZA 5EB8A 1MW3A 2VPIA 1CECA 3WH5A 1XCWA 1UR1A 5IHRA 3K46A 1HJWA 2J4GA 4Y1FA 1M01A 5HNNA 5IFTA 3RCNA 1ISZA 1BG4A 1OINA 1JDAA 5HDRA 2F7RA 2E0PA 2V3GA 1TVNA 4MB3A 5D9PA 3VPLA 5BROA 1HVXA 5I3DA 1GOMA 4HMDA 3BCDA 1HKIA 1VBRA 4W8AA 1W1PA 1BYAA 3NIYA 4E8CA 4M80A 2E9BA 3GH7A 4X0VA 4RKYA 4FNSA 4AUEA 5CXPA 5M17A 1KXHA 4U5KA 2G4FA 2WMIB 2XG9A 3NUKA 5A95A 1GPMA 3TTTA 1LL4A 2VX6A 5E1QA 1J0HA 1GPWB 2YL9A 1JYVA 2JFEX 1BYDA 5LA2A 3E1F1 5GPRA 3WENA 2JEQA 3VGGA 2WHLA 3BVVA 2VCAA 3ZT5A 3MU7A 3SCRA 1E6NA 4WSJA 4LYQA 1VENA 4FNUA 4DWSC 4WSKA 4UTFA 4DO4A 2WLZA 4AUMA 2W7TA 2QPUA 2A3HA 5CPQA 3BCFA 4H7VA 3AHZA 1KGXA 2GUYA 1H4PA 2DSZA 4Q7NA 3KKLA 1UA3A 1E3ZA 1W9VA 3QHOA 2CNCA 5GNZA 4AWEA 2ZXBA 3BUIA 1R9GA 1WDRA 3AMLA 3UG4A 3JUGA 3A24A 1JF5A 3UMMA 1E1FA 1VJSA 3DDFA 3OZOA 3ZJ5A 4U2YA 3WDQA 3MI6A 2X8RA 4FLRA 3AFBA 3HG3A 2ZWZA 1CGTA 2V5DA 5CG0A 2J74A 1QI0A 5CQ1A 3ARVA 3VSTA 1LG2A 2WKLA 1JYWA 3LPFA 4BCEA 1ZBCA 4BQ2A 4JHOA 1PIGA 2J7CA 3OLEA 1VRXA 3UERA 1H5VA 4NX0A 3FXYA 1EIBA 3NDZA 1ODUA 3DECA 4MTCA 4Y1RB 4B3KA 2F18A 1SMDA 3CTTA 3AHVA 5SY6A 3NDYA 3GNOA 4JCLA 1XHGA 2VO5A 3DX3A 4TXEA 1KXVA 2WWCA 1ISYA 1V0LA 2XGBA 4D1IA 1W2VA 1SZNA 1E6PA 3GYCA 1PDWA 2ZOXA 2QHAA 3SF8A 3SCWA 4CD4A 3WQWA 1BHGA 2W4XA 5A6KA 4CVWA 3MMUA 1B3WA 1YHTA 4PMVA 1JZ7A 2WC4A 4TVUA 1CBGA 3PTMA 2ZUVA 1VBUA 1B3ZA 4GPNA 5EMYA 1DWAM 2J25A 2RGLA 4OGGA 3FY1A 3CMGA 5EFDA 1C30B 3BUBA 4KMQA 2F7OA 2VX4A 1NWRA 1EHNA 1CXIA 5C71A 1AQMA 3WF3A 1MQQA 2VKTA 2PWDA 1I7QB 3VILA 1TQUA 3WF0A 2EAEA 1K9DA 2NT0A 1TG7A 3OA5A 3D5HA 1J12A 3ARPA 4XUYA 1V3LA 5I2UA 3CPUA 3TTXA 4R27A 4CU7A 5I77A 2ZX7A 1W2PA 3U7BA 1VEOA 4BF7A 3RHTA 3TTYA 3HMCA 3PN8A 3A6OA 3M3PA 4TX8A 2DSVA 3W37A 1JIBA 1NP0A 1WNOA 3QHMA 2C8NA 1HKMA 3WNNA 4A4AA 1HP5A 3BVUA 5DEZA 1B3VA 1PX3A 1MWOA 1XYZA 2YL5A 1OB0A 3J7HA 2EPOA 4W5UA 3AIRA 2VL4A 2PBGA 2A3AA 2OW6A 1DTUA 1E4IA 1R86A 3K8LA 3CC1A 4HTYA 1JZ4A 1JYXA 3GXMA 4PTMA 3SUWA 2BXYA 4XLLA 4MNTA 1O7DC 3AZSA 1KXTA 5AYBA 1WZLA 3W81A 2W67A 3WY3A 4EKJA 1JI1A 2XVLA 4DO6A 3WBEA 3DDGA 1F4HA 4AW7A 5A6BD 3NOOA 1QHZA 2CKRA 1P6WA 1W1YA 3L2MA 1UD2A 4YPJA 3U5UA 1G94A 1PZ3A 4WXYB 3ZR6A 3WDJA 3L3BA 5M3WA 2J47A 2VCBA 1EGZA 3W53A 1KBKA 4OJYA 1V03A 2B31A 1E72M 1KXQA 4MNMA 2W62A 2DIJA 3BAWA 2VNCA 3K4DA 5D9NA 3VIMA 1UR0A 3QGVA 4HA3A 1E5JA 3EN0A 3VX0A 3T0BA 2ISSD 2FH8A 2WMGA 2RK4A 5JUVA 1QHPA 3LX9A 2BV9A 2WB5A 3AIWA 5JZOA 2YDQA 1UR9A 1ESWA 4WINA 3CH9A 1C7SA 2YWJA 3OGVA 4J3WA 4OBSA 5E70A 2X2IA 5LA0A 3VDAA 3MSDA 3VX1A 2PI6A 1XH1A 2WVTA 1QI4A 1R33A 4FNRA 2WZIA 3HN3A 4W8LA 4JFUA 4OKDA 3PZQA 4MNLA 4OOUA 4OFWA 4J7RA 4UFLA 2WSPA 2ZXDA 3SIMA 3WQ4A 3FNDA 3LPGA 3EWNA 1V02A 4AXNA 4QYXA 3WBAA 3BAIA 2ZX9A 3CYFA 2EPKX 3KLLA 4GZIA 4ADSG 3TQIA 2FGZA 4ENRA 3OIHA 3SUVA 5BXRA 1QI2A 1QNPA 2OSXA 1OX6A 1R7AA 1Q6CA 4NXSA 3B38A 1UZ4A 6A3HA 4HOZA 3CHDA 2NW0A 3UR8A 5ABHA 1CGXA 3UG5A 1UD5A 1A3HA 1K9FA 5BRQA 1OBAA 3LRMA 2J7DA 2D0GA 4AISA 5FL0A 2CBJA 2CXGA 2VVNA 1N82A 5I23A 2AD5A 2EQDA 1V02E 1QX1A 1H3GA 3CZ8A 2OWWA 1GQJA 3AQUA 2GJXB 3MV01 2W5FA 1XGZA 2YJQA 3SEPA 1HF6A 5BWFA 4HCJA 2PF0A 4MJ4A 3MMWA 2J7BA 4PMDA 3W38A 3QHNA 3EJSA 3BXWA 3CUHA 3VDCA 3FIJA 3VM5A 2WCGA 3BSHA 1NWTA 1TQSA 4ZGGA 3SF8B 3B36A 1ISVA 3VMOA 5JBFA 4B15A 4L8WB 5A69A 1UD4A 3BAKA 1BVNP 2EABA 3AXIA 3VUPA 4F8XA 3HZ3A 2RK6A 3W26A 5FCZA 3PZUA 1BLIA 4JL1A 3WD2A 5CGMA 4ENUA 2VC9A 3SCVA 1HKJA 4AZBA 1W3KA 2J7EA 2DT1A 1J0ZA 4FLQA 3RM9A 3ZR5A 1XV8A 4AIEA 5HPOA 4ENPA 1HKKA 3VD3A 1HTYA 1RP9A 4WK9A 1H1NA 1W91A 3UESA 1VIWA 4XZBA 1WDSA 2WLYA 1GW1A 4J28A 2VQTA 1LWHA 4P7NA 4HZ8A 4B5KA 1VHQA 2VRJA 2WVVB 2WC7A 4P36A 4DM1A 4QDMA 1UH2A 3PTQA 1ECEA 4ATDA 1Q6DA 3H53A 2XYLA 2EEXA 5A8QA 2VDJA 4LPCA 4PCSA 1JDCA 1V3MA 1JFXA 5IHSA 4CGTA 1OM0A 4D6FA 3GXFA 1V0MA 1IV8A 4LRUA 1XD0A 2R1UA 2VRKA 2J7FA 5I79A 2WMHA 4TX6A 1PIFA 3HG2A 1HXJA 5A6SA 4BZYA 1SY7A 4DWSB 1PDVA 5IXEA 4GO9A 3MIIA 3LRLA 3VDBA 