4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
1JDBC 5K4AA 3VGBA 2E40A 3WDQA 1AMYA 1QNSA 1TQTA 3OLIA 4MNJA 3W81A 4D6FA 2VRJA 1QNQA 4D72A 3OT1A 1CF9A 3MKKA 3VOCA 4W84A 1IPHA 1R47A 3MMUA 1HJUA 2J8FA 2NT0A 1XD1A 3VD7A 4AZCA 1GW1A 4HCJA 1GVIA 4D6DA 2F18A 2VRNA 4PEEA 4F79A 3BAKA 2DT0A 3VGDA 4YHEA 1CEOA 3P9QA 3D5HA 2VQUA 4B5KA 2DSUA 3BLBA 4WKAA 1K9DA 2CIPA 2WZIA 1KBKA 4Q7NA 4CN4A 1V0MA 1V3HA 3R76A 3CHCA 5BROA 5HPOA 4PTMA 3SUSA 2PF0A 3BHNA 2ZUWA 4U2ZA 3OZPA 1IZYA 4CGTA 4V27A 1B3WA 3ZSTA 3ZT7A 3AZSA 2QPUA 1PPIA 3SOZA 4Y7EA 4H41A 1CENA 2WBGA 3NSMA 2X8RA 4AYSA 4FMVA 4X0VA 5A6BA 1UR4A 1KFWA 2IUZA 4HZ7A 3BUDA 3GBDA 5GPRA 5KZ6A 1EA9C 2EO7A 4UTFA 2ALWA 4TTUA 2DSVA 3BVUA 1XRVA 4W86A 3SCVA 3WQ4A 1VEOA 4PSRA 1B2YA 1Q4NX 4NRSA 4D1JA 1CE8B 2OYLA 5EBAA 2WMIA 4HOZA 2X09A 2J77A 1NOFA 1ZJBA 3ZJ7A 3SF8A 3BLKA 1T3TA 1GOIA 3PTMA 2WC3A 3RHTA 3DYPA 5CPQA 3IANA 2F2HA 4AD2A 1CGTA 4W85A 2YIHA 4YHGA 1V3IA 4FK9A 3G6MA 1OWQA 1JVNA 1XSJA 4NI3A 3A24A 2V3DA 1MXGA 4E08A 2XIBA 3A4AA 1QW9A 3AIRA 1CECA 5A8NA 2E4TA 1WDSA 4HMEA 3LRMA 3R74A 5JIPA 2EPNA 3BWEA 2GFTA 1Q7RA 2ZUNA 3ARYA 1QNOA 1KTBA 1GJUA 4AD1A 6A3HA 3WNNA 1HKMA 3ARZA 5A6AA 1WO2A 2WWDA 4Y0NA 4PUDA 4C7DA 4L8FA 1VJSA 2WC4A 4ML4A 1XV8A 1QVVA 3HG4A 5HNNA 2RK3A 3A4WA 3QHOA 1GNXA 4H04A 4PBGA 2VDJA 3BAWA 4J3WA 4D6GA 4JCMA 4ADSG 3SEPA 3T2OA 3SCNA 4GO8A 1TVNA 3MV01 2ZUTA 1LG1A 3PQ7A 1TG7A 4AMWA 1V0KA 4DUWA 3T08A 1QI5A 1KXQA 3PZVA 2GK1A 2VZTA 1LL6A 4M80A 4XLLA 3WDIA 1NP0A 4R5EA 1WAWA 1W91A 4GI8A 2XPKA 3TA9A 2JF7A 1JZ3A 1T0OA 2J75A 3GXNA 1GOOA 2PBOA 1R34A 3DX4A 2JFEX 1PZ3A 4W89A 4JKLA 1GUVA 1MW2A 2VRQA 3EDKA 5FL1A 1MQRA 4B2YA 1HJSA 2VMFA 4AD3A 1J0JA 1R86A 2DQXA 4W8LA 1SR0A 1JXKA 2W67A 1EOMA 1KB3A 1JYVA 2O9TA 4DWSA 1MXDA 1K9FA 8CGTA 1JF6A 3QR3A 1B3XA 1XSIA 4PCTA 4R7GA 3II1A 3VX1A 1W2VA 2VOTA 2PWGA 1P7YA 2PWDA 3WMCA 1VFOA 4I46A 3H55A 4D1YA 3S6TA 3SCRA 3GTNA 1UASA 4ENVA 2NW0A 3OB8A 3AMKA 4D6IA 3KL0A 3L7NA 1DHKA 4AZ6A 1AQ0A 3AS1A 3VIPA 1JZ8A 3H54A 3ZSSA 2HVMA 2XTKA 1VHQA 4FNQA 3AQUA 1UOKA 4V28A 2WYSA 2VCAA 2VQTA 1Q6GA 1I75A 1KXJA 4P7QA 3HG5A 2EEXA 1MQPA 3PTQA 5A8OA 1JG9A 1VIWA 3VDAA 3AS2A 3A3HA 5AC5A 5FCZA 1R9GA 2YLLA 4AD0A 1MQQA 4L95C 4MNMA 5ABHA 5AYBA 1WDRA 4Y1FA 3ARXA 2D20A 5ECUA 3NOVA 2DSWA 4E8CA 2J8GA 1QHPA 1C7TA 2VCBA 4D6CA 2WLYA 2OWWA 1G94A 5CLWA 3MSGA 3ARUA 3VU2A 3U5YA 3DDGA 4PN2A 4RL3A 1ESWA 5I78A 2WMFA 3W38A 1W1YA 1E73M 5I0DA 1MW1A 3MANA 1N82A 5BCAA 2YOCA 1A47A 5C71A 1UWQA 1W2PA 3VIOA 1FFRA 3VTRA 5IDIA 4B31A 2GSJA 3AS0A 2X2IA 4P7OA 4OZOA 2YDSA 1V3MA 1ITCA 3OBAA 3AMCA 5HPCA 2A3BA 4QCFA 1MW0A 1NWSA 4B9ZA 4OBRA 1V0LA 3FXYA 1GPWB 1DP0A 5EFFA 5I6SA 1TA3A 3PTKA 2XGBA 4AUEA 5M17A 1W1VA 3BAIA 4JCLA 2XGIA 4LX4A 1UR0A 4QCEA 3FHQA 1U2YA 5I23A 1KEEB 1V6WA 1Q6EA 3CH9A 5IFPA 2CNCA 2CBJA 2XYLA 5JBEA 3N17A 4W5UA 4FLOA 1E0WA 3GRAA 2CHOA 5D8WA 2W7TA 4JKKA 2WHKA 2C7FA 3WY3A 4PMUA 4XV0A 2ISSD 2OSWA 2QPSA 1QWNA 4ZEPA 1B3VA 1QVBA 5A1AA 2OR3A 3LPFA 3VNYA 3EWNA 3WD0A 2OSYA 3EMQA 1WZAA 1QNPA 1KGWA 1H41A 1FA2A 1JYWA 4TTGA 1NQ6A 3OLDA 4LYQA 2XM1A 2VR5A 1VEPA 4QDMA 2F8QA 4CCCA 4ZDIA 2J4GA 3VIFA 2VZSA 4F66A 1PIFA 4GKLA 5SY4A 7CGTA 4AUNA 3AYRA 3W37A 1UKPA 5BXSA 1PX4A 3WNOA 1JZ7A 5DT5A 2DSZA 4JFTA 2XN1A 1E1EA 2Z1SA 5M03A 1JDAA 1XCWA 3TTOA 1HIZA 1O1YA 3WQWA 2A9VA 2ZICA 2W66A 2XFFA 3L2LA 4AZ5A 1HJWA 4P8XA 4J7RA 1XYZA 1H0IA 4L78A 2R1TA 1FHLA 1P6WA 3TTYA 2FHBA 4BTEA 2XVNA 3HMCA 1QWSA 4GIAA 1SMAA 1E9LA 4AYGA 3KL5A 2G3JA 3W25A 3AMDA 1WPCA 1E6QM 3M7SA 3NSXA 1B0IA 1FP8A 1QHZA 3S5YA 1QVZA 1PZ2A 4MNKA 3WQVA 1G2IA 1HL9A 3T09A 3BMWA 3D4ZA 5CSUA 3AIWA 4URIA 3VX0A 3KKLA 2ZUVA 4B16A 1KA9H 3MUY1 1C3FA 1RH9A 3NDZA 1WCGA 3EFEA 1W9PA 4JHOA 5DO8A 4ENPA 1OGSA 2ZX7A 3BSGA 1JF5A 1H5VA 3WELA 4GINA 1SYTA 3ZT5A 2VL4A 3ZM8A 3A22A 4RE2A 1MVYA 4M81A 3EJSA 4J3TA 3N11A 1X6NA 3AFBA 4RE3A 1EH9A 1OB0A 1O7AA 4MJ4A 3S5ZA 3MU7A 3UCQA 4UQ9A 1CGWA 3DX2A 1TE1A 1J0YA 4OFWA 4OKDA 4D71A 2VNCA 2WLZA 4AIEA 2WB5A 4QLKA 3D51A 5GNXA 2J62A 4H8HA 1WDQA 1OX4B 3M07A 1OINA 3TOPA 3RMEA 1PJ9A 2W91A 3ARWA 2XVKA 1W9DM 1QPKA 1QDLB 5SY9A 5I77A 1QBBA 2XSBA 2D0HA 4OIFA 2X2HA 3WUBA 1Q6DA 3CZKA 5CG0A 1ZJAA 3PQ3A 1LF1A 2OYMA 3PZOA 1QOXA 1IZJA 1PV2A 2XN2A 3GYCA 3QGVA 1W1TA 5A6BD 3VD9A 2GDUA 3ARRA 4PMQA 2CHNA 1R46A 1BLIA 2TAAA 3NOQA 1VCNA 1W3HA 4F8XA 1B1YA 1X1NA 2YL9A 3AIBA 3K4AA 2DGAA 2IGTA 2X2YA 2JALA 1EDTA 2J78A 4OJYA 1ISWA 1BGAA 3PZ9A 3TTVA 2ZXDA 2ZXBA 3AXXA 1KGUA 3BCFA 2AOSA 3QHMA 3SCTA 1UKOA 2QV4A 4CD5A 3VGFA 4JFUA 1HF6A 3WH9A 4ENSA 4UOZA 5HBFA 2Y8KA 1D2KA 5BYWA 1WB0A 1FH9A 1C8YA 3B9EA 5JBFA 2LXNA 2HISA 1L9XA 3WSUA 3CHFA 5I2UA 1HXKA 1LWJA 3MO4A 4BZYA 3VMNA 3CNEA 1C8XA 1R87A 3W29A 2V3FA 4YN5A 5EMYA 1OSEA 4WLCA 2WVVB 3EBVA 4AZIA 4AZ7A 3CZEA 4TOQA 1VJZA 3K46A 4ATLA 2V3EA 3HG2A 4NSBA 3EJUA 2FHFA 1HP4A 4CD8A 3CZGA 2FHCA 3TONA 3N9KA 4PMVA 4AULA 1DWAM 3AMLA 3W0KA 2BS9A 4GQQA 3VINA 3WQ5A 3CUGA 4Z2LA 2YWDA 4UQBA 4J3XA 3GXTA 5FIPA 1WZLA 3EJ6A 3IAQA 4MB4A 2YWCA 4GZIA 5CLTA 1OT1A 3WUEA 1CIUA 4ACYA 5D9PA 2DT2A 3A6OA 5BV2P 3VIJA 1HKKA 5GQBA 2D3LA 4OOZA 3WDPP 