4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
b'HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
molecule tags Hydrolase
source organism Bifidobacterium animalis subsp. lactis
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
1GCYA 3RMEA 3WKZA 1JGIA 1JFXA 1W3KA 2X8RA 1E15A 3WEMA 5A8OA 1QNPA 2VVNA 3CV5A 2NSXA 3ARTA 1F4HA 2E8YA 4CN1A 1ISWA 1ZBVA 1G01A 3BVWA 3SOZA 4QDMA 3CUFA 3B3AA 4M24A 1JF5A 1C93A 1OBAA 5DEZA 5CLTA 3HU7A 1B9ZA 5M5DA 4HTYA 3HJEA 3ZJ6A 1CENA 3CHCA 4N0RA 4C7GA 1GJWA 2FHFA 4FNUA 4LGYA 2GJXB 1FH8A 2C0HA 1O7DC 3TA9A 3VDAA 1R9GA 2VPIA 3VVGA 4GINA 4GIAA 3CUGA 3KE0A 3QOKA 1C90A 1CE8B 3WUBA 4MJ4A 1BGAA 4Z2JA 3DHPA 3AMCA 4J7RA 4UQBA 1GPFA 1AQ0A 1HT6A 1C8QA 2WHMA 3NOOA 1J0JA 4WSKA 1R86A 2YL8A 2FGLA 3NORA 1JZ7A 2E8ZA 3WNLA 1QNOA 3ZR6A 3AHXA 4FNSA 4MDPA 5EBAA 1MW1A 3CYFA 2FHCA 4GQQA 4W7UA 1UA7A 1VHQA 2ZUWA 3CBWA 5A6LA 1O1YA 3VIIA 3BVUA 2BY3A 1KGXA 1R33A 1JZ8A 4PMXA 2D0GA 3WF4A 3T08A 2J7CA 4OBRA 1WP6A 4P8VA 2CIPA 1BYBA 3L4UA 1KBBA 4W7WA 1W1PA 3ZOAA 1EH9A 2V5CA 1B3XA 1V3MA 3U57A 4K2HA 1TUXA 3SF8A 1Q6FA 3M46A 3NOQA 4WF7A 4W8LA 5CJ5A 2X1IA 4A3HA 1TQWA 1V6VA 1WNOA 3U5UA 3DECA 2A3EA 1R8LA 2YBUA 4FLRA 2XN1A 2Z1SA 2RGMA 2DDXA 1MW3A 3O6AA 1U33A 2VDJA 3UJNA 1PX8A 1CXIA 1XYZA 3VOCA 4H2CA 5HBFA 2FYVA 3AIEA 3OLIA 3RIKA 1JZ4A 2EPMX 1WZMA 4JKLA 3UR8A 3WQ8A 1OX6A 3L2MA 4AIOA 1EQPA 4CD7A 3WY1A 5FL0A 1GOMA 4D1IA 3BUQA 3QOMA 1LWHA 3D50A 2BV9A 3BHNA 5I5RA 2PF0A 2RK4A 3F5JA 3AROA 2F7PA 1K9FA 4AISA 1PJ9A 1PDVA 3NOVA 5CPSA 5C70A 2VUYA 3T2OA 1T36B 1GPMA 1CXKA 1DWFM 4ZGGA 4OKDA 3M07A 2WANA 1OT1A 1CXEA 2WMIA 3D4ZA 2V3GA 4S3KA 4L8WB 1PEZA 3WDHA 2EBNA 3CZKA 1H0IA 2R1VA 3OZPA 1WO2A 2ZUUA 4E5VA 1V0NA 2GK1A 1VFOA 1LLOA 5D4YA 3T2QA 5AC4A 1S46A 1LJYA 4AD0A 1W3LA 5FKYA 1CBGA 4N0MA 1HJVA 1Q4NX 2D22A 4WINA 1E55A 2DT2A 3BCDA 2VC9A 2W92A 2Y8KA 2YFOA 2CBIA 3IGUA 4W5ZA 5M03A 1V3IA 2XHYA 3M6DA 2GUYA 2JF6A 2R1VB 1OM0A 3CZ8A 3TTWA 1W91A 4D6DA 3OLGA 4NSBA 2VZSA 3K8KA 2V5DA 2GJPA 5BRPA 3L7NA 4D6CA 5GPRA 1ZS2A 5FL1A 3BWEA 3A24A 4JFUA 3UG3A 2VKTA 4ATDA 2DSZA 2F7RA 4DWSD 4GE0A 1GQKA 2A9VA 3SCVA 4I4NA 4AZHA 3GXFA 4D6JA 3ARWA 2X2IA 4PN2A 4L7QA 1BHGA 2BY2A 2AMGA 2V3DA 4JQSA 3LPOA 1V02A 2ZXAA 1EIBA 2GK1B 3CMJA 3UGJA 4PRWA 1XD1A 1SY7A 1MXGA 5E09A 2O9TA 3WDQA 3ARXA 3CUHA 4UFHA 2VX5A 3SCWA 4ACYA 2J78A 5CZKA 1NP2A 3QHMA 1E6QM 3K4AA 4UOQA 4H7VA 3DX3A 1X1NA 5M3WA 2VOTA 5JBEA 2XWDA 4TVCA 4AC1X 1QPKA 3WNKA 3W26A 8A3HA 3JUGA 1JD9A 4BA0A 2EQDA 3WFZA 2YFNA 3UG4A 4P5PA 4JL1A 1I1XA 3VM7A 4B9ZA 3IK2A 1K6AA 3AXIA 4BTEA 1VFMA 4A3YA 1IZYA 2ZUSA 4QAWA 3RM9A 1W9XA 2X05A 2EPOA 1IZJA 2WCSA 2EPLX 1KXTA 1KA9H 3CZLA 4HMCA 4J3WA 3IJ9A 1JYWA 4NZCA 3PZNA 3RM8A 3IAQA 4WIWA 5ABHA 3VNYA 4FNPA 3SUTA 1LL6A 4HOZA 1OT2A 2Y4SA 3TTXA 2FE0A 4CD4A 1TA3B 3EFEA 3SUSA 5HDRA 1UCFA 2IXUA 5BWFA 1WPCA 3VSUA 3SCPA 1J0IA 4P8UA 5D8ZA 5LA2A 3VKKA 4C7DA 1JDAA 1JD7A 1PIFA 5K4AA 4DO4A 4J27A 1J0HA 3EDDA 1GGFA 4J3SA 1J42A 3HG2A 1QWNA 4AY1A 1A3HA 3LPPA 5E6YA 2XF2A 4ACZB 1B31A 4I2NA 4ENUA 3BVVA 3N04A 4RKWA 1DWJM 3OT1A 3VX1A 1ZB5A 1JXKA 4FNRA 3KLLA 4GI8A 3CUIA 2WBGA 4CD6A 1B1YA 2VZTA 3MU7A 4FK9A 1HIZA 4D71A 3R74A 2CBVA 1GORA 2WZEA 1E9LA 5A6BA 2OR3A 3RPMA 1E70M 2X09A 4B3KA 3WDRA 5A1AA 4E8CA 3TTTA 1UKPA 1BG9A 3EJRA 1CXLA 1YHTA 3IAPA 3ZJ4A 4GE3A 1G5AA 1UKSA 5HXMA 1OINA 3GNRA 3LMYA 2FH6A 1QOXA 1MWOA 2WWDA 2WBKA 3H55A 3L3BA 1US2A 3N12A 3BGAA 7CGTA 4TUFA 3PTMA 3WF1A 3L2LA 1V6YA 3CGTA 1E43A 3FXYA 2VMFA 5A2CA 3R75A 2A3HA 4QCFA 3MO4A 2BHZA 4TX6A 1K9DA 3GXMA 1UD2A 3SURA 4PMNA 3NYDA 3GXTA 5DT5A 4D1YA 4HMEA 3UESA 4MDOA 3VPLA 3SEPA 4N12A 3AIVA 1SZNA 1V6WA 4HPGA 4OJYA 3OZOA 4K68A 3SUUA 1B3VA 1ITXA 2R1UA 3AZSA 1QBBA 4MNKA 1UKQA 1JG9A 3D51A 1E0VA 2DIEA 1W9UA 5KZ6A 4FMVA 3GH5A 4P7RA 2CEQA 3N13A 3ER6A 3K8LA 3ZSSA 3CY6A 2YWCA 4D6IA 3AI0A 4ENPA 1ZL1A 1GOIA 1UWSA 5IFTA 1BVNP 5BXRA 3OLEA 1EXPA 1G1YA 1W3JA 1EDQA 4XUYA 4AUMA 4P36A 2VR4A 3ZQ9A 1E1EA 5HNNA 5GNXA 2NT0A 3PTQA 4OQ4A 3UEQA 3EMQA 4Z2GA 1OX4A 3WF2A 4W8AA 4D1JA 3H53A 3UCQA 3W0KA 3E1F1 4WK9A 1HJQA 1EQCA 4UOJA 3AHYA 2YA0A 3WQVA 1NQ6A 2W7TA 2OWWA 4FLOA 4MAVA 3THCA 3WD2A 4CU7A 1AVAA 4GZIA 2XIIA 1TCMA 3KKLA 3ARRA 2HVMA 1J10A 2G41A 1S1MA 5I79A 3VINA 4DWSA 2J8GA 3NCOA 2YDQA 3VGEA 3BLKA 4FLQA 1GHRA 4AD5A 3W53A 2PWHA 2VO5A 4QLJA 1GNXA 1HVQA 3HG5A 4D72A 4ATLA 1UWRA 3VSTA 4H41A 1GGHA 1B3YA 4Z2HA 3S2CA 4GZJA 4P7OA 1HP5A 3VIHA 5BXTA 3FAXA 3WFLA 4L4OA 2PBGA 1TVPA 1NH6A 3GXNA 2G3NA 3WH8A 3L4ZA 1UWIA 3CHFA 3AQUA 1LF1A 1HJSA 1H11A 4IUGA 1P6WA 3KL0A 1W9DM 3SCNA 1CPUA 2AD5A 2Y8VA 2QLYA 5IFPA 1JDBC 1JAEA 3QHNA 4OGZA 1O7AA 3WF3A 5A3HA 4U3CA 1WZLA 2V3EA 1NP0A 2VI0A 2VX6A 5A6MA 5BV2P 2YWDA 5BRQA 2XPKA 1QNQA 2CHOA 3AHVA 4DM2A 3WD1A 2F1BA 1VCNA 4DO5A 3OT1B 5IHSA 1SYTA 4AYSA 2AOSA 4CKQA 2JE8A 1KGUA 3VILA 2DGAA 2WB5A 1XYFA 2BVYA 1C8XA 5AYIA 1GOQA 4Q22A 4MB1A 3OB8A 1IPHA 1JNDA 4MB3A 1FFRA 2JIWA 1U30A 3ALFA 5HOSA 1I1WA 1WDSA 2XVKA 3PQ7A 2A3BA 1DWIM 2WZIA 4BCEA 2UY4A 2YLAA 3EN0A 3N1AA 1A9XB 2ZUVA 1E4NA 2BS9A 2DSVA 4B7AA 5A6AA 3UMMA 3VIOA 2UY5A 2XGIA 1EDTA 3VX0A 1Y7VA 4H04A 2A3AA 