2D2OA 3GZAA 1FY2A 3T0DA 1DP0A 3PZTA 4JFTA 4S3JA 3NVAA 3WL1A 2A3CA 2PB1A 4AD1A 3WUGA 2WVVA 2XF2A 3CUFA 1OT2A 1WKYA 1FH9A 4PMUA 4UQCA 2QLYA 1MW2A 4B2YA 4PUDA 5A6LA 2QMKA 2OWXA 4D6IA 5IP5A 3TOPA 4HU0A 3BUDA 2D0HA 2IUFA 5SY9A 2G3JA 2WHJA 1SOAA 4UZSA 1CXHA 3NORA 4MB1A 1KEEB 3MKKA 2YWDA 2VZTA 1BFNA 5A2CA 4PTXA 1GG9A 3AHTA 1VCNA 1RP8A 1R85A 5A6BA 3DHPA 3WEMA 3SOZA 3U5YA 1WZAA 2ZUWA 1OGBA 2Q8XA 3WD0A 3M7SA 3LXCA 1NH6A 5DMYA 3ECQA 1I1XA 1E71M 4H04A 1I1WA 1U2YA 3O2LA 2XFYA 1GGJA 3L4VA 2OYLA 3IJ8A 3MUY1 1V6UA 3ZJ7A 8CGTA 4FNTA 3ARZA 1W32A 2VX7A 3GDBA 2EPLX 2G3IA 5I78A 5KZ6A 4D1YA 3BVTA 3OT1B 3N12A 4HMCA 2OWCA 4CN6A 2RK3A 2DH3A 1KTBA 1E4NA 1UWTA 3W25A 2VZVA 2GHRA 3WNLA 1E73M 2BS9A 1KQYA 5FOOA 1LF1A 1Q6EA 4U5IA 4I4NA 1V6XA 1QHOA 2MANA 4LGYA 1K9EA 4GI6A 5E09A 3VIIA 5A8PA 4MTVA 1XD1A 1H2JA 1O6IA 3EFEA 5JZMA 2NT1A 1SYTA 2XIIA 5DO8A 3CBWA 3ARWA 4C7GA 2CETA 1CYGA 2J78A 9CGTA 1UQZA 4MB4A 4D6CA 3SCTA 2EBNA 1U30A 2WANA 3A4AA 4V2XA 5A6MA 1AQ0A 3AMDA 4PRWA 2WMJA 5DT5A 3OLDA 4UFKA 1J0IA 3BUQA 3IAQA 2IXVA 5ABGA 3GXDA 2HVMA 2WSKA 2XWEA 2FHBA 4X9YA 1C90A 2AAAA 1V3KA 1HJSA 2BXZA 3P9QA 1HJXA 2E4TA 4P7LA 5CJ5A 4C7FA 4JFWA 4J3UA 1V08A 1MVYA 4GIAA 2FE0A 1MW1A 2WCSA 3RDKA 3RMEA 4TVDA 3MSGA 4JHZA 3CZSA 2ESCA 4P5PA 2VX5A 2VJXA 1FFQA 4QLKA 3VU3A 3TTOA 2YL8A 1C92A 4M56A 2NV0A 2V3FA 1QW8A 2E40A 5CLWA 2Y8KA 3AXHA 1JZ2A 2D73A 1GOQA 1VFMA 1PAMA 5A2BA 4L7QA 4ZFMA 3WIJA 2YBTA 1J11A 1SFSA 3I3BA 4HA1A 4NZFA 4FMVA 2FH6A 1UWUA 5EFFA 1JDDA 2WNWA 1X6NA 1I75A 1U9CA 1R46A 3ZOAA 3CZAA 1HL8A 4N12A 3OGRA 2FEXA 3OT1A 1K9TA 4UQDA 3MS8A 3N15A 4H8UA 1IZYA 4I2NA 2BVDA 5BV2P 1CEOA 1J0YA 3VOCA 4AEEA 3WY2A 2VR5A 2BHYA 3EJQA 4WKHA 2VZOA 3NONA 3W4RA 2J8FA 5BRPA 4JFSA 1E6XM 2A3BA 2F1BA 2G8ZA 4L4OA 1Y7VA 1CLVA 3WEZA 2BY3A 1FP8A 4PMYA 3A5VA 3VD4A 3F5JA 4E2OA 3D3AA 1EDTA 5DT7A 3ZT6A 2CBUA 3BLPX 3A23A 1ITCA 1VFFA 4KRUA 4AD5A 1XC6A 3RILA 4XX6A 3PQ8A 3WDHA 1JAEA 3FW6A 2AOSA 5I6SA 2YDSA 1UKTA 3CGTA
chains in the Genus database with same CATH superfamily
1ZD4A 3HB5X 4NYMQ 1P0CA 5D30A 3RBGA 3LT1A 2DFTA 5TPWL 3V35A 3TLQA 4AZIA 3RRJA 2VFGA 4S1WA 1FNHA 3ZKMC 4TUYF 1RWPA 4WADA 4AMKH 1CFVH 3FT0A 3HAEA 4QWWD 3IJYB 3I7SA 1GKRA 2I2WA 1NARA 3E0XA 3N8IA 4IRJA 5T3ZL 1OC2A 3UHAA 1L8AA 5IDXA 1FWEC 3WXWH 5IESH 1J24A 1KZ4A 1P9MA 3EDCA 4RSHA 1ACCA 1I3GL 4C0XA 3NYWA 5FKYA 4LAMA 3SY1A 5EZYA 1EGJL 4QAWA 4IQDA 3IOEA 4M6NH 2ZT7A 2BEWB 2ADMA 1KJMA 3DK0A 4FNPA 4P2OC 1W87A 2WT4A 2K7QA 2OLHA 4W82A 2H0PA 3BDKA 3ZT7A 1N6VA 4F0HA 4BE7B 3FUJA 2JRCA 1Z0FA 1W47A 1WDTA 1THZA 3MLWH 2E6QA 2LGJA 4YP7A 3DT6A 4NKOA 5DS8B 4KKAD 1HYGA 4J2HA 3DOSA 4LEXL 1SFJA 3NCCB 4TNGA 3BHBA 3NH6A 4HJSA 3DO3A 5LUMA 3WQEA 1U33A 1YCSA 3N75A 2WNQA 4BECA 3ZOZA 1OE0A 8ABPA 4L29B 1NQ6A 4TRPL 3AQXA 3MFQA 2DR0A 1E4WL 4RELA 4ZJZA 3UPCA 4HBCL 3DFOA 5HF6A 2YQ5A 1PKNA 2RALA 4AD2A 4OZ4A 1BQEA 3RC7A 4BRSA 5DWVA 3TLYA 4OUUB 5B3AA 3UZJA 4NP4L 2XUPA 5L2KE 4LL1A 3QUXC 5FUQA 5HNUA 2BEWA 3P9KA 3UWVA 3L49A 3H7LA 4ZOBA 1F0LA 4DCVA 4A3SA 2FWSA 3SOPA 3WN5A 3EUUA 2O92A 4JD4A 5IHZA 3BL5A 3VX3A 4RLHA 2C5LA 1YRWA 5GGUB 3COTA 2RKWA 1RUMH 2MQ0A 2VDWB 5GVSA 3S98A 2MINA 4CCSA 4XZ4A 4D2JA 3KDMA 3VXRB 3PZGA 1RJQA 2E7CA 3Q48A 1A4JA 4Z7UE 4LDQA 2WJWA 1J5SA 2PU0A 1LXMA 4Z18A 1T8SA 3M9LA 1NPNA 2HFEA 3C6KA 1P7CA 2Z1KA 4DKFL 4XR9A 3IAEA 3DX2A 3GGCA 1B23P 4ZT6A 3US0A 5H7XA 4EIUA 1FVCB 2DS4A 3DX8B 1S2TA 5KBKA 7ODCA 2EG6A 1EKOA 4WASA 3P2KA 2GM4A 1CDJA 3G1SA 1XNGA 1FY6A 3KYJB 3B1FA 4MW6A 2J3LA 4G6AD 5IJCC 1GEHA 3S9IA 1AC0A 1EVJA 4NZ8A 4BO7A 1VEMA 5ULLA 5I48A 1S5IH 1DQUA 1QRSA 2AZXA 4DVRH 3FB7B 2CKBH 4G1MB 1OWRM 5DXFA 4BKUA 2I4TA 3IPRA 3L8FA 4XVTL 1TKWB 5D2LA 3Q4DA 4JY5H 2IYOA 2V2HA 4HNLA 4JQSA 2ZOKA 3F2BA 1U2DA 1TVLA 1J1XH 5F2KA 5D7JB 5DGTA 2VCOA 3HA7A 2D1ZA 2W4MA 3EXG2 2FDSA 4U2GA 2EIHA 4A1RA 3SDAB 1ZNQO 2PLRA 1F3LA 3KBOA 1CZLA 1ODAA 3Q12A 4IPTA 3LP8A 4PCKA 1WAEA 