4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
3BAXA 1PV2A 2BHUA 2G3NA 5IHRA 3CYFA 4DWSA 2DT3A 2AAAA 4OOZA 1V6VA 1C3OB 1PDVA 3BVUA 1GJUA 5D9PA 1W9VA 2GUYA 3SUVA 1EO7A 1E4LA 3KLKA 5HBFA 3U7BA 3W4RA 1Q2UA 3OB8A 1U9CA 1HTYA 1TZ7A 4W8BA 2EO7A 3FN9A 7A3HA 4K2HA 1QNPA 1OX6A 1SZNA 1JF6A 2ZUVA 1O7DC 4M81A 5BYWA 1GW1A 3UESA 3NORA 1V08A 4PN2A 1MFVA 5CJ5A 3SF8A 1SMAA 3SCOA 4D1JA 3BCDA 2ZX5A 4JFVA 3WH9A 1S1MA 1T3TA 2WNWA 2CHOA 3LMYA 1UWTA 4S3JA 2WC4A 5IFPA 5CSYA 3W24A 3MU7A 1HJSA 2ZUSA 3L4WA 1CXFA 3POCA 1EXPA 3IAQA 2VRJA 4D6IA 1FYEA 1Q6DA 5FKYA 1C30B 1VBRA 4RE3A 2J7BA 3AYRA 1N57A 1WE5A 1OIMA 2QLYA 4D71A 2QPUA 1K6AA 5KEZA 3DC0A 4PBGA 4AD1A 3N18A 4M24A 4HPGA 1JDCA 1G5AA 2AB0A 3AMKA 3R76A 1GGFA 4CVWA 2R1VA 3ARWA 1TA3A 3VGEA 3TTUA 4EAMA 3BUDA 2CXGA 4QYXA 4LGXA 3EJPA 3ARXA 4L7QA 1QHOA 1UG6A 1UZ1A 1QWSA 5JBDA 2DEPA 4UCFA 5A8OA 4D6CA 4OGFA 4I46A 2OSYA 2J78A 2W66A 5I5RA 2F7OA 5I0DA 3EJ6A 4Z2GA 5JZMA 1JI1A 1QDLB 4JHZA 2WW5A 1HN1A 4V28A 3VDBA 2ZOXA 1K9FA 1J12A 3FXYA 3ZJ6A 2Y8KA 1BVNP 2JALA 3ARYA 3MMUA 1JYWA 4P35A 2YA0A 5FD0A 4CU8A 1FP9A 3WUGA 3L4TA 5AC4A 1K9DA 2VRKA 3RIKA 3WDQA 4AIEA 1TA3B 3ALGA 5KZ6A 1GORA 3EDJA 4OJYA 4PCTA 1HWWA 2GJXB 3HG5A 1JDDA 2QV4A 4LPCA 3CNEA 1C3FA 5BROA 1E1EA 5DMYA 3WF4A 3PZTA 3FY1A 1WDPA 4D6JA 4J3WA 2RK4A 1XYFA 4K68A 5BXPA 1QW9A 1O7AA 3BGAA 2RK3A 3VGDA 1CGVA 3LPGA 1E6PA 4JIEA 2ZXBA 1M7XA 4AEFA 3AYSA 3SCQA 1CXEA 3OBAA 4AIOA 1B0IA 3IGUA 1KFWA 1CS0B 3BAJA 2FEXA 3W0KA 1R33A 1M6VB 1B1YA 1Z32X 3CUJA 3BCFA 1V0MA 1GHSA 4D6EA 1E3ZA 2A3EA 4DWSC 4MNLA 2Y4SA 1R7AA 3CUIA 3NDYA 7TAAA 3M46A 2A9VA 1BVZA 1QNQA 1TE1A 3BLPX 4UFJA 5M3WA 4P7NA 3A47A 1V6UA 3N1AA 5A6JA 3WNKA 1XGZA 2PWFA 2ZWZA 4BQ3A 1VF8A 3K1DA 3ARUA 2PB1A 4NI3A 2W4XA 3DYMA 4LRUA 4H7VA 3SUTA 3VIFA 4OQ4A 4GZJA 1GOIA 3I3BA 2XM2A 1H2JA 1BAGA 3MUZ1 3CHFA 2HVMA 1AMYA 3AHTA 3VU2A 1JI2A 3WH8A 5D8ZA 2R1TA 5BV2P 4WIWA 1P7ZA 1MWOA 2WMGA 3VPLA 2E9LA 4GI8A 1PZ3A 3VIKA 1GOMA 1LLOA 2VZVA 3HZ3A 4MJ2A 2OLHA 1IT0A 3D4ZA 1UR0A 1PEZA 3CH9A 3BAYA 5GQBA 3D51A 4ATWA 3AZRA 1CPUA 3WEMA 3WQ6A 1V3LA 3ARVA 5ABGA 4JCMA 2CYGA 3S6TA 2EQDA 4J3TA 2VX5A 2DPEA 2F7PA 2ZUUA 5HXMA 4UQAA 2V5DA 3MV11 4PYSA 4Y1GA 1W91A 3IAPA 3VD9A 4MADA 4DUXA 3WQ4A 4PRWA 1OD8A 4J3VA 1KQZA 3DDFA 4H8UA 5HPCA 1BSIA 5A8MA 3WD1A 5TD4A 1KCKA 1VHQA 3WNNA 5ABHA 1GGHA 1A9XB 4MB4A 1M53A 2X8RA 3IK2A 1ISYA 2VZUA 1MXDA 2V4UA 4LGYA 3CZJA 4FLQA 1UWUA 3TTTA 1KQYA 5ECUA 3BVVA 4LYPA 1PIGA 3VSUA 3MIIA 1QNSA 4MNMA 4JAWA 3EJUA 5A2CA 4TOQA 1TQUA 3GXFA 3PBGA 1QI5A 4UQEA 1I75A 2YJQA 1QX1A 2W5FA 3ZJ4A 3PZNA 2J7CA 5A94A 4RKWA 3CIVA 3ARQA 2PWHA 2Y5EA 4Z2JA 4UQBA 3D3AA 2DSWA 2VVSA 4AIUA 4L8FA 1NOFA 4H8VA 2V5CA 3PZMA 3DYPA 3RM8A 3SCWA 3UETA 1PDWA 3WNOA 2WHLA 2J7GA 1ISZA 1JNEA 4TXEA 5LIRA 3EJSA 3DHUA 5SYAA 1HL9A 4HOWA 1UWRA 3VGGA 3CZKA 4B16A 1W1YA 2Z1KA 3MUAA 1BFNA 2OW7A 3QOMA 4MJ4A 4PMZA 1BLIA 3POHA 1C7SA 1J10A 1IZZA 1CGYA 1NOUA 3JUGA 2GK3A 3L7NA 2WKGA 1E43A 1CGWA 4WKAA 2XWEA 3NOQA 1GHRA 3UR8A 3A5VA 2W61A 3F5JA 2VX7A 5E6ZA 1OX4A 1JVNA 1EIBA 1LG2A 1M01A 1XCXA 3VKKA 2WVSA 1E40A 1X6LA 1JFXA 1J0IA 5CPSA 2YWDA 1H0GA 3ZMRA 2VI0A 2WMJA 1KGWA 3BUBA 2J75A 4ACZA 1ZBCA 1GQJA 2YFOA 2PF0A 1E6RA 3ZM8A 2LXNA 2WMKA 3NONA 2AMGA 5E9AA 1JDBC 4BIMA 2X2JA 4GPNA 1JNDA 4XZWA 1KCLA 3WKZA 1LWHA 4ZXOA 2BNJA 2D3LA 4KGJA 1XD1A 3WQ8A 4WKFA 1KXTA 3BVXA 3VNZA 3ZT5A 1U30A 1J11A 1BYAA 1OX4B 3UG3A 4MTVA 2WPGA 1UR9A 3ER6A 3M3PA 2NV0A 3WD3A 4BF7A 2G41A 2J7EA 3ZOAA 3ZJ7A 1UWIA 4XZBA 3A3HA 3WUEA 1GGJA 2Y8VA 