1NWTA 2RK4A 2CITA 3L4EA 1BFNA 1K9TA 1TFVA 2WNWA 1XGZA 5HDRA 3FNDA 4LPCA 3CPUA 3I3BA 5A2CA 3PN8A 4PCSA 1DWFM 2E9BA 2W63A 3CZ8A 3GH7A 3B9DA 1UG6A 3RDKA 3SCUA 3POCA 4UQCA 2YWJA 1ZBWA 2V38A 5LA0A 4W7UA 3CYFA 4UOJA 6TAAA 3TTSA 1V03A 3ZMRA 1VCMA 4WKFA 1L0PA 1Q2UA 2RK6A 4JAWA 4Z2HA 3WY4A 2VPIA 3WFLA 3IJ7A 2XN0A 1TQWA 4HPGA 3EDEA 4W87A 1ISXA 1G1YA 3A4XA 4HOWA 4MJ2A 2G8ZA 3WUGA 3B38A 3AHTA 1WZKA 2WVVA 5ABEA 1NM9A 1SZNA 1B90A 2WMGA 9CGTA 3IGUA 1BVNP 3W27A 1HT6A 3K8MA 5C70A 3D50A 3PQ8A 4AJ9A 3CZSA 4D1IA 3WFZA 3POHA 4ACZA 3N7TA 3ARVA 4BA0A 4PTVA 1US3A 4XZWA 3L3BA 4Y1RA 2EAEA 4ZDKA 3U7VA 3VILA 4KGLA 2ZUUA 5BRPA 1B3YA 1JZ4A 4AC1X 3KLKA 3P9SA 1KQYA 4UR9A 3ZOAA 4P8VA 4JQSA 1WNOA 1OIMA 4DO6A 5A8MA 2ZX5A 4AISA 4DWSD 2WMIB 4UFLA 4V2XA 2F1BA 4PTWA 3BXWA 1AQHA 2J79A 2YDRA 1QHOA 1EO7A 1WE5A 2IXVA 3IJ8A 2D22A 1AVAA 5GNZA 5I5RA 2R1UA 4B9YA 3D54D 2C0HA 3N18A 4Y1EA 1QNRA 3OLEA 2W92A 4AMCA 3CUHA 1TQUA 1NH6A 3MSDA 1NWUA 4RE4A 5E6YA 2YJQA 3CMJA 4ATWA 4ZXOA 3WH6A 1TQVA 3ZO9A 2BXYA 1V02E 2XFYA 4FF5A 1PAMA 2YKKA 1U33A 4UQEA 4AWEA 4J3VA 2O92A 1E4MM 3B8SA 4HPHA 1MW3A 4WK9A 1ODZA 1HVQA 1AQMA 3AROA 4GI6A 3VIMA 3W82A 5CPTA 4AMXA 3FSEA 4NX0A 5D9MA 1KGXA 1E55A 5KEZA 2AB0A 1MFUA 1ITXA 1GPFA 1RP9A 1JFHA 2OYKA 2D73A 4W93A 1JNEA 3UR8A 3RCNA 3VPLA 4Z2GA 3WEMA 4RKYA 2EABA 4P8UA 2BY1A 1H4PA 1BVZA 5BWFA 1H09A 4GZJA 1QBAA 3WF0A 1P5FA 2DDXA 5FD0A 1KXHA 4NF7A 3APGA 3RM9A 1UD8A 1OT2A 4WSJA 2VUYA 3L4YA 2VO5A 1CS0B 3L4VA 1PDWA 3BGAA 1UR1A 2G3MA 4P2GA 4PSPA 1GGJA 1UH3A 3DHUA 2JEQA 1XSKA 1CXHA 3EMZA 4PYSA 2ESCA 1EXPA 1E40A 4CN6A 4XB3A 1JD9A 2WMJA 2ZXAA 3BH4A 1MYRA 2YA0A 1KCKA 1E4IA 1E5JA 4BF7A 1HN1A 3GXFA 4J27A 3M6DA 4J28A 3DYMA 3RJXA 3PQ4A 1YQ2A 1UR2A 3WKZA 1CZ1A 1C8QA 5DFAA 2B31A 3SUVA 1BAGA 3CUIA 3AIVA 7A3HA 1G9HA 3VU3A 4GQRA 2XVGA 3UR7A 3CZJA 5D8ZA 5I79A 5JZOA 3VDCA 2O9OA 3A47A 3VD5A 4ZGGA 1K6AA 2JE8A 2V5DA 1CLVA 2YFOA 2ZUMA 2CETA 3AMGA 4L4OA 4N42A 2WCAA 1EHAA 2EXOA 2WJZB 2BV9A 1VEMA 3PZTA 1QVWA 3EDFA 2VKTA 1E71M 1EHNA 4J3UA 4JHZA 3O9NA 4LXFA 1VCOA 2E9MA 1UWRA 3MGKA 3LXAA 5E09A 3D52A 1VAHA 2NSXA 3GM8A 4E2OA 2VRKA 2GJXB 2WC7A 3WQ8A 2E0PA 1UA3A 3WF4A 1CXEA 3THCA 4MNTA 4JL2A 3S2CA 4PUEA 4UFMA 3WY2A 3IJ9A 3OT1B 3GNRA 3CY6A 1PIGA 4M29A 4QYXA 4OBSA 5TD4A 1E70M 3AS3A 3AICA 2PWEA 1R33A 3BSHA 1I7SB 1VENA 2MANA 4QYTA 1RP8A 5A2BA 3DECA 3FAXA 4AD4A 2XJ7A 3SIMA 4LYRA 2XF2A 4UFJA 3F5JA 4HOXA 4DM2A 3RILA 4JKMA 2YL5A 4L8WB 2WVTA 2X0YA 3AOFA 1J0KA 2VC9A 3CHDA 3K8KA 2E8ZA 1R7OA 3CUJA 2X0HA 2W4XA 3WH5A 4K68A 2ZXQA 2CKSA 3SUUA 1DWJM 1FFQA 1M6VB 1BYBA 1EQPA 4FNUA 1GOQA 3AIEA 5BXPA 4U5IA 3WUFA 1P81A 5A6MA 4AUMA 4IISA 3UGJA 4OGFA 2ZX9A 1B9ZA 1HNYA 1QWUA 2WSKA 1ISZA 3DX0A 3BVVA 3P9RA 1IZZA 5SYAA 1PEZA 2X1IA 4FLRA 3EDDA 4PMOA 3WMBA 2BHYA 4PMDA 2Y2WA 4GXPA 3VIIA 1JZ2A 1I1XA 3WENA 2BVDA 4CU8A 3LMYA 4JL1A 3LRLA 2BNJA 1PBGA 3MI6A 3GDBA 3NJ3A 1V08A 1KBBA 4PMXA 4AEEA 3EDJA 3OLGA 3PZMA 3OIHA 1CYGA 5DF0A 1OIFA 4EKJA 1GGKA 3HG3A 4M24A 4PMNA 4TXEA 2VURA 3FAWA 3F5DA 4UCFA 3LPGA 5M5DA 4X0NA 1CNVA 3T0DA 5JBDA 2J7DA 3UG5A 2JF6A 1GHSA 5EFDA 4CD7A 1JI1A 3ZR4B 1P7ZA 1V6XA 1T0BA 3ALGA 4E5VA 1UZ1A 5CJ5A 1UQYA 4P5PA 3AXHA 2XUCA 3TTTA 4W7WA 4CD6A 3MIIA 4B3KA 3B36A 1OGGA 2WKLA 3AYSA 1C7SA 3PZNA 4OGZA 1TUXA 4S3KA 3WMSA 3VSUA 4ZE5A 1UHVA 4H8UA 1GZJA 3NOOA 3ARTA 2EBNA 5M3WA 4LQ1A 4DM1A 2X05A 1UWIA 2JIWA 4TUFA 5CZKA 3TTXA 2YDQA 4PRWA 5E70A 3ZIZA 1HTYA 3VD3A 3RM8A 4ZXLA 4GPNA 1OI4A 3U5UA 1XD0A 2J7HA 4BCEA 4ENRA 1GQJA 1JDCA 3AZRA 1C93A 3UETA 1UD3A 1OBAA 3CV5A 1QF7A 1R7AA 2RGLA 3NDYA 1JYNA 3W26A 1LWHA 4ENWA 4F9DA 1XC6A 2G3IA 4KRTA 4W88A 4BIMA 3MS8A 2BFGA 1N57A 3NORA 3VGGA 2XM2A 4EANA 4AW7A 1HL8A 3WD4A 4NZJA 3K8LA 2QMKA 3MV11 1ODUA 5CGMA 1PX8A 2BVTA 4B40A 1BYCA 4H2CA 1J0ZA 2JEPA 1GORA 4MB1A 3F5KA 4U3AA 1TA3B 1XCXA 2Y8VA 1BYAA 1HKIA 4FLQA 2DSKA 3SUTA 1S46A 2V5CA 3W28A 4HZ8A 1VFFA 3O2LA 2YBUA 1CWYA 4CN1A 1XYFA 1CBGA 5JUVA 3ARPA 2F7OA 4WKHA 1E15A 5A6JA 3L4XA 1ZL1A 2DT1A 4K2HA 2F61A 2FGLA 4HZ6A 1IZKA 1CXFA 4OUEA 2CPUA 1KXTA 1C90A 4NZCA 1J0IA 4MTVA 2VT0A 4C7GA 5ABFB 6CGTA 1OY1A 1HWWA 1GGEA 2EACA 1BSIA 4JFWA 5SY6A 4H8VA 3ZJ4A 2NT1A 1ZBCA 4Z2JA 3CZAA 2ZX6A 4UQDA 1JI2A 4DO5A 1GOMA 1GGFA 1XH0A 5IP5A 4CKQA 4M56A 3SCQA 1ZS2A 4CCDA 2VI0A 4Y1RB 2R1VA 2CXGA 3P9PA 2Y5EA 4UFHA 1UH4A 2YL6A 4XZBA 2A3HA 1E1FA 5DMYA 4L7QA 1JNDA 3VGHA 4E8DA 4P7LA 1V3KA 5GNYA 1XH1A 2CERA 2W5FA 3WD1A 4IPLA 4EAMA 2D0FA 1JGIA 1TR1A 1E56A 3SCWA 4P8WA 1M01A 4ATDA 3GZAA 4BFLA 1ONSA 1VF8A 2BXZA 4HTYA 1OX5A 4XX6A 2QF8A 3AZTA 3MUZ1 4UFIA 2RGMA 3L4TA 1UCFA 4WJXA 2DH3A 1J9YA 4GZEA 2ZWZA 4OQ4A 3PZQA 2Q8XA 2WMKA 3NONA 4GO9A 1CGUA 1HVXA 3AXIA 1VFUA 1CXIA 1UD6A 3WBEA 3PZGA 2WHMA 4UZUA 2UY3A 1B30A 3MUAA 3G6LA 1NOWA 2VX7A 3ER6A 3ZQ9A 4TVUA 4F9JA 1V3LA 4PTXA 1K9EA 4ZE4A 3N04A 3MMDA 4BQ3A 1D3CA 4CU6A 3AIQA 1SY7A 4NXSA 1E6RA 2J7GA 3BLPX 3PZUA 1KCLA 4IM4A 4AZBA 1GQLA 1GPMA 3TP4A 1E6SM 3RIKA 2OLHA 1Z32X 3VKKA 3CUFA 1GGHA 1FHDA 2UY2A 4FNSA 4YPJA 1J11A 3KEHA 2J7BA 4CD4A 1HJQA 2VX6A 1SOAA 1CDGA 3KZSA 2WKGA 2VXOA 4M1RA 4Z2KA 4LRUA 1CXLA 