1NANH 2WO4A 1P4LA 3S88L 4OU5A 3P9XA 1EIZA 1S5HB 2LIVA 1BBDL 4NDNE 4YWIA 2WUBL 1L6SA 2J32A 1P5BA 3E7FA 1QFUH 2D2HA 3BWVA 2J8UB 5HJEA 1RPUA 3HHSA 3KWVA 4BS0A 5DCCA 5IEJA 5TQ2H 2HVKA 2P5WD 4G80B 3MFFA 3QI9B 4YYCA 2C2BA 2ZZKA 3I8XA 1IBKB 4EF9A 4ZZ1A 4I4IA 5ISZA 3FF4A 5DGHA 1NURA 1A9EB 2DQDL 1VPOL 4K7YA 1DHKA 5F7AA 4PCTA 2DE0X 4MXQD 3LRXA 5IESL 2PKQP 5LA1A 4EMBA 1OF1A 1P7HL 5EPDA 1KJZA 4DAIA 3NCHA 1WB4A 5K6AC 4UM9B 2OL4A 5C0AD 4RDXA 1NGQH 4UC0A 3IDXH 3DV4A 2WINI 3NDZE 4H26A 4HWBL 4AMKL 4EI5C 4EGAA 5GINE 1T0MB 3BI9X 1OJXA 1NLBL 1F8UA 2YD4A 2RHLA 2B7BA 4L1BA 3GBNL 1KTVA 3PUVA 4N48A 3CXUA 4D71A 2AYXA 4TMCA 4HAVA 3BKML 1ZCOA 3RIAK 3W7KA 4ACPA 1FC0A 1GYQA 5GRXG 4DP1X 4UZFA 4I6KA 3TROA 4YJGA 1BMZA 4OVXA 4U2DA 3PHOA 4YHPB 2DPKA 3E15A 5KSUA 3ML1A 4GI4A 2Y36L 1E56A 5DK2A 1TRKA 4ACZA 2P6NA 2CUMA 2WKSA 2HGSA 3ABGA 3L3DB 4UB0H 3PX3A 1BVKB 2BL4A 1H65A 5DJ8B 5FAGA 1Z0IA 3ZI0A 4LOCA 4A3RA 1D4AA 4H13C 3URQA 2JFPA 4JU8A 3GMIA 4CKBB 2PWHA 1W0WB 2CBVA 2WTPA 1KCRH 2Y3NA 3SN6N 4B0OA 1FBNA 2CLIA 1Z5PA 2EGGA 5JH2A 3IH5A 1KO8A 3OF3A 4LOEA 4F2BA 1E2QA 2PJZA 2WKPA 4P5KA 4QRAA 1PSKH 4M51A 4D9RD 5AKLA 4BH8A 5A4AA 3RY5A 4XR4A 3HNSH 3D3KA 5IDVA 1Q1BA 1KTDB 1S9DA 3O2WL 3HGSA 4LF6B 3A3OA 2TAAA 3RBZA 4PW9A 2Y3IA 2P5ED 4XD7D 3I4EA 1P5UA 2FUCA 1H9BA 4PMFA 2H07A 2YXMA 3AUSA 2X0RA 5IBQA 421PA 1CS6A 4OJFH 3ULVD 1NF0A 2G0TA 2P40A 1QPPA 3ZQWA 1LVGA 3PBGA 2YJ6A 3REQB 2HTEA 4X6CE 4NBLA 4PLYA 1E20A 4PTDA 5LNVA 4FMCB 4ND3A 3TIDB 3DZIA 3G5MA 2QADD 3IT8D 1JBEA 3FQ4A 2WPDD 3TI7A 1H93A 1U8LB 3GGWA 4LPUA 4S24A 2PUWA 3E2PA 3ENVA 2F5AH 4XOEA 2OBFA 4PRRA 1NANI 4NHOA 4MA4A 5DYGA 1XD2A 1H0GA 3A05A 1XD2B 4LIQL 4HMEA 5FEBA 5I45A 4KR9A 2B7NA 1P17A 1UKSA 2HHJA 5JAQA 2ZRVA 4R31A 4MKVA 2JVKA 2J5WA 4C7MA 1PJSA 2ZYGA 4WGGA 2JGKA 5I8ZA 5ACMA 5JE8A 1QCYA 1FZKB 1W8IA 2ZSAA 1EGHA 3X2EA 3UK7A 4JGGA 4NFBA 1ZITA 4NDAA 2DPEA 4UOEA 1X1AA 5ES4B 4A0GA 4LU5H 4DGVH 1YW1A 5ID0A 5KUMA 1ZS8B 3ECBA 3LUCA 4NH0A 3AALA 4QBHA 1DXFA 2Z7YA 1Z28A 3BSZH 3H6GA 3AKZA 1EQCA 1I8UA 1JDJA 2YD8A 2F7PA 2IFTA 3FSOA 1TO6A 1U8PA 4ECAA 3AAZB 1DBML 3UBXG 1FYEA 3MTIA 5H94B 3QFDB 3BPSA 1YZVA 1UATA 2OTUA 2QMUA 3IDQA 3OVGA 4PJ8D 1OI4A 1QWNA 4RMJA 4CRPA 4PJ5B 3F4NA 1UAAA 3HM7A 1MA0A 1Q7BA 3WKEA 1XZQA 2VKWA 3RJZA 3FU7B 3RFZA 2FSDA 2VJAA 2E7ZA 3AZPA 2N59A 4WF7A 5DHPA 3CY6A 4TYQA 3RCMA 3F65A 1D9ZA 1N5AA 3J80A 4PGCA 4BFLA 1Z36A 4PBTA 3KR0A 3QDMB 1DC5A 4EAEA 3DKPA 4LCUA 1AVAA 3ZGHA 2F4NA 5K6AA 5TLSA 4X4ME 2VQUA 3ZE7A 2BP8B 5KSBE 4O12A 1BEZA 3THXB 3UJTL 2HV8A 4JYFA 4MCYA 3WFLA 4UAGA 2EC9T 4NJOA 4Y2RA 1PWZA 2ODHA 4P48A 3WUEA 1A97A 3JY6A 3VTAA 1OAXH 5DO9A 1RRGA 4MDEA 4KTEH 5HE8A 2X9VA 2PMQA 2Z1WA 4XIGS 2YHIB 4HCRH 3CXFA 3AUVA 3QX9A 1RSCA 1GPNA 1SCAA 3QVMA 1U02A 4TM9A 3LAFA 2ZYTX 2CHQA 2K9FB 3OAAA 3GU2A 4DSOA 3AYRA 5FSDC 2FKAA 3A70A 5LGKA 2QUNA 3ESNA 1NC4B 3KPMA 5FX3A 1WB6A 1WLYA 4GQBA 2J9FA 4LJ4A 5ITBL 2J1KA 3MO4A 4ZENA 3G5VA 5C37A 1EXWA 3RIGA 3SE4C 1KK1A 2HDJA 3CV6A 1SC4A 3LPAA 5JFGA 4HH3C 2WTOA 4JB3A 3EJJX 3EYWA 1QVOB 1TT5A 2WJZB 1O5DT 2Q46A 1I1OA 2ZWOA 4UTPA 3HS0C 3ZK7A 1A1NA 5HHQA 3QY9A 2GI0A 4LCRA 4PM4A 3HW7A 4R3UC 2D7NA 5AICA 2QVGA 4G0WA 3S1LA 3MAWA 1E69A 5D7JC 4M22A 4NJJA 4IMIB 1OYBA 4WOKA 3L7FB 1ZGGA 3R6LA 4E0BA 1RI8A 2BMKB 4B3ZA 2IGTA 3QHTC 5TMPA 4ADGA 3ME5A 2YR3A 3G9QA 1V54B 4LRYA 3QU5A 3SZOA 5CEEA 4A8LA 1RLWA 4C65A 4WHBA 5ESAB 5LXVA 1CF2O 1IY0A 4KFSA 3KPMB 2DQXA 5LQCA 3S4TA 1Q6OA 1AO7E 4EEZA 5JS7A 3NFUA 4LOAA 2HT6A 4LUSA 4EUEA 3QHPA 3GI8H 2VNKA 3N6XA 4X1OA 1QNZH 4FNLL 2XNHA 1BKDR 4YGAB 3DHDA 1HP4A 9XIMA 5DSTA 3ARTA 3NJFA 1IX2A 1FL5A 2OXHB 1NOKA 3KU4A 4XN2A 5EOQH 4LOHA 3H5NA 2P49B 1DSWA 1KZ6A 5DRWA 3CDFA 1O8CA 3OMWA 1ML0A 4CN9A 3AR3A 4QX6A 4LF5B 5EIIB 3EO0A 5JHMA 2FQEA 1N70A 4R26L 2CWNA 3QBVA 5CEYA 5DIFA 2ENYA 1GG5A 3OEEA 5A2AA 4WNAB 3FVDA 1B9KA 3Q0EA 3H4HA 4EZIA 2GC7C 3B8WA 1KLUB 3M1IA 4GXPA 5JS2A 