2YIHA 1B3VA 1JD7A 4CCEA 3PZUA 2BXYA 1LL7A 4JL1A 3TTXA 2YDQA 4UFLA 4GE3A 3QGVA 3VU3A 2W92A 3WL0A 2WVVA 2PWEA 3QR3A 4P8WA 1UKQA 3W6LA 5A95A 3RHTA 4MDOA 4ACYA 1FFQA 4S0ZA 1E1FA 4PMRA 3PTMA 1NWTA 5A69A 2EPKX 3D5HA 1GUVA 2DDXA 4H8HA 1FFRA 4NZCA 4OBSA 3UCQA 3EWNA 2XWDA 1E6XM 3N12A 4D6HA 3UOWA 4QLKA 5SY6A 1KXHA 4AULA 1MQQA 1H11A 4L4OA 1J0HA 3VMPA 5FOOA 1CGXA 2XFRA 3WH6A 1SY7A 1OX5A 2JIWA 1B3XA 1HXJA 1DTUA 3PZ9A 4AZ7A 2D1ZA 4F79A 2F1BA 2WHMA 2EEXA 5CQ1A 4PMYA 4P7OA 3FIJA 5I77A 1E70M 1EQCA 4YHGA 3AS1A 3CUFA 2CETA 1R47A 1T0OA 3LX9A 1NARA 3K46A 2WBKA 4F66A 4MNKA 3RMEA 2YOCA 1I1XA 2EXOA 1UD2A 3AS0A 3GXMA 3LPPA 3CGTA 3FHAA 4AUNA 1EDGA 1XC6A 4HZ6A 5A6BD 4GQQA 1ZU8A 2YFNA 3BLBA 1UWQA 2YLLA 1D3CA 3FAWA 4FNUA 4J3XA 2WBGA 5ABEA 4J27A 3WF3A 5EMYA 3EYPA 3GH5A 4IISA 4XLLA 3L18A 4FLOA 5A2BA 3F71A 2XVKA 4CD4A 3VTRA 4Z2LA 2YWBA 2GJPA 4TX6A 1E4NA 2WVVB 1VCNA 1WCGA 4R5EA 3D54D 1VEMA 1KBKA 4AYGA 3TTQA 1UR2A 3KE0A 1B30A 3O6AA 4A4AA 2UY4A 4P7QA 3IJ9A 5IDIA 4TVDA 1J9YA 1E3XA 1WKYA 3WH7A 3GH4A 4JKLA 5BXSA 2OW6A 1ODZA 2FYVA 1K9EA 2C0HA 1JD9A 4L8YA 1V0KA 4ENUA 4PMDA 3WBEA 1E5NA 4MDPA 4FNTA 8A3HA 2XN0A 3WELA 1OWQA 3MI6A 2CITA 2O9RA 1Q6GA 1QVBA 1J0ZA 1MXGA 3KLLA 1A47A 1E0VA 4ZE5A 1UA3A 2BVTA 1VAHA 4UFIA 4LX4A 3BC9A 2YL9A 4Y1EA 2OWXA 1TQSA 1CEOA 3VDHA 1BTCA 1QVZA 4JZ5A 1HP4A 1ISXA 1HJVA 3CZLA 1BHGA 3AQUA 3ECQA 1ISVA 3CV5A 3L4XA 4BTEA 1EDQA 4ADSG 1S46A 3GTNA 4W84A 3SUWA 1OSEA 1CNVA 4DUWA 1HF6A 1C8QA 4W8LA 4D1YA 1FY2A 3ARSA 4ATDA 2GK1A 3GXIA 4WSJA 2E40A 1A3HA 1NQ6A 4BQ4A 3GNPA 4FLRA 3R74A 4PTXA 5DO8A 1HJQA 3AIRA 1HT6A 4ZXLA 2X09A 3OZOA 4B40A 4P7RA 2RGMA 3W37A 1R85A 4GZEA 3EMQA 2ZUWA 4OFWA 1E55A 1EQPA 2XTKA 4ENQA 5JZOA 1P81A 1R34A 3PQ3A 2E0PA 1GG9A 3B36A 4I4NA 5HDRA 2ZUMA 4F9DA 3ZT6A 2YBUA 2D0GA 3VUPA 3P9QA 3CZSA 1BGGA 1WP6A 2OSWA 3K4AA 2VOTA 1ZJAA 4ZGGA 3W26A 5C70A 3L4UA 4MGHA 3UMMA 1UR8A 3BWEA 8CGTA 1W1PA 3CMJA 3P9SA 4UFMA 3T2PA 3WDRA 1UKTA 3CZEA 5CSUA 5FCZA 1GVIA 2VQTA 2VX6A 4QCFA 1QBBA 3OLDA 2HISA 3OIHA 6A3HA 2BXZA 1GPMA 2RK6A 4J3UA 4HMCA 4DO5A 1OBAA 3W81A 1UHVA 1G1YA 1WAWA 1DWAM 2PBOA 4PCSA 1V0NA 5DFAA 5LA0A 4KGLA 4P8XA 2WMIB 1MQPA 3WQVA 3WY3A 2GFTA 7CGTA 2XUCA 3UGJA 2IGTA 4BA0A 2D20A 4UZUA 4XUYA 1UQZA 2O92A 1GCYA 3VNYA 3AMGA 4MNTA 4X0VA 1LQ0A 3L4VA 2WSPA 1KGUA 4OBRA 3GZAA 3AMCA 3GBEA 3MS8A 2WM0A 4TTGA 1PS3A 2BY2A 3HMCA 3MSGA 1MW1A 2ISSD 3BXWA 3DX2A 1EO5A 4M56A 2FGZA 1Q4NX 3BSHA 4FNPA 2EACA 3CZ8A 4L4PA 4RE4A 1DWGM 5LYRA 3PTKA 1KXVA 3OG2A 4AZ5A 1ODUA 1D7FA 4GQRA 3P9PA 5E1QA 1NOWA 3BMVA 1KXJA 4AZIA 1MYRA 2F1AA 3L2LA 2EAEA 5DT7A 4JFWA 3EMZA 2X2IA 5SY9A 3FW6A 2C7FA 3W27A 2W91A 4AD4A 2DSUA 2BHYA 3BAIA 1ESWA 3P9RA 1E6ZA 2XSBA 4BQ5A 1HVXA 2GDUA 4ACZB 3RJYA 2ZXQA 1OINA 1EOKA 3AZSA 1IZYA 4DWSB 1V3KA 3WFZA 1KR0A 1OT1A 2VZOA 2VZTA 1BF2A 2C8NA 1CXKA 1K9TA 3ZIZA 1CECA 4GE0A 2R1TB 3M07A 2E3ZA 4HOZA 1B90A 2H2WA 4AD3A 1SYTA 3W28A 3GM8A 3A24A 3AXHA 3PZQA 3B3AA 1TVNA 1E71M 2VCCA 4MTCA 9CGTA 3BSGA 3J7HA 1JF5A 1HXKA 1FA2A 3CTTA 4FLSA 2NW0A 3W82A 3S2CA 4HCJA 1VJZA 1QHPA 2D0FA 1GVYA 2PWGA 3CMGA 5C8BB 4PMQA 4D1IA 1EA9C 4DO4A 5CLWA 3W29A 3MGKA 4BFLA 4DWSD 1GONA 2WB5A 4PMXA 2XHYA 5CXPA 4AMWA 1CGUA 4S3KA 3ZJKA 3PZOA 5A6AA 4RKYA 4JFTA 3OT1A 2CEQA 3H55A 1KEEB 1UD6A 1SR0A 2VCAA 5I2UA 1W3LA 1RPKA 1W32A 3B8SA 4L78A 5HPOA 1EOMA 1YHTA 4MAVA 1DWJM 4ZDIA 1MW3A 4B15A 3A4XA 1B31A 1NP0A 3GDBA 2X0YA 5IFTA 3PQ5A 3NOVA 1E4IA 4UOQA 1AQHA 4CU7A 3TTSA 3ARRA 4X0NA 1CBGA 3QHNA 1CXIA 1QF7A 2X05A 2J79A 4AZCB 1SFSA 3DX3A 