2EEXA 1JZ2A 3ARSA 3IJ7A 1HWWA 4AD4A 5GNZA 3U5YA 4AEEA 1ESWA 2IUFA 1HKKA 1CZ1A 3PQ8A 3W27A 4PSPA 4N42A 3WDJA 1EA9C 3U7BA 1JI2A 1WZAA 3VO0A 4JZ5A 1IZKA 3G6LA 4F8XA 5I6SA 1J01A 3AS0A 3BUBA 4E08A 5IXEA 2WMIB 3GNOA 5ABEA 3ZIZA 3DYPA 1QVZA 1W3HA 1E6ZA 5A6BD 1DP0A 4ZEPA 1MW2A 3WNNA 2PB1A 1W2VA 1CGYA 2YBTA 2Q8XA 3NDYA 3GRAA 1B30A 1IT0A 1J0KA 3RO8A 1VIWA 4NXKA 1U2YA 1PBGA 4F9DA 2XVPA 3VGBA 1W1TA 1QBAA 1GVYA 1ISZA 4PUEA 5DF0A 2JIEA 2UY3A 2VVSA 1UG6A 1Q6GA 2VURA 3AMKA 1V3JA 4ZDIA 2W67A 2W5FA 1E6SM 2GDUA 4UZSA 3BUDA 4EKJA 3OLDA 4ZDJA 2OLHA 2ZX5A 3AZRA 4IISA 1IV8A 1BYDA 1V6XA 1TQSA 1JL8A 3ZJ7A 4GQRA 3K46A 1SR0A 2VRJA 3WH9A 4NZJA 2H2WA 1CXFA 3S5YA 1JNEA 4ZXOA 1JZ5A 1C91A 1T3TA 4NXSA 4P8XA 2F8QA 1KR0A 1WDQA 3WY3A 3CO4A 1C7SA 4NZFA 2VQTA 2W63A 3VSVA 2QMKA 5I78A 2VJXA 3UK7A 4EAMA 2VCCA 2WMHA 5AYBA 3BAJA 3N17A 4YN5A 3GM8A 3MMWA 1GJUA 1UD8A 3P9PA 1CXHA 4BQ3A 1U9CA 1M7XA 1LL4A 3MUIA 4E4PA 5E0FA 4W88A 3SIMA 3ZO9A 4PBGA 3ZR5A 3AS2A 3NSNA 4KH2A 4F9JA 1VFFA 2YWBA 4M1RA 1MYRA 4RE3A 3W6MA 4ATWA 4W5UA 1UD3A 1QVWA 4DWSB 3EMCA 3N9KA 1QHZA 1KFWA 5LYRA 1CNVA 4AZ7A 3A47A 1ECEA 3AIWA 1QDLB 2CERA 4JCMA 1PZ3A 4IPNB 2YOCA 5A6SA 1QVVA 4HMDA 1OIFA 1HKIA 1T0BA 1X6NA 2PC8A 2PWEA 3ARZA 4AIUA 4WSJA 2PI6A 3TP4A 2JEPA 1KXJA 3CLWA 3PTKA 3P9QA 3VD5A 2CITA 3TTSA 1W32A 3AXHA 4CCDA 3W81A 4Z2IA 2EO7A 4ZXLA 4PTMA 5ABFB 1B0IA 3SF8B 3RM4A 3VMPA 1UD5A 4OBSA 1W2PA 2VZUA 5A2AA 4W86A 1QWUA 4QCEA 2CESA 3EJ6A 4AJ9A 3MS8A 1KQYA 4PMOA 3RJXA 3AMDA 3CNEA 3VMOA 4L8YA 1OI4A 4Y1RA 3DX4A 3OGSA 3AHTA 1K9EA 3I3BA 5BYWA 1J18A 3N11A 4CCEA 1Q6DA 5SY9A 2ZWYA 2UWFA 3VU2A 1TQTA 1QHPA 4TX8A 3SCSA 1Q7RA 5AC5A 3D54D 1UWTA 3VIKA 4JFWA 3ZSTA 5EB8A 1V0MA 4MAZA 1FH7A 3EZGA 2XFRA 2Y2WA 4XZWA 4GUDA 5LIRA 1BYCA 3ALGA 1DWGM 1RP8A 3VDCA 2DPEA 1QVBA 4DUVA 2ZUTA 4UR9A 3VD4A 1V3LA 3GYCA 1OY1A 1BSIA 3SUWA 4P7QA 3MUZ1 1GZJA 1E40A 3DDGA 2QF8A 3NVAA 4LRUA 2W62A 1HJUA 1HKMA 4R5EA 5A94A 1JAKA 3VMNA 4OFWA 3GXPA 1SMDA 4CD8A 4P8WA 3B9DA 4ZE5A 4J3XA 5IP5A 4X0VA 1ISXA 3T09A 2OYMA 4L4PA 4D6HA 3EJPA 4V2XA 4PEEA 1VRXA 5I77A 2FEXA 4MPKA 3A4WA 1UHVA 3O9NA 2JEQA 2J77A 1UR2A 4NRSA 1FH9A 4XB3A 3KZSA 3EMZA 3ZT6A 1V0KA 1E0WA 1Q6EA 3WDIA 1TZ7A 4JL2A 4JIEA 3DYMA 2O9RA 4UCFA 4PMRA 2RK3A 1OD8A 1HL9A 3CZSA 4P35A 1BVZA 4ENTA 2BNJA 4W89A 2V4UA 3FHQA 1HJXA 2YLLA 2C8NA 2OYLA 5CLWA 4JAWA 3VD7A 1OSEA 1CGXA 1BTCA 4F79A 3ARYA 3IJ8A 2EAEA 3FN9A 4QLLA 1ODUA 4AZ5A 5E1QA 1PX4A 3N15A 3ZJ8A 4PMYA 3PZ9A 4GZEA 2OSWA 1TQUA 4CCCA 1V03A 2J62A 1P7ZA 4C7FA 3NUKA 1UD6A 2VXOA 1UR0A 2VCBA 5D9NA 5AY7A 3MKKA 1NM9A 4W85A 3CZ9A 3GBEA 1C3OB 4UNIA 1ZJBA 3II1A 4UQDA 3EBVA 4HPHA 3TTQA 2AB0A 1NOFA 1CF9A 1ZU8A 2D7JA 3AS1A 1JVNA 1PX3A 1G9HA 5CQ1A 4A4AA 2WCGA 3BVTA 2NV2B 2D3NA 3AIBA 3MUY1 3FSEA 3DYOA 2XSBA 1KCKA 1J9YA 3PQ3A 3PQ5A 1OWQA 2ZICA 4AD1A 4OIFA 4I46A 1PAMA 4KWUA 1KGWA 4W7VA 1VBRA 2OSXA 3MGKA 3ARVA 3HZ3A 1TVNA 1K9VF 3I3DA 5HPOA 3B9AA 4BQ2A 1JYVA 1G0CA 1JDCA 3AZTA 1KWGA 2OWXA 4AIEA 2WLYA 3CZGA 1R7AA 3MMDA 1QI5A 4AYGA 2WSKA 2PBOA 1C3FA 1D3CA 2WMGA 2WW5A 4QFUA 1RPKA 3B8SA 3VIFA 3MIIA 2C7FA 2DSKA 1UR1A 1RD6A 3FY1A 1W9PA 2NV0A 4Y1RB 1VEPA 1UKTA 1UOKA 2ZXDA 4AMXA 2RK6A 3WUFA 1JF6A 1LWJA 4GO8A 3W38A 1GQLA 3GH4A 2XVLA 5CPTA 3PZUA 5HPCA 1QW8A 1OX5A 2Y5EA 2ZOXA 1EHNA 1NARA 4ZE4A 3T2PA 1R47A 1AMYA 4CN6A 4XLLA 1B90A 2WVVA 1M01A 2XUCA 3APGA 2YA1A 3AFBA 2OW7A 1CDGA 4WKHA 3VM5A 4AZBA 5ABFA 1HN1A 1CGUA 3WDPP 3AYSA 4CU6A 3GH7A 3SCTA 2FGZA 3AHZA 4H8UA 4S0ZA 1XSIA 4CVUA 4PCTA 4M56A 4UZUA 3T0DA 2WMKA 2VR5A 1B2YA 1AQHA 1J0YA 1E72M 1NOWA 5I2UA 4GI6A 3F5LA 3MSGA 3NONA 1R85A 2E40A 1XC6A 2DT0A 1KXHA 1BXRB 1R34A 3VIMA 1Z32X 1V0LA 2WKGA 3J7HA 2VTFA 5DFAA 3RCNA 1E5JA 4J28A 4B2YA 5GNYA 3OIHA 3VDBA 2WAGA 4DWSC 2GVYA 1M04A 3EWNA 3CMGA 4CU8A 3LXBA 2JF7A 4HA4A 1ZBKA 2CYGA 5CSYA 5IDIA 4B9YA 2DT3A 3WL0A 1W1YA 5CXPA 3AJ7A 1WKYA 2IXVA 4CN4A 2WVUA 2XIBA 3CHEA 4U3AA 1JYXA 3VNZA 1VJZA 4PTVA 3WL1A 1ITCA 1WZKA 3GXIA 1BG4A 2ABWA 1GGJA 3VGFA 5A6KA 3M3PA 1UQZA 1E3ZA 1TA3A 4V27A 2ISSD 4D6EA 3N18A 9CGTA 1PE0A 2D2OA 1OGSA 4P2GA 1AQMA 4QP0A 2QMJA 2WVVB 6TAAA 3LPGA 5FD0A 1HX0A 2J75A 1UKOA 3BMWA 3EJTA 4KMQA 4EANA 2EPNA 3QGVA 5LA1A 4UQ9A 4OGGA 4M8UA 1H4PA 4NX0A 1M6VB 1JFHA 1DEDA 1E73M 4P34A 2VQUA 5SY6A 2XVGA 1SFSA 2PWFA 4CD5A 3MI6A 3F5KA 4JFSA 1XCXA 3AXXA 3GDBA 1VF8A 2WC3A 1MW0A 3F71A 3WD4A 4AZ6A 1D7FA 3WNPA 3WH6A 3BAWA 1JYNA 5DO8A 3EYPA 1GOWA 3RDKA 2J79A 4OOZA 4PXYA 4EE9A 4FNQA 4HZ7A 4ML4A 4M29A 5I3DA 2XGBA 2ZIDA 4U2YA 1QX1A 2ZX9A 2WCAA 1KXVA 3AISA 2WHKA 4AD2A 3AYRA 2F2HA 3WD3A 1WCGA 3BSGA 2Y24A 1PZ2A 4BZYA 3NSXA 1GG9A 1C8YA 2BXYA 3ARQA 1SOAA 4UQCA 2WMJA 3MV11 4BF7A 2R1TB 1ODZA 2WJZB 4EK7A 4HZ6A 4TTGA 1JDDA 4PTXA 2XFFA 2W4XA 1ZJAA 4UFJA 5CG0A 3F4VA 3W28A 2J7BA 5TD4A 3MV01 3AIQA 3LX9A 1MFUA 1M53A 3FAWA 1LQ0A 1FFQA 1E71M 4M80A 4UTFA 1G94A 3L4XA 3B36A 2ALWA 2QV4A 1PIGA 4ENVA 1FY2A 3WY2A 3WBEA 3A5VA 1CIUA 1LG1A 5A8NA 3KWXA 1UD4A 1OGBA 2J25A 4ZFMA 1UA3A 1P5FA 1R7OA 2CKSA 3CIVA 3WSUA 3I3EA 4Q7NA 1XHGA 1O6IA 1HJWA 1VB9A 3WF0A 1ISYA 3K8MA 3A6OA 1I1QB 1R75A 3PHAA 1XH1A 2AAAA 2J47A 3GXDA 4CVWA 