4JUBA 1C3OB 1DDHA 5EBUA 3O9MA 3VU1A 5CP8A 2VRCD 3CUPB 1UM6H 3OAYH 3NHAA 1NAL1 1ENOA 4Q3DA 4KK3A 1TLLA 2CNOA 1LPPA 3KBJA 5CB4F 1NIBA 4HZLA 3HYCA 4IQHA 2PH1A 3NPVA 1I30A 4PJCB 1KYVA 5CZVL 3UX9B 2GQ3A 1WQ1R 2QDVA 3R4RA 4IGIA 4RMQA 1XA3A 1FQ9C 3DX1A 4P04A 4KKXB 3TLJA 1OFUA 3FAWA 1TZJA 2ERJC 2PDJA 3HVIA 1OXUA 3K2MC 1V77A 1UWFA 3PX2A 2QADB 1QNVA 4AX8A 3A67L 2WZAA 4ZZFA 1D5XA 4OR1A 3FRJA 1PV8A 3AQDA 4L78A 1JKXA 3RUFA 4OXRA 4LPYA 1DOHA 1EBAA 2BVQA 1T5BA 3A2LA 3H2IA 4RPQA 2AFHA 5CSRA 1P9RA 3N58A 1O89A 4IG2B 3TBSB 4KC3B 1CIDA 4RTOA 5CYPA 1SK8A 4FZEL 1GVHA 1OAOC 3BOVA 3CH8A 1P5RA 3BCRA 3C70A 4JCCA 3S96A 1UHVA 3QX8A 3AVWA 3EOLA 2UYYA 1EEZA 3IDIB 4FHEA 4PTLA 5MEND 2YVAA 4Y9BA 1SFLA 5L4FA 5E5CA 2OAGA 1R3IH 2G75B 2WEKA 2ZK7A 5KWIA 2WAGA 3SFVA 3GLUA 3E6EA 4K39A 4WZ9A 3TYCA 1VE7A 2YC4C 1RWQA 1LORA 4IDOA 2C3YA 4HTFA 3QXSA 2BSSB 3WLBB 3A27A 4GF5A 3QXAB 3EZ2A 3NALA 3V7YA 3RX3A 1G20B 5EORH 1E1NA 3FSVA 4XKYB 4QG8A 1ZS9A 3GCGA 2VF2A 3OKOA 2R82A 2OQRA 4YE0A 3Q6IA 2AW5A 4WTQA 1BRMA 1G01A 4UHKA 3EF4A 3TA4D 1RH9A 1M9NA 5FHRA 2VA8A 3P0YL 1J2WA 1JHPA 2I5GA 3N6YA 2WLJA 3WJJC 3D54D 2ZKHL 4PFHA 3LLXA 4DELA 4LGXA 5IROC 1O57A 4C5CA 3DIVA 2A4ZA 4O2AF 4RDYA 4WJXA 4S1DC 4JI5B 4GMDA 3IHTA 4LYRA 1LNQA 2JWYA 3DL0A 2WHMA 3UICA 4CMKA 4XX0B 1QUMA 2PLCA 2X3FA 1PG7X 1KYAA 3SAJA 2OP1A 3B53X 1X4XA 4D9PA 5D01A 5EWIH 2A9FA 4KROB 3T1YB 4N2MA 2H26A 3QXGA 3KSZO 2HMIC 3ETBJ 4BX8A 1Z8DA 3JQAD 4JZOA 4U4AA 1KFCA 1H3XA 4GL2A 1P5UC 4Y2PA 5D1QB 3DO7B 3QKSB 2AZDA 2VQDA 3ZXYA 3URBA 4KK4A 1GC1C 4HIEA 4YIQA 3QLVC 1WMAA 4ADIA 5FHAH 2OJEA 4IMPA 1NF7A 1KEPA 1MCOH 4C47A 4Y4KC 4QHNB 4O2BF 5GVJA 2OC4A 3AISA 1MFCL 5C0JB 2GK1B 4XWTA 1LPBB 1JZGA 4NJMB 5JROA 1WO2A 4BQEA 2H1OA 3L3JA 4HWEL 2WZ5A 1FRNA 5IMLB 4AN4A 4JTUA 3QZUA 4EATA 3ND6A 3PQ7A 2YASA 5CPFA 5AVUA 1UF9A 1PZSA 5JPCA 3C75A 3EGXA 4Q33A 4ERIA 1F07A 3C7DB 3KPUA 3KK0A 2W2OA 4DEFA 4LNYA 2EGZA 3MROA 3ROKA 4JTQA 2QD5A 1E94E 3SE0A 2WWMD 3GQYA 4AE0A 3ERCA 3ST7A 2X5OA 5BYAA 2JAUA 4P4KC 3KFTA 3SI9A 3CUKA 4BX0A 2WKOF 4NONA 2P5YA 2C3HA 4JODA 4P7BA 3NQCA 1JKJA 4I0CC 3ZRFC 3EX6A 1XGYL 1DWHM 5BRNA 3L3OB 4TQTA 3MLSL 4DUOA 2HA6A 1FZJA 1G1CA 4XUGB 2XSXA 2Y93A 2P10A 4Y2XA 2O9PA 2ZRNA 3JZFA 3DJZA 1UQUA 4BFIB 3FH8A 1WSDA 3GMLB 2WB2A 4R1TA 4HKPA 2WWMC 3K6DA 1U1UA 1Q0QA 1H5BA 4Y2NA 2EKCA 3WL9A 4ZVLA 3RS2A 5ENZA 2ZG6A 2ZRXA 1V8OA 1WAAE 3ABKB 1CVLA 1XBZA 1J0CA 2C26A 2DLIA 2VI0A 4R83A 5IAGA 4GP7A 4OKIA 4FXFA 4QBGB 3DBVO 4LVOB 4MZIA 4HHMA 1XP8A 3ITCA 4OATA 2EHDA 4L8SC 4HN2A 3FQRB 2BISA 3CLTD 3DE2X 3KW8A 3GFXA 1CUWA 1JKJB 1FORL 3TX4A 4DSUA 1FCJA 2GJ9A 1ONSA 4Q00A 4C4AA 2JCWA 5AVQB 2A57A 5CZJA 4D4IA 1HYSD 4XWUA 3TYFB 4JTHA 3VVMA 4JKWA 2UYHA 3ZKQD 5JXEA 1OC7A 1ERNA 2E4YA 3KUXA 1EPFA 4PG2C 5ERWA 2EZ4A 3HU3A 5FOSA 4XXWA 4CNOA 4JCMA 1T26A 1CD1A 3M5WA 5FYJE 2ALRA 3HVKA 3U09A 2PD6A 2DXIA 1CEEA 4JTSA 4QXPA 2FUQA 2EACA 4KEAA 4A35A 3OFNA 2XQJA 2GIYA 4ZTBA 4MZRA 3WS3B 5FFOA 1O96A 4MR8A 3D3VE 4DMMA 1W581 2DLFH 3T8XB 3GXNA 4DJMA 3FSJX 3RADC 3C9NA 2BFFB 4Y4HA 3H1TA 1XLVA 3QKEA 2X87A 1QAMA 2QSZA 3VVWA 3VI3E 1HGYA 4YPOA 2CALA 3D8SA 1T0PB 2IO5A 2R0LH 3OPQA 5JNVA 2SHKA 1TNMA 2VLME 4AK9A 4HJJL 2PA0A 1L9MA 2Q62A 3CU1A 3R06A 1QDEA 1AODA 3ED1A 1A9RA 1K8YA 3VB9A 3SIRA 1I6WA 2BVOB 2H32B 2PS2A 4HMOA 2NP7A 3KTXA 5FTLA 2VN5A 2CJXA 2FZLA 1WXJA 3MSCA 3HO1A 3VTKA 2VDNB 4NNYB 1RWWA 1QYGL 1HTWA 2OMZB 2F8OA 3DMMD 3O7UA 1TV3A 4IZHA 3QO1A 1ZA1A 3UBGA 2JXMA 3B7YA 4AWAA 3FRUB 4H0IA 1YY9C 4FFZL 2R1TB 3TO4D 2Z0MA 4MQFB 4OF5A 2V7BA 1N0XL 3NPUA 3L6FB 5ABDE 4O58L 1YS2X 1EJ2A 1JXKA 4TPRH 4E7PA 3TFXA 1MEOA 4QHKJ 2W93A 2IUYA 1OCWL 1AC6A 2PHZA 2RIRA 3RYFA 3VV2A 1YVPA 4R9NA 1W8EA 2VBCA 1HJWA 4R1MA 1WDMA 1T4WA 4IQLA 4CIBA 1KB9K 5DJCB 1CP2A 3SCZA 2QHLA 3NTCL 3KHKA 3BCDA 4G6FB 4LY8A 2W0FB 3SBPA 4K7PY 4W9JC 3P5BA 1OV8A 3MSRA 2QY6A 2OXIA 4V2UA 1N25A 4HR7A 4WL0A 5CXPA 2P9BA 4G5OA 