3CY6A 1QNRA 4AC1X 5M5DA 3NSMA 3WMBA 4B9ZA 1CDGA 2CPUA 1FH8A 5C71A 3AHVA 5D4YA 3U5UA 3OZPA 1TFVA 1AQ0A 4BQ2A 3E1F1 1M03A 1JYXA 3BMWA 4XX6A 3N17A 3T2OA 3IANA 3RCNA 2W7TA 2WLYA 3GH7A 4PTWA 1ECEA 2BY3A 1OI4A 4FNRA 3B9EA 3MMDA 4C7DA 1R8LA 3MUIA 2G3IA 1US3A 4GO8A 1UH4A 4NRRA 4OGGA 2O9TA 3SCVA 4NSBA 1AVAA 1J0JA 4R27A 4R7GA 2ZX9A 5GNZA 5A8NA 3VIMA 4BCEA 3VGBA 1V02E 3CUGA 1GQLA 4KRUA 4HZ7A 4PUDA 4Q7NA 2ESCA 3IJ8A 2D24A 3SEPA 1O1YA 1TQWA 4GO9A 3FAXA 2D23A 2WC3A 1WNOA 1JIBA 3A23A 3VDCA 1KGXA 1ZS2A 2DSZA 4NRSA 1UKPA 4RL3A 3VIIA 4OOUA 2WWDA 5A6KA 1TVPA 4CD8A 1J0KA 2WAGA 1JYVA 5M03A 5I78A 3VSTA 4MNJA 4TUFA 1KTCA 2PI6A 4UR9A 4AMCA 1QWNA 4AMXA 2XVPA 3EDDA 4M80A 1FHLA 4I2NA 1L9XA 2EPLX 4E8DA 1JZ5A 2DIEA 1CE8B 3SURA 3ZJ8A 1ZBVA 4NXSA 4LYRA 4CN4A 2WKLA 2VUYA 4JHOA 3N15A 4EK7A 2BVDA 1CIUA 1HKKA 1IPHA 3BUPA 4J7RA 4TTUA 3AHXA 1JYNA 3ZR4B 1BYBA 1HNYA 2VPIA 3AIWA 1G9HA 3TTYA 4HA4A 1WDSA 1TG7A 3TONA 3ZSTA 5EFDA 1C93A 4W87A 2OSXA 4ENPA 1XHGA 1EH9A 1P6WA 2ABWA 4MPKA 2IUFA 4W8AA 4P36A 1WPCA 4W7UA 5EFFA 3AROA 4U3AA 1I1QB 4X9YA 1QHZA 4ATLA 1V3JA 1OGBA 3WF1A 1V02A 3SCPA 4MAZA 3NUKA 3WBAA 3BAKA 4U5IA 3WF0A 1QNOA 3A4AA 2ZX6A 4W5ZA 4P34A 5I6SA 1E6QM 3SOZA 2QF8A 5M17A 4HZ8A 1B3YA 4ZE4A 3UR7A 1LJYA 2DGAA 3WUBA 4ENWA 2XN2A 4YHEA 3AISA 3DYOA 3T2QA 1OGGA 4IM4A 3N11A 4N0MA 4M29A 1L0PA 2OWCA 3U7VA 2BV9A 2WWCA 2J47A 4HMDA 3FHQA 3TOPA 1V6WA 3H54A 2WMFA 3NOOA 5AC5A 1R86A 1WZLA 1WO2A 2XF2A 4CU6A 3UG5A 4W7VA 2VURA 1MW2A 3OLIA 3SCUA 1B9ZA 2CBUA 1JDAA 3LXBA 2FHBA 1UD4A 3OLEA 3CZNA 2ZIDA 1AQMA 4U2ZA 4Q22A 2O9PA 4OKDA 3GNRA 3AS2A 2DH3A 1TMQA 1GZJA 4KH2A 3NYDA 3AHYA 2XJ7A 1VCMA 4AD2A 1J0YA 5LA2A 1CLXA 4GINA 1XSKA 4UQCA 2DSVA 2A3AA 2CNCA 1V3MA 3KL5A 1JAKA 2WSKA 3IJ7A 1WZMA 2MANA 2VZSA 2VCBA 4N12A 3BVWA 1VB9A 3EJRA 2XG9A 3WNMA 1E6NA 5EB8A 4FK9A 3KKLA 3A4WA 4CCDA 1CGTA 1DWIM 4AJ9A 3ZT7A 1BYDA 1JZ8A 3BLKA 3CPUA 1LL4A 2A3CA 4AY1A 3THDA 2XFFA 3AS3A 4JKKA 2NT0A 3HG3A 1GGKA 4IPNB 2NV2B 2ZX7A 5DF0A 3TTVA 1ITCA 1PX8A 5I23A 1W9PA 1E5JA 4CN1A 4YPJA 4EKJA 4XV0A 3AIVA 3TV8A 1G2IA 1PX4A 3HG2A 4U5KA 3DDGA 1I7SB 2W67A 1GOQA 2BFGA 3BAWA 4ENVA 4UQDA 2FH8A 1VEOA 1H1NA 5CG0A 4CCCA 1JAEA 3EJTA 1H49A 1CYGA 5IXEA 3VOCA 3PZIA 3N04A 2DH2A 1E6SM 3VIOA 5ABFA 4LQ1A 3M7SA 3BUIA 3DX4A 1BG4A 1D2KA 4NZFA 1Q6EA 2Y24A 1VCOA 3VGFA 4H2CA 4W89A 4WF7A 2XN1A 1VIWA 4JCLA 1XSIA 4ZFMA 2CHNA 3HU7A 3KZSA 3UEQA 2VTFA 4ENRA 5A8QA 1UKOA 1HIZA 1JXKA 2E8ZA 1J18A 2CIPA 1EHAA 1OD0A 2VC9A 3MMWA 4AUEA 5CPTA 4HMEA 1GPWB 1XSJA 1P7YA 3UK7A 1UH3A 2JFEX 4LXFA 4TX8A 5I79A 1ZBWA 3AXIA 3GNOA 5A3HA 3EDFA 3F5LA 4OUEA 1UCFA 1BQCA 1C8YA 5DEZA 1GPFA 4UTFA 4Y7EA 1W3HA 3CBWA 4WINA 1IV8A 3VO0A 1QVVA 5A6LA 2J7FA 2WMHA 2YLAA 2J25A 1BGAA 5A8PA 2B31A 3TTOA 4J28A 4W88A 2WCGA 2XSAA 4WSKA 4URIA 3AIQA 4B2YA 3W6MA 5CGMA 1C91A 3G6MA 3GXDA 4CD6A 5E0FA 3AI0A 1J42A 5E0CA 3EFEA 2GVYA 5GNXA 1DWHM 2QHAA 3T08A 3D4YA 3RILA 2OYMA 4UNIA 3QHMA 3WQWA 1UWSA 1FH9A 3VILA 4B31A 1NP2A 5D9MA 1EGZA 2UWFA 3AMDA 3T09A 4P7LA 4AZCA 3WD2A 1MW0A 1OCQA 1GOKA 2CCRA 1W2VA 4Z2KA 4NF7A 3DX1A 3OGRA 1CZ1A 4D6FA 2Z1SA 1Q7RA 1H3GA 4MB1A 2EBNA 4GUDA 3CZ9A 1I7QB 3UERA 3VD3A 2CERA 4UFHA 3I3EA 1C8XA 3VIHA 5HOSA 4BZYA 2D0HA 3WEZA 3I3DA 1CTNA 2EPNA 2DSKA 3PHAA 4A3YA 1KA9H 4E2OA 3GBDA 2YBTA 3KL3A 1PPIA 1XRVA 1UZ4A 1H41A 2RGLA 1X6NA 4P8VA 2J62A 4F8XA 3B9DA 2YDRA 2WCAA 3AOFA 5AYBA 4HP5A 1VFFA 1JXJA 4D6GA 3KL0A 2YA1A 2WHKA 4NXKA 5BCAA 2D22A 3WQ5A 3VGHA 4JL2A 1PX3A 1QI2A 1GQIA 1UASA 1R75A 2TAAA 3EDEA 2JE8A 4F9JA 1J01A 