1E56A 3A21A 4LYQA 4CUCA 1DHKA 1V3KA 2YDSA 3T0AA 5M17A 3R76A 2J7FA 2DEPA 3T0BA 2XM2A 5C8BB 2CHNA 1G2IA 3BAKA 1UH4A 3BAIA 1V08A 4LYPA 1FP9A 3N7TA 1E4LA 3DDFA 1VCMA 4HU8A 3WEOA 7A3HA 1GGEA 4B16A 3PZQA 1MQPA 2VRNA 4PYSA 4BFLA 3BLPX 4P7NA 2B31A 4Y1GA 1HKJA 3CH9A 5BCAA 2XG9A 1US3A 3S5ZA 4DO6A 1BF2A 4D6FA 2CCRA 4AUNA 3BUIA 5D8WA 2PWGA 3VGDA 1BAGA 2X0YA 1VAHA 2YL5A 5FCZA 3CC1A 1MQRA 4XZBA 5CSUA 2FHBA 2HISA 4E2OA 1VEMA 4AZGA 1KEEB 3NJ3A 1MQQA 1PS3A 3PZIA 4AXNA 1D2KA 3DX2A 2XJ7A 1HP4A 2E9MA 4DUXA 1XSJA 2D73A 3BH4A 1QHOA 4BS0A 2E9LA 1CGVA 2E4TA 3RILA 3EJQA 3RJYA 2CETA 1T0OA 2CXGA 1I7SB 2G8ZA 3KL5A 3MANA 2GK3A 1HNYA 2G3JA 3MSDA 1SMAA 1W1VA 3D3AA 4YHGA 1TR1A 5EFDA 2EPKX 1IZZA 3FIJA 5E9AA 2EADA 3PZMA 4B31A 1PV2A 2LXNA 2DSWA 2DSUA 4MTCA 4YHEA 3HN3A 3WNOA 3UETA 1UWUA 2W91A 1MXDA 3QR3A 1DWHM 1LL7A 4UFKA 6A3HA 1Q6CA 1UASA 3CTTA 2VZVA 2NT1A 1UUQA 2D1ZA 4HOWA 2W66A 3HMCA 4TVDA 3NSMA 3P9RA 3TTVA 4ACZA 2D0FA 3TTYA 4AUEA 3CZAA 8CGTA 1ONSA 3W24A 3B9EA 1HTYA 3HG3A 1NWUA 4UFIA 1QNRA 2A3CA 4BIMA 1NOUA 3ZJ5A 1Q2UA 1FOBA 1N82A 2BY0A 4PTWA 4TVUA 2R1TA 1V6UA 2J7HA 3ZT7A 2ZXBA 3M7SA 1OGGA 1VJSA 4WXYB 1GONA 5A95A 1HXJA 2O92A 4BQ5A 4AZCA 4MADA 1H41A 2X2YA 3WY4A 2ZE0A 4L95C 3W37A 1GVIA 1QI4A 4PMUA 4PSRA 2DT1A 3WQ4A 5D9MA 1OCQA 1OD0A 3UOWA 4UQAA 1HL8A 1QI3A 3WH7A 5ABGA 1W9VA 3L4WA 5JZOA 4ZDKA 1OIMA 1UYQA 2XWEA 5EMYA 4NF7A 2MANA 1CGTA 1BFNA 2YIHA 4GO9A 1V3HA 5A8QA 1NWRA 1P7YA 2WSPA 5SYAA 4H8HA 4AZCB 3A23A 1FHDA 4LX4A 3WBAA 3W6LA 2EACA 3A22A 1VCOA 4V28A 2V3FA 1LG2A 2WVSA 1L9XA 1EOMA 5C71A 2YJQA 4PCSA 1HXKA 3F5DA 1TFVA 2GDVA 4R27A 1XH0A 4CGTA 4OZOA 1UH2A 3TQIA 3W25A 5GQBA 2VRQA 2QHAA 2F1AA 2IGTA 2O9PA 3PBGA 1XV8A 1TMQA 2WC4A 2J7EA 1JXJA 1GQIA 2YKKA 3EDEA 1H2JA 1MVYA 5DMYA 1J11A 3ZT5A 1J0ZA 4KRTA 3CPUA 1E6RA 2OSYA 2BFGA 1KTBA 3PZGA 4W93A 2D3LA 4XV0A 3ECQA 4P7LA 3A4XA 1JZ6A 3L18A 4WLCA 4AW7A 4FF5A 2ZUNA 4WKAA 2XVNA 7TAAA 5A6JA 1UR4A 2RGLA 2JFEX 2G4FA 1YQ2A 3KEHA 2J7GA 3GZAA 3WD0A 3KL3A 3GBDA 2DQXA 1HF6A 2UY2A 1V02E 1H3GA 3A3HA 3VD9A 3WNMA 3AICA 1GGKA 1E6XM 3KLKA 5JUVA 2WMFA 4WKFA 3RHTA 5D9PA 3EJSA 4HA1A 2VCAA 2BVTA 3W29A 3A4AA 2CKRA 3U7VA 2VNCA 2WNWA 1J12A 3DX0A 4IPLA 2EJ1A 4U2ZA 1M03A 1QWSA 1BPLB 3TOPA 4KGJA 4HU0A 2WK2A 4RE2A 3WQ5A 1CGWA 1XH2A 4JFTA 4D6GA 4Y1EA 2WZHA 3CZJA 3VGHA 5LA0A 4ZENA 2VT0A 1CEOA 4ENWA 2BVDA 4JKKA 1VFUA 3P9SA 4PMQA 1C7TA 3WENA 4PMVA 5ECUA 1H0GA 1X6LA 2WLZA 1K9TA 1FYEA 3BUPA 1OB0A 2VX7A 4HOXA 1GPWB 5I23A 2E3ZA 4J3UA 1FHLA 3LRMA 4IM4A 2FH8A 1KCLA 1H09A 3K4DA 4MNJA 4UFMA 1JIBA 1ZBCA 3W82A 1PPIA 4UQEA 4E8DA 4Y0NA 3WQWA 4RE4A 3QHOA 1FP8A 2E0PA 3W4RA 2VZOA 3LRLA 1CS0B 2ZX7A 1P81A 2IUZA 1EOKA 3AMGA 4OUEA 3WQ6A 2O9OA 4Y1FA 4LQ1A 5JZMA 2PWDA 3LXAA 4B3LA 3EDFA 3VDHA 3CUJA 3MUAA 3NDZA 4UFLA 3UR7A 3LRKA 3LPFA 5DT7A 1GOOA 2CBUA 2F7OA 3BAYA 4DM1A 1WDRA 1FA2A 2J4GA 3LXCA 1HVXA 1EDGA 3SUVA 3PQ6A 4H8VA 4LXFA 4OGFA 3WMCA 3ZM8A 4Y7EA 5A69A 2X2JA 3WUGA 1WDPA 4W8BA 4AD3A 3IANA 2F18A 3PZVA 1L8NA 2CNCA 2XYLA 4PMDA 3BMVA 2QPSA 2ZX6A 2X0HA 4S3JA 3WH5A 1N57A 4GI9A 3FHAA 3PQ2A 4R7GA 1QI0A 1WAWA 5A8PA 3L4VA 4MGHA 2ESCA 3EDKA 1XGZA 3ZMRA 3OA5A 2WKLA 1VENA 4MNLA 2WXDM 4Z2LA 1EO7A 2J8FA 2WYSA 3EJUA 3BXWA 1A47A 3THDA 1WE5A 2DH2A 1RH9A 2BXZA 4L8FA 3BVXA 2YL9A 1CTNA 2J74A 3SCQA 2FDMA 4ADSG 4GXPA 4MNTA 2F61A 2XSAA 2ZX8A 2VRKA 1QNSA 4OOUA 3ARUA 4BQ4A 4PMZA 5IHRA 4U5KA 2G3MA 3NIYA 3CZEA 4AULA 1BQCA 1GW1A 1GHSA 1UR9A 3VUPA 4NRRA 2F7QA 2WM0A 4LGXA 3VIPA 1XRVA 1WB0A 3SCUA 5E6ZA 3WMSA 1CECA 5D9OA 1UZ1A 4F66A 1KWKA 2ZXQA 3CZNA 4QLKA 1I7QB 2XN0A 2J7DA 3L4EA 4URIA 4ENRA 2EABA 1B3WA 5I0DA 1H49A 1CLXA 4HZ8A 3WUEA 2V38A 3TTUA 2D20A 3MMUA 3O2LA 3DHUA 2YWJA 4M81A 4AWEA 4XX6A 3AIUA 5E0CA 4QYXA 3B38A 2WHLA 1BGGA 1TG7A 2XM1A 4TTUA 4L78A 2VX4A 5A2BA 2GSJA 4NI3A 3K1DA 5F7UA 4QYTA 3EDJA 1EO5A 1E1FA 4HP5A 3VIGA 3GTNA 4KGLA 3AOFA 5CGTA 1B3ZA 1VBUA 1H1NA 2D23A 1VEOA 1P80A 3L4YA 2E9BA 3SCOA 3WMBA 5EFFA 4J3VA 4X9YA 2GJRA 3PQ4A 4MTVA 5FIPA 2XTKA 3BAXA 5JIWA 4M82A 1UR8A 1KTCA 1L0PA 3ZR4B 5BROA 2JALA 1UWQA 4LPCA 1TQVA 3VGGA 1UZ4A 3ZJKA 4TOQA 5FOOA 2GFTA 4GKLA 1ZBWA 3HG4A 1WL8A 3WELA 4DUWA 1PDWA 1R46A 3TTOA 4HA3A 1KB3A 4YPJA 2YL6A 1QF7A 1CLVA 2ZWZA 3PZOA 4FNTA 4ENQA 3BLBA 1BYAA 1CWYA 4JHZA 2BHYA 3G6MA 4AMCA 1E4IA 3SCRA 4W87A 3WN6A 5JBFA 1C30B 4U31A 3OBAA 4JFVA 1EHAA 4JHOA 1E6NA 1EGZA 4MNMA 1R87A 2YDRA 3PN8A 1QW9A 1E6PA 1QI2A 2DH3A 1KQZA 4WJXA 4B40A 2OYKA 1RP9A 4B15A 3D5HA 3AIRA 1OX4B 5CGMA 4Z2KA 5JIPA 4RKYA 4ENSA 2GJXA 2CBJA 4JCLA 2CPUA 2EXOA 2YA2A 3OG2A 4MB4A 3WEZA 3FNDA 1XSKA 1XD0A 3AMLA 1BLIA 5I24A 3D4YA 3D52A 2OW6A 3L4TA 4RL3A 5E70A 4LYRA 3VU3A 4X0NA 4KRUA 3VTRA 3CHDA 2ZUMA 4MB5A 4TXEA 1F4AA 1KR1A 3FW6A 4AMWA 2NW0A 1KXQA 1ISVA 3TV8A 2D24A 4J3TA 1H5VA 3PZTA 4AEFA 1E4MM 1DTUA 3S6TA 4B5KA 1C92A 4JKMA 1UH3A 2QPUA 3UERA 4AZIA 1MFVA 2TAAA 2BY1A 4UOZA 1E0XA 1KBKA 2Z1KA 3BC9A 3GNPA 5JBDA 3UG5A 2W61A 1UQYA 1NWTA 3WIJA 4FLSA 1W9BM 4PUDA 3DC0A 4U5IA 5BXPA 2OWCA 1I75A 3BCFA 3VD3A 1GUVA 1JI1A 1E5NA 1TE1A 2G3IA 3AS3A 2WWCA 5KEZA 4MJ2A 2DIJA 3TONA 2WC7A 5BXSA 5SY4A 1DWAM 4W84A 2XN2A 2WHJA 2WVTA 2WPGA 4U33A 5CPQA 2X2HA 1JZ3A 3DX1A 3BSHA 1GOKA 3OGRA 2XFYA 2GHRA 1CYGA 5A8MA 2D0HA 2VL4A 6CGTA 4HCJA 3ARPA 3POCA 3H54A 2BHUA 3POHA 3VIJA 1NWSA 1E3XA 1GQJA 1XCWA 4GPNA 3OGVA