43CAA 4HJUA 2G4FA 3NUKA 1M56B 1XYMA 3S8HA 4IKNA 4Q3BA 2NTJA 2Q9CA 4ZCPA 1VPEA 4S3BA 1BYDA 3UZEC 5JZ7C 2GUGA 2WHLA 2X8BA 3VO2A 3S3SA 3S9DB 2CDBA 1E1RA 3V4PB 4JUDX 5CT8A 5DBTA 3PHJA 3OPSA 3C4UA 2OO3A 3ISYA 1XLGA 4MJMA 4OV6F 1E89A 5ESDA 3IIOA 4HIHB 2NY0B 3I9NA 4K7PL 3SBQA 1JZSA 2PX6A 5JEDA 2W7TA 1DQPA 5BURA 3CFNA 4G5DA 4CADB 1RQ7A 5CPQA 4GZ5A 4BCYA 2OKGA 4KPYA 4H8PA 5EYPB 3JTMA 4LBZA 1EQAA 1IMJA 1D6VL 1H4PA 1V8EA 1TZHA 3SOTA 2VP4A 5M04A 4AWEA 3C60B 1FSSA 4KO2S 4KO8A 5HUOA 5GGRB 3O3RA 4AFNA 3UMMA 4HD9A 3VRJB 5GGVL 2QGCA 2NQ9A 2KX7A 4DJFD 3ZE2E 4JA0A 2FE4A 1E27B 3QWFA 4MPDA 1CGTA 1XYAA 2WSSA 1MZZA 3ATZA 1BMFA 4REOA 5AG8A 3W5HA 2GL5A 1G17A 1PIGA 3U44A 1GA6A 4C4XA 5DMKB 3R5XA 1EIBA 3KD4A 1SVLA 3ZIDA 3M5ZA 1Z0UA 1AZZC 6REQB 4U1KB 2NNWB 3B2NA 3FTEA 1Y5WA 3UXHA 1XRNA 4NDMA 4EI6B 1XHGA 4DIOA 2WWCA 1QP8A 3FOBA 2VOEA 4QEZA 5LWQA 5ALQA 1WFTA 3FU8A 5DVPA 2WTAA 2HWKA 5C6TL 2QZ5A 4BLQA 2X3CA 1K97A 3R3UA 2R7NA 5BV7A 3N8HA 3R0KA 1TRDA 3SPHA 5CPLA 4X8OA 2QQGA 5F9DC 4KI7A 2PWYA 4FQIL 3DG3A 3L5WB 5AZUA 2Q6OA 1DQKA 4CMMB 4JFOB 3SIPA 2OQ2A 1UCBH 4YCCA 1Y6GA 5HYJB 3WF3A 4UJ5A 2HRQA 2QPAA 2ZZ7A 3UD6A 3QZWB 3WBBA 4LGSB 4YRPA 3APNA 3OA5A 3D5HA 4XUYA 5DPMA 5H37A 3B9KD 1S5HA 1PL9A 1OC6A 4BO4A 3G2NA 2IEBA 2WSYA 3PWPB 3IODA 1ZANH 3U7BA 3RHTA 3ZDZB 4R0VA 3EOTH 4QDZA 3FYEB 4DJDA 2XTLA 4OP2A 1KKLA 3HMCA 1XAHA 4JDBA 3W7JA 3O9WA 1PJRA 2EDDA 5BRBA 3TCSA 2BNQA 2ZPKH 5CT5A 3TNFA 5A0VA 4KK9C 1RZ3A 2Y62A 1PX3A 3N40F 1RXYA 4X6DF 2Y7LA 5KVMC 4N3AA 3UAJA 3DOJA 2WMNB 2Q7AA 2XGZA 3KDOA 4QODA 3KV3O 4DGUA 4Q9HA 3SLRA 5B5SA 5I1KL 2CJWB 4W1SA 1DGQA 1AXSB 4L7VA 4WKCA 4XLLA 3WQGA 4A6YL 4HT1H 1BLNB 2WTEA 3VO1A 5FV2A 3VR3D 4XC3L 1Y1LA 1SJMA 1OD9A 3TEVA 2CXRA 2ZCVA 4EKJA 3L7RA 1BOGA 3VACA 1Z68A 2G9QA 3IBYA 3BGFB 3T3PF 1DZ0A 1PZ3A 1Y7LA 3HCRA 4OL9A 1G5QA 4NFHA 3ESZA 4MUXA 3HKBB 1Q9WB 2J43A 4XFKA 5GHWL 4WK6A 1YNKH 3DX9B 3HADA 4M6QA 3QQWA 3FYSA 3KE8A 3UAXA 3LQZB 3EN0A 1BVUA 3BXZA 3MV7E 2ASEA 2RK4A 2CR0A 2DZVA 1GT6A 4X5WA 1PVOA 4BJHB 3A1WA 3EODA 4P4KA 2WB5A 3T65B 4MMXB 2X7LA 5C53B 3T3NA 2ZOSA 3ZLUA 3FA5A 1A6AA 1UC6A 3RSZA 2DUUA 2YMLA 4XQEA 4QSHA 1TETL 2A30A 1QI4A 1X6VA 5PAZA 3PZQA 1N0LB 5EF1A 2WWXA 3H7RA 3WTCA 2BE9A 4B7IA 1RXEA 1T7YA 3DDHA 4A04A 4NU5A 3SSZA 1PEAA 3V1NA 2B39A 4CTMA 4G65A 4JTDA 4O2FA 4TV9A 1NBYA 1KCSH 1H7OA 4QYXA 5B22A 3RL2A 4OGLA 3QW3A 3TBKA 1TWSA 2A58A 5CU5A 2DQIL 2EPKX 1BBJB 1KF0A 4LLQB 1QNPA 3QLVA 1R7AA 5G2WA 3NR0A 4CJXA 2OMEA 3CONA 3VZSA 2ASVA 2OFXA 1CGXA 2VNJA 1FNEA 1S3KL 3WOHA 1JVKA 3OZDA 4IINA 1RWXA 4TSKA 3R5JA 5CILL 5FOBA 5I23A 3OFND 4G0OA 1HZHH 3PHCA 5H70A 1GHTA 1GQJA 2W60B 4OBWA 3EB4A 3AOEC 1TNNA 2HUEA 2RGAA 4GICA 4Z76A 4Y4HC 4LQFL 1GU0A 2J7BA 1QKJA 3EHBB 2PRSA 4W9NC 5L4JA 2PXAA 3SOBL 2QRZA 3VDCA 1FTYA 3F2DA 1TQXA 2ZF8A 2C1OA 4IGEA 1FYTA 1T0NB 4AK2A 4NC2B 2I5IA 5JBFA 1X3SA 4L8CB 1JSRA 4QEEA 3E7XA 4K6HA 3PPWA 3CBQA 3E3HA 4IIQC 1Z8AA 3WD2A 5LXGH 2ZWPA 4MP8A 5IFAH 3QNYA 3SCVA 3OOWA 4AZBA 3ZHSA 4LJ7A 3WFBL 4DIKA 5E99H 5F7LB 4B2DD 2WB1A 3K0FA 5D2NE 4MO2A 5TT1A 1JPVA 2WHEA 4V39A 4YDNA 4HRAA 3WYRA 3GZJA 1PZMA 3JSXA 3UL4A 3ILEA 1VIWA 5ID0B 3QUSA 5KTRA 2FT7A 4BZ1L 1R5NA 1DC3A 4MV1A 1KELL 4MS3A 3SOBH 3CCHA 2ZVPX 4XP1L 4DF9A 2SCUB 3BK7A 1I1AB 3W84A 3KCNA 3GKZA 1QM5A 1VZ2A 3H53A 4ZZIA 2IZ1A 1U1DA 3O2DH 4LXUA 3MDWA 4XIYA 3O3DB 2E5WA 3MYYA 4M9CA 1BX0A 5JO5A 2MCPL 3QA9A 2WD8A 1U65A 1OM0A 1HMYA 1RXOB 4L9XA 1SEQH 4Y9NA 2BM3A 2OMWA 1XUZA 5LNK1 3O45A 4UIOA 4W5OA 5FBZA 4YT2A 1I3NA 3MLAA 4TVSA 5HHVH 3ZIAD 3CEAA 4DQOH 1XGEA 1RV8A 4F80A 3MSXA 3S47A 1XQ1A 2QGYA 4S1FA 2ZXFA 3SJVB 4M61A 3EC7A 3GRRA 4JO5A 2VLRB 4PJGA 1J0AA 1NIDA 1WKFA 4OJKA 5CPOA 3IUMA 2VXQH 4R3WA 1ZN8A 1YEGL 3IBCA 1OT2A 1WKYA 1H0DA 3S9YA 4Q47A 4UMFA 4QNWA 3K35A 3WGIA 1RKVA 4HATA 4LE2A 1TC1A 4LOUD 1W2GA 3QR1A 2HI0A 3T6ZA 3DLIA 4BXOB 2DR2A 2G3JA 1KN4L 4GC9A 4CSPA 1TELA 2X0EA 2K3TA 1FVFA 