1F4AA 1JZ2A 2QPSA 2CBIA 1XV8A 1UD3A 3RO8A 3PN8A 4OGZA 1RP8A 5JBFA 1R46A 2V3GA 4U3CA 2GK1B 2DT2A 4D72A 2YWCA 1H09A 2IXUA 4PEEA 3PQ7A 3AJ7A 2E9BA 2D3NA 1WL8A 3WUFA 3AICA 2ALWA 4PTMA 1NWUA 2VMFA 1QVWA 4ZDJA 1WZAA 3ARTA 4WKHA 3VX0A 5AY7A 5FL1A 2YKKA 3WEOA 2G4FA 3OGVA 3WIJA 4OZOA 2E4TA 3WSUA 2F18A 2V3FA 2CESA 1WDRA 4QYTA 2VO5A 1XH2A 4ZEPA 3TQIA 3VM5A 1QBAA 1EDTA 4P2GA 1RP9A 1V0LA 1ZBKA 4B7AA 3GXNA 3N7TA 1US2A 2DT0A 4MB3A 4DUVA 1UH2A 3PQ8A 2GJRA 4U33A 2X0HA 3EDKA 1LF1A 3DECA 1QI0A 2DT1A 5JIPA 2YL6A 3RDKA 5ABFB 3QOKA 4TVUA 1VBUA 2J8FA 5D9OA 3RPMA 3WN6A 2F61A 5I24A 1W1TA 1OB0A 1HX0A 3CZGA 5EBAA 1HL8A 3S5YA 3S5ZA 3OLGA 4QFUA 4NZJA 2OYKA 4C7FA 3R75A 4EE9A 2XIBA 5CZKA 1BYCA 4PMUA 2JIEA 3QHOA 3RM4A 2ZE0A 1JL8A 4AZBA 4WLCA 1LL6A 2A3HA 2EPOA 3PQ6A 1H0IA 4PMNA 2F7QA 4AD5A 4DO6A 2VJXA 1CLVA 3D50A 4BS0A 5BWFA 4W85A 3WY1A 3F5KA 2XVNA 3EJQA 1Q6FA 1TCMA 4B3KA 3AXXA 2WCSA 3MUY1 3AIBA 1OM0A 1NWSA 3WF2A 4AZGA 5D8WA 2XVGA 2G8ZA 2O9OA 1P80A 3WNPA 4OIFA 3SCRA 4UFKA 5FL0A 4FF5A 4HA3A 1W3JA 3HJEA 5I3DA 3CZAA 3A21A 2D2OA 2ZUTA 2BY1A 3UG4A 1HJUA 3F4VA 1E73M 3U57A 2VKTA 4IUGA 2ZWYA 3WL1A 3OT1B 3ZR5A 3W38A 3N9KA 1T36B 2VRNA 1H4PA 3O2LA 3VD7A 3ALFA 1GGEA 1UD5A 2YL5A 1G01A 3BH4A 1XH0A 2J77A 4AXNA 1TR1A 2BHZA 4WJXA 2CBJA 2E8YA 1KB3A 2G3JA 4E8CA 4E4PA 2WANA 2FE0A 1H5VA 4W5UA 3MANA 3CC1A 4RE2A 2ZXDA 2WYSA 4UOZA 1W2PA 4HTYA 2DQXA 4GIAA 5GNYA 2D7JA 3APGA 1F4HA 1PBGA 4MB5A 3M6DA 3VINA 4UZSA 1O6IA 4Z2HA 1CENA 1PJ9A 3WNLA 2V3DA 2JF6A 3AIEA 4LYQA 2QMKA 1FH7A 2NT1A 2X1IA 1KWGA 4U2YA 1KR1A 1XYZA 3FSEA 3WDPP 3ZJ5A 3VIJA 4AEEA 3MKKA 3GRAA 2V3EA 2X2YA 1W9BM 1R7OA 5A1AA 1U2YA 2WXDM 4FMVA 3BUQA 4CGTA 4PMVA 2EPMX 1OT2A 5AYIA 3WH5A 4HU8A 2XVLA 2IXVA 3VVGA 1KBBA 4C7GA 1UQYA 2PWDA 3L3BA 3VIGA 4P8UA 2VNCA 2A3BA 6TAAA 1PAMA 1T0BA 3SUSA 3HG4A 1MFUA 2X2HA 3W25A 3UJNA 3GXTA 2J7HA 1QI3A 3NIYA 3OA5A 4UQ9A 2BVYA 3ZO9A 4CD5A 3SF8B 4DM1A 2ZX8A 3PTQA 2VX4A 4W86A 1JFHA 2OYLA 3WDHA 4L8WB 2W62A 1TQTA 5F7UA 3RJXA 4J3SA 1XH1A 2WZHA 1VEPA 5HNNA 1UYQA 3ARZA 4D6DA 4N42A 4KRTA 1K9VF 3CO4A 4Y0NA 4NX0A 3TP4A 1GOOA 1CF9A 2WZEA 4EANA 1ISWA 4V27A 4AZ6A 1UR1A 2XGIA 2UY3A 4DM2A 5BRQA 4AW7A 4IPLA 1C7TA 1JZ6A 1W9DM 4AYSA 4M8UA 2AD5A 4Y1RA 4WXYB 2AOSA 1OGSA 3N13A 3K8MA 1E9LA 1TUXA 2CKSA 3NVAA 1SMDA 1GNXA 2F8QA 5DT5A 1B3WA 4KMQA 3NCOA 3K8LA 1QPKA 4Y1RB 1ZB5A 4ENTA 3CLWA 4U31A 3VD5A 1JZ3A 3RM9A 1VFOA 3B9AA 1DHKA 1X1NA 3WD0A 1E0WA 3GXPA 2BY0A 2XIIA 5CGTA 4GI9A 2VQUA 4PMOA 3VIPA 1VFUA 3U5YA 3O9NA 3G6LA 4Y1FA 5SY4A 4UOJA 1NWRA 1FHDA 4QLJA 5A6BA 1BG9A 1V3HA 1M04A 4AISA 4JQSA 3AMLA 1NH6A 4KWUA 3KEHA 3VX1A 1JZ4A 1GJWA 3VSVA 1WB0A 1DEDA 1YQ2A 4E08A 1KXQA 4V2XA 1E56A 4AUMA 2EADA 1UUQA 5CLTA 3WY2A 4CUCA 3PZGA 2BS9A 1BXRB 3B38A 3NSNA 3L2MA 3ZQ9A 2VRQA 1UD8A 1HP5A 2FDMA 3MO4A 3F5DA 3W53A 3WENA 4B9YA 3ARPA 1VFMA 1W9XA 4TVCA 2R1VB 3PZVA 3SCNA 2VXOA 1I1WA 3K4DA 2YL8A 2R1UA 5E70A 4W93A 1ITXA 4WK9A 3A6OA 3H53A 2WK2A 5BXTA 3T0BA 4E5VA 2UY5A 4XB3A 1UOKA 1HKMA 3VM7A 3ZR6A 2ZUNA 1V3IA 4QP0A 5LA1A 2VR4A 3DHPA 4M82A 1BPLB 2JF7A 1XD0A 1ONSA 2PC8A 3SUUA 2Y2WA 4PSRA 3HN3A 1E4MM 1FOBA 3THCA 2G3MA 2XM1A 3LXAA 3LRLA 4H04A 2GSJA 3T0AA 5A2AA 4HPHA 2XGBA 4YN5A 4GKLA 4PUEA 1B3ZA 1XCWA 2WHJA 3BHNA 4QAWA 4ENSA 2D73A 1G0CA 3LXCA 1KTBA 3AIUA 3EBVA 1B2YA 3OGSA 5A6SA 2IUZA 1PZ2A 1FP8A 1PIFA 3EZGA 3SCTA 1UA7A 3VDAA 4W7WA 3CHDA 2XFYA 3WMCA 2OR3A 4JKMA 3EMCA 1CWYA 1MVYA 2YA2A 4Z2IA 1DP0A 3AFBA 4GZIA 3SIMA 6CGTA 3KWXA 4B3LA 3TTWA 1EHNA 3WDJA 5IHSA 2VL4A 4FNQA 2Q8XA 