chains in the Genus database with same CATH superfamily
5TH2B 3IOCA 3Q41A 2OCZA 3W6OA 3OM9A 3T81A 2QD4A 3BOXA 5INCB 3AYTA 2GA9A 4MS1A 5D3ZA 4ZALA 2P3SA 3AB3A 2IFFL 1P91A 2WVAA 2I8AA 2RJGA 3PG5A 2X16A 3TQFA 1K08A 3L5XL 1SUDA 1XLJA 4QHUB 4G5HA 2DRIA 4DPRA 1N2OA 1G7LA 2NY3C 5ENLA 4HALA 3ZJ6A 3QEQB 3LP5A 1II9A 1P75A 1XGEA 5TJWK 1GJWA 3TLBA 3UBTA 3O9WB 4FNUA 4L18A 3ACDA 2GCYA 4DN4H 2JGEA 4S3FA 3VDAA 5H3HA 4GI7A 1R9GA 1I80A 4FYPA 1Z9LA 1C7JA 1Z6JT 2Q5EA 1OPGH 2XH2A 3P61A 4N0FA 3L5LA 3HMXA 2R4SL 1DE4A 3PM6A 1TZJA 4LU5L 3QF4B 2BUCA 3PT9A 4M43L 1AQ0A 3FKRA 2N7AA 4Z0SA 3UY4A 4H1WA 4LQFH 2G4GA 2VRAA 4IDFA 4RVFA 4ZMZA 1ZJ6A 3MTGA 1Q2SA 4Y2UA 2QTAA 4I6GA 1OTYA 4X42A 4DL9A 2VKXA 4OT1H 1KPUA 4XDGA 1XF0A 4LB4A 4L6CA 2CKBH 4I0PB 3BVUA 2OB3A 4MQ5A 1N2HA 1O8BA 3ZH9B 2PL5A 3AR4A 4IOSD 4QTTB 3E2SA 1TZ8A 1H7NA 4DN1A 3B1ZA 3M6VA 3GVWA 4KFNA 1KBBA 2EE6A 1VRDA 1EH9A 1X80B 1ZKMA 4OAPA 4L3EA 1OVDA 2W2MA 1R4MA 1CLYH 4R9HA 4BXOA 2XWTB 3SF8A 4YBQC 4CRPA 2IS7A 3DSNA 5E8PB 3GUTB 3COPA 1U1JA 1Q0TA 1WNOA 4WQ6A 1U0HC 1YJDC 1E6JL 4HS9A 4MVJD 2YBUA 2W2LD 5AMXA 2VDJA 2OTCA 1TCVA 4FSHA 1P2VA 4MW0A 5D72L 4WRLA 1U8YA 3AFMA 3DEKA 4KITB 2I2BA 5H8PA 4NPHA 2C9XA 3UR8A 5TF0A 1WXEA 2FWAA 3UJ9A 2W88A 3L2MA 3N40F 3KZKA 5EVJA 1QAPA 3BAEL 1JWMA 5E95A 1T36B 2OZLA 3REWB 3KEMA 5L2KB 5EVCA 2CUTA 2VJPA 4PLWA 2OTDA 4OX9B 1Z2EA 4ZCPA 1BCSA 4PFQA 3NIGE 3P5YA 2WMIA 2WIJA 1Y8BA 4YZFE 2AH5A 2JCCB 2OHJA 5T33L 4S10A 5I17A 3OZPA 1C29B 2ZUUA 2H8XA 3IDSA 2P28B 3QJQB 4M6PA 5IUNC 4C3OB 1W3LA 4AC4A 3RC9A 4DLVA 2HFEA 3O45B 1DBTA 4KCTA 2HHAA 2HVKA 1KW1A 1I6NA 4ZYYA 1RUAL 4BEQA 3SJAA 1N8OE 2D2CC 4G7YL 3P0RA 1KDOA 5DDIP 3ZQ6A 1WIPA 3BLIA 1YE8A 2MMGA 1R3HA 1OM0A 3TTWA 3DAPA 1E1RA 5IXYA 1V6SA 4KUCD 5KUTA 5DUJA 4MCZA 1ZGLA 2V5DA 5EZOH 2ZIGA 3L5MA 1ZAJA 4GBUA 4GLEA 1BVHA 4OKNA 2ZJ4A 3JTMA 5AM4A 3BWUF 4TLSA 4JL5A 1WTLA 3KNZA 1NGWB 5BVJB 4RTLA 3R44A 3MI3A 4NZNA 2ZRXA 1UQSB 4PN2A 5CG1A 1DIAA 4P9ML 5I3JA 4GP9A 2EDYA 3QVQA 1UR3M 3DIVA 2X6RA 4QRBA 1IJFA 4QS6A 2ZT9C 3UWOA 4RTOA 3SCMD 1V47A 2HQOA 1RUML 4TNVK 1JECA 3BRSA 3THMH 2O9TA 2EWVA 2DHCA 4IGBA 1ZTMA 1FVFA 3ARXA 3GGDA 4BYHA 3OCVA 4A55A 4JYPA 2P1DA 1NP2A 3K4AA 3A9RA 3L7MA 3N8NA 4CTMA 1BFOB 5DNCA 3MJ8B 3T1FA 4LOFA 2FO4B 3JQ9C 4FA7B 1YLVA 3W26A 3PHQB 3INOA 1P7TA 4FKMA 4PD4K 5JHMA 1I1XA 5ERWA 4MUXA 2VXQL 5HUQA 4YJ3A 5EBMB 3B7SA 4NOFA 2O20A 1KIQB 5I2IB 3WDMA 3D2UD 4WRRA 1FVEB 1BO6A 3ES7A 2JQZA 1VBFA 4JRYA 4Q4KA 3CLUC 1LWIA 3QCVL 3SBQA 4HC4A 2UKDA 4LDNA 2A99A 4N18A 5E9WA 3GIZH 3GR8A 2C9BA 2Y4SA 4EWJA 5TDOB 4A7GF 5GJTL 4HBCL 4RDVA 1RYFA 2J8OA 2RH8A 2VXQH 3B6KA 3GTXA 1SQ5A 2BEVA 3LUAA 4LCEA 4LP8A 1HXYA 4YEDA 3RHGA 1JDAA 4LSTH 4CL3A 1T29A 3ETTA 3QHZH 3P54A 4UULA 3U2QA 5J1SC 4DW2H 3FKSD 3HUJA 3DQQA 1UKEA 4BWLC 1DC5A 2P8JA 4I2NA 4K46A 3N04A 3CVHA 4GI8A 4R5VA 4EI5B 3SBWA 1C41A 4UUJA 3QWIA 1GNTA 1BW8A 3QUYA 3JQBA 4IDLA 1OAOA 2HKHH 1A65A 2RA1A 2QN3A 1PIWA 4D71A 4OH1A 4P9MH 5JW4Q 3D0LB 5K3VA 2FSHA 3I2GA 4Y9SA 2OSLB 5FO7A 1SJDA 3CBJB 3N06B 5CC6A 3C2RA 4PNEA 1EZ2A 4BKQA 4D3SA 4PGLA 2IS4A 4HVTA 3NACL 3HPSA 1WAPA 1LSUA 4DERA 3ITLA 3PNYA 1T2NA 4JI0B 3LE8A 4Y0GA 2OXTA 3S2FA 3MLVH 5I19L 2JKRM 5HXMA 2XXAA 3TNDA 4X54A 4OZ4A 2ATMA 4LF9B 1KELL 2V5BA 1KFAL 5IQ7H 1PR4A 5SX5H 4JKPH 1TYZA 3W6YA 5FAKA 2B3IA 3UZ5A 2P6NA 3VWKC 4M7KL 4HHPA 2NNAB 2WU1A 4RPCA 1YYLH 1EFTA 3MO4A 5DFVD 1PGJA 3HKDB 4DAOA 5KSUB 3LX4A 3CSGA 1N7GA 5KVEH 4BFFA 1RURH 3UESA 5HE8A 4JKOA 1SJAA 5IF0B 1CVRA 4IS6A 1MA3A 1CK4A 2I9TA 3AIVA 1K4DB 1V5IA 4OJYA 1Y1DA 5CA0A 2UZ9A 4RE5A 4MUHA 4Z4CA 5D1XD 4MD0B 2DUAA 4AAJA 1NGWA 2A86A 1J1UA 3T61A 3I50H 4NN5C 3E6HB 3KKPA 4LV6A 3SHSA 4XKJA 1MFBH 2WZPA 1DQVA 1A8QA 4HRYA 4EOWL 3W73A 3S5OA 1WA1X 3K8LA 1V43A 1IAII 3FU9A 3LW8A 3HJ0A 4IU3A 2JKWA 5D1HA 4D0RA 3PREA 4FQXD 1G1YA 4FHBD 4J0KA 4P36A 1VJIA 4AUMA 5MEOA 2OR9L 1UKAA 3W77A 5GNXA 4TKUA 2YPVA 4TTSA 1W8GA 5K2OA 5JXED 1PZUB 1TREA 4I36A 1VFPA 3GU2A 3AW8A 3U7WH 1BQEA 3K4HA 3SPXA 1U6AH 3GLHE 2OO5C 4F5CA 3KDMA 3DNKA 5K0GA 1PDKB 5A2LH 3W53A 1TJPB 5IVOA 1HOTA 2I25N 5AM5A 3M4XA 4D72A 1KYOK 1UWRA 1DSFH 4CSTA 4GGMX 4GKKB 5JO0A 4MAYA 5AC6A 3C5WP 1YJXA 2BTOA 4W9FC 5FEPA 2AZTA 3FN3A 3TLYA 4PC8A 2QFPA 2B7CA 5CSGA 12E8L 2EBWA 3W1UA 2P3QA 5JRJA 3RS3A 5M04A 4AJPA 3JV6A 1MFEH 2D7MA 4ND7A 3QE9Y 2EERA 5TFSL 3EZ6A 4I9GA 2CLRB 2H1PH 3LKPA 1BAFL 3IGLA 1TPEA 3OIXA 1ZVSB 1U1IA 4NX2A 1I1AB 3WQCA 3M6AA 3RYFB 3HMXH 2CHOA 3L1IA 4NNAA 4K23L 1TUPA 2Z2UA 5E9QA 4N6QA 3STFA 2XX0A 3CPSA 1EBBA 5JPDA 1I8MB 1IX2A 1ZTXH 4R2GC 1YU6A 3HJTA 4B2LA 3WO4B 6FABL 2V6BA 2P8CA 2JXMB 3VPCA 4GUGA 1C8XA 1W0MA 1XK6A 1M2NA 3N2IA 4KDEA 4EG3A 3VE0B 3T38A 2OV3A 3T0EB 3H2MA 2RBGA 4RVNA 5HYSG 3D85B 1K8RA 3P80A 3D0QA 2JKLA 2R4TA 4G83A 3U0PA 4YWSA 1WIUA 5BXQC 4NV0A 1F6AB 2ZUVA 3IUDA 4DABA 4B7AA 4TNFA 4I50B 5FCUL 3SKYA 1G6RB 4YEFA 1TTAA 3IQHX 1OPRA 3BVNB 4RZ2A 3VX0A 2HC9A 1CZ8H 3IO5A 2VYVA 