1BQCA 4X9YA 4ZFMA 2XIIA 4XUYA 1K9VF 4JZ5A 2Y4SA 2WAGA 2FH8A 5CPSA 1JYXA 3CMGA 1PDVA 4S0ZA 3TTWA 3KL3A 2E9LA 3JUGA 4KH2A 2WBKA 1E6NA 3H53A 2VX4A 3LXCA 4D6EA 3DC0A 3VSTA 1J42A 1NARA 3ZR6A 1BG9A 1W3LA 1WZMA 1BHGA 3BAJA 2FE0A 1EIBA 3OGSA 3HN3A 1YHTA 3MUIA 4LGYA 2GK3A 3VM5A 3NUKA 1ISVA 2OW7A 3L4UA 4ZDJA 5FOOA 1FOBA 1CGYA 5LYRA 2VX5A 1SMDA 3IK2A 3WF2A 8A3HA 3VIGA 1UWUA 1WP6A 2OWXA 1KXVA 4JFVA 2GHRA 3GXMA 3UESA 2WWCA 2WCSA 3WNPA 2O9PA 2PB1A 4CCEA 3CO4A 1QI3A 3WNMA 2DIEA 4UNIA 1GG9A 1GQIA 4QLLA 1H49A 3ZJ8A 1O6IA 1J18A 3BCDA 3AISA 2EPLX 4U3CA 4ZENA 3VDHA 4L4PA 5EB8A 1EOKA 2D24A 2IUFA 1JIBA 2F7RA 4AD5A 2AMGA 2C8NA 3HU7A 4AEFA 4DUVA 5DEZA 3PHAA 1V0NA 2J7EA 3WDRA 1EDGA 1MWOA 3VMOA 1LG2A 3ZR5A 3WEOA 1W3JA 2PBGA 2WZEA 3I3EA 1RPKA 5LA2A 4W7VA 3K1DA 4H7VA 4MPKA 1EGZA 1FH8A 4GE0A 2FGZA 4HA3A 4PMRA 3UOWA 2GJPA 3LRKA 4CU7A 3TTUA 4A3HA 1ISYA 3L2MA 1QI0A 5D9OA 3WEZA 3VDBA 4AXNA 1M03A 2CBVA 4N12A 2X2JA 1QW8A 4QFUA 1NOUA 1OD0A 4MDOA 1CGXA 3A5VA 4P7RA 1M7XA 3PZIA 1BPLB 2XHYA 4FNRA 1GQKA 4ACZB 1UUQA 1OX4A 3GXIA 4JFSA 1CLXA 3GNPA 3OGVA 3W4RA 1E43A 3EN0A 1TCMA 2A3AA 1H3GA 2WW5A 5ABGA 1PX3A 1C3OB 5A6SA 2WHLA 1E6ZA 1OGBA 2WHJA 3GBEA 2PI6A 3HZ3A 3PBGA 3WF3A 2J7CA 5A8QA 3MMWA 1JD7A 3SF8B 4BQ5A 3CHEA 4KWUA 1OD8A 3CBWA 3NYDA 5CSYA 2QLYA 2Z1KA 3N13A 1KR1A 5AY7A 1E6XM 5JZMA 1HXJA 2WMHA 4S3JA 2FEXA 5A6LA 5A3HA 4U2YA 2D0GA 1H0GA 3RM4A 3OG2A 2YWBA 2R1VB 4M82A 4TVCA 2CKRA 1E0VA 3T0AA 1V6UA 2OW6A 1W9XA 1V6YA 2WANA 4CVUA 3LPOA 1CTNA 5CXPA 4W8AA 1H1NA 3FN9A 3BVWA 2XG9A 2V3GA 3AJ7A 2ZWYA 1M53A 3DDFA 2AAAA 2ZIDA 2XFRA 1GVYA 4B7AA 1DEDA 2WPGA 1CPUA 2GK1B 4QP0A 2XWEA 2EPMX 3K4DA 1OX6A 3D3AA 2GUYA 2CYGA 1C30B 5DT7A 2ZX8A 3DYOA 5E9AA 2OWCA 1U9CA 1XHGA 4M8UA 1J01A 2V4UA 1GCYA 3QHNA 3BUPA 3EZGA 4BS0A 4AZGA 1UD2A 3WN6A 3IAPA 1Q6CA 5D9NA 1IV8A 5A95A 1MFVA 3F4VA 5FKYA 2BHZA 1VRXA 3AHZA 3T2QA 3VM7A 3WDJA 4BQ4A 3RPMA 1BF2A 1JL8A 4WINA 3VD4A 1UQZA 1UZ4A 2ZE0A 2DPEA 4U5KA 2WM0A 3VNZA 4ENQA 5CQ1A 3UEQA 1U30A 3U57A 3WNLA 4U33A 4PXYA 3ZJ5A 2Y24A 4Q22A 5BRQA 2O9RA 2XSAA 3AHVA 3PQ2A 2G3NA 4Y1GA 3GH5A 1V3JA 1LL4A 3KLLA 4OGGA 3UG4A 3L4ZA 2XWDA 3I3DA 3N12A 1XH2A 5LIRA 2VR4A 1WDPA 2E8YA 1R8LA 1TQSA 1KWGA 1BG4A 3CIVA 3CLWA 1DTUA 1GJWA 2WCGA 4CVWA 3NCOA 2ZOXA 1KR0A 1NP2A 3VSVA 3GXPA 3NVAA 4D6HA 1J10A 3AHYA 4DUXA 1UYQA 3BAXA 3PQ6A 4NZFA 1R75A 3OZOA 5A69A 1UD4A 3N15A 3WL0A 2W62A 3EYPA 4HU0A 4AZHA 3LXBA 1UKQA 3AI0A 5FL0A 1UKTA 4AIUA 1I7QB 2PWHA 3TV8A 4TVDA 3RJYA 2YFNA 3WF1A 4MB5A 1UWTA 3TQIA 4WXYB 1C92A 1TZ7A 3ALFA 3BUBA 1F4AA 2D1ZA 5IHRA 5HOSA 2UY4A 1QX1A 1JDDA 3CZ9A 1I1QB 1PE0A 3VIHA 4NXKA 3BUQA 2VTFA 2BY3A 4MB3A 2QMJA 1VB9A 3WDHA 2XVPA 1JFXA 2VVNA 4EK7A 2JIEA 1B3ZA 3J7HA 1GOWA 3GH4A 4EE9A 5I3DA 3CC1A 1HJVA 2VZVA 2UWFA 3OGRA 3ARSA 3WIJA 4DO4A 3EJRA 4TX8A 1QI4A 1E3ZA 1T36B 1JZ5A 4RKWA 1F4HA 3A23A 1EDQA 1NWRA 1RD6A 3AHXA 2DEPA 5ABFA 2VZOA 1VFMA 3AIUA 4CUCA 1HX0A 3BVXA 1UR9A 3LX9A 1R85A 3FW6A 3CZLA 2BHUA 3WH8A 4UQAA 1Q6FA 2VJXA 3R75A 1BYDA 3BC9A 5C8BB 4HP5A 2QHAA 3RO8A 4HMCA 3FY1A 1HP5A 1UWSA 2GDVA 3UERA 2EQDA 4GUDA 2WVSA 4B3LA 1W9UA 3UMMA 2EJ1A 1VBRA 2F1AA 3CGTA 3D4YA 2IXUA 5IFTA 3ZJ6A 2G41A 1P80A 4MTCA 2CCRA 1TMQA 3PQ5A 4L8YA 2D3NA 1GHRA 1OM0A 2D7JA 1OCQA 4DWSB 1FP9A 4PMZA 1EO5A 4ENUA 3GXDA 3KWXA 2J47A 3EJPA 1QI2A 1X6LA 1E0XA 3UJNA 3F71A 1E6PA 2J25A 1LLOA 1W3KA 2CBIA 1V02A 3O6AA 1KQZA 2VVSA 3ECQA 1KTCA 4JIEA 3ARQA 1J0HA 4GE3A 1ZBKA 4I2NA 5A94A 4U31A 3CTTA 4UZSA 5HXMA 4MNLA 2YLAA 4DWSC 1JAKA 2NV0A 1I1WA 5E0CA 3T2PA 3ZT6A 3WH7A 2ABWA 5BXRA 5AC4A 5CGTA 1BTCA 4QLJA 4N0MA 4R27A 5A8PA 3DX1A 3QOKA 2CBUA 4FNPA 4KGJA 2EPOA 5BXTA 4A3YA 4W8BA 1A3HA 2J7FA 4UOQA 4BQ2A 4UFKA 1LJYA 4KMQA 3HJEA 1FY2A 2WSPA 2H2WA 1DWHM 3GNOA 2OSXA 4AIOA 4OOUA 1Y7VA 4PMYA 1LQ0A 3B3AA 1J12A 2D23A 1E5NA 1TVPA 5IXEA 1A9XB 3WQ6A 1DWGM 3EJQA 1W9VA 3SCOA 1UA7A 1W32A 4WSKA 2YL8A 1ZBVA 5A6KA 4P34A 1JZ6A 2BVYA 1E72M 4WIWA 1UR8A 2WZHA 1PS3A 4HMDA 4D6JA 5E6ZA 1O7DC 5I24A 4IUGA 3W53A 4MGHA 3NSNA 1W9BM 3WD3A 4AY1A 4B15A 1FH7A 2UY5A 4P7NA 4HA4A 1BXRB 5LA1A 1GONA 1IT0A 4TX6A 3BMVA 3DX3A 2NV2B 1FYEA 4J3SA 2CESA 1CXKA 1EQCA 2WXDM 3VVGA 3BUIA 1WL8A 3F5LA 5D4YA 3WY1A 1H2JA 1GOKA 2XVLA 1UH2A 4KRUA 3SURA 5F7UA 3WD2A 2YA1A 1M04A 3THDA 3VMPA 2BY0A 2F7PA 3WL1A 4P35A 1G5AA 4W5ZA 1E4LA 1HKJA 3VO0A 2FH6A 3W24A 2DIJA 4HA1A 2FYVA 1LL7A 3CZNA 1SFSA 3B9AA 1HJXA 5E0FA 3ZJKA 1D7FA 5JIWA 4NRRA 2CEQA 3FHAA 2GVYA 4FNTA 3SCPA 2BY2A 4ENTA 4MDPA 2DH2A 5IHSA 3L4WA 3VUPA 2R1TB 4IPNB 2FDMA 4I4NA 3W6LA 4A4AA 7TAAA 1US2A 2WK2A 3U7BA 4FLSA 1ZU8A 2WVUA 3UK7A 4MAVA 3KE0A 2D2OA 3BVTA 3W6MA 3FIJA 1CGVA 2A3CA 2GJRA 3SUWA 3T0BA 3TTQA 1UD5A 1WKYA 4WF7A 2GJXA 1ZB5A 3OA5A 5AYIA 1H11A 4N0RA 4AZCB 1JXJA 1L8NA 3WNKA 1ECEA 3UG3A 1JAEA 1VBUA 3DHPA 4LYPA 1G01A 2ZUSA 1S1MA 2J74A 3VIKA 4LGXA 2EPKX 4HU8A 1E3XA 4QAWA 1C91A 1W1PA 1G0CA 1UKSA 4MAZA 4GI9A 2PWFA 4C7FA 1V6VA 4MADA 2VCCA 3WBAA 3M3PA 2F7QA 3VGEA 1B31A 3M46A 3EJTA 5E1QA 3LPPA 1BGGA 1E4NA 4E4PA 2E3ZA 2YBTA 3QOMA 1DWIM 2W61A 3BAYA 3NIYA 2DT3A 1KWKA 2VZUA 3EMCA 3L18A 2EADA 4P36A 4Z2IA 2A3EA 3SCSA 2AD5A 3N1AA 2PC8A 2G4FA 3A21A 5A2AA 3E1F1 2YA2A