4FNSA 4PTVA 2F7RA 4HOXA 1KWKA 1W9UA 2WMIA 2PBGA 3L4EA 3BVTA 2J4GA 1OY1A 3D52A 4CD7A 4N0RA 1E72M 3VMOA 3GYCA 1HKJA 1N82A 3FNDA 1R87A 4JFUA 1CXHA 1GQKA 1P5FA 3WD4A 4CKQA 1JG9A 1OIFA 2V38A 3WFLA 3AHZA 3LPOA 4H41A 3NSXA 1HVQA 3PQ4A 2WLZA 1QWUA 3SCSA 4PXYA 1JZ7A 1ZL1A 1W3KA 2XPKA 3L4YA 2E9MA 5E09A 3A22A 5FIPA 4ZENA 1HJWA 3WY4A 1PE0A 4AZHA 2WC7A 2VDJA 3K8KA 4JFSA 3T0DA 2FGLA 4ML4A 2OWWA 1MQRA 2WJZB 2EJ1A 1QI4A 1QOXA 2FH6A 1WZKA 4L95C 3VMNA 4GI6A 2J74A 3AZTA 4GXPA 4QDMA 2GJXA 3WMSA 1LWJA 2JEPA 1VENA 1DWFM 3II1A 1UKSA 2DIJA 3L4ZA 1Q6CA 3CUHA 1VRXA 1WDQA 1W1VA 3CHEA 4PSPA 1GOWA 1U33A 2WVUA 4QCEA 1V6XA 1ZJBA 1JGIA 1CXLA 2J8GA 4CN6A 3NJ3A 5JUVA 3NDZA 2XYLA 4P5PA 2GHRA 5IP5A 1RH9A 1R9GA 2F2HA 4HA1A 1E0XA 2YDSA 1IZJA 3VD4A 1RD6A 1HKIA 2CBVA 5D9NA 2UY2A 2NSXA 2JEQA 2QMJA 5JBEA 1LG1A 3DX0A 5BXRA 5E6YA 3MV01 4M1RA 1TQVA 5CPQA 2YWJA 3CHCA 3ZSSA 3LRKA 1C90A 4AD0A 1E15A 1V03A 1IZKA 2WZIA 3MSDA 4A3HA 4QLLA 4AWEA 3LPFA 2ZXAA 1UR4A 1VJSA 4ZDKA 2VT0A 2J7DA 2GDVA 1C92A 2VR5A 1V6YA 2WVTA 1NM9A 2W63A 2EABA 4HU0A 1QW8A 1HJXA 3PQ2A 2ZICA 3LRMA 2FHCA 4CVUA 2VVNA 3WDIA 5A6MA 2FHFA 5BRPA 3TA9A 5JIWA 1G94A 4B5KA 1SOAA 1L8NA 3EN0A 5K4AA 2CKRA 1Y7VA 5GPRA
chains in the Genus database with same CATH superfamily
1WTLA 2WQXA 3OE5A 3HKCB 5JHLL 2GHQA 3KEQA 3AWDA 3ILEA 2VWTA 4OOZA 4YCCA 4R90L 2QX7A 1VGKB 3JQAB 4MKSA 4UB0H 3C43A 1QK0A 4EUPG 4P3WA 1J4EA 1WW8A 1U9CA 2DBZA 2ZB3A 3GCDA 4NAEA 4ESHA 4F7DA 3U17A 1JF6A 4BGUA 3WKML 3X14A 3AKZA 2ON6A 2ZT9C 3NORA 1V08A 1R3UA 3VNQA 4YJ2B 1DEEB 2BFVL 3LKRA 3N42B 2HA4A 3DXAB 1B6SA 3SCOA 3LCYA 2DWUA 2QKSA 2B0MA 4NLAA 4JZJB 1X7HA 3DFPA 2GS9A 2MOGA 4L15A 3VC1A 4MQBA 3FTNA 1EEZA 2G5TA 1FYEA 5LBVA 3GUCA 4BRUA 2AV1A 4RE3A 3WIFA 1CJTC 3B82A 2AG1A 2GTHA 2QLYA 4LVNB 3CTPA 1GTZA 1U36A 3M43A 1SQ2N 2NW2B 2YO3A 3E9QA 3I6LD 2V1UA 1G5AA 3E23A 2DPLA 4LVCA 1A2QA 3AMKA 2QVIA 3O7UA 3L92A 4FRWA 1T8PA 4PGAA 5SWQB 4KAAA 5IUKC 4FQXD 4O52A 3QUCA 4KN6A 3ESPA 3V6FA 4FE4A 1QWSA 5LP6C 2AUMA 4LYGA 4UCFA 2X4GA 4WKZB 2CXTA 1W8SA 3IDZA 3UH1A 5H1YA 2FGJA 3VR3D 5GGVY 2XYQA 4IL5A 2WZMA 2Q1XA 1AXIB 5BUPA 4Z2GA 2YK1H 2GAAA 3MK31 2C7OA 3N85H 4YMZA 5FNVA 4EVZA 5AK0A 5A4MS 3GN2A 3MMUA 5A1TA 1VKXA 2VISA 1B0PA 2ZIXA 4FTVD 4PYOA 1B74A 1K4DB 3H3PH 2Z1DA 4LVOA 2AZUA 2Y66A 4U1IB 1AT1A 3NEYA 2ZAHA 1NA8A 4DP7X 1IBKB 3UXHA 1QH9A 1UDAA 2ADAA 2QV4A 3D6MA 1J5SA 4L9YA 2CA3A 5DMYA 3WF4A 5CPLA 2DV0A 2J20A 2Z4RA 1IG0A 2C2GA 2HJVA 5TXGA 4YT2A 4IRXA 4JC4A 3UWEA 1N59B 1ZA3A 5FUOH 2GAJA 4H9VA 3K1ZA 3MS4A 2RGBA 5E4EB 5AAMA 3GVQA 2RGNC 4AIOA 1B0IA 2C2MA 3K1GA 1SCJA 1OFAA 1ESEA 2PKYX 3CPJB 4KQNA 4LCYA 3TS1A 3VR5H 2D3JA 3G8CA 1L8XA 4XPGL 3AU1A 4ZUTA 1RJRA 2XTJC 2RBEA 4AWAA 3H1TA 4AF0A 2O2YA 1J8HA 3ANMA 4P0DA 1NDZA 1UM4L 1QHSA 1RQXA 1R7AA 3MJFA 1R8XA 5DRXB 1A5OC 3AG6A 2A9VA 4LMBA 5KTMA 5EGRA 3DE6X 2P27A 5TQVA 3AGQA 5HX7A 2H8XA 5D7HA 2VJKA 1XF5B 5EPUA 1T0NA 3D6FA 2PB1A 2EG5A 2ZANA 1NLBH 3HYCA 5KVQA 1MHCA 5DD0L 5EIQA 1XRFA 2C1IA 3VIFA 3AWIA 2NQLA 4YXFA 1T4KB 3I3BA 2NVDA 4F4JA 2KLTA 4XWGL 4PLOB 4HVLA 1F12A 2UXTA 3LWBA 1V6SA 3HUTA 1ZTXE 5AKSA 4RZCA 3ZTEA 1CEYA 1RHHA 3TCXA 3SWWA 1VFAA 2BJWA 3QAZB 1AQKL 4MZRA 2FYTA 2P79A 4D4IA 2IYPA 1YMHB 4L29B 3C6LD 4P5TA 1SY6A 1UR0A 3HI5L 4CKXA 3VI4F 221PA 4CNUA 1JNHA 4POUB 3WEMA 1YKSA 1IWOA 2E9IA 3B34A 2H3HA 4KHXH 2QUZA 1DBMH 4A6PA 3KTSA 4GX0A 2ZUUA 5GONA 1EJVC 1CDYA 3E7PA 2ZUQC 4LSSL 1UQSB 4S1QL 1TT6A 2VM8A 2CGZA 3AESB 2CMHA 4N5IX 3R4DA 1OD8A 4QM6A 1Z18A 2WZ0A 4ZU3A 4J3VA 1YR6A 