4URYR 3T0IA 2VT6A 4W70A 3U1VA 2H2DA 3LY7A 5DSXA 1O89A 3PFUA 3WDJA 1F3LA 5IBPA 5C1BA 2OQJB 3ZGXA 3WIBA 2NVWA 1CDIA 1O68A 3MHFA 1JF1A 5LKNA 1E6MA 1Y4AE 1LTDA 4D74A 2PO5A 1MCWM 1S38A 1MW2A 2E4UA 4DBLE 3KVQA 4JFOA 3ROQA 3M5XA 1QEWB 2R1MA 1RK6A 3JQ8B 3T5MA 4PD4J 3GH1A 4IRSB 2YXLA 2VVSA 4NUGL 3KPTA 4RV3A 2QPLA 4F7PA 4R7OA 4FULA 4WWNA 1RXWA 2BSCA 3BUDA 1L5ZA 1GITA 2H6EA 2YRPA 4TMYA 4LMRA 3LYUA 1WB5A 1CE1L 3LXXA 1UDBA 3QOYA 5E4FA 3EUDA 5IN5A 4F20A 4BGDA 1E7WA 3WO8A 1JNEA 2IDKA 4ZXOA 2J0UB 3KDAA 1TNNA 4O0QA 4WKPA 1G18A 1KR0A 2WKSA 4PJ9D 1O96B 4MS8D 1JKXA 4Z0PA 4DQOH 3ULVL 5IHPA 1TV3A 1Y3DE 3A36A 3E9YA 2VFGA 3V95A 2ONCA 5A5EA 1HUVA 1SFHA 3MS4A 3W5SA 1F3DH 1AZLA 1LEIA 2P4HX 5T5FL 2D1SA 1EE9A 3DI0A 3TGWA 3V0AC 4NRYB 5IP4A 4YN5A 1TMCB 1E9IA 4YGYA 5F2GA 2Y1VA 4LAJH 3PUKA 2Z9BA 1VLVA 2YZGA 3AQDA 3L02A 8RUCA 4CEJA 3VR2A 1FTSA 3BEDA 3H5AA 5L6UA 3Q9LA 4QYAA 1ONPA 4C0SA 4N8CL 4M1RA 5DJ0A 3LWZA 5SWZB 1QVWA 2O5EA 1HLDA 3B13B 4L8VA 4MPJA 4AL8L 4AZ7A 3IU4L 1NXSA 2EGUA 2CERA 4NRXA 4U4BA 3MCWA 3RM3A 2CEKA 3FF8A 5CEXB 1COBA 3MXVH 1CWUA 3X14B 3MUGA 2VSXA 2OK8A 3CB4A 5AVWA 4IIFA 3EOBI 4Y4HD 4LUSB 2Y1CA 1KMCA 3RZWA 4P2OD 3TP4A 4R2WA 3WGIA 3NCWA 4Z0XA 2CJFA 3P9QA 1Z2OX 5E0QA 4IJQA 3MCLH 1JPNA 2HBRA 3CPGA 5G4WA 2QTZA 3HMWL 1JMKC 1FBIH 3E7JA 3GFVA 3AUTA 4DGWC 3KAKA 5K9OA 4N9EA 1GT6A 3KWFA 1ZOSA 5HDLA 1JPSH 1W37A 1MLCA 2ZOLA 4OBSA 2DE0X 1FP7A 2G9NA 5EBLA 4MOZA 3KEOA 3VACA 3IULA 4LLVA 5LIXX 8FABA 4UTZA 3GI8L 1IKOP 3OGSA 3KU4A 3NACH 3N42B 2QNBA 5FW6A 1AO7B 3N11A 4Y96A 4KXBA 1JQKA 3HP1A 4WEQA 3SQWA 5F9WC 1E4XI 4PJDB 1YN6B 2BY4A 4XP6L 2WMOB 4EJFA 2N46A 1JXGA 1KN2L 3H8SA 3ARGD 4PTTB 3H2QA 4X00A 2M9MA 1Q1AA 1IAIH 3JATB 3W83A 1VPDA 3LBMA 4EBQL 4C90A 3KLBA 2Z27A 5FFGA 3B20A 2ODPA 1G1OA 1J00A 3BM5A 1TR7A 4X6FB 2CFIA 3Q72A 1H42A 2X6QA 3WFBL 2Q3RA 1E40A 3K6JA 4I66A 3I04M 5BVHA 4JM2B 3PC2A 1S3KH 2CNKA 4Z54A 1EEZB 3NEVA 3BA1A 4K6MA 1U95B 1GZSA 5EFZA 2YMXH 4DG8A 3EOEA 1SG6A 5I0ZA 2WTMA 3OIFA 4YREA 1N64L 3OZSA 1S3HA 3WZ2A 1Z6KA 4LNYA 3ESMA 4Q9DA 4K5OA 4PEEA 3UXIA 3L8EA 2VK4A 3ZKWB 2QDHA 5D2VA 5GS3A 3NN8B 1OXUA 5DDHB 3EVCA 2G5PA 2JEQA 4HCRA 3FVWA 3ONEA 2O8BA 1ADSA 4P38A 3MGTB 5EP2A 2YINC 2NY2C 5IEKB 3IS4A 2NZVG 1RFDL 5E1BA 3FWYA 2WB4A 2RK3A 1KCVL 1QIDA 4TV6A 3KQPA 1QPGA 1K7YA 2NUYA 2VYOA 4O1MA 1NDTA 2K70A 2I7TA 4PFHA 1KJMB 5CLWA 3DJZA 1NAML 4FN4A 5KREA 1T0UA 2XQYA 1FV1B 4HX1A 4AC2A 1AZWA 2AC2A 2GBTA 5TS3A 3HIZA 3R7QA 4JYEA 3RX2A 5C0AB 5JIDA 1WFTA 4KNQA 2QEJA 3Q9NA 2VJOA 4JC0A 4B4VA 1F5SA 4PMYA 4WV1A 1A3XA 5DHXB 2IIBA 5JYLA 4CKBA 4LK3A 1OYAA 4L6HA 1JK8B 4U1MB 2VCBA 5DMMA 1GZHB 3M64A 1CNFA 2BWGA 5IJ9A 4JEJA 1YTKA 4RX4D 3QXXA 3WQSB 4WFEE 4BMZA 2E1PA 4FXLA 2V82A 1KM5A 1V96A 2PGJA 5H37A 3KELA 3LGXA 5FGCB 5SZIA 3GBPA 4OUDB 4IJ3B 5EHXA 5HJ7A 1AM4D 4QRPA 2HTKC 4TQEL 5L9FA 2LW3A 4PCVA 2HMID 4ZT7A 4K6GA 1VKRA 3I6EA 3D08A 4KVCH 2UZ0A 1MJFA 3ZVIA 1ZSDA 3W74A 4PGAA 5KB3A 3THAA 2BOBB 4AKOA 4XRRA 3KLHC 3OKMB 4WKOA 2UZIR 3ABLB 5D1NA 5BRZA 4RA6B 3AEYA 2A6JB 4KKLD 1GOGA 4RA0C 4NJGA 3TZLA 1DIDA 3QMRA 3VIFA 4YE0A 1YZTA 4JR0A 2C7FA 3L21A 3UFXA 3HGSA 2BZDA 1I0ZA 3BGDA 4P3DA 4NV1A 4NZ3A 1AHMA 2ATPA 3WUFA 3P0IA 1FF5A 4M60A 4NR0A 4EM6A 2ZZ1A 1OD7A 5IBQA 2PO7A 4X50A 1D09A 4LKXA 2Z98A 3X43A 5BYAA 5F9HA 1N3BA 5A3VA 1DO6A 3FJ6A 5CZ0A 1P9WA 5GJSH 1SXZA 3L7FB 3UTSD 3NIBA 4D2JA 5CYFA 3TL3A 1L7BA 1HK6A 1QIEA 4Q1VA 5ESQA 5EZLB 4OM0H 3UM9A 4IPPA 3MBIA 2K3HA 2PX6A 4ZMYA 3PUHA 4WK4B 4NO5A 3Q3GB 1EJ2A 1FDVA 3S5JA 3DV0A 1PYFA 3TYAA 2F9MA 2YPLD 4JDVA 4HYYA 3IAXA 3HCFA 1JPHA 4QM7A 4QNPF 2RHMA 2GKSA 3V18A 1IAIM 2QVZX 4QRPE 4F2PA 1ZFJA 2DJSA 5J3JA 5F21A 4WFHD 3R8BB 4OXQA 4C05A 4B5NA 1H8EA 2V2DA 2EDQA 2FKPA 3BE7A 3TSDA 4B1FA 2O55A 4LCBA 3QRFM 4H2HA 4WDXA 2ODIA 1W5NA 4HB0A 3A9VA 2B35A 1OFOA 3EWSA 4TT3A 3CN0A 4PPYA 5C07E 1Q8JA 3OLQA 4J0EA 2TRSB 3WL0A 4XKYA 3VE0A 3PGFH 3RF9A 4C1KA 1AKWA 1Z15A 1LPBB 3X1YA 5HP5A 3QCUL 1V93A 5DULA 4LSVH 4B8ZA 2I67A 4JD4A 4XR8C 5DXJA 5CJXA 3WWYA 1YKSA 3S4TA 2QVIA 5IM4F 3B2EA 4F3CA 5IHXA 1TU2B 2FEOA 1G9XA 2EE0A 3KEGA 2CKDA 3TA3D 1XLFA 4YYZA 2OTUA 3V9EA 3KE8A 3B9BA 3PEUA 2NUXA 2BTEA 3TSBA 4N49A 3V8NA 1FIGL 4DP6X 3AINA 1A4RA 4WY2A 4YUZA 5I30L 1MJJB 1GN8A 2G8NA 3SP1A 4CMHA 1LORA 1DEDA 4D2IA 1SFSA 3EIOA 4MPQA 1RY8A 1BMGA 4PIVA 1QXSA 1A1NB 2IPXA 3ZZUA 3RKUA 4CMMA 2HU7A 4G43A 2IDZA 4GAYB 4PXYA 3EYSH 4J2TA 5LGKA 2ZJBA 4FHGA 7YASA 4ML4A 1MHHB 3DAFA 3II6X 1N2RB 3RX7A 4DVJA 5LFAA 2IFFH 9LDTA 1SXJC 4D7BA 1H5BC 2AUMA 2YJ4A 3CM0A 1PFKA 2YZ1A 5SWQB 4KF1A 2XCRB 1Y65A 4XO4A 4JY4B 4X2PA 5AENA 2HSJA 4UQLA 4ZRDA 2FF7A 2ZUXA 3PWNA 1YTUA 1IJ9A 1TZ9A 3FSRA 2VHWA 4M62H 3MVTA 4Y6SA 1KPUB 2AN5A 2HVJA 5FJTA 5HGGS 3D4BA 2GEVA 5GRVL 43CAA 2R2EA 4F9GA 3JWOL 1NLZA 4XAWL 4X6DE 3JWDH 1VG9B 4YIWA 4HK4A 4TSAH 3A6CL 3MWLA 1PIGA 3NQIA 5KNDA 4QRPB 5B22A 3QX8A 3AXKA 5EXSA 1XMXA 3GLZA 3RYFA 1EXUB 4HUWB 2KBFA 4PBSA 4LT7A 3CIVA 3PE4A 3Q6IA 4F37F 1WAAF 4RIRB 3AQIA 4K4KA 1MCBA 1OM3L 5EJ7A 2NY1D 3DAYA 5E2IA 1PYMA 3I52A 1BU8A 3RADC 3M5DA 2AL1A 3OFND 4PWKA 5EIOA 3WADA 4QPEA 1DUYA 2VC2L 2FNBA 1CXZA 3NPSC 3OCXA 