chains in the Genus database with same CATH superfamily
3A6EA 3OAUH 2C9RA 5DF1A 4U3HA 4MKZA 2BFDA 4IUCS 4JLPA 3WTBA 4JPWL 4CNUA 3KFTA 2AXQA 2IEBA 4DUYB 3FKUS 4QDZA 3OT1A 5H82A 1PJ4A 5FHAL 3KEFA 2WM1A 2GLXA 2W6MA 5GVRA 1HJUA 4G9FE 2PZMA 4BO5A 4XH9B 3O7MA 1U36A 4GA8A 1IJ9A 4D6DA 4F79A 2L5HA 1UBFA 4J2OA 1OLUA 1SVMA 2C4TA 4FR2A 5JEEA 3ZWDA 3D5HA 5E7FA 3F74A 4ZANA 4L4TE 3K80A 3CINA 2O7SA 1OLLA 4R5HA 3L66A 1MPXA 5CA0B 4XGQA 1K5GA 2JIZA 1ZITA 3CEMA 3P2EA 2AZ4A 5D1QD 2QBWA 5EZOL 4X6EA 4NENA 4JO1L 2WVHA 3PDJA 1IZYA 2JGDB 4QLAA 4L1HA 1CDEA 4ANFA 5KINA 1A5KC 4ALLA 4Y7EA 1HH9B 5F4XA 3JR7A 2OG1A 1YKWA 3UMBA 1RSYA 1OAKA 2ID9A 4Z9AA 2IQ9H 2XXGA 1DIAA 4LOLA 1OY3B 2JC3A 1FE8L 4LJ8A 4PJGF 1VFAA 1LTDA 4PULA 1OZGA 1II4E 4S10A 2OQHA 4PGEB 5KYWA 3NW9A 5CITA 4XMXA 3U44A 4PEKA 4IINA 2YZ7A 1CE8B 1OLXA 3WIHA 2VCEA 4KUZH 4U1NB 3LS5L 1FMCA 2VA8A 1ZA6A 2P76A 5C0CB 2VH1A 4AT1A 2PLCA 4CEHB 1U8KA 2IWKA 3BH8B 3GQBA 1I9EA 1NF3A 3H5IA 3GEPA 4EHHA 4ALAL 2R66A 3NFYA 1JN0A 4WU7A 3GSNH 4JLUA 3N9SA 4I9WD 4KDVA 2OD2A 3TXZA 3CFUA 3A24A 1T6YA 4N2AA 5J5DA 2ONEA 1M8GA 1JQDA 3WJ1A 1P2CB 1NP6A 1RQNA 1O77A 2DL9A 1F58L 3CFTA 1QFXA 1WDSA 3R74A 1F0KA 2QCCA 2NTFA 1RRPA 2WJEA 1QC5B 2J6EH 3SBPA 3CLTD 3E12A 4QXGH 1EP2B 3PWLA 4FIQA 4BO4A 5D4JA 3RHWF 2WWDA 1G8YA 2W2VA 3DMDA 4BFAA 4ERXA 1A14H 1TCDA 2RK3A 3RWCB 5C0DB 1P8JA 2AMLA 3IDIB 2BCMA 5I9BA 2AVNA 2R9HD 3SOTA 4HZUB 3OKCA 4DZ8A 5JORA 1A71A 4JQZA 4FQJL 5I9IA 3EIWA 3PICA 4E33A 1KO1A 2EIMB 1UM4H 1MXHA 5LD2B 5I8WA 1Y6QA 4LK3A 2ZBRA 2ZYAA 3SLGA 4XGRA 1OU0A 3HZRA 1EC7A 2DU2A 1F38A 2DUUA 5C0BA 4OZGA 2PBOA 2QZRA 1A76A 1N64H 1W6RA 3BSFA 4JXXA 2OXIA 5FL1A 1FNSL 3TAKA 1Y8QB 5ALIA 2DQXA 1O6TA 3UC0L 3K0AB 4RCZA 1PT9A 4EJ1C 1JYVA 4L48A 4DLAA 1JF6A 3I76A 4GLRI 4FD0A 2AUTA 5BNTA 4B96A 1RMYA 4MVJI 1HKLL 1PTGA 3M4YA 3C16C 5KG9A 3H4XA 4I46A 3RABA 3VCRA 4ML3A 1IG0A 2X4PB 1PZFA 3MZNA 1CD8A 1Z3GL 3PV6A 4DSTA 3AMKA 4D6IA 1EZ2A 3MBEC 3KP0A 4RX0A 1IHOA 2BGNE 3WMPA 4AZ6A 1N2VA 2XVMA 2G4LA 4F0HA 3HI1A 3DIFA 3ZHCA 4QRRE 4KV5E 2NXHA 3EX2A 1EK3A 3W9EA 3FU7A 3BCJA 5E38A 2RH0A 3ETNA 3EARA 2IS6A 5DWUL 3M0EA 1GGTA 1C9DB 5CSZA 3VXUE 3DX6B 3O0KA 3DZ8A 3MEQA 1FQOA 4Y1FA 2OKCA 4MPJA 2VEMA 4G5GA 1JWMB 2BFNA 3I4FA 5KO2A 3GUHA 1CT8B 3W3AH 4BPRA 5E5MB 5DGHA 5MKGB 1U8IB 3B0UX 2AQQA 2DLTA 3QWOB 4OHRA 3SY8A 5JSKA 3PFBA 3KHOA 2XE8A 1DCMA 1SO3A 5I30H 2QMUA 4E9VA 4LRSA 5DWDA 3N2XA 3HUTA 2X7XA 4HCRH 4KEZA 4TXNA 1WTCA 4JG1L 5F88B 5J6SA 2JGQA 3ABKB 3OBAA 2QTFA 1BAPA 2PPEA 2PL5A 4LVHC 1LJ8A 3SM9A 1H0SA 3PTKA 3GEBA 1H8EA 1W1VA 3TUIC 4OQLA 3T2LA 5IZ7A 1ZUNA 3P9LB 5D9SA 3KGRA 2W6ID 2OSBA 1GGIL 3UTQA 4JGNA 3U9LA 4NHEA 2B25A 2CT8A 3FYCA 3QLVC 3MBKA 4QO7A 3WDLA 2GTWA 2RJMA 5FC9A 5BXFB 2JBAB 1KLFB 1OSZB 1X5IA 3ARDB 4GX8A 7MHTA 3ZDEA 5BOJA 1USQA 3TIDA 1ZQ1A 4A6EA 5CJNA 2QN2A 3RNQA 4JTDA 4XXWA 4GNVA 3RQ3A 5I6LA 1VACA 2I3GA 1PD0A 2H63A 5FUQA 4KREA 1PSKL 4G5OA 4NABA 2GB2A 3WD0A 1DIDA 4TUUA 3O8QB 4DYHA 1NLUA 2BDNH 4MAYD 2FUKA 1Z3CA 1NQ6A 5E95A 2J12B 1RIHH 3KL4A 5HATA 1TPVA 4ZI7A 4AIZA 1PIFA 1BOYA 3VSCA 3EOSA 4IHJF 1NVMA 4DCGA 3DKKA 1TJ0A 4ZQNA 5KYTA 3DWGA 4GXUM 3REFA 4HUUB 5BXSA 4II3A 5DT5A 3GHEL 4JFTA 1SSDA 3WKPA 4RA6B 1E1EA 1CUEA 4WLUA 2XUKA 4JN7A 2AC7A 4I6JA 1RXWA 1Q9WB 3W2KA 3FRIA 2Y27A 1ORSA 4PJ5D 1KZ6A 3S3SA 2H48A 5E0QA 1AZWA 1QKZH 5EZYB 1B0RB 3R4VA 3CH7A 4NATA 3OF2A 1A3QA 3E80A 4OWGA 2GZ2A 3BHBB 1YN6B 2OGJA 4F7EA 3I62A 2R5NA 3W5JA 1XLUA 4GIAA 4TWZA 5BR1A 2BI8A 4I14A 4OCSL 1KKMA 3QQDA 4WXEA 2OQ2A 3GFYA 5CDFA 2Y70A 2R6ZA 4F8YA 5DMJB 2RGEA 4JM4H 3W4IA 4L23A 2A9DA 1MCLA 1G8GA 3LD9A 5JYEA 3EVNA 2X2FA 3ASZA 4G4IA 2BIFA 1S89A 3MUY1 1A9EA 1NIBA 1Q9KB 4BWWA 2QUTA 3ESAA 2YIDA 3AU2A 2QPEB 1JF5A 2DS4A 3VZZA 2J48A 3V0DA 3QS2A 3UWYA 1E7VA 4F15B 3GUWA 4I4IA 1BXAA 5DGXA 2W58A 3PGDB 2QRQA 5KNDD 1EDBA 3DV9A 4B9GA 1JPVA 3V9AA 4DXXA 4GGBA 2YICA 2IDZA 4JIIX 1S1RA 1H3WM 3R89A 4HV8B 5BQOA 4HKTA 3PHIA 2F58H 2J62A 1TTQB 1NCTA 1SXJC 1ZRNA 5JPMB 3FRPB 2O4MA 1E1LA 3WFIA 4HAXA 4IL0A 3MW8A 3QVTA 2Z1XA 2WGNB 3WBDA 4CKCB 4J0KA 1Q6DA 3AM4A 1IGIL 4Z9KB 1WXEA 5JW3H 5CG0A 2OYMA 3SI9A 3ISRA 3QZEA 4L3CA 3WJXA 1T10A 4W9NA 4Y2DD 4G7EB 3G5MA 1KG0B 3W06A 4LXTA 5ISZB 5ECWA 3DK0A 4XO3A 5HG0A 1W3HA 1TMHA 5JNWA 3G1SA 2AK4B 1YZTA 3RJ9A 1G4PA 4DEPC 3GJ4A 4FFWC 3GPLA 4W9KC 3VPBA 4A7QA 4F15C 1L9OA 3NLLA 3QDAA 1QO0A 1SLVA 1YQGA 2GN0A 3RU7A 1V4NA 2JCXA 3A32A 4BMPB 4MICA 3OIWA 4WUTA 1VHJA 3AXXA 5EZJB 3BCFA 5AM4A 3D0LB 4JI2B 3QJYA 1CLZH 5F1KC 3URQA 3HWX1 3CNQS 3CXRA 3DOEA 4GGMX 3L0PA 1QEXA 1XW8A 3BSZL 5JBFA 1GCIA 1OJ7A 3GD1C 2M6RA 4LQCA 3GJQA 5H80A 1ACCA 1NASA 1YZQA 3U80A 1J88A 2VH2A 1Y7PA 5DQDH 3U36A 5C6PB 2R39A 1CHDA 1Y6NR 4B5NA 2QVMA 1BWRA 1Q6LA 1W76A 3E9YA 1S2NA 3G5XB 2HBZA 4NP9A 5L3SB 3FO9B 1VSQA 4Q9QH 3JQ7B 3UPUA 4QHNB 2O6FA 4PGLA 1E3WB 1YL5A 4UDYX 4R7NA 4S0TD 2NVUB 5FTWA 3IDNA 3NMEA 1GEQA 3QU2A 1U8QB 5B8CA 1AKJB 4HJXA 1Q83A 3GSVA 5DMXA 4DLYA 5KSAB 5K8UA 4JO5A 5KWVA 3IKMB 2ZP9A 1FTGA 4LRNL 1VFAB 1WZLA 2JAXA 1A7KA 3C3WA 2R8XA 