2JF0A 5F3WB 4HDOB 2QLMA 5AZ2H 3GF8A 4HAKA 3DDZX 5EG5A 3TZVC 4M1EA 4XCCH 3ZTTA 1R6DA 4NVTA 1NDMA 4R9OA 2L04A 1ZCFA 4UNTA 1XXFC 4U4MA 1Z0ZA 3AL3A 2FWSA 1HE1C 1PS9A 2HIMA 3SN1A 4U10A 4ZMVA 2Q2OA 1HBJA 4GSLA 4FLFA 3OG9A 4BJ5A 3LG2A 2EUVA 4F0MA 4JX9A 2I5PO 2ZATA 1IGCL 1VMDA 1QNSA 2UXFA 3ZDZE 1U8XX 2O5ZL 1KQNA 2XJLA 2V5LA 4MMYB 1P5UB 4PWJA 1YASA 1WFTA 1QX1A 3N59A 3FS2A 1V4VA 4YH6A 2B4AA 5DN6A 4HPOL 1X6UA 4BY3A 4RXUA 4LF1A 2FW6A 4BNXA 3G1HA 5HNRA 3DXIA 2K8MA 1U8IA 3KK0A 3HE7A 1XVVA 5T3XE 3X1GA 2CJWB 4F0HA 4G9BA 2ZYWX 5BWCA 5K0GA 4HN4B 3VFDA 5FM8A 2O55A 1VHDA 1UWRA 5JRZA 5BV1A 1O66A 3DWTA 3BKMH 3NACH 4G1MA 5IG2A 3HG1D 3IJLA 3ELYA 1G0DA 4JKPH 2QT9A 3KLHC 2XT0A 1W72H 4CQ9A 2AX3A 4IQ8A 2XWEA 1YCGA 3D7LA 4W6YB 1CCWB 5GGSA 5DC2A 4JJAA 4UARA 3VFMB 4F5DA 4S3CA 1RXVA 4H88H 2BR3A 4DEFA 1W48A 4D0SA 1PFCA 1V5IA 1NCBL 4MLRA 3D7MA 1SKBA 4XAPA 4N8SA 3FU9A 1C4OA 4ACZA 2WQ6A 3N1GC 3X2QB 3SQRA 4WL0A 4OZFG 1XSOA 3KCPA 4BTVA 2I9TA 4IMPA 2LXNA 2X2JA 3D3FA 4GY0A 2WMYA 5EN4A 3OJ2C 2O3UA 2ZJSL 4RWZA 3DX9B 2WXRA 4IDCA 1UPUA 1YNYA 4TSAL 1XD1A 1GYAA 1J96A 1JYFA 1Q3TA 1QUNB 5F23A 2J0QA 4DOHB 1FQ0A 3UG3A 1GW9A 4AW4A 1RYFA 4NP7A 2QTVB 3K8YA 4KR6A 4CILA 2REXB 4BF7A 1PS0A 4I3HA 2G41A 5D8JH 1EJ7L 2J7EA 4HTFB 2HLAA 2Y1GA 1HFKA 1N8WA 2Y8VA 1D5ZB 3WUWA 2YDXA 3LEVH 3LHKA 4BRWA 3HHMA 1AUXA 3OPVA 3HCBA 3GEDA 4L3EA 1MHCB 2OM6A 2FUG1 3L5KA 3SDBA 5D05A 1I8TA 5D55A 1AQDB 3QTTA 4P8WA 3A6FA 1RHUA 4MCHA 3GJFA 1QO2A 2J7PA 2RGDA 3LTVA 4N5DA 4H83A 3N86A 4HQ0A 3WJXA 2W79A 4H59A 5K51A 2DLTA 4UILL 5KSOA 1UXLA 3LYRA 2BCJQ 1K3FA 4D79A 3GQFA 4FG6D 1DEKA 3KVMA 5PTDA 2R82A 4AZ7A 2Z4QA 3F7VA 3P40A 2QDEA 3SCMD 3QLDA 1YOVA 3EG9A 4PMYA 2ZCUA 1ZWIA 3FIJA 2I25N 4X8JA 4ZUVB 2IADA 4YHYB 4F1WA 2QUNA 2FK8A 3SEQA 1CDEA 2BE9A 1Z0UA 4G8IA 5BUCA 4NBUA 1BE0A 1JGLH 4DBDA 3EUDA 3JTTB 2ZBPA 1EX0A 1M2JA 3MYPA 3CGTA 1QABA 2MJWA 3CUPA 3WLWD 3FHAA 2M32A 1L5ZA 1QK4A 5J1SB 1NFBA 1F5WA 4UT7H 1QVRA 3M82A 1Z3IX 3IP9A 4GBXB 4GW1B 5B1SA 5FGRA 2R4SH 4LHUA 3F71A 1ZALA 2XC8A 3VI3F 2XB9A 1U2SA 3L01A 2RHTA 5TH2B 1KIRA 1SWVA 1M34E 2B37A 3K2MC 2NNWB 5DHYB 3WRXC 1MF2H 3HPXA 1GNRA 2O20A 2FCBA 3LOWA 4R81A 3N40F 5TIIA 1XICA 4OL0A 1F51E 2PFKA 5IAEA 2WF9A 1T3FA 3RT1A 4QA9A 1ODZA 1QPRA 3IARA 5LSMA 1LLAA 5JNRA 1JD9A 1WE2A 2CO1A 4POZC 2GEJA 3G02A 4HXBH 1V0KA 3GSQB 3H2GA 4ENUA 2TYSB 4O5LL 3BPNC 2R60A 4K2UH 1AL8A 2PMKA 2MR6A 2QQKL 5E3HA 1AK5A 2CITA 1NFDB 3CUZA 1CI1A 4JB9H 3DDNA 5BPPA 2R9HD 1EEQA 3SGUA 5GS0L 2C5AA 5I15H 3MVEA 1FU7A 4KU4A 4F7CB 4XGZA 4D94A 1DV2A 4U1HB 5K3FB 5C0OE 5ACZB 1QVZA 4KFUA 4HN4A 3CZLA 5LXTB 4C6FA 1NVFA 1EDQA 3E5MA 1UK8A 4M22A 3SUWA 2LR4A 2NSDA 2XY4A 2X42A 1JI0A 4XN5A 4DMMA 1Q3NA 3QZWB 3RVLA 3ROLA 3QS3A 1Z5ZA 2XHNA 3JWNH 3PF3A 4H0IA 1M73E 1Y65A 3WKCA 3WBXA 1K8DA 2FYMA 1L0XA 4YQXH 4E9WA 3PXHA 4FIQA 3KFLA 3WLTA 4D8AA 1QO9A 1KBJA 1P9WA 1NQ6A 3H87A 1JZEA 4WUUA 1M7IA 2Q28A 2NTNA 5EIWA 5K1JA 3AREA 4OCMC 1Z7GA 4BNWA 1FNNA 3JARA 1ACJA 1HINL 4G42A 3JU3A 1GJPA 4PSDA 1Q72L 3A6CH 2F2KA 4AY0A 2WT4A 4FYTA 5AL8A 3O4OB 4PLPA 5EWMB 2ERJB 1QLHA 2IBZX 3BOFA 1UC8A 3ZGHA 3E53A 4CMHC 4ALAH 4W63A 3HE6A 2WV8A 1E0OB 3VC6A 4X7BA 1A5AA 1I3KA 2FJHB 4PRDA 4U6YA 2BFDA 3H7VA 3HJBA 3I6ZA 2FEDC 2J2ZA 3W26A 3FOWA 3TOSA 1Q8MA 4IIQB 2G97A 4EPWA 1S8DA 5EU5B 3BWEA 3LLVA 5JSUA 4WN9A 1OIOA 3I9OA 4L8BA 1LQSR 1M7UA 5FLKA 2FX2A 3C6CA 1J33A 4JEJA 5DMJB 3ENLA 2WFMA 1KS9A 1C5BH 3A31A 5FUCC 2E48A 2YS7A 1E2JA 2OMUA 5DFAA 4U9UA 4DCGA 3ARBB 3TCXB 4R7NA 1PHRA 4M8NE 3QKEA 1W5SA 