4G0XA 3ZDWA 4XZIA 5CLLA 1TTHA 3FMVA 3R3HA 4HU8A 4XZHA 2NPFA 4DIOA 2NU9B 5F3HA 2NX5B 1Z18A 1YIAA 3X3FH 1MFDH 2KW5A 1Z9OA 1MVLA 2R83A 5KVFH 3DHFA 1J70A 1T8SA 2G5BA 5A7EA 4GQBA 1YH3A 2HO5A 4IFIA 3RWJA 5T8IA 2QIWA 5D6CA 2CCRA 4L9LC 4UU0A 2DR2A 2PWGA 2Q45A 5J59A 1P7QB 2DVTA 5ANME 1ABEA 4B3VA 1SR9A 1CUXA 2D4AA 4AZ8B 5JANA 2B3DA 4DBVO 4RLDA 3VR6H 1E3WA 2ZQ0A 4F2GA 4QJBA 3EA3A 3QHPA 4PAZA 1NCCH 5HJBA 2XJ7A 4V0MA 3JWDL 1P2TA 4KRXA 4NQ1A 3GQYA 1FRNA 1W48A 4KIWA 1Y9DA 2E4TA 1QOPB 2XB6A 1ZD5A 3CH0A 1BX1A 4F2UA 4GNKB 5JIIA 4LHQB 1MRFL 5LDUA 4ZDHB 3KHKA 2H16A 1YE5A 2EPKX 3BDXA 2I9UA 3IKVA 1E1RD 4B31A 5BWLA 2NUTB 2AABH 4IS6B 2PMEA 4PJGB 4YHEA 2I27N 3B4YA 2XH4A 1BZOA 1AYOA 3FJLA 4U7PB 3UB3A 2TSYB 4DREA 3N41F 4E42B 4MWAE 3TEWA 4QU9A 4FZIA 3PA8A 2NT1A 4FXGA 2WUFA 1MO6A 4DJDC 5CCXA 2CNNA 4MR9B 3WX7A 5DUPL 4BWLA 4HKZA 3HUTA 4RTQA 4CG0A 4IK7A 1I9CA 4WW2F 1QNRA 5KTOA 4OLJA 2J27A 2LGJA 3SFKA 2Z8XA 1E5BA 3OR6A 3ULUH 4OD1H 5AYVA 4INJA 2YXPX 4F9PC 1FZOB 4QRRA 4BZ1L 2JKZA 1IGSA 2I4OA 5FX2A 2LTQC 3CQJA 3RT7A 4P46A 1R1CA 3ENQA 3S4SB 3IEAA 2VAAB 1JZSA 4BZ1H 4AZCA 2X2YA 2QTEA 1ZT4B 4FABH 3HS9A 5DD0H 3E6HA 2R1NA 3G6WA 5FO8B 2WZ6A 5LNDA 3ITYA 2XUZA 4MP3A 2XY4A 3ORSA 3PRHA 3K13A 3MTXA 5FYJH 4ALAC 3A28A 3KYDB 1IQRA 3LKDA 5DYYA 1IM3B 3CFYA 2VP5A 1W5AA 4MZDA 2JIMA 4YAJA 2JJQA 1EVEA 2EATA 2AJCA 3WL6A 3CF6R 5A8QA 4F3RA 1NG9A 1OFHA 5LJIA 2L04A 5IHUH 2J1XA 3MOQA 2NCMA 5IUCA 3Q9UA 1AMUA 2CO1A 4DG5A 4R90L 2WVSA 2FQEA 4QTFA 2P2DA 3QHFH 1JPSL 1GH7A 1CUOA 5AN7A 2FDSA 5CD3B 5C9WA 4RLFA 3ARDB 1UZ8A 4OA5A 3CGGA 2PZBA 5BV7L 3QIAA 3VI4B 3NMUF 1LO2H 4C83A 1WCQA 4CA4A 4HI0E 4PWGA 1SVOA 3IIJA 4DCPA 2WF7A 2R47A 2P41A 2AX4A 3WHIA 1RUKL 4L37B 5EXEA 1C3JA 1PFQA 2ZBGA 4MDHA 4DT1A 1SUBA 1KB5L 5DK3A 1QYWA 3G6DH 3ULUF 3GMRB 1VRVA 5DR5H 4OECA 3DV6A 4HWSA 1W96A 1T2XA 1PY4A 5G4OA 2CSPA 1UXSA 4JM2A 2A5LA 5KNCH 4YMTA 2GNPA 4YXFA 1T9DA 5CAYB 5TVGA 1NAMB 3ZHTA 5ADWA 1LE5B 5JUVA 5K9XA 4JT9A 1IXOA 3W7DA 2VAWA 1LRQA 2I4TA 3Q3HA 4FCVA 2XZTA 2AJSL 1OGAD 5EOTB 4OHVA 5LU8A 3B3DA 3W01A 3SZRA 3P5ZA 4OYLA 1MHTA 2R11A 5HTOA 5DK2B 1XZBA 1U8QB 1QG0A 2ZWAA 1K4KA 1CEOA 1JG7A 1A3CA 1XEXB 1F90H 4JD5A 2SNIE 3QUYD 2FYYA 3S1GA 4WZHA 4A6YH 3TO2A 4WEBH 3H8AA 2HWZH 5EBMA 4FFYL 5DHYA 3HRKA 3FDGA 2AFIE 3NWPA 3BERA 4MNJA 4Q1EA 3K4DA 3EDYA 4G5AA 2NY0D 2W43A 2YXGA 4UQEA 3ZE1F 4XC1L 1JWSA 3W3AD 3KPSA 2WGNB 1XF9A 2Q0QA 1HFWA 3X11B 1U5AA 2B98A 5BS0B 5C86A 2ZRPA 2XMQA 3C2AH 2BFOA 1LI4A 2EFJA 3ZIUA 5HDQA 4URTB 5IKCA 4YB8A 4ZTEA 4OZGF 2Z4RA 2XCTB 1KYZA 1OWNA 3HJFA 5JUEL 1ZSHA 2N0KA 4B76A 4AQAA 5TX7A 2XQ0A 3CF0A 3C0LA 4DNLA 1KFJA 2AEQH 2I5QA 5LBVA 1QGOA 2J4GA 3E61A 3T1GA 1HVXA 2EX0A 3QWFA 3SUVA 4UDUA 3MB5A 3MDJA 2FLIA 2XYBA 1H2FA 4FSAA 1WBHA 4OIIH 5EHGA 5G55A 3PPHA 2WPBA 5EZ6B 4JEGB 4LWQA 5AKQA 3OP2A 1TU4A 4DZZA 3PJFA 4ZTZB 2B1JA 4PMDA 4E9QA 2QPSA 1A0QL 4JBIA 1NL0L 2ZX6A 1MIEL 4YP6A 2ZR9A 3EC2A 5IUSA 1W7AA 4GI9A 4KLAA 4P4SB 3QH4A 5BORA 4LYYA 5LP6F 4X7TB 1CUWA 3PNRB 2DQGH 1SFTA 3OZTA 5CM9C 3KLAB 1QHHB 3TB4A 4CMCA 1FQWA 2ZULA 1FJ1B 2X4RB 2DH2A 1JAHA 4DPBX 4GM1A 5A4KA 3ADDA 1S2NA 5HZKA 3KP0A 5LIKX 2BXZA 4YCAA 4ADIA 4YRQA 2RDXA 2NU8A 3L7JA 1A3WA 3H1TA 1CK0H 3FSUA 1UBRS 3OPUA 2CDEA 4QELA 3MO1A 4XA8A 4D4LA 2B7BA 5DH9A 3FZUC 4XCEA 1SZGA 2B4KA 3FT4A 2ZJ1A 1A9PA 1BXKA 2VAAA 5JNYA 1DCFA 1NVMB 4QXOA 4HJIA 3WJWA 5CS7A 1W0WB 1F9CA 1T9GS 1XGRB 3H24A 3QVGA 1RJDA 3PAYA 3PKJA 2XMZA 3BCHA 2DQDL 3K70B 1TMOA 2QDGA 1JQAA 3GZPA 3HYLA 1ZNNA 1FQOA 4EJSB 4B7UA 4PS3A 3UZYA 4TXLA 2RD0A 2WIIB 1CUHA 4O59O 2NNCA 1H49A 4C21A 2VSMB 3HGQA 4OHYA 1NDGB 3N86A 4TXHA 3OOEA 1TJHH 3O7MA 4G80A 4JB2A 5E0CA 3QKRA 3TNLA 3FFOA 5DWQA 5E1GA 15C8L 4B7IA 5DTFB 1SUAA 1EGJA 3V8EA 3MNVB 5TGBA 1IGTB 3R1IA 1SD5A 1VRSA 3S47A 2RMKA 3Q8LA 1D6MA 4G5YA 1RVGA 5HW0A 4PIRF 4EUPB 1CE8A 4ITUA 3WLAA 4BP3A 1IPEA 3GX1A 2ZIZA 4JTEA 1OCBA 1BVKA 5FYJU 4CG2A 4CLRA 1G6HA 1RSZA 3ORJA 4AHPA 3C3KA 4MD4A 5I1JH 1IZ7A 4UNNA 2E82A 4PGMA 1KPRB 2NWSA 1QKZL 2YAMA 5AICA 3PZOA 4GKNA 2ZG6A 1YO6A 3SE0A 4JQVC 3RA7H 3UP8A 1AHWB 1V4NA 2J30A 1CTOA 2YBRA 3IXAA 2G04A 5EMNA 1L5HA 4A6PA 1E6NA 2OLDA 1MFNA 3IDQA 4X1KA 2FHPA 4WOJA 3NPMA 5DD1H 5FEZA 1TFRA 3L7DA 2OLEA 5HANA 3D5HA 1K6QL 2QPAA 1AODA 3NZEA 2PUBA 2HWZL 3BXGA 2XFWA 3GDRA 1UXHA 4A6YL 3DNFA 2DPLA 4PGBA 4JCLA 3Q10A 3OG2A 2RAVA 2OEMA 3DVNA 3FNDA 2A9OA 3L40A 5GJWC 1RHFA 1L7DA 5CA0F 2ETXA 2L7JA 5B2ZA 1Q0ZA 4MYWB 4LSGA 1ZISA 4TXEA 5L0QB 5JFOA 5TQLA 4TYYA 4AMWA 1IZ9A 4O3FA 4R26L 1KXQA 1YEEL 4RZIA 4P3WA 4LVOC 3MGCA 3LP8A 4M6VA 1TCBA 4MO2A 2ZIEA 3V5CA 4YUEL 2AOXA 3ROZA 4XBPA 4WTZA 3OG6B 5F1NB 4YFLI 1BS2A 5C55A 4Y16C 3RTQD 4X9XA 4TQGA 3BKJH 4UV7H 1GGIL 2YWYA 4GXMA 3KYIB 2J9FB 2KYIA 4BIIA 3FRHA 1DKWA 4R81A 1A8PA 1CBVH 3CNHA 3M9YA 3IJYB 1VCFA 3SKNB 3I72A 4X92A 3RC7A 1FZKB 2UZYB 4YPVA 3E1SA 3OMNB 1PG0A 2EE9A 2XISA 1RTTA 2X2HA 1QBLL 2CR6A 5C0GA 2YXXA 3TMAA 3JZAA 3KVVA 4IG4A 4RHEA 5JXHA 4FKBA 4MVCA 5I02A 4B5VA 1BD3A 5MEOB 1YMUA 3H54A 1EDDA 4GT7A 4KR9A 1GQJA 1CI3M 2OGUA 4P2YA 4M8QB 3GRFA 3TZHA 2X8RA 5J13B 2FZLA 4Y5YC 2ZKXA 4CGUB 2GVEA 1P5BA 2HNAA 3P2BA 