2Z93B 3L5LA 4C5BA 2R7EA 2Z7UA 3FRPB 2DP4E 2WU0A 2ORBL 2WZ6A 2WIFA 5A2CA 2AQWA 4JRXE 1G0YR 2B37A 3OPYB 3HS8A 4MRAA 1ZNYA 4DBUA 1Y9JA 2ZUWA 4NZNA 2ICWI 1EDBA 1TMGE 1WYIA 1ZI6A 1ZJJA 2DMHA 2Y1EA 2XECA 1RQBA 2PZAA 4ESKA 4KQ6A 3E8UL 1UT6A 1UUOA 2GASA 4OXYA 4X8CA 1FQKA 3QEJA 1RZFH 5HF9A 1V6UA 2H2DA 4NJAH 3SDAC 4LSSL 4KTDL 2IPOA 2G9HB 3VC1A 1TMKA 2XV3A 1R6TA 3IR7A 4LSRL 2H4WA 2FWPA 1FK8A 1REQB 4PV9A 3SY0B 1SQ0A 3WDKA 2P9YA 3DXYA 1N6NA 3EF3A 2R7EB 3I4FA 3FUFA 1KQYA 3JQ7A 3ULSB 2RHRA 1YADA 5HHOE 4FLHA 4RQQB 1KPVA 3S8MA 1LEHA 3W7LA 1CY1A 2XWBB 3C8HA 1QF9A 4D8OA 2FVLA 4L27A 1VCIA 3GJ3A 5CYFA 2R2EB 4IP7A 3ANUA 2NT1A 2J73A 2Z5GA 4YRCA 3B5GA 1RI4A 1X7ZA 3N07A 5BNTA 4D6CA 2KX9A 3GIWA 2O8BB 4X7EC 3DS8A 4TX9A 3ABSA 5DT5A 4MPTA 2WV3A 2NNCA 2Y4OA 3DNMA 2W0LA 3TJRA 3SYOA 4WVRA 3G6KA 5ABGA 1ZM2A 2M2DA 1NFDE 3TQCA 4TLAA 5C7IO 2D7PA 3DKHA 1EX0A 1ZLUK 3ULUH 3SE4A 4NBKA 3E9AA 3V5NA 1AGFB 5BOZG 5AYQA 2MPAH 1Q2SA 3K4QA 5DX1A 5KYTA 1IGFL 4FC6A 4I8YA 2ADJA 2XOXA 5ECGC 4V0MA 4D0BB 3I4LA 4ELKA 3F97A 1E2PA 2EF0A 4XC1H 3QXTA 2GBLA 1E1CA 3KSRA 4MWZA 4C60A 1C16A 3DBNA 1X7XA 1IZ0A 3SZGA 521PA 1X7XB 4NJIA 2IUTA 4DVGA 3DTUB 1JHYA 3SPVB 4YIKA 4PHZA 4X1YA 3KTCA 2CBQA 4CMEC 4PM1A 3CW9A 1GP2A 5AFAA 1T1SA 5E2UH 2R39A 3IOMA 3MRKA 4JQCA 3LBMA 1GFIA 1YNSA 2PEZA 3UB2A 3W7HA 3JR2A 2E40A 2GJZB 2I9PA 1PLJA 3ZHUA 1TW2A 4GVPA 4ZCLA 3RDPA 4FWBA 2PZLA 1S1CA 5GS0L 1D7KA 4JL5A 1F9CA 1J11A 1Q1AA 2EBUA 2EZTA 3OJ0A 3WBJA 3SGUA 5JCPA 1FHNA 2XRMA 4S11A 5A4DA 1UADA 3OT1A 3VNLA 4MPRA 2C42A 3CSGA 2H4YA 3MS8A 3IE4A 1IZYA 4XN1A 3CXHK 3EHDA 3M17A 5FYKL 1GXSA 4WKHA 2VZOA 4L4YA 1Q83A 2WIAA 2A3BA 5TMEA 3U4QB 1HZKA 3IBGA 3U4QA 2DLTA 4K3DL 3ARBA 3HMXL 1VXRA 1Q0LA 5F1NA 1YQGA 1PFYA 2IKJA 2OT1A 4POCA 1DVFA 3AKEA 5EU4B 2WYOA 5DZJA 4KRUA 1YKSA 1KYZA 4A8NA 3RVNA 3UPUA 1EE1A 1Y0LB 3WDHA 1KC7A 2YQZA 2E28A 3K1JA 2ZTMA 3UADA 3BDAA 3VH1A 4YXFA 4PLJD 1TUXA 1E60A 1HC7A 4YMLA 2D7MA 2WSRA 1XZPA 4KETA 3O4JA 3ERXA 2GSDA 2VP8A 3SHVA 3TFOA 1E7WA 3APDA 4LNUB 3CLFH 4PREB 3LCLA 1HV8A 4JQAA 5F3BB 4XZUB 1Z8HA 1Z6QA 1HTIA 2BPBA 3CV1A 4F71A 5AB3A 4JHAH 3KU1A 1W0VB 3B9AA 4AP5A 3HCBA 4Y2OA 4P9ML 5MF6A 3TK7A 1UBOS 2YIMA 4DA4A 4QUHA 2R59A 4XQCA 4GLRI 4IDLA 2OGSA 2CM6A 4JWKA 1WP6A 3CFYA 1OU0A 3P9SA 2Q3ZA 3ILPA 2NVBA 3NNSA 4RTRA 1ZD1A 2NSYA 1K8DA 3SN4A 3PPXA 1MW8X 4BFJA 5LQRA 3RH0A 1FWSA 1FFEA 1XFCA 2G25A 2Z31C 4F7TB 2B1GA 1L7RA 1SLVA 4EZMA 1PX2A 4PRBB 1AOHA 1SXBA 2P1ZA 4PJDA 3SE7A 3ZX5A 4JNZA 2O5VA 5IEHA 4JYCA 4C03A 4O4HB 4KH2A 5I3GA 3A4EA 3F2CA 1O0CA 2BZDA 3F96A 1ETA1 5CIPA 4DFIA 3LB6D 1IE5A 3TA3D 1DQVA 3DTTA 5EPEA 3O7WA 4Y9TA 3BCSA 4QDOA 3F7YA 1Z2AA 4ACYA 1NCOA 4ND1A 1Q7ZA 4IIHA 4BX2A 1DWJM 1U36A 3ABMB 1NL0H 3FJ1A 3LNIA 1J10A 1T7VA 4WW1A 3NZQA 3KEFA 4CVUA 1UQRA 5T1LA 2PPLA 1CFSB 2ZAMA 4HWKA 4DEPB 2PPVA 4OCXH 1BE6A 2L17A 1EEUA 4M00A 5E6IA 1QQDA 3CXHJ 5D2CA 1X9RA 2MPVA 3HWX1 2X05A 4TS3A 4QYAA 3UJEA 3EZ4A 1QQ6A 1Q6GA 5C0CA 2E46A 1L0YA 2VDQB 2H1CA 4RK6A 5SWZB 3EQ7A 4RBNA 3R0UA 3B40A 1ZUHA 3WFZA 4FQ7A 1EQWA 4MARA 4AZVA 3VC7A 3IIPA 3MBKA 3FKUS 3GZTB 3TN7A 2C4WA 1V25A 3IAPA 4JR0A 2XV2A 4D7PA 3KBVA 3R3XA 4ZMYA 3CLMA 2LDBA 1ORHA 1VYUA 4B5ZA 4FX5A 2IQ9L 4CBPA 4Q8UA 1VFBA 4KO1S 5FT9A 4FLMA 3U7QA 1U8CA 1GVOA 2LOEA 1LTHR 5ALXA 2Z98A 1X7FA 1B88A 4ZDHB 4E5VA 2X6AA 2L19A 3FDFA 5EHXA 4LQDA 4M5TA 2G8LA 3T5MA 4C7KA 5GJMA 5IVKA 5A16A 4R7GA 1DKMA 2V7UA 3L0SA 1G5AA 3FMGL 3QUYC 3QHZL 5EBWA 2FR4A 2OZVA 3W3AH 3H7VA 3PXDA 1IZ8A 3FCSA 5E0KB 1R1CA 4L80A 3HN2A 3CX3A 3CFTA 3THMH 4C6BA 3AHGA 4PN7A 1IHUA 4EZKA 4PRDA 4I0PD 4IIDA 5IJXA 2FCBA 3GF8A 2DW5A 3I01M 1T2JA 3W7VA 1NBCA 4KI0A 4Z0BL 2R14A 2NUAB 3MW7A 2BVYA 4X00A 2YIHA 1NCUA 5BMVF 2K9UA 1B6UA 1XYCA 1NEPA 1J1ZA 5AVQA 3GMNB 3O6FB 2WWOA 1F6DA 2C0QA 1BPLB 3E3LA 2P30A 1D5ZA 4FD2A 1U6KA 3TW8B 3BXPA 2J7LA 4HS4A 3TDFA 3GFQA 3SMQA 1IHXA 1I85A 4PG9B 2HT3D 5KVSA 3UJIL 2YPIA 2ADOA 