4AQOA 5K0JA 1JHQA 3MO1A 3TVDA 3D7NA 32C2B 3EOAB 1HKHA 1BHO1 1EE9A 2Y5TB 4WUKL 2EWMA 2IPUG 1DQDH 2Z6IA 1U7ZA 3L4VA 3LB0A 2OLEA 2G0LA 3FR7A 1QAQA 1KEZA 1W96A 4PEVA 2J4DA 3BZBA 2ISSD 5KSAD 1RHMA 5D6CA 3P02A 2E09A 1HNXB 3KYAA 2GSWA 2GEFA 2ZB4A 1KXVA 2Q7OE 2I71A 2WQRA 1E5LA 3IEPA 1W0YT 3SQOL 3R0QA 3MROA 5KOHA 1EUZA 1IGIL 3DO7B 3H22A 4FG6C 2VMJA 1NQOA 3FB5A 1Z5UA 2X2IA 1XQXA 4Y0AA 3T3MF 3HPLA 4TTRA 2GOYA 3DAOA 1XCJA 1A4JB 5J4MA 1BWWA 2XSBA 1U8MB 4TOYL 4A7UA 1BS2A 4NH0A 3IIZA 1UBFA 4TRJA 3QZLA 1GNSA 4UUPA 1DBQA 4WDTA 4AQAB 2CUNA 4MS6A 2YBEA 2BHNA 1PZMA 1OZMA 1TT7A 2DR3A 2VLRB 2XMGA 3OJXA 2NUYA 3ALPA 2CLZA 3W28A 4X60A 3VR5A 3A36A 4KPUB 4QRHA 5JCOC 4GSXA 3AXHA 1K7FA 3H4TA 3TKLA 5EORL 5J11B 3LDVA 5JHAA 4MTCA 2TPSA 1JF5A 5KNBD 3SHWA 1R3KA 3Q40A 4LAFA 4XYBA 3V95A 2NY2C 2ERJC 2G3XA 5T3XL 3H4IA 4I4TF 1XMOB 4XNMA 5IFAL 3SI7A 2PP0A 2IFFH 1PG7L 3R8CA 2D7DA 2IJ0C 3LOQA 1QLEB 1M7DA 3CZFA 4HUTA 2F53D 3WTYA 3N0VA 2JJ1D 3Q7SA 4XP4L 1GP2A 1JCYA 2OHFA 3ZY4A 3OT1A 2J4CA 5KWSA 2ZTMA 1SR0A 1RQRA 3GJ6A 1X9UA 2E27L 3NEOA 4PYIA 4GKSB 3DJ9A 5ETUB 3MREB 5JR1H 3M6UA 4HEQA 4UINL 1OB5A 3ZCSA 3FIUA 3G0XA 5D2LA 2EXXA 1BREA 4G65A 2CO4A 4K40A 4L22A 1KCBA 1WHSB 3GJTA 4A92A 1J8HE 1P7HL 3DMGA 4N65A 4CU7A 1EO8H 4X99A 1G4HA 1BX2A 3P2DA 4NHVA 1VKJA 3CM4A 1JCJA 1RRPA 1I51A 2QUBA 2ADOA 2E46A 2XA9A 4UMCA 5IR1B 4G42B 1P1XA 4EFDA 4M9PA 3EYWA 4IEIA 1C5CH 4M0MA 3P4LA 5KSPA 4I3GA 2FD6H 4H13C 4PW3A 3HVNA 5F9WB 4JYFA 4RSVA 3LCXA 1RR2A 4EO7A 3E1F1 5F7YC 3OSUA 3CCFA 3IWVA 3MM4A 1P4UA 1IOLA 3T2OA 1WP9A 2DQFB 5CR1A 4S3AA 3V6ZA 4O4IA 2AXGB 1KBIA 3BT2L 1S7GA 1BXGA 3SCVA 2GZAA 4DETA 2JIXD 2VQ6A 2FQXA 4NPCA 1GYUA 4APQB 1BYIA 3A2MA 3OIGA 4XUGA 1G8GA 3GAAA 4HWSA 5SZKB 1XX1A 1A8SA 5LBSH 2NU7B 1PKMA 3EKZA 4BFKA 5HVWA 1OIVA 5I1GL 3EASA 2OYRA 1VG8A 3SZUA 5KVDE 3W1UA 4D8WA 1OBVA 1BJMA 4RZ2A 1T2XA 4KDRA 2NVWA 4G71B 1C9DB 4AQ8C 3VSTA 3SADA 2H31A 1W6RA 2VDNB 3H8WA 4MIKA 3EDDA 1BKYA 1UDXA 4LCQA 4Z1MD 4I9FA 1QFXA 3TNDA 3BGOS 2E6PA 1YA4A 1BFVL 2DI9A 3F58H 1XG5A 4O8ZA 4PAQA 4YSSA 4IO0A 4GUOA 3TIMA 3NT5A 1ICPA 4DIBA 1XPUA 1ZBVA 5HE9A 1N2RB 4OEHA 5CCXA 4FMCB 1DJPA 2DZTA 1ETZA 4JFRA 1RFLA 5LSAA 1AY1H 1JDVA 1XF4A 4OAOA 1IUKA 4GRIA 1FDIA 5FLYA 4Z7UF 3R5TA 3EHBC 3T6VA 1PTJA 2CL6X 2PYED 3ZDAA 2C5SA 4H9TA 1BYBA 4PYMA 2V30A 4C0BA 1D2NA 1Y6FA 4X6CB 1HHKB 3LENA 2AZDA 5EFDA 2FGWL 4UHBA 3RTAA 4R0NA 3WJZA 2C9CA 2YC1A 3MW7A 4Q4QA 3S4SG 1EBAA 3ROGA 1VKFA 4JEUA 2JVUA 5DS2A 1I1QB 1PR4A 4Q6IC 2PRYA 2OFJA 3RWMB 3MHUA 3NUKA 2PLMA 4M7OA 1ET8A 1NBEA 3GLFB 3CX4A 3TQPA 4D9HA 1CBVH 2FLMA 2AG8A 1Z47A 3UR7A 1X96A 3RIGA 1LJYA 5U4XA 1W73A 1ES0B 4AWUA 4F27A 1WBXB 3LMKA 4A5SA 3U2JA 1OGGA 3Q12A 4RTJA 5ECGA 1FWRA 5U1PA 4I77H 4OHOA 1UATA 2OBBA 2LVCA 2BV9A 3K2UH 1JQVA 5FFFA 1GGMA 1TCAA 2ED8A 4N40A 3MWCA 4D4JA 4JJ4A 1Y81A 5EJ4A 5EIBC 4WZZA 2QSYA 3OEWA 3PF9A 2QULA 5HI5D 1BFOA 4GU5A 2YC4C 1LLDA 2BNRD 4PR3A 5DVMA 2XJ4A 2BFWA 3NJKA 4ONHB 1U3HB 3B9BA 3MJ9A 1CWVA 3NYDA 1SJHA 1PF7E 4FEZA 4Q9RH 1VCMA 4NZOA 2HR1A 2NO1A 3D0LA 5F9DC 5LA2A 2HKHL 2PVCA 4MKFA 4NQDB 1GGUA 5JANA 4PI2A 5EHFA 4IBVA 5E2AA 4E9LA 4DSYA 2G75A 4JIQA 1J8FA 3HQOA 4NCC2 4TNWF 1QYIA 1IHDA 5CTJA 2K6ZA 4BVKA 4Z1YA 4LY4A 3ABMB 3CFEB 3NQBA 2XG9A 4FK9A 1NMAH 1YHPA 1JHLL 3VFNA 1Z3NA 2JJWA 2OMBA 4ARIA 3NB0A 1KFEB 3U1TA 4BNKA 5C0DA 5SWUA 4KZKA 2NSLA 4K7PX 1T2CA 1EUDB 1RKQA 5DISB 1SEBB 1NAKL 4HH1A 1MOSA 1C9JA 1PTJC 4BNFA 5IBXA 5CT4A 3CONA 3EIHA 2ZX7A 4KRZA 4PMFA 4YPJA 3MCTA 3BE1L 1J23A 2IPUK 4O2BF 1I5EA 4U5KA 