3N3MA 4UUPA 4JLJA 1PUXA 3T7JA 4K2UH 5DURD 4XNQB 3SGUA 4WU7B 4DRSA 1X9IA 4C4UA 1P84K 1HDZA 1JSZA 5C7YA 4HBCH 1AQKL 2OMTA 1IKNC 2D9QB 1AA1B 4ZMNA 3DJRA 5FYKL 2Q8AH 4L2YA 4FOLA 3M1CA 4QHTA 2R60A 2VPIA 3DSFL 1NBCA 1E9EA 3VZRA 4MZYA 5CJQL 1IC4H 3UPCA 4IZGA 2WWXA 4GMKA 4E1AA 3BWWA 1Z5PA 3BC1A 5JXEA 2XVXA 3EW7A 3B2VH 1ZUNA 5FUVA 2JPDA 4LNRB 5EMMA 4XG1A 1ONBA 3W72A 4GW5B 3GKFA 3KP1A 1M3SA 5K59E 3BPNC 4HAIA 5DBTA 2CO6A 3VQMA 4X71A 2HK9A 4FNSA 1WY5A 4GQQA 3OOWA 5AW2A 1VERA 1DBPA 3OKEA 3QFJB 3EOTH 4UTAL 1QPRA 3L68A 3FL7A 4N20A 3Q8MA 4I5GA 1YC8A 2REOA 5I75C 4XBJA 1Z2CA 4ZSOB 5E93A 3T08A 1L5RA 3D4IA 1ZNZA 1Q6QA 3P1JA 1ML1A 1EZSA 4G7QB 4J9VA 3FGNA 2HJWA 2C4FU 3QJUB 4WOKA 3WYZA 1BCSB 3AM1A 3KCQA 3O38A 3NQ7A 1A21A 2O8NA 2G36A 5AAMC 1TUXA 2JTYA 1DC4A 4K40A 2RSLA 3U80A 1U4FA 1BMFA 2SCUA 4NRZB 2IWKA 3WGHA 5F21B 4KYUA 4WO4D 4GA8A 3TLXA 4IOFD 2XWPA 2DDXA 1MW3A 2PSEA 3UTOA 1FPQA 1YI0A 4TMWA 3F2LA 4UNVA 1EE2A 4HKPA 1SIWA 2C3XA 4TSFD 2FBJH 5FBQB 1DANT 4AK9A 3WY1A 3NBKA 1HQRA 5REQB 1MH1A 2HYDA 3Q3JB 1H9BA 2BYTA 3HVKA 2VK2A 1PJ9A 4FQJL 3FMOB 5C0AD 2Z6UA 1FTGA 4C7BA 1F3DJ 3LWBA 1H5NA 3P0HA 2K3TA 1TZMA 3WU1A 5FAAA 5HJYA 5AVVA 4BSVB 4HZAA 2XSZD 1Y5LA 4CNPA 2GXAA 1ESDA 4AEIH 3EY9A 3N4AA 3IB6A 3PUOA 7MDHA 3VA8A 2G30A 4AQ8C 2C2BA 3WTBA 4AD0A 1PNCA 4UJ5A 3LKRA 1HJVA 4QG7A 3F7TA 4QGCA 4WTXA 2CBIA 4GG9A 1L5YA 2LVBA 4WXRA 2ZCJA 3ZJTA 2XHYA 3EQ9A 2GUYA 1WITA 3T1FB 2R1VB 3RR2A 4BDVB 3BQNB 1A4JA 1OGPA 2F58H 3OLGA 2DLTA 3ZL4H 3UWZA 4BP9A 5FKPB 3LP6A 3WLFA 3BWEA 1I3CA 2WYZA 1A5BB 4URFA 5K01A 4ATDA 2PN1A 4NQSB 1PX2A 5I7HA 3Q06A 1BJ1J 4AX6A 4BFAA 4OI4A 5IM5A 3WL4A 4KRMB 4LDQA 1GG1A 3NCFB 1V02A 1PZSA 3WQGA 3IVKA 4I9XA 4YRAA 3ZIDA 3B6EA 2QQLH 2CLLA 3O4OC 2N0SA 2OTUB 1A7NL 3UT5B 2X89A 3F84A 3TBYA 4FTWA 4NU7A 3A6CH 4JHWL 3TRIA 1NKGA 4CLMA 2KMWA 3HHPA 3M8OL 1Q4WA 1NNEA 5KVCA 3CMCO 4RAUB 4CYMA 5E2VH 4GFDA 3B4NA 2HMCA 4MUPA 2YFNA 3HB5X 3A6LA 4D4JA 3IDYC 2JGDA 5C34B 5I9NA 1AR1C 3HQ4O 2G60L 3QUQA 2VXVH 3BD3A 5JC1A 1YNKH 5B7GA 1CZ8L 1A5AA 4MWEA 5CFMA 1FFHA 1MHCA 4DOHB 3FT9A 1LVEA 4GOMD 3WFDL 4WDIA 3VE9A 2XHZA 1JU3A 4KV5E 2V2HA 3WJYA 1BX0A 4KO1S 2XUDA 1JZEA 2C58A 1LL6A 1GTZA 1CULC 4IDJH 2VNJA 3SO3B 2KPNA 4ND8B 1CB7A 4HFUH 4ZV7A 2BSXA 1USWA 2WAXA 2XMGA 1VGEL 3GKAA 3OCJA 3NYQA 3OEED 1AKUA 3DEYX 4FEEA 3VXMA 1U5CA 2Q5OA 3L46A 3DLBA 3EH2A 3DBOB 4ZA0A 3QVXA 4Y9NA 4X95A 1LA2A 2QXUA 4ML3A 1I33A 5HYSA 1DWJM 5F2MA 1JXKA 4P0DA 3FHLA 2J67A 3CPHA 3RS5A 4XZ3A 1UAGA 4TRMA 3WKAA 4HU2A 3A6DA 5C32A 2NVUB 1JHRA 5GJCA 2X1PA 1IOLA 3BSSA 4KXFB 3L8GA 4NM8H 5G0VA 1PL9A 3NIGF 3SGKC 3RPMA 3TZCA 2GJNA 4RHUA 3QU7A 1IC7L 3ZVNA 4HH9A 1F0NA 3RHWK 2XBUA 1CIVA 1OVGA 3FCXA 5BQFA 3DJSA 3EJRA 5JHBA 3LZFL 4ELDA 4IKJA 1F3XA 3O3BA 5CNHA 4IRJA 3RUIA 3OHXA 1KKMA 4BZZA 1NCAH 1FNCA 1QM5A 1H19A 4KB5A 2VI5A 2P9HA 4F4FA 2WWDA 5DOVA 5HJLA 2IOOA 4M9RA 3EGXA 3TNOA 5DWUL 3S28A 3PTMA 3V42A 3NHAA 3I6MA 4NHEA 2DIBA 1UACH 4NZRH 1Q7BA 3CZQA 4TQHA 1KMHA 3OVMA 4MPDA 2XWJI 3NTCL 5KWVA 1FH2A 1H2XA 1NE7A 3KO8A 1QAQA 5K20A 2OR9H 1EF2A 1EK0A 3QZWG 4IKIA 3BKMH 4AYDC 2QSJA 4FQQA 4US5A 2BCGY 4RANA 4H08A 2PJZA 3U7RA 2DN7A 4RBNA 3UKOA 1JR4A 1YJ8A 2JGDB 3PCYA 5TAOA 4UTXA 4O5LH 3OZOA 1EBGA 1JKIA 3LXMA 4IZOA 1B3VA 2XDQA 3G6JE 4MUKA 2PURA 2PGWA 4MCYB 3LTEA 4HS6A 1AK9A 2NY7L 4YDIH 4RPJA 2AAMA 2CEQA 1QANA 2RAFA 3NLLA 4OU1A 3WQOA 2ACEA 2PO6B 5EIBC 1GOIA 1GZUA 3H3KA 5IFTA 1X1BA 2DHQA 4J43A 5JVDF 2HG5B 3EPKA 5AVSB 2DBRA 2PRJA 4PJEA 3I9IA 1E1EA 3MWJA 3UEQA 1GPNA 3OJDB 1E7MA 2QPXA 5C09A 1A3LH 1AGFA 1S9DA 1SC3A 4WK9A 2Q8PA 3CPLA 4N4QA 3VNSA 1FQ0A 2W7TA 3THCA 3CUTA 3B3IB 2YZNA 3D4PA 2CGZA 4AG3A 5FWYA 3WK7A 2OXCA 3K80A 5T1DH 2HG0A 2OPHA 3MV8E 3EIEA 1KFAH 5E94B 4X63A 1KCBA 4BEVA 3G1XA 7REQB 1QFYA 4EXAA 5CAEA 3WKBA 5B2EA 1B3YA 4FEMA 2NYAA 5LCVH 1YC5A 3TCKA 3PP3H 3IRCA 4V2IA 1VACB 5G4MA 1YXCA 3RZCB 1A82A 1I2NA 1OH7A 2GSGB 2ITCA 1G67A 1LLCA 1M54A 2VXTH 3ZWWA 4X7MA 1Z42A 2X9GA 1HE7A 2QJNA 1W85A 1O7AA 1FNNA 1DL3A 2V3EA 3W79A 1P5UB 1BDBA 1B2WH 5EOCL 4U28A 4KMOA 2DH5A 1V7AA 4EG5A 2GUUA 3SADA 1KRMA 3WD1A 4B4UA 2Y2VA 4KQ4L 3WK3A 4O2LA 3LQQA 3C09C 4WLFA 2AOSA 1U9YA 2Y7GA 2X1VA 4Z08A 4QPPA 3LV3B 5K2ZA 2J6XA 1P60A 1S4MA 3IKCB 2X4PA 3A6BH 4MQMA 4AKQA 3ZQUA 4QA9A 4F7KA 1WC7B 3ALFA 1UZDA 1OJ7A 1CRLA 3O2VH 3DMFA 2MIIA 1QJCA 2JI7A 4BO0A 4QS5A 3VFCA 1NF3A 2JEYA 3P2TA 3GMQA 2XKJE 3SOBH 1DHRA 3CIQA 2HE8A 3O4JA 3TNBA 3RJZA 1T7LA 4JO2H 3T3DA 4JLNA 4FBGA 1RY7B 3F01A 2UXTA 3HNRA 1URPA 4TXNA 3NFYA 1NNSA 3RKRA 2P45B 3TZQA 2W65B 2GYWA 1FK8A 3SE6A 2AFIB 1ZENA 2X58A 3PQEA 1SJMA 5FXMA 4PAMA 2QCFA 3G18A 3HC7A 1OF8A 2BDNL 5K1NA 1NBVL 4D92A 4JM4H 1BN7A 4P9HC 3UZXA 3ARGB 1NVFA 4Y7MA 1P6QA 4QO1B 3AS0A 4NT6B 5IXEA 4FHJA 1U8UA 4ZSOE 2ZI7A 4E94A 1XYMA 1ISGA 2PDPA 3NV9A 3BURA 2CWWA 3GIWA 2CU9A 1YRKA 3PY2A 5NLLA 5H8MA 2PXYD 1AE6L 1QBLH 4DKEL 1UJTA 3KQHA 1I3KA 3HS0C 3UYKA 1Z63A 3KIPA 1RULH 3RWGA 4YLQT 5JPMB 3R6TA 1WUNT 2PUAA 4JDVB 3K1AA 4TYNA 4YL2A 3DG6A 5SYMA 3RSGA 5KX5A 2PKQO 1TQSA 2PAAA 4MVJM 3K46A 3WN5C 4PRKA 3BXOA 3FGCB 4QTYA 3GX9A 1AH4A 2BD0A 3B9OA 2A83B 3FZNA 