3I73A 1PIWA 1DAEA 2QRVB 3W2JA 3IP6A 3VFWA 5JXQA 3G9QA 4DW2L 4FLMA 3TV3L 2XA9A 2BNRE 4JTQA 2PC4A 3A9VA 2VR3A 1GUZA 2ACUA 1UPXA 4WRHA 4NU5A 2FZEA 1R8XA 1J1XL 3MWDB 1FDOA 3FFTA 5HS4A 3NR0A 4UTWA 2QPDB 4YR9A 2W63A 1T2NA 1ZT1A 2DPXA 3I6RA 3ITKA 4L3EB 5BRNA 4FFOA 5CLYA 4P2OD 3DUSA 5EC1A 3HEIB 5B55A 4W7UA 5IN4A 2ARJA 3RWGA 2H51A 1SFJA 4JAWA 4TMBA 1B1CA 2HT2C 1SJHB 2GJNA 4A16A 4DN6A 1R5IA 1GVHA 4BQ8A 4L5JA 1I9RH 4HLZH 1YEKH 1JLRA 2ZYDA 3VG0L 1H7OA 2WT9A 3AHTA 4YDMA 5I5IA 3WJMA 1CDZA 3LEPA 1BXRA 3ZYCA 3V3TA 5FJTA 5LQNA 2E89A 4XYEA 3CX2A 4UTAH 3RVPA 3PQ8A 1OFUA 1RMFH 3H99A 2W6OA 2H1OA 4N2GA 3RIGA 2Z6QA 4O5LH 2P5ED 4PLGA 4ZEVA 1UB5B 3VILA 1SY6H 2B8OT 5IVZA 3THQA 4AC1X 5ALPA 3HQNA 4NFSA 2YUZA 5JIIA 5J3HD 3KPTA 3MWLA 1T4CB 1LCOA 2O5XH 5FWXB 1LDMA 1VH7A 4K28A 1OGAB 1Q1GA 4V2XA 2KPWA 5C35A 5ALOA 1RZ8A 1GZ4A 3BCUA 4K9JA 3SEQA 2NQHA 3FSUA 3AC0A 2RTTA 1EO7A 4HLJA 1WE5A 3NQ2A 4WHYH 3MJ6A 1AVAA 5J12C 3T3PE 3U2CA 1V2HE 1K8RA 4RE4A 4F2HA 3JWDC 1E59A 3KDOA 1DRJA 5DHSA 3DFIA 2Y5TA 1UZ6E 3ZO9A 4AAJA 1D4OA 1JAHA 4Z4HA 3WGJA 4OCYH 1T25A 4MV1A 1YMHA 9RUBA 5JCXA 3RWHA 4K9EL 2UYOA 3K16A 2QN3A 1VIYA 2ONKA 3TZ6A 5IB4A 2PKCA 1PYWB 3W82A 1K97A 3AR5A 1ZN7A 4R81A 4BJ1A 3HR6A 3ARDA 4MJ5B 4Y67A 1JWUA 1XFCA 3TRIA 4OB5H 3HMWH 2OYKA 5C32A 1PEKE 2ZXCA 1U91B 5DNDA 2NPFA 2DF3A 3NCCB 2NO4A 1E28B 3OHPA 2I9LB 3ITYA 2C2HA 1H4PA 4OO3A 2C54A 3CFKB 4CLXA 3N3TA 3C6QA 3MX0A 2PCPB 4L9ZA 4HS4A 2EJVA 4DKTA 2GSWA 2WSSA 4E5KA 4YXWD 4P2GA 4UTAA 1RYHA 4LJ5A 2KMWA 4JFZH 4G8GB 4NBRA 5AUPB 2HFFB 4A9AA 3T7SA 4J28A 2DQMA 4JXCA 4AK2A 1B4TA 4WWKB 4YHNB 3L8MA 2V5KA 1QV9A 4KH1A 4PYHA 4NECA 1I0ZA 4U1LB 5F0MB 2Y7DA 1RY8A 2BM9A 2V9TA 4WMLA 1ZOIA 4L80A 3V8RA 5IUKC 4DEVA 1OAQL 1RJEA 1DRVA 1T8SA 1TG8A 2D9QB 1LBMA 4R33A 1N2CE 5EU7E 3DURB 1X3DA 4OZ4B 1M2HA 1CDCA 1T35A 1KY6A 4AL8H 2BDUA 3C9NB 2C3XA 1BWMA 5DC9B 1B0PA 4BCCA 3WFEL 4X5RA 3RIMA 2BV9A 5GHWH 1LLAA 1KPRB 1WCYA 3T4PA 4ZOCA 1HX7A 4RIHA 2XTJD 2E9MA 3QTPA 4WVXA 1SXNA 5KWYC 3IRCA 1YNTA 3T7RA 4R31A 4HRAA 1TMOA 5T8IA 1XROA 3OCWA 4W6WB 4JR2A 4H0NA 2WC7A 3PWVB 3FH7A 3U9WA 4UTJA 1WS7A 1BYPA 3IXAA 4JL2A 2HTFA 2PQ6A 4R8WH 2RAUA 1T89A 4DV7B 1SOWA 1DFBH 3ZE1E 1VL1A 4Y9MA 3U7RA 3GG8A 3QRFM 1NQOA 2O1WA 1R27A 3T8XB 2R69A 5K51A 3T9WA 2GT9A 3X14A 4AKOA 1LD3A 4Q6IC 3PITA 3EBIA 1EDZA 3KYJB 3E2PA 2YRXA 5D2NE 2Y6SD 4LSUL 5LWHA 5GONB 4QGBA 3VKCA 2X76A 3ANLA 5E8NA 3QRHA 4NARA 3GJEA 2LBPA 1V4VA 2Y5JA 5I1AA 5CKGA 3R13A 4FYXA 3RQIA 3ZTJH 4LOVA 3ZS9A 4GVHA 1ZV5A 4EIGB 5HBBA 1JP7A 4O4HF 3QY7A 3IE2A 3FU5A 4ZMSA 2KE5A 4TT3A 4L9LC 3GB7B 4Z1MD 3UC9A 4L75A 3MBIA 3IQEA 3GGDA 2Z91A 4HULB 1JVSA 1ZSNA 1V51A 1KJJA 4Q6BA 2XQYK 3HKBA 3IOMA 4X00A 3L17A 1HE8B 4LCJA 1IJFA 1PEZA 1S5HA 3K3PA 1NQVA 3GUCA 5FBRB 4TKLA 1AKUA 4YV1A 2NGRA 3U7EB 3D6FA 1UC5B 2ZBDA 3HJ0A 4MQEA 3W0WB 3NJ3A 1K3FA 2V4ZA 2BMKB 3W5BA 1CYGA 3WO0A 4Y16D 3P2MA 4CM4B 1PFCA 2VURA 5ECYA 4IXDA 4H9TA 5FV7A 1NLYA 1DJLA 4UXHA 5FX2A 2WJJA 3MMZA 2WXRA 2QD2A 3MO7A 1LSOA 5AO9A 1CU4H 3D6NA 3UWUA 3ZDZF 1PRYA 1XLBA 1AKJD 2NOAA 3H7RA 3B0XA 4CLOB 2WNSA 3PGCA 4QUJA 5GRYA 1AV6A 4B3KA 4WI7A 1KU6A 2JTYA 4X7SL 1XHHA 3RLHA 5BMWA 2NX5E 2Q6OA 3KIPA 2WKLA 4H1VA 3F85A 2VABB 4TKMA 5ALRA 4S3KA 3NOOA 4WQMA 4H26A 3K3QA 1UWFA 1EE2A 1N6HA 5B7NA 3ZU3A 3ZHKA 1FSKC 2QDHA 2ITDA 4LEXH 5LP6C 1TM2A 5CZKA 5FUZH 4PRWA 4AWUA 2RFXA 3ZIZA 1Q7QA 1MBZA 2G7MC 1MB9A 5JSYA 2PGLA 4F7EB 5MEOB 5CO1A 2ERCA 3R0VA 5LR6A 3GNSA 4YSRA 1P17A 2EERA 3V0VA 4G8TA 1WDMA 3GLGE 3WJYA 2J20A 1DT5A 4P2OC 5CYGA 2Q8LA 3LBHA 3MACL 5GJSH 1EJOL 5JALA 3DGCR 4PHZA 5FO7B 3KR3L 3D0VB 3SQOL 2QAFA 4Z9FA 2XCUA 1RBMA 3NA9H 3LG3A 1V11A 3O90A 4A0FA 1ONRA 4J16A 3CL8A 3BREA 1A88A 2I5YL 5CJPA 1O5QA 1UC4A 2H9IA 4KX3A 5T5NF 4JM0A 4F0KA 4MLJA 1X2BA 1AHWB 4BA8A 5K9JL 2ERYA 3ILVA 4G4SP 4POCA 1CBGA 2Y4NA 3CO8A 3H5WA 3WLAA 3TXAA 3USCS 1RBAA 1O87A 2F7OA 2QN1A 1JFLA 1E4KC 4AK9A 3V46A 4XR8C 4BVKA 3AXLB 4FFDA 4NE2A 3T6WA 1PJRA 1CXFA 4MVJE 3OQVA 4RV8A 1D8AA 4BGEA 5AWNL 4B76A 3I9NA 3DQPA 4Y6SA 1HWWA 1OSZA 5I6KA 4EN3D 5C7HA 4IRZL 4MRVA 3MLEA 3FO0L 4JM2D 1CE6A 1HKFA 2V7UA 1BW9B 4YTEA 3ZQKA 5TE4H 4FGWA 1HXHA 3PXCX 1P2BA 5EFOA 4IDLA 3K7UA 4CILA 5BT8A 4Q4OA 3F8SA 5T3XE 3U0WL 2XT0A 3FMGA 2P79A 3LJ3A 4P23A 4XZBA 1I9JH 5H8DA 3HV0A 4R7ZA 1FUUA 4LSSL 5PTDA 1E1FA 3U6RA 1JKJA 1MCWW 5MEOA 1S7SA 5GNYA 3PUHA 4JY7A 4CL8A 4OI9A 4DLZA 4DPKA 2CNYA 1E5ZA 2FWUA 5F88A 3WLKX 2YVLA 4P8WA 1BEZA 2EKCA 3INPA 2PUCA 2FCBA 3UGVA 4GYWA 3C97A 2A6KA 4AF6A 4NQDA 5CIPH 1J9YA 4O63O 1GAFH 5B7GA 1EHLH 1W0MA 3VYVA 2F6AA 1NCCL 3C8KB 2FX9H 4DANA 3SECA 3WBEA 4C5AA 4M7ZB 3GDGA 1CDDA 3UT0A 5A2IH 3RRMA 3JYPA 3DTXB 1IB6A 5FF0A 1SVKA 1Y8RA 3ZQ9A 3RYTC 1T1XB 5IM51 1DSWA 3MBWB 5DMGC 3UXMA 1Z12A 3QUMA 3IFLL 1XJQA 2N0SA 5HEKA 1IIGA 2D2FA 4U3JA 4MKTA 5EDXA 4EZBA 2C82A 2VD8A 2H1WA 4AZBA 1AGDA 3OOQA 2KDYA 2VKXA 2VN8A 1R15A 1GGHA 4D99A 4G41A 4LYKA 1VBJA 2QLVB 2ZYSA 2CXHA 3NA8A 1U8XX 2B20A 1ADQH 3A4DA 2YZ5A 5F89A 4R7TA 1EEQA 2WKGA 3OJCA 1A6ZB 3IAFA 2AMUA 3H9CA 3G5TA 4I7WA 3EZ4A 2IAMA 1L5WA 1CVSC 3H42B 4ZPVA 3PFIA 3KVMA 