4GGMX 2BFGA 3OKDB 1WRBA 1N3BA 1VL8A 4I36A 1EXVA 2WM9B 5K9JH 1HE1C 2CITA 3HUUA 4AXBA 1X4YA 2HLFC 1TTRA 1DDOA 2FEMA 2BC4B 1HQRA 3KX2A 2WVUA 2VMFA 3O91A 1YYML 1G9EA 4ABVA 2BP0B 5SICE 3FOMB 1USZA 3FOMA 2XMZA 4GZ7A 1Q0SA 3IAXA 1UP7A 2DF3A 4XD5A 2QSQA 1AO7D 4YR6A 5KYGA 1EA5A 1E1QA 5GHWH 4KJPC 3GRGA 2ZUUA 5C0EB 5BP7A 1I33A 1DZIA 4YFLF 4UV4H 1J8DA 3CB2A 2HFGL 3M8KA 2NZLA 5IQOA 2Y1AA 5CX1A 2J77A 3E35A 3PQ4A 2Y69B 1MO4A 5H16A 3F12B 1FFRA 4HAZA 3SS8A 4OUDB 3ZY4A 2JFNA 3K91A 1II0A 2YWBA 1OSPH 2GERA 6ALDA 3T1HB 2W9DL 2F8SA 1ZLSL 3PDGA 5FL3A 1MDAA 1VJIA 3LBAA 3QY6A 3TAKA 1K6QH 4I2XA 2YXXA 1XNJA 4A2MA 1TF4A 1BXUA 2XN9A 2VK2A 5AI8A 2QELA 4OLYL 2JQMA 5K93A 2IXUA 2VUIB 2QP9X 5I1GL 1MRCH 1JV2B 4X54A 3EDQA 1FNBA 3PQEA 2WLLA 1NJFA 3UC2A 3SQNA 3TOVA 3MJDA 3WQ8A 1KR1A 3GRCA 4BTVA 3L77A 5DM1A 2QADC 1LE9A 3OQ6A 2PR4L 5D6OA 5U4QA 3DGGA 3PNWA 3JRXA 4E7OA 2YR1A 2HKFL 3VXME 2JKVA 1WDKA 3HDHA 2QXWA 3ROLA 2AKEA 4ZUVA 3IMCA 2OSBA 3AF4A 4J1QA 1TVKB 4E07A 1HHHA 1LK3H 2ZJ2A 1WDLA 3D43A 4AG0A 1S5NA 1ETUA 5FH9A 1U3JA 4YAQB 3CLSC 3QQ9D 1BF2A 1V5IA 3OWEA 1EDDA 1POJA 4FYRA 4ZI7F 2HHHB 4IIGA 1MX9A 1YZGA 1QUFA 3DXAE 1QG2A 1L8LA 2FHSA 5K33A 1QGUA 2DEYX 2QUIA 3WB2A 2XZ9A 1WPCA 2GEVA 5JXAH 4NO5A 2ADYA 3O3UN 2UXFA 1E5YA 3JUYA 4KVCH 8ADHA 3INOA 2AJXL 1IXOA 3T42A 3S3GA 2XBLA 5AHLA 2CJ3A 4K9PA 4GJTB 4N7QA 3KSDO 4HUXB 1AXTL 3EDKA 4HQFA 3S8YA 1OBFO 4P3PA 3V2AR 2OAEA 1Y3BE 2EIXA 5AW5B 2EPNA 3LHWA 2VR1A 1PEWA 2BFBB 4E68A 1GTEA 1CUOA 1JZJA 4ZXOA 2ED9A 1BWWA 4D0RA 2YK1H 1KA9F 4F8PA 4Z3IA 3H4VA 1Z5UA 1T1RA 1DUSA 4YLBA 5KNBD 5E94A 2J88L 2NUTA 1PWYE 4X62B 1NTOA 1W4ZA 3TWAA 1C3FA 2V4UA 1I45A 4TWIA 3W5UA 1W5EA 2EDMA 3ARGA 4WV1A 5DSCB 1NASA 3L7MA 3O2VH 1AHPA 2BS71 2ODTX 1E9PB 4Z95H 1RPTA 3LLSA 2VISB 3EZGA 2MMXA 1W3TA 1M2WA 3OZBA 3IMEA 4L64A 3JZUA 1LT7A 1MCQA 4XTRC 3MODL 4OZIA 3WL7A 1FCGA 1A7QL 1V0NA 4NU0A 4ZQKB 4DIXA 1N9GB 1U8OA 3HV2A 4B34A 5HPMB 2HG5B 1S96A 3CUWA 2JI3A 3K8MA 5I07A 1JQAA 2AHOA 4P2GA 2F9BT 3KS5A 1VLLA 2AN1A 3DEFA 3T4UA 1SKYE 5D1QD 3FPFA 1UOKA 4ZMQA 1DQRA 2VJYA 1RHKA 3FNEA 2KPOA 4RPCA 1ZKMA 5DI8A 3OFSA 2J75A 2QJIA 5TNXA 5G2HA 2YD9A 1FNCA 3KBFA 1U9YA 1J5HA 4Y4KB 1RIUH 2GDUA 1GAJA 3UFYA 4U6NA 1VKFA 25C8H 3PF2A 1K4KA 1C8LA 3U44B 3K0AA 1KOJA 4YK7A 3ROEA 4LYEA 1H3EA 3BSZL 4K3UA 3ZE0B 3UJJH 1F7BA 3LV3A 2Y85A 3KR3L 4QRPB 2W2XA 3DBRA 1BM3L 3I75A 5EHFA 1T6NA 3HFRA 3CUGA 1V39A 2TS1A 4DGYH 1GZVA 5B1DA 2KBGA 2B59A 4IOIA 4P53A 3TECE 5AOVA 4LHSA 4AZ0A 3JQQA 5KQPA 1Q6YA 2O5ZH 4J3OD 2DJ4A 3OLWA 2LR4A 2EZ8A 1M76A 3RVXC 3FDIA 2HBVA 2CMHA 1BEUB 1AJ2A 5DRCA 3DCNA 4XB3A 3TMLA 3CX5J 5FPSA 3B1UA 4APQB 1XTTA 2PW1A 1PLCA 1KZ7B 5I1HL 4PFQA 3MRMA 3VJMA 1AB6A 2RARA 5K59F 1Y9AA 2AUMA 3HY4A 5BO0D 3SMVA 1NN0A 4X9BA 1KJWA 3C3YA 2ZJAA 5AXAA 3WFEH 5EBAA 5DUPH 4G81A 1A5TA 1OX4B 1UDAA 3LCJA 3HN8A 1VTKA 3F1LA 3D1MC 4QATA 3UOGA 4AE1A 2PYEE 1TO1E 4YEDA 1KK2A 4BQRA 5H37G 3RFZC 2P6PA 2Q0HA 2Y4SA 5LA6B 4YLYA 1L7QA 3FJ4A 3VM6A 1RCQA 4BTEA 4DJJA 4EMSA 1OWQA 2WD7A 4FONA 3ZE1E 2EJUA 5F9MA 5DJ2B 4H0FA 5DJYA 3DLCA 4NZZA 3RJDA 2EKSB 4E2BA 5K51A 5COAA 2GJAA 3ECWA 3D8MA 2P3SA 2NLJA 1YNPA 4NL4H 1S4IA 3RUBL 1K8RA 3NM3A 2VXSL 1M7IA 1E4EA 4ZRGA 1M67A 2R96A 3PT5A 1AKQA 5B53A 5T67A 1AKEA 4BFYA 2I1QA 1QH1B 1DIAA 4F1ZA 3P0JA 3D06A 2V7EA 2QV0A 2GBFA 3B0PA 5F2OA 3ASZA 3OVUB 1N4XH 5ENVA 4FS9A 5IT0A 7YASA 1NCWL 3OSKA 1LRQA 4G7SB 3D46A 4XO7A 4DGIH 4OOEA 3KWFA 1KJVB 2W5PA 3K6FA 5F96L 1EC7A 4PHCA 1SKQA 2A1TS 4ALAH 4XBPB 5DDHB 3TEWA 1WEHA 1EVTC 2WNIA 4PYQA 4K7PX 4M4SA 4X6EA 4U7PB 5CJXC 1AGXA 3RPTA 3JR7A 1E5TA 4N0EA 2WV9A 1OWLA 3BQUC 2PK3A 3F03K 4CWAA 3LHDA 2WXMA 4B3SB 4KKVA 3PBKA 5FOQA 4RE5A 1HXMA 4JZ5A 1P62B 2KB0A 1U21A 4C30A 4GY4A 3M7WA 2C7PA 2V5RA 4YVUA 4WRRA 1WEKA 3QRFM 2A5FA 1ADWA 2PCXA 2VN4A 1MLBA 3R7LA 3CF6R 2P7TA 3KWLA 3N76A 4S04A 3OZCA 3PYCA 3WWCA 5FPQA 3T1QA 3P73A 4TTDC 3SZKC 2NXZC 1CUBA 4CCYB 