32C2B 4LRSA 4JTRA 4QRRD 3WIHL 3KQOA 3O1NA 2F8QA 1K5HA 4KAQH 4P4LA 4DYKA 4E03A 4OF4A 4P7FA 4JP1A 3CO4A 2R23A 3Q8WA 1M6WA 3MU3A 4D82A 1P7KA 3ZE8A 3OAUL 1UBSA 2ICSA 2OORA 1V48A 4M9PA 4LK2A 1XAKA 3U1BA 1POWA 5TARA 4PY8J 2B39A 3MCOA 4PJCE 4AO7A 5D7JC 4GM0A 1N2IA 1TWDA 4A91A 2BI8A 2GZSA 2QUNA 1FFXA 5EKSA 3I12A 1U2SA 1UBJS 4F9JA 4P2BA 4W5UA 2FSVC 4BYGA 1JNYA 2O3UA 5JSQA 3N9KA 1CU1A 3F6RA 3B40A 3T78A 4L8BA 1CNVA 1S2IA 1NKSA 3BKWA 3RSHA 1E66A 1Z69A 1LTKA 4MIOA 3V0FA 3KPVA 2YD1A 3U9TA 1VBKA 3OW1A 1WUJS 5E5UB 4PRNA 1OIFA 3DOUA 2IALB 4MLPA 5TJ9A 5FOBA 3PWUA 3V0WH 1RL1A 2GHQA 3TM4A 2X40A 3MGOB 3NJJA 3MAAC 1SZEA 4NPKA 2I62A 6YASA 4BH8B 3A6PC 4XXDB 1DQKA 1W32A 3RYTC 2V9RA 3VNRA 4YCLA 1MEXH 2Q5QA 4QWWD 1I4FA 4GI3A 2E7BA 1PR2A 5INTA 4Y7CA 4ZJ9A 3I9GL 3LB0A 1J22A 1U8CA 4L4LA 4XYLA 1C2YA 5LBSA 3VMPA 2HFTA 1G66A 2BWQA 2CE6A 3QEQE 3PDOB 5KYWB 2UUPA 4C01A 3RRFA 4DCTA 3FU3A 2H2GA 2OPBA 4HHWA 4L8YA 1T3FA 4V1CA 3W3AH 2OMYA 3B8VA 1U8LA 2IAND 3SX2A 4BMYA 3QO0B 5EOCJ 1E6CA 4RJKA 4EHFA 2XNDD 4UHKA 1LRKA 1TRHA 3AR6A 3UXYA 4WZAE 5C7HA 5SYNA 3CD4A 2A9RA 2X0WA 1YJ5A 1CQXA 1Q7RA 4FC6A 2NZ9C 1FDTA 5D96C 5E03A 4L5JA 3H7LA 4EAYA 2GLXA 4EBFA 1L7VC 3CZRA 3I42A 4CMEC 5DBUA 2NY1B 2HS8A 2QJGA 3PWPD 2YD8A 5KC9A 1KIUA 5ICEA 1L6SA 3WUZA 3TW0A 1TJ3A 4UTHA 1N12A 1N67A 2QL6A 5E0OA 2QUHA 2WK1A 5AVRA 3KRUA 2R0WH 2GOYA 2EW1A 1OCZB 4LQFL 4Y8VA 1IEHA 3I3OA 1R9FA 3S48A 1G0OA 2J1ZA 2O0JA 1VIMA 3DBXA 3AQ4A 3LWNA 3QWOB 5C2XA 1UFOA 2ZSUA 1XQLA 4GPD1 3G5YB 2QU7A 3IJ6A 1WNFA 4JHAH 5I77A 2FEXA 4MPKA 3WFDH 4OY3A 2R69A 1UQUA 1NW3A 3IMCA 2ICEC 4XCYB 3PWVA 3DVQX 4LCIH 1ZI9A 1K6IA 3NTOA 2WTAA 2NZUG 4JUIA 5GGTH 4PJ5A 5K3SA 2I3AA 5EUBA 3KJ6H 4P35A 2NNRA 4ZMAT 2FPSA 4JAMA 4QHYA 1TIKA 4LHZA 3T7CA 3WSQL 2Z2XA 1T9ZA 1OLZA 2P5WA 3DX7B 3VOJA 2VQ1B 4ARZB 1O3YA 3U36A 5FPKA 2NX5E 1CRQA 4JBRA 1Z7YA 2FFCA 1JG1A 3WRYC 3OE4A 4IIJB 1F4XL 5BXYA 3GMLB 2BSLA 2HBQA 3OB0H 5KVGL 3QJVB 3BW2A 1P9MC 1RZKL 2B4QA 2ES4A 3WNDA 1YDFA 3P2OA 1UZ6E 3QSTA 4UM8B 3SGJC 3V9CA 5AK0A 1HIML 3MKKA 2EFCB 3PK0A 2SEBB 3UMJA 4UNIA 3TGLA 3VRIA 3II1A 5AHXA 5AHKA 5IT5A 3MACL 2IX3A 4ESVA 1ZU8A 5FQNA 4OCSH 1JRBA 4DSNA 2OZ8A 3IJSB 3LHAA 2Q3DA 1YDMA 1YB6A 2NV2B 3R3VA 1A3QA 3DMYA 4IHJB 1HDEA 4WSGA 5FPIA 3T7SA 1KGWA 1A3ZA 3WG6A 1QFJA 3HZ3A 1PFUA 1BE1A 1RFLA 2RKOA 3G5AA 3ET9F 5JALA 5JOFA 1XMJA 5JPIA 3T7DA 1RW4A 3K6KA 3C8NA 3INRA 3SQXA 4RESB 3GLGB 5F52A 3P0XA 1AA9A 5HKKD 4QFUA 3RVQA 1HAUA 2VPXA 1M5TA 2YHIA 4C87A 3NNTA 4L0QA 2IBTA 1M2VA 1KZ9A 3TSWA 1UOKA 2RK6A 5U4QA 1A7QH 1GQLA 4HJJL 5HPCA 1QW8A 3K2UH 2GARA 1EHNA 5KJ4A 4FNLL 1NARA 4IBLT 2P9BA 4L0ZA 1GNRA 3QRGL 4AXWB 5TPZA 2BVPA 4KVNH 3IUEA 2CXTA 3OETA 4H7ZA 2LCFA 4YXWA 4WKHA 1GKRA 5F3HB 2C1PA 2X5PA 5B1DA 3MBWA 3PUXA 2C6QA 3KB2A 1Y34E 2DJUA 3BH7A 1QPBA 3R6WA 4FEYA 5IT4A 4QT5B 4TV8B 2E1RA 4ONGH 4S1RL 4AJKA 1ETA1 4BI6A 5EEYA 3GZQA 4PCTA 3P8JA 2XQKA 3RB7A 2YWZA 4NQVB 5DD5L 1BF5A 3PC4A 5LXEA 4FZ3A 4OZHB 1U91A 1PSZA 2DFPA 2VDLH 5CWSB 3LV5A 2KZ1B 2DT0A 2CLSA 3AAZB 1V0LA 1J79A 2GB4A 5D32A 2ZIFA 4AGOA 1TETL 4PUKA 1XIJA 1YTLA 4H1TA 2C2ZA 4HUVA 2J3HA 3HCVA 4WV1C 4INFA 3LEVH 3ZE2E 1TQDA 1FGVH 2AT1A 3B2NA 1N32B 2WSMA 1TO3A 1FVDA 4XAKD 3TW8B 4F97A 1TD9A 3IV6A 3EA1A 1RYNA 4EVNA 1XZLA 4PB9H 1MUUA 1J0AA 1TM7E 3BMOB 3BWVA 1G38A 1NX6A 1NZDA 3CVYA 1U8LB 2I5YH 3GEHA 4D5EA 2XJ9A 1T5KA 3M9XA 2PR9A 1VJZA 3HQOA 4NVTA 3K74B 2ABWA 1GPKA 3GWZA 3R58A 2ZSAA 5LNK1 5DMJB 1LNUA 3T1TA 2QBWA 3BW9A 5E4EC 1FG2A 2BFWA 3N2TA 4GFSA 3CO8A 1GTVA 1Z26A 4BNDB 4RWYL 1U8KB 3KJXA 3CFBB 1P4RA 1UIPA 2EU8A 3S29A 2NLJB 2H8PA 2YJNA 1D8TA 2ZSDA 4WGWB 2A0LD 5KWIA 2Y0SA 3KFTA 3RBGA 4EMBA 4P34A 2IS6A 2V2WA 4JQIH 1KZYA 1VF8A 1MW0A 1A76A 4AZ6A 2YS7A 4E9TA 3SODB 2QYOA 1U7ZA 1VLZA 2H0QA 1QTNA 3KCPA 4C4KO 5DQ9A 3QBUA 1KIRB 5D70L 4LW7A 3FT1A 1NPTO 2DYSB 2R79A 2XGBA 2WCAA 3WRVA 4DC1A 4L1HA 5C7OO 1CDDA 3QUSA 3MDUA 3WD3A 3VI3E 1JPKA 4QEHA 2Q7YB 4MSWA 1TX0A 4JFDD 3KZNA 1U3WA 3ES6B 1II8A 4ESKA 1S6YA 2POCA 2DFDA 2H5JA 2F38A 3OD1A 1TIWA 4H7HA 2ZXWB 2C57A 3IDIB 3K4PA 3LSOB 1TXGA 4PJXB 2Q6KA 5K39B 4UFJA 1AY1H 4BO9A 2FWLB 5EC2B 4P5TB 3W28A 5BNTA 2FL5A 1M1ZA 4A39A 4HQ0A 3FAWA 2QV5A 1F05A 1IUNA 4DQ0A 2QL7A 4HD5A 4QDTA 1V41E 1XRPA 1RZIA 3V5KB 4FTVB 1XKQA 1T8UA 3ESNA 1DXHA 2F8XC 2QTHA 1GYWA 1RLBA 2ON6A 2EIEA 2CUAA 3T4YA 4KHPB 4U1JB 1Y18B 1PRYA 1TEVA 1X5FA 4CU2A 3HS0A 3QE4A 4IP0A 4R54A 4IZIA 2G07A 3LTVA 3KYKL 3BO9A 3TH2T 1IN5A 4K3DL 4DKFL 1X92A 4EKGA 1BYPA 1A4AA 4I89A 4S1SL 2VN8A 2XCQA 4QFBA 3RFTA 1NKRA 4LYQA 5CLQA 4TL6A 2NW3B 2J7FA 4LPWA 3RG6A 1D5MB 2VKZG 5AD0A 1JNNL 2DEUA 2I1LA 1JTTA 3W2DL 3RL1B 4XTRA 5EIQA 2C13A 4MTLA 5EZOL 7A3HA 1P7CA 1XLMA 2O7RA 1T9BA 3DKVA 4LSPL 4BNKA 4BFLA 2PTTA 1U65A 2X4DA 2JHCA 3GVIA 4G7YH 1QBML 4YH6A 4MVJI 5C7LO 2BIQA 3B5HA 4MW9A 4URVR 4E30A 2BOEX 4W5RA 4EB0A 2Z64C 1OBHA 2X2FA 4W9KC 3N2BA 5CFLA 3ECUA 3V5OA 1BAGA 2VR9A 6NULA 3WXBA 5FCZA 3CC1A 1V2HE 1CN4A 3NV7A 4WA8A 1RJPA 3IKTA 1ZXKA 4A3SA 2W6JD 1XQWA 2V59A 2XR1A 1ICTA 4XPAH 2WTPA 1RQNA 2GY7B 5JVLA 4FD3A 4RD0A 2V5VA 1OJLA 4PY7B 4DSZA 3F3YA 3V1NA 1QHSA 3B5IA 3NA9H 4U05A