3ZH2A 2QADB 1ZTVA 1CSEE 3QDME 3HR7A 3P94A 1PDVA 4Y4HD 3G6WA 1JQXA 1SUWA 3EBHA 1FQJA 1TVDA 4TNVK 1E92A 4B41A 3LXCA 1TIMA 5EBWB 1BHGA 5DCYA 2BCEA 4RULA 1IFRA 3WRVA 3VM5A 4CSZA 2ID4A 5FOOA 2W8CA 3FMGH 2Q3BA 1PT5A 3MD9A 1A25A 1F07A 4RQBA 4BATA 5A3SA 2FJGB 5HMDA 3F49S 4JFVA 4KXDA 3AWDA 4KZEH 2EXTA 5IEHB 1D0IA 1GPKA 1BQ5A 1EHKB 3HLAA 2I2FA 4L7ZA 3AUYA 1W8EA 3DUHA 2ZA2A 2NU6A 3H4VA 5HI5C 3GYGA 4QGGA 5EB9A 3S42A 2LCIA 4ETIA 4DVRH 5B30A 1OAZL 4L4PA 5EB8A 3M8KA 4OU3A 5ECGC 3KLQA 3OAZK 1QMPA 1JIBA 2F7RA 3AHHA 1HH6B 3P0IA 5FAXA 1D5BB 5CM1A 4Z8XA 5TE7H 5CZSA 2Q21A 4EB6A 2CF5A 2ATSA 1MWOA 2G0LA 4N24A 2QJJA 1RXSA 5E0KB 4DNLA 3O8DA 5D7EA 4UU9A 3QEHB 3PJWA 4QTXA 1M2KA 3I3EA 1YACA 3VPAA 4DYJA 3IRVA 2IXQA 2FGZA 1JTFA 2WIJA 5TPZA 5HDQH 4IQ4A 2AW3A 2DQJH 2C83A 4L6IA 4MCJA 8MHTA 2F19L 4LSWA 2AGTA 1UDBA 1URZA 4QFUA 4TQTA 1NOUA 4DJDA 2R1ZA 5DNWA 4ZAKB 1ATZA 2BFEB 4Q19A 3U4AA 3VUAA 2ZYIA 4EE2A 1OZFA 2Y1XA 4RW0A 4URWR 2Q41A 4X8JA 3ABXA 1XZPA 3OGVA 3QWNA 4BE4A 1U63A 2UZ1B 4XO7A 3PDOA 2WJFA 2AEPH 1TMKA 4G7QB 4PI0A 3TX4A 1Z42A 2FWPA 1GGIH 5KOYA 1B9KA 1QVOB 3AUOA 5F1IB 5GSVB 2XMSA 2G5WA 1XGDA 4RXTA 4MHSA 4DNMA 2H0FA 3S7GA 4BV1A 4TQPA 4BLRA 1XTBA 1H0GA 1DL5A 5JXED 3VRIA 2FT7A 3DZKA 1AS8A 1W9XA 4H6XA 3HAEH 5BSGA 4NUWA 4K5OA 4QOKE 3R5XA 3QORC 3PREA 1EC8A 1M57B 2R2HA 1EB3A 1I8TA 4WSHA 3LD5A 4ZEXA 4MR9B 3K74B 3J81k 3U2EA 3FTNA 3QULB 2FQ1A 2F54E 1YNQA 4G84A 5AC6A 3L4KA 4LVHB 5I76A 1JWUB 4B7AA 4JN6B 4EJ0A 3GSRA 3GJ6A 3V36A 3W7KA 2X14A 4ZP1A 4PC8A 1L5OA 1A5FL 3R11A 3FF7A 3FOBA 1MX5A 4N2MA 1Z0DA 1E6WA 4IOMA 4B5EA 1HSZA 4JBSA 1XHGA 4HJJL 4FN4A 2B8WA 1QA9A 1ID1A 4JKPH 5DMNA 2C97A 3QOFA 4QTFA 2NR6D 4A68A 3KJQA 1FVHA 4OUUB 2EBUA 5L45A 4WZBA 5D9NA 1IV8A 2GA8A 4E9XA 3IUNA 3WDJA 1Q50A 4LXQA 2XFWA 2VLJD 3GAAA 3RB7A 2CW6A 4DLFA 2VWGA 4IQGA 3HTLX 2K6GA 2WYZA 2PL3A 4L0MA 2HVBA 3PJSB 3MHPA 2HD4A 4HNGA 2EE6A 4LEBA 4EI5B 1DDIA 4ZQHA 3UVIA 4R2GD 4HHWA 5D09A 5AI6A 3Q2VA 4XNYL 4A3UA 2A5GA 2AKYA 3TSWA 4LUYA 2YFQA 1RWBA 4JM2F 4CQMB 2X5KO 4LAOA 3N12A 4NDAA 2FPYA 1NC2D 4RD4A 4PRNA 2REQA 4RXFA 2IW3A 3H9BA 3VJKA 3WFBH 5E24E 4C56E 1SRRA 1WPQA 3GP5A 2WCGA 1LE5B 4DCMA 3T65B 3DKRA 5EXEA 3I9JA 3TKYA 3DIDA 4G6AC 2G1PA 3A6HA 3MCUA 4MH0R 2WNNA 4G9BA 4FAAB 4N7BA 3H2AA 3OZGA 5AHOA 4ZICA 4HS6A 4KMRA 3FUFA 5FIEA 4CEJA 2D1RA 1X5MA 3LMZA 2D7MA 2WNXA 4HJIA 3WJMB 2IP4A 4HDIA 4BFWA 1DZ0A 3STWA 3GRBA 3WF1A 3TDMA 4FILA 4PONA 4EN3B 1GEHA 2Z28A 2WWWA 1XN1A 1UZNA 3KOFA 4IFOA 1A6TA 4C90A 1B4RA 4AHOA 1HLFA 1EM8B 1QX1A 1TGVA 1PE0A 3RKPA 2Q8NA 4GUAA 2GK2A 3VIHA 2AL2A 3LZ3A 2YBVA 3BZEA 1U3FA 3P0VL 3E8MA 1KDJA 1OFRA 3H4FA 3ISTA 2C77A 4GICA 4CVXB 1NMZA 1JFXA 4X3CA 3AB3A 1ZT1B 3EBOA 2PLWA 1QR1A 1KJNA 4G0YA 4Y5VA 1T5DX 3ORFA 4N6NA 3O06A 1JZ5A 1PP4A 2HLDA 2YINC 3R5SA 2LTQB 1NWRA 3FA3A 2VN5A 1CN4A 2OZVA 3W7GA 3EPNA 1KDIA 3E22B 3U26A 1UBNA 4CUCA 5EIBD 4AX4A 3VXQA 3FW6A 4TQGA 1KYVA 4OCWL 1P1JA 4RQUA 4O1AA 5E1AA 4Z7NF 2AJXH 2A6LA 1DAHA 2HTKC 4RF5A 3NRBA 2ATEA 3JTMA 1IC4H 1F56A 4PS3A 1M9SA 4N0YH 1J9TA 1E7WA 1OF6A 1FYFA 3S8YA 3GDRA 1KBVA 1XRSA 3RB8A 1GZUA 2F3RA 2ZZMA 4MR7A 4ETQB 1S2GA 3ES9A 1QAMA 3CGTA 3CBGA 4K9MA 1QUMA 3CIXA 4MTCA 5INDB 2PP0A 3S5NA 4FS0A 3PQ5A 2NW6A 4LVCA 1OXMA 3NM3A 3IFPA 4JV5B 5K4XA 1VFTA 2BVOA 4JTGA 2OO6A 2ECFA 4UTUA 3FJNA 1N2XA 4N47A 3MA9L 1WMBA 4NI5A 2SFPA 4LT9A 1NYRA 2W9XA 1KIAA 1VSUA 3L4CA 4F7TB 1RUQH 3CM0A 5HILA 3F71A 1LLOA 2WYHA 3SYOA 1U8PB 2LWIA 4YASA 4HVLA 4TM7A 1Y7TA 3CFNA 4N39A 1O57A 4PVDA 3AKCA 5I1DB 3BJLA 3CEHA 4AYBA 4MNLA 1JAKA 3OZMA 4MIKA 1N3NB 5AQ0A 2V1UA 4KPGA 5CGTA 3OLCX 1HYGA 4R27A 1KCUH 3W2UA 1WHOA 4ND3A 2WXMA 3QOKA 1J05B 3EZYA 4XM2A 1QD0A 2EPOA 3EUUA 4GOJA 4K7FB 1UANA 3VR6D 3KCPA 2XA3A 3B12A 3WLLA 1CRPA 5I1GH 3EYOB 3I2IA 2ITCA 1OALA 3GBLA 4IOTA 4ROQA 5G2IA 2ZRAA 1BD2D 2IXTA 1TVPA 5IXEA 5AYQA 2HSJA 1LNUB 1QNZH 2H6RA 1XD8A 3SQMA 2PBZA 2WUWE 5GS0D 3KELA 5MGNA 1EJOH 2CDGA 2I9EA 1B0AA 1Q1JL 3EXLA 2DB3A 1LVGA 4EGAA 4WI6A 1U7TA 3KTXA 4RF3A 1ORDA 3C8NA 1O7DC 1ELOA 1ZICA 5GRVL 4IJ5A 1JFQL 1ETUA 4C4KT 1FP5A 4HXAL 2I6GA 2I9PA 5IYZA 3F4NA 3QIUA 4DSYA 1YAJA 1FYEA 4E5XB 2WUEA 1GWJA 1NDVA 1UH2A 2OXGB 2IIQA 5C0FA 1SFTA 3QKEA 5FBHA 5F7UA 4HZIA 2P8PA 4W9GC 3VMPA 5LKNA 3THDA 3DEFA 4UMAA 3SF0A 4JHLA 5BO5A 4G89A 1YKFA 3ORWA 3DMYA 2FZ8A 1U4FA 4GC9A 1VLJA 1A4JA 1GQRA 4JG0L 2MMCA 4YRMA 4C78A 4G0QA 3Q43A 4X6CF 5A04A 5CD3A 1VHPA 2V2XA 1X7XA 4MROA 4ENTA 4MDIA 5HHQA 5LVEA 5HIAA 2F17A 1T2DA 4XMKL 3BHBA 3O8XC 3H4IA 3RGWS 1HKUA 4I4NA 4A4AA 3G59A 1EZUA 1JVLA 2GSIB 1IG3A 4MAVA 3FQUA 2BUCA 3BRSA 6CHYA 2PPDA 4KR2A 3BVTA 5GOTA 4PTLA 2PPLA 5IUJC 3MAGA 2XZDA 5TK2A 1LEHA 3WYZA 1NN3A 2DU8A 1E4XH 1RLMA 3ES6A 5IG7B 2WD7B 3VXTB 1XVTA 3TR5A 2XH7A 4LYPA 3DHPA 1N2IA 1P5VA 1JJBA 3EYUH 1U8LB 3B82A 1LEIA 4XTRC 1RYDA 4GXMA 1RZJL 4G6FB 4YXHL 3W0WE 3K94A 2GD0A 4W8OA 1TCUA 2QM7A 3P4UA 4V1DB 2PEZA 3ZV6A 1KJIA 2PRYA 5D1QB 1PSKH 3QH4A 1G0NA 1NDMA 1ZC4A 1FVCB 1E8NA 2Q2WA 3OX8B 3BIWA 5FPPA 2TECE 4UCXA 4FHEA 3K0HA 1BGGA 4Y8EA 4J1TC 4LF3A 5C5EA 3NIYA 3K81A 4OGYL 3AUXA 1MFEH 3PJGA 3EMCA 1EJBA 