4W5NA 3E0QA 1V0KA 2WK1A 5KHOC 1GORA 5TJWK 1FVPA 2DKSA 1VZWA 1RZRA 3LLFA 2XICA 3ZKXC 4KGDA 4PZLA 1NCAL 2K7PA 5CZSA 3VFDA 1WDPA 1RIVH 3J8F7 1KE1A 2YL2A 2ZCGA 5FKJA 4EX6A 2HA0A 4IOMA 3L3KA 1PAZA 2F7FA 5ALIA 4DIFA 1EHIA 3DBOB 1RI5A 1F17A 1Z37A 1Y4UA 3EZFA 3LBCA 4IEFB 1FP2A 2J2ZB 1KP2A 1T5KA 3TR0A 5C7LO 4PAQA 3G2QA 4IPIA 3QOFA 5HGDA 3UYLA 4FB7A 3R9WA 2I5YH 1QGZA 3G02A 1HK6A 3K09A 2QQKH 2AXJA 5JHAA 4PJ8A 4ZO6A 4PP2A 1X9HA 4AU1A 4MVAA 4RKWA 4EIZC 3N17A 3SJ3A 5JH7F 5C81A 4C6FA 1OGPA 2NY0D 2EHHA 3HMQA 3OTTA 3BJRA 3OPZH 4YSRA 4DP0X 1R30A 5DMNA 4PRID 5B3JF 3L7CA 1L6WA 4JBGA 3KD3A 4XVJH 4NJEA 5AYTA 1Z41A 1G6CA 1JPGA 3T71A 4S2SB 1T4MA 2JJ2D 3K1AB 3MLXL 5K3FB 2FGLA 4GYJA 4MGKR 1T1WA 1NVVQ 1XOIA 4V24A 3EOEA 2JKLA 1YMHB 4ELDA 1ZAGA 2GLUA 2XIBA 3CZUB 4UXJA 1OT4A 2NU8B 3HDJA 4ILKA 4O2LA 3MR9B 4KFZC 1I01A 5BUZA 3L0KA 1XROA 2X9LA 4XO5A 1NP2A 1VCGA 4QJ3B 1UOZA 3ILYA 5EULV 2EL7A 3LO8A 3V6OE 4WGKA 1RUAL 4S3KA 3HMWH 4KAQH 4FNQA 1K9SA 4TOQA 1YRRA 2CRZA 3L95B 4PWFA 1IGTB 1LC3A 3S27A 2Y24A 4FKBA 1V26A 2YGVA 2M8XA 3QZMA 3T95A 2GGGA 4QXMA 2J08A 3DRQB 1NPJA 1MJHA 2H85A 2BIOA 4PS1A 4DQXA 4Q4PA 1CR4A 2C7FA 2WQXA 4CNIB 1WU7A 3UUWA 5D9SA 1F9EA 1LDGA 1U2ZA 5KSPA 3T5DA 4MRRA 4P8WA 4EYQA 1JPFB 4KS0A 2XYGA 3LQRA 5LDUA 4HYTA 3RU8L 1B8OA 4N0UB 5HS4A 2G70A 2CKBL 1E2KA 2QAJA 5JD6A 1IAKB 3P0WA 1M7DA 3G5XB 1XN1A 3PDIB 4K71B 2V3DA 3L6EA 1AQUA 1AM4D 3NCTA 3QELA 4I5UA 1NC2A 3T4CA 3ZDYF 1GTHA 2BGMA 4DA0A 1TCRB 5JHHB 3TSOA 4YCNA 3SE6A 4U3XA 3FO0L 1JPNA 3GLCA 2ZSIA 4CFSA 2HCZX 1J8HB 4C1NB 3AU9A 2FWIA 1V3JA 3OOSA 4BEVA 1YA8A 4RPJA 5EOQL 4H7ZA 3K4AA 4P7QA 1TJIL 1KBWA 1LD9A 4L8GA 4HJ1A 2G50A 3CNYA 2VMDA 4BB9A 2PTYA 5JAMA 4PGEA 2YPVL 4BKMA 3L79A 1FXUA 1EAYA 1DBJL 5H9VA 4WNCA 4O51A 3N2XA 4OKNA 4DUWA 2PEVA 3BMXA 1VS1A 2NR6A 1LBMA 4A27A 2BVPB 4EG1A 2JZCA 2C3GA 4GDMA 1VGKB 1VGKA 3TSBA 1SQ6A 3D8RA 3RE0A 4V1CA 3QFGA 4XXCC 4WY8A 2AC2A 2HIHA 1XR8B 1ZK3A 1Q1NA 2JCVA 4I4TF 1G7UA 4Z4CA 3T6QC 4P4RA 2A5JA 2A9OA 2ZJBA 1EJBA 2ZI9A 2DWCA 2FFCA 4FFBB 2E7HA 3LZOA 3KW3A 4II7A 2D8AA 4XWGA 2HJKA 4RZCA 3LKNB 5CZ0A 2BDNH 1SSGA 2QNBA 3NWJA 3SDDB 2WP8J 4JREC 3PDCA 4YI3A 4X60A 2G06A 4EY3A 4P5UA 3FTPA 1DAHA 1KDIA 4ZIRA 4ZI8A 2HNAA 3VGEA 4CTJA 4DR2B 4L5FL 3LHIA 3FZNA 3IT0A 4KFOA 4B4FA 3QFHA 5MDHA 1RZGB 4C6QA 4DUGA 1RJ9B 1Z5ZA 4TYUA 4C20A 1GM5A 5AM2A 3CVYA 2IRWA 1ODLA 4LEEA 2VZ0A 1FHGA 2E27L 2FUG1 3VVBA 2FFBA 1S3SA 1MHCA 1R0BA 1XRQA 3TBCA 2HSEA 5BNIA 1DAIA 4K9LA 4IO1A 4WCJA 2QQKL 3CNKA 3OQBA 2NU7B 3SZRA 2P4HX 4XVRA 3IUSA 5HJYA 4N2NA 1O2DA 1OXSC 4WFEE 4XBGA 1L4EA 1O3YA 2D2GA 2EDXA 5CVUA 3E8SA 2DQUH 5B8CB 1ZNNA 3WNIA 3BZWA 3DEKA 5GM1A 5ICMA 1IAQA 1DIHA 1TGYA 3A04A 1HL4A 2OBXA 4TMZA 2O9JA 4M81A 4TXLA 3W8FA 1H8LA 3I74A 3JWNE 3HCAA 1JJUA 1L5SA 1G1YA 3S4SB 2X7JA 1IGML 5H1WA 2H57A 3FCXA 4B3CA 1YY9D 4EBBA 3RTQB 5LCVH 1GFWA 1UVQA 2ZPUA 4KYVA 4OI0A 2PDAA 1ESOA 3FJTA 2H6RA 2VPYA 1DEHA 1T5XB 2DMBA 3QV1A 4CLXA 5F3FA 2Z1NA 1FYHB 3DV6B 2H1WA 4ER3A 2KZWA 4QU8A 1XRTA 1Z4NA 1E8XA 3IDJB 3MIZA 3O9NA 4DLKA 4CNQA 3C60A 4B6JA 1Q5PA 5GZOD 1QF7A 1SN7A 2FUEA 1H3NA 1XVTA 3EXSA 2J0UA 4H9GA 4YHEA 1Y1KE 3HP1A 1UD3A 1D6SA 3BWBA 3WCYA 2Z95A 3PPYA 2QVYX 3WYBA 3V4FA 3Q5TA 1I3LA 5DFAA 3PQCA 3VCCA 5DF0A 3F6IA 2G95A 1WC7A 1Z13A 2EIBA 1X38A 2IK8A 3DT8A 2KHZA 3PUWA 1Z2CA 1BEXA 3FB7A 4RMVA 3SY6A 4G80A 3UVAA 5IAJA 3IFPB 4X7SL 5GGSA 2X4LA 1HZLA 4Q1AA 4TUUA 4BDTA 2CO4A 2OK0L 1AFVH 4ZK6A 2QKYA 1KULA 1XGPB 1CJTC 1X7DA 4IIQB 5D05A 4QFMA 1FFAA 1K2VN 5J89A 4KNWA 1OBOA 1EG7A 3H6AA 1ISZA 1P7TB 4WZBE 2BFOA 2COVD 4LHYA 4LS3A 1NBAA 1GY1A 2F7RA 1C9SA 4IOFC 3PIQA 1HVXA 4TPRL 3TCLB 4XAPA 1N3YA 5E2AA 2OQVA 1W2WB 4W8AA 4P5TB 3QPVA 4ZQGA 4BNNA 1WZNA 3CAQA 3NIYA 4G8GD 1GD1O 5AWFC 4Q9NA 3X1WA 5T6MA 1H6UA 3IS3A 4YCBA 4MKIA 1BX3A 1QOQA 3VJLA 3AUYA 4RY2A 3WXVL 1OARH 1C9KA 5CNHA 3LZQA 4Y4FA 5LA2A 1VJGA 2HBZA 2WE8A 4OAOA 4MUNA 1PV4A 4FJ1A