1ZQ9A 5J1TB 3BKML 3CTMA 5FM5O 4WCFB 4OZFG 4P2QB 1KFKB 1V47A 3N1AA 4KWSA 5JH2A 4ZQTA 3ZD6A 1NM4A 2KLBA 4WKGA 3E8UH 4AC4A 2JV6A 4ND7A 1Q22A 3DE3X 1QO2A 3VZBA 3D7RA 5FUBA 4D9QE 4NASA 1IZ8A 1L6FA 3QE3A 4H9UA 4IJRA 2ODQA 1I60A 2ZKMX 3GNTA 1NCWL 2WSMA 4N7JA 1Y3FE 2XCOA 3MRJA 4LANA 5FSEC 1QLWA 1F90L 3OGOE 1A8SA 4Z0XB 3LVBA 4MJJA 3DONA 4YGVB 3EVZA 1O1ZA 3M83A 3EWXA 5JJKA 5D1XD 2P9JA 2VRNA 3S36X 3BAKA 2R4RL 4OF7A 3E6EA 3SG0A 4X98A 3EOBB 3DOSA 4IMLB 1E5VA 2PBRA 3LA4A 2WBWB 3NTXA 4J4BA 2ZA1A 1DQQA 4A2QA 1NAIA 3JD1A 5ICMA 4BQSA 4NWIA 3WZ0E 5L9FA 2ZT7A 3DD5A 4P5TC 4L18A 4N9WA 3KPQB 1T1GA 3BHNA 4U2ZA 1R3HA 2GSHA 4TMVA 3WWDA 1D04A 3LSOA 1GPOH 4ALIA 1D8TA 1B3WA 4LL1A 5J1SB 2JK5B 4PJ7B 3ED1A 5TDOA 1WBBA 2YBEA 4U4MA 1T15A 3DUGA 1DIEA 2Q6WB 5A40E 1EBBA 3EQ8A 4AJYV 5E5RB 5HGDB 3EWDA 4CE6A 1A1MA 4DJDD 1U5BA 4TTUA 5GXBB 3SCVA 2HLFC 4B9AA 5I28A 4YHYB 4X5XA 3D09A 4QDTA 3CN7A 3W86A 4M51A 2BP7A 2B94A 5HHNA 4OLVL 4JY5H 3FSGD 4ZAKD 4JXZA 1X9UA 1VB5A 2HKHL 1O8BA 3I58A 4DKAA 5EPUA 2Z6UA 1U5BB 1OHHD 5JDSA 2WC3A 1X4XA 5E8OB 3DYPA 4YEEA 4IJTA 4A8JA 5DUBB 4BSVA 3VNSA 2GQ8A 3HV2A 1SVWA 5IV2A 5EIWA 1Y18A 2GIYA 4RHEA 1LP9B 4NI3A 4MKMA 2IBBA 3M47A 1RK1B 2V3DA 6FABL 1AYOA 1MX1A 4IVRA 3MUGA 3HCCA 3ECBB 3D69B 3TR0A 4W5NA 1DL7H 3BWEA 3HHEA 1WXIA 2LU5A 4E36A 1QZTA 3ISWA 2QTNA 5FAGA 1X1BA 4MWEA 3QE9Y 4H13C 2AXGA 5DMLA 2V82A 2J9YB 4YYCA 2VGIA 4QRPB 1PWHA 4HJGB 3B2QA 3F6YA 2XUGA 2JKTM 1AGBA 3GPDG 4UAUA 5C7OO 4MJHA 2FI1A 4B8ZA 5SWSA 2NW2B 3NAAH 2X4NB 2BC4A 1V79A 4NL4H 3T2OA 3O84A 4WNCA 3EG9B 4NJIA 2BJMH 2YKLH 1RFDH 4DUWA 3LH8A 3U2IA 4K2SA 3U8GA 3MU3A 3BDVA 4LWPA 1NMYA 4AN1A 3SS8A 3FHLA 4EA8A 4CCSA 1ZVKA 1TJGH 3ZWCA 4CEXC 1RMTA 1XEFA 4G80A 4QF1B 1RZRD 3GELA 2HW8A 2BN4A 1T80A 5T3UA 4J4HA 1K86A 2Q8BL 3WV0A 1I8AA 1YSOA 2W6ZA 1XRJA 3HBFA 2WLNA 1CK4A 3PCTA 1NBIA 2WLIB 8CGTA 1P4UA 1GYQA 3TBFA 1JHTB 1VKNA 1HC1A 5FOTA 1U92B 1O6ZA 3HE6A 5BVGA 3UBGA 4UV7L 1WCBA 2QDXA 4D1YA 1NWOA 2WCPA 1JK8B 3TPUA 1J1XH 3GDWA 1CE8A 5BSFA 4H3HB 4MQMA 5D2NC 5EJ6A 3B37A 4G6AD 4S3BA 3EYVA 4IU3A 4IKPA 4DV5B 4G6JH 4J49A 5DN6A 2YSSA 3GFTA 3VH1A 4TV8B 1LOQA 1NG9A 5EO9B 1WKBA 1DEXA 1E3JA 3CAQA 3ENEA 1IVLA 1I75A 1MQPA 4N65A 2FN9A 4L95C 3T9FA 1H4SA 4UZEA 3KQNA 2HQAA 2QL9A 1ZAJA 1T3LA 5E6RA 4NJAH 2FZBA 1HMPA 1OAOA 3OIGA 5JIMA 3FPYA 1DL3A 1QBGA 4I8XA 4BDTA 4LSPL 5EZOH 4XIFA 1SYVA 3MJ7A 3HY4A 3M5PA 3IA7A 2Q7DA 3CSYB 3FCGA 4ALKA 2KPNA 4IBYA 5AH0A 4G5ZH 4BPBA 1ZK0A 3W38A 4YDVA 3THWB 2VF2A 1SM9A 4DSUA 4LA4A 2JLXA 5BCAA 4HBKA 4J1SA 1F4LA 3U7QA 1UWQA 4YYEA 3WG6A 1KTLB 3VXOB 5IDIA 2HR1A 4PC2A 5HHTA 1GZPA 4PN7A 4V38A 3H4GA 2ZE5A 3F8TA 4QCFA 3GSUB 4Y8FA 2FEWB 6NULA 2CKNA 5L4IA 2CCWA 1X9RA 5M17A 4ZO4A 3QMTA 4JFRA 2YJLA 5U9CA 3FHQA 3QYCA 1E9FA 3ISJA 2ZTUA 1BN7A 3MP5A 4PJ8A 4XKYA 1QE0A 2UY7A 3MLUL 3HNVH 1L0BA 1JCJA 2JH9A 5C0IA 2GPYA 1D5ZB 3QV6A 2P5WE 1EXNA 2PAJA 1E89A 3S47A 1QGDA 2VMJA 4AKQA 2OV1A 4MNHA 4RZUA 1UK9A 4C55A 4H83A 1CQJB 5DHYA 4TTPA 4NJMB 1B3VA 4L7VA 5AZEH 4BB0A 2NSDA 3E0XA 3L07A 5D1ZI 4NEHB 4UBPC 5CR9A 3R8HA 3SHQA 5A0TA 3RYSA 3DCJA 5LJLA 4WW2A 4ZQFA 4DMRA 2NY7H 3ECCA 3LNFA 1S6NA 1W4AA 5FL7D 3MHTA 1NFDB 2E76C 3G5UA 3WQPA 2PTVA 4HLEA 3RWBA 4DXHA 3RUIA 5F7JA 2FZDA 4K94C 4BHUA 2X7JA 4Q02A 2AGVA 1U8IA 1KYUA 4JTLA 3LDBC 1CJBA 1NNSA 1S4QA 4BBPA 4HUMB 1SY6A 3VXGA 1BJTA 1MIEH 4CCYA 1AZBA 4HCGA 2OMYA 1LM8V 4JREC 4PGBA 2NY3C 5GRJL 3QHFL 4KMTL 1WSWA 3ZNPA 1FORH 1E1MA 5ALVA 4MWSA 1CR0A 1L7AA 5T6BA 4QG3A 4RYLA 3GFBA 1FHLA 1QYVA 4QTIL 1WU7A 2TPSA 4P46C 1VI6A 5IC4A 2QZ4A 5K0ZA 2G3JA 3EOTL 1JCKA 4YRTA 1PNDA 3S5YA 1IDOA 4M0EA 5AVQB 2H52A 4PJFE 2W6RA 3OFNA 2PZBA 5EWIH 2O5RA 3S4SB 4XMTA 4HGPA 4D57A 4JELA 4RABA 1OCRB 5JNUA 2A4EA 2WF9A 4Q8NA 2DM4A 1X9IA 2IGFL 4FMKA 4ZZKA 2P35A 1JR4A 3U4BL 3EFEA 3E1KA 4W7HA 1GKQA 1RZ7H 3LQKA 3HVHA 5DMKB 4ZK2A 4D8XA 4CCZA 5CJ8A 2IK8A 2ZYTX 3DVGA 2QUJA 4RE3A 4HSHA 1U83A 1ZEJA 5I1GL 3HJTA 1C0KA 3DFMA 3RUGF 4NAFA 1U8OB 3EAQA 2B61A 4OT1H 2FMUA 5AW5B 3TQTA 2NYAA 1ACYL 5DHPA 3WSQL 4A7UA 3FTSA 2ATCA 1OX4B 1GIGH 5KPDA 3DLQR 1PJ9A 3IRPX 4EN3C 2CLKB 2ZE3A 2VDIA 4OJNA 1W4BA 3FN4A 4WX2A 4L4RA 5SY9A 2GJKA 4YRKA 4NU7A 2C1GA 2NO5A 1JHLL 3WV5A 1NVTA 3CVHL 4ZYYA 2BKUA 4UTOA 3R7NA 1LF1A 2X2OA 1EHYA 5CCBA 4TV8F 3I83A 3L0KA 3TXVA 3TR6A 4O02B 1SELA 3R9XB 1YIOA 1KC1A 2PYFB 3ICEA 5IJKA 2JALA 1EUYA 2QP4A 3M17B 1C16B 1ISWA 2GESA 4ELKA 1JQBA 3EGOA 2CXTA 3EZ9A 4P3OA 4X7SH 1KGUA 4K55A 3RHWK 1ZW6A 3T9PA 3TNNA 2P52A 3CZFA 1ZUAX 4KFTA 4KMMA 3AU1A 1KMIY 2B5WA 2X7VA 1FH9A 3DO4A 3WFHA 2D0OB 2J5RA 2LXNA 3OPYB 1VADA 4DDKA 3RWDB 1DUZB 1U5VA 2VOMA 3KTSA 4BWFB 3T1FA 35C8H 4HD5A 4Q6KA 5CINH 1Y3BE 4YN5A 1OSEA 2FG7C 2WVVB 1QQAA 3NXFA 5TPWH 2IYTA 1N5DA 4LX8A 5L3QA 1BM3H 2BP7B 1CNFA 1X70A 4PCVA 5JFGA 4KWVA 2OPJA 2O55A 1QAWA 3KBMA 1LXMA 3FQ2A 5KWSA 2X2GA 1LMKA 1KCRL 1Z1WA 3EJUA 1JTPA 2PPCA 4WOCA 3FNBA 2RSLA 2FDBP 3RDJA 2NSHA 3AF5A 3V4ZA 3KAJA 3QVLA 3WKMH 4PBSA 2FPRA 4J5NA 4GQQA 5CVCA 4Y2JA 4G1FA 1RE1A 2YWDA 1S01A 4Y5YA 3OTRA 1UDWA 3NEAA 4CT4B 3UTSB 4C0XA 2VRBA 1SZDA 1FF9A 3SBFA 3EO0A 5EJ2A 3UEOA 1GOTA 1ZOPA 2D3LA 2B92A 5B2FA 4OAWA 4JGGA 3JWGA 4NYLA 3R94A 3IMVA 3FVDA 2FEKA 5FJUA 2AXPA 2JIOA 1XGZA 1KTDB 3GMOA 1JB9A 2RKBA 4QIHA 3I3BA 4ELME 3P45A 3A1DA 4MIYA 2C7VA 1UG6A 1RLIA 4I13B 5I07A 5D30A 4JYBA 1P2TA 3E03A 1DGQA 2G88A 3D87B 3KSZO 3H9SE 1XRRA 3U3ZA 4Z0XA 1GQFA 3PFGA 6TAAA 521PA 2GDZA 5AM5A 3U9TA 3ZXAC 4W1TA 5DU7A 1CPYA 3N5AA 2IHTA 4H4IA 1Z2EA 5HGAA 3P4NB 3EDEA 3ZQXA 3ET5A 3ZW7A 4O1DA 1Z18A 1W37A 1HYQA 2ZROA 3BRCA 5FPSA 1J4EA 4GCXA 3VKVA 3BVDB 4KDEA 4Q3BA 2WVVA 1Z4OA 4FXOA 1HCZA 1YHNA 2UZXA 4PZZA 5F7LB 1Z2AA 2Y7QB 4TL7A 1QFPA 1YUKB 4KLZA 3OESA 1KELL 4Y2HA 4ZCWA 2XDHA 2B1QA 2DQKA 3BVJA 1US3A 1C9EA 4XZWA 3QUTA 4Z7QB 3LHUA 5DR5H 3BX1A 4IHJB 2ICEA 3AABA 3G0XA 4CT5A 3HE6D 1GVEA 1BFSA 2YCLB 3RFVA 4GYYA 4D9CA 1P33A 2K7PA 1RQLA 2ZQ0A 3KLKA 5C5DA 2ZUFA 3KPWA 4QNMA 5FWRA 3QFTA 2O1SA 3HIZA 3VRJA 4OCNC 4RZSA 1YN7B 1K6JA 4AVYA 1KK0A 1MKYA 2UUPA 3RHSA 4LLVB 3XINA 4ABYA 3EULA 2F1EA 5JHDD 3BSYA 4P5TB 4Q4SA 5FA6A 4AQYB 3ENLA 4K7JA 3ATYA 5JJBA 1RUAL 5KBPA 2I2WA 3KG5A 4M1EA 1RK0B 2C0HA 2QV5A 2NYRA 2VLME 1NGWB 4P9ML 4NRYA 4TZ6A 2BSLA 2YXMA 4Q9CA 4HX2A 1KY3A 3GV0A 3Q3GE 5A3VA 1LX7A 5ULLA 2DQFB 3KWWA 3BXGA 1JSRA 2F8IA 3BP6A 1TEGA 1SJXA 2V2XB 1X7XB 4M9SA 3TC7A 1L7PA 2OE2A 3FWZA 4MVYA 2ZSBA 5T4HA 1NM5A 1WC7A 3QEGL 4RM2A 4UEWA 4JA0A 3UYIA 1F6AA 1LTXA 4FXRA 4ZQRA 4UTPA 3N1GC 2PODA 2D73A 3RWMB 2OPBA 1S3KH 3WYFA 4YJFB 2YD1A 2WDZA 1YASA 3VB9A 4JDEA 1MHPA 4JRXB 2ZJ5A 4JZOB 1U9IA 5AW8A 1QBAA 1NCCH 3ATEA 4NDMB 3PP7A 3VH3A 3WZLA 5FR3A 1AUSL 5FPKA 1M6HA 2PE5A 4BMVA 1EWDA 1ZNXA 3UJIH 2YAMA 1CS0B 1UT5A 1RU3A 4NYJR 4HSAC 4TRRA 4UT9L 3WLJA 5KZMA 3AKYA 3S6DA 1FCUA 2KZKA 4A04A 3K32A 2VS1A 4XVSL 4FFYH 2IZOA 1R3TA 1IRXA 3U30C 2AQPA 5EERA 3O2DA 3OI7A 4NK5A 5K9OB 3TQVA 5EOTA 2CIIA 2ADGA 3TJHC 2JIQA 5K2OA 5HJ2A 3AEQB 2QRMA 3SKUD 1BAGA 1XAHA 13PKA 1DX9A 4R4BA 7ENLA 4QFMA 3QNWA 1P45A 3OKDA 1TPC1 4MCZA 3DBXA 3IPXA 1V7PC 3FOCA 2LR0A 1Q1AA 2XINA 5FWDA 4GLEA 1D6VH 1Q38A 5BV7A 1JA1A 4PUUA 4B6EA 4ZX3A 1RXIA 1YB5A 2AR9A 1GAXA 4JPIA 1QFOA 4WHBA 5ADHA 2OBYA 2Y66A 4LHUD 2EDMA 3H13A 3D46A 4MXDA 4EF6A 2A79A 5HHPA 2V2TB 1MFPA 2DE0X 4GEGA 2Q4DA 2Z0UA 4B83A 3FKRA 3UTTA 2QFRA 5I74B 4OD3H 1HTIA 1WPRA 1NCUA 2LKDA 3THCA 1SLXA 4S1NA 2F8VA 4WW2B 1W5MA 4FB4A 2OZ4H 3CY6A 3O1NA 4M29A 4NDMA 2WPBA 2P9YA 4PQRA 5HYVA 1I80A 2AFHB 4DQ0A 2DKSA 3IO5A 3NT2A 4QYTA 3QPVA 4UUJA 2ZBFA 1M1ZA 3Q3JB 1JPJA 3A6KA 2A1UB 3B7YA 3RJMA 4BVHA 4DM2A 3E9DA 2YL5A 4ZXFA 1HQ4B 1DQDL 4F06A 3ADBA 3DVFA 1AZNA 2Y5SA 4POYA 3HI4A 4ZFOB 4AE1A 1GSHA 5CS7A 4PUWA 1QGYA 4RTRA 3WHIA 2APVA 4QS6A 1J8VA 3PSAA 2P65A 4MJ3A 5JJLA 1T9BA 3I6ZA 1NL3A 4FYJA 1EUQA 4RIRA 5ANME 2HQ1A 2Y7SA 4BFSA 4PE8A 3QN3A 3HXOA 4U5IA 3I0MA 2DAVA 3LU1A 4H44C 3KJ4C 3ANXA 3WFDL 4A3QA 3ZDZB 4Z78A 2G17A 4M6OL 1VC4A 4IIYA 4IBZA 1E2MA 3T7KA 4LKCB 3DI3B 4K7PX 1VYSX 4QYAA 4JZOA 2PGJA 4MX8A 3RG2A 4BK5C 5HHMD 4FLRA 2PP9A 4JFXB 2D5BA 4J9VA 1ZR2A 4XPFL 1ZH6A 1ZTXL 4C4KO 5K6RA 4PH8A 1PBGA 4UTBL 1OAUH 3SXJA 1GJPA 4GLLA 3VR3A 5EC2A 1NLFA 3PWSA 1T8TA 2HJSA 3H2IA 1RWKA 3QORA 3JQAD 4X0NA 3LAWA 2FZCA 4X0KB 1REQB 3F7KA 3RFZC 3IT0A 3VNLA 4W6YB 5LNUA 1U0NA 2CRMA 2FPLA 1I6LA 4DV2B 1WFOA 4QNNA 1VQ1A 4BKPA 1G3UA 4X20B 1UZ1A 3D1MC 4P5PA 2XG5B 3QUXA 1LJMA 1V9LA 2FSFA 3O4LA 3MIIA 4ADIA 4JT8A 2Z64C 5CFHA 1N4DA 1XX9C 1Z47A 1C7SA 3UJFA 3RT7A 5TTRA 4ETMA 4GM1A 3W7CA 4AVFA 5IB3A 3AB0C 3ZHBA 4LQ1A 1CY6A 4OGYH 3KPJA 2AFIA 1B5TA 2QZ5A 3GI9L 1FFPB 2HH0H 1N68A 4M5ZH 3HC7A 4LKXB 2B3RA 1SC3A 1UFQA 3B3QA 1RHHA 2X6CA 4LP4A 4AM0Q 2VQSA 2ZQZA 5BQFA 4GKJB 2P9ZA 4PWIA 1QF7A 5L40A 1KTJA 3BUTA 2P2YA 5GRUL 3T7AA 4W88A 4MAYA 5CBPA 1VG1A 2NNRA 3O8XB 1ZKAA 4G6FD 1HL8A 4HX5A 5AHLA 1EFVB 5FNVA 4JY6B 5C09E 4B7ZA 4X3OA 1FUYA 1B43A 1YNKH 2M2IA 3SO5A 3VBCA 2Z95A 4ONHB 5FI0B 4Q4QA 4FLQA 4AGNA 3ELWA 1L5HA 5BV1A 2DSKA 1BD0A 1P84K 2WQ8A 3SUTA 3SZ8A 3O2LA 5EORH 4DSOA 2CDCA 3B1XA 1MDTA 4OUUA 1PZNA 5IJZA 3UW1A 5D6DA 1X14A 4MEAA 2R8WA 3RI5K 2NACA 1QTYT 3OQRA 1CW2A 4D3XA 3WYRA 4CKVX 3QXXA 3EDQA 1CD0A 4M8QB 2E6AA 1GC1C 4RTLA 1CF1A 4MOZA 2YMMA 3G7SA 4RH1A 5LCVH 2OTUA 2WT4A 4NZ4A 1YBQA 4PR5B 1KJ2L 1NYQA 2XBLA 1XGKA 1MCSA 4Z0PA 5JXIA 4TLDA 1NW4A 5CTJA 2V33A 4KPHH 4UQDA 2G70A 4MVWA 3S3DB 4EAEA 1NUGA 3LOQA 1MB2A 4RPJA 5C8JB 2VXQA 2Y62A 1PZCA 3LWZA 5HQEA 3ZCQA 1INQA 5ICZA 1GNPA 4U2KA 2CXGA 3CH0A 1PWEA 2B9VA 4UNKA 5MP6H 2V8BA 3AG1B 1QK0A 3GLHE 5IV2B 5K33A 1BMTA 3SKNB 5DLMH 2H7VA 1CEEA 2IF0A 1V1MA 3BESR 3TB6A 5JASA 2YXWA 2V9PA 2AJZB 2AJ3B 1T8XA 1G7MB 3NGLA 1M01A 1KGDA 2JARA 4XMPH 4BSWB 4FKKA 2IMRA 1Q94A 1RP1A 2Y1DA 2C3GA 4KRYA 4LQ4A 3S8EA 3B2NA 3AZTA 1G4EA 2L82A 3N2TA 1X3LA 3ED5A 4Z1BA 4J1QA 3VI4B 2D4AA 1AK2A 2UUBB 1EP3B 3ZUCA 4OXXA 3IAM1 1EWRA 1W4RA 4O02L 4W8GA 3QCUH 2WUCH 3KFVA 2C7OA 3ICJA 3IMFA 1RT9A 5BQ3A 1CXIA 2Q6WA 3EXG2 3T3MF 4JKPL 3WFHB 3SBRA 3B34A 4Z7WB 2QT9A 4D8PB 4NVRA 1V3LA 4GL2A 1BV8A 1NMAL 2J3HA 3GMSA 1XMSA 3OO0A 3GGWA 3VRLF 2Q07A 3QQXA 4D0BA 4WOKA 5EIBC 3SFTA 3OBKA 4I77L 1G7QA 1L9QA 4JYDA 4WIQA 4U7SA 1WW3A 5ALDA 1WGOA 4APXA 4GACA 2JI1A 4KMOA 1V95A 5DZLA 4CFYA 3RX8A