2JG3A 1Q8JA 4H1LA 3RWDA 1PD1A 2IWEA 2IH5A 3RK1A 1OP3K 3DP9A 4D0CA 3AERA 2VPZA 3V80A 3F6SA 1ACXA 1G6RL 2IE0A 1BFKA 4HPYH 3PZIA 3TQRA 2HJWA 1ZK5A 3VIOA 3VH3A 4JMNA 3E48A 2IFTA 5B3JC 2JRLA 4FEEA 2HBRA 2QN7A 2ZRCA 2PHZA 3OM0A 3LRXA 1EMDA 2XN1A 2J9XA 2PX0A 2BOBA 4F58L 3IJEB 1UKYA 2JK0A 2IQDA 4X7TB 2P5NA 1D9ZA 1MLDA 3PL6D 3ZKWA 5DZAA 1KO7A 4BC0A 3C24A 1FB5A 2H3EA 4YUZA 5JAIA 3G6KA 4LWWA 2QS8A 3T55A 1ZNWA 4J4HA 3SGJA 1ZSDB 1KQFA 1RI5A 3LL4A 3L2NA 4H17A 5CGQB 4AJPA 4U6XA 3F5QA 2QADD 2Q9CA 3ISRA 5EL1A 4TT3A 4WGWB 1AKNA 4PLFA 1QMLA 4LA4A 3OR7B 4Q7BA 1HAUA 1DARA 1E7MA 1UCFA 2JI8A 5L88L 1ZUD1 2ZADA 1EK2A 1XKJA 2W98A 3UGRA 1A5FH 2JK2A 2O6DA 1ODTC 1QVAA 5AW9A 5EYPA 3ALXA 3C5EA 1VZWA 4AKQA 4ZQIA 5DTEA 1DFBH 4XPZA 1OWLA 1H9VA 3K6JA 4WSKA 1EJWC 4MA3B 2G60L 4EUFA 2B4CC 2XPZA 4BHUA 5JYBA 1IIKA 3TMAA 5CDHA 3V7AE 2GVYA 3O15A 1K6XA 5K0EA 1YNSA 4HCRA 1OMOA 3FB7B 4OF7A 2OXEA 4TZ6A 2WINA 1NWPA 3DVNA 2P5TB 4JV5B 2V2HA 2IYZA 1YJDC 4KOAA 3W73A 4HQVA 4TV8B 4Z7QB 3DVAB 4A3UA 2WSSD 3WD2A 2X4NB 3O8AA 3VJ6A 4M02A 5K2MA 3V75A 3VTZA 2F0CA 4PWHA 1UEJA 1J8SA 2XFGB 4EG6A 3R5EA 2DX7A 3WZ2A 4WEVX 3VWKA 3VTTA 5L53A 5DBHX 1QHEA 3LHYA 3GDLA 1THZA 2IPAB 1BZ8A 1A88A 2JHGA 5AO9A 2D31B 5AVTB 2R86A 5FEBA 4YCAA 4X24A 5B4MC 1RVDA 2RCYA 1IGSA 2J3LA 2WCAA 2X0UA 1JXJA 3ROTA 4E5SA 5L45A 1O6TA 4ALKA 3STEA 5ACZA 1N6UA 4JFYB 3WQ5A 1VGEH 4FDWA 1SW7A 2VJQA 3G9VA 2I6SA 4PLTA 1SN0A 5TDHA 5LMNB 3LCJA 4NKDB 1OYOA 5TJ9A 4XDGA 1T13A 1A98A 3PR3A 3KM1A 4P4LA 2FSHA 2Y7EA 1A96A 2WTXA 1Q21A 1N9PA 3WFBH 4NIYE 3PUCA 4AV0A 3NWBA 4RA3A 1RTTA 3GYRA 2GK1B 4N1HB 3QPDA 1VHNA 1VYSX 1LB1B 1KJZA 3QUKB 3DHNA 4FMCF 4YNGA 3KJ4B 3AREB 1JPSH 2WYUA 5IVOA 2OYPA 4AC4A 4PTMA 1T5IA 3IDNA 3B52X 1QTPA 2NXJA 3F6EX 3KQYA 1FSPA 4KNTA 3U3JA 3UJIH 2FUG6 3O47A 3HB3D 3HHPA 1JEAA 3S83A 2VJMA 1YTEA 2VWEC 2FQEA 2PUHA 4R31A 4GC9A 5AAWA 3LVRE 1WOAA 3GDRA 4X20A 3BYZA 6PFKA 1X15A 3LCMA 4ND2A 3T5MA 1M71A 1DELA 4PY8I 4JKWA 3P4MB 4CHGA 3HADA 1OE2A 3LZCA 1UBOS 4OLBA 2RDUA 3E5HA 2DWYA 4NUJA 3AGPA 4BZPA 4B84A 4MR7B 4R7JA 1LF1A 4NQDD 1N0LA 4JUDX 3HR5B 2FFAA 4C08A 1F8UA 2BVOA 1R0ZA 1YUNA 5KYGA 4Z7UA 1KT2A 1UJCA 2WKOA 5B7GA 4A7SA 1MC5A 3CZQA 3MRFA 4Z7WA 2QIPA 4ZTOL 4M9RA 3EFOA 2GWHA 1XU7A 1UJ3B 3KDSE 5CZKA 1XQKA 2BL4A 1OQOA 4MOZA 2WTRA 1LQ2A 3S46A 1MDBA 4QTIL 2IOIA 3LECA 4WLCA 5AKIA 3K4ZA 4KK3A 4G1EA 1AE6H 2EPOA 4HSCX 1DANU 4AL8C 3GMIA 3S1AB 1R6TA 1T9AA 3IUMA 2BEJA 3QPEA 3FQWA 1GN8A 2ZKIA 2J88L 1SFDA 3F5KA 1TCMA 4RNFA 3IF1B 2XB2A 1I85C 2EDAA 5CBAB 1IARB 1IVTA 5FXMA 4RD6A 2YVLA 5C9XA 2VLME 3V4VA 4GAFB 4ZYZA 1M9WA 2G8ZA 2VKWA 4HBZA 4MLDA 1BLNA 5HOQA 1KAOA 3GM0A 4XKYA 4PWZA 3U4KA 5I8KL 4HA3A 2DFTA 4N9CA 2V6IA 1URIA 4ZZ9A 2A2IA 3FB4A 1GLVA 1LPBB 3FB7A 1E0DA 1KSGA 5AP9A 1K7XA 4YVXA 5K39B 2WWRA 5IB1B 3D64A 3QH4A 3LVBA 1YB6A 2ZJOA 3Q5GA 4LYJA 1R0KA 2CZGA 4BMSA 2Y85A 3ME3A 5TDOB 2OA9A 4PRBB 2FR0A 3GMNA 1QYRA 5CB4F 1QRUA 1TEYA 4BJ3A 4RFOH 4KIRA 3INUH 3WLBA 1LWOA 4EARA 3PGFL 4TQUS 1PQYA 4TU1A 1Z7EA 1JE0A 2FEJA 4QXIA 2NXWA 4OCSH 4KKPA 3IH5A 4L7VA 4Z7NB 5DVKA 5B4VA 4Z2HA 4OZIA 4O2RA 4C6IA 3NJRA 4TKWA 2XTNA 4AOFA 4MNGB 2DORA 4QOKA 3R6GA 3JWOH 1XYZA 2C5HA 3PZRA 2DCUA 3HRZA 4B7IA 5AM3A 3FT3A 4GFTB 2PS2A 3EHEA 2Y1ZA 4KPLA 2DQUL 4RAQA 4UV4H 1KBBA 2G2NA 5T4FA 4N6GA 2GBLC 2ZTHA 1Z5NA 5AVKA 1ZLVH 1K6IA 2AF2A 4HK4A 1SC4A 4BLQA 2EFCB 1R2TA 4K7FB 2I69A 3EXJA 3L7DA 43C9A 5SZJA 2ZSWB 4JM2A 2VN6A 1JF1A 3CLUC 3ROMA 4RZ6A 4JFDA 4KHXL 1GRCA 4Q2ZA 1QTQA 4AK9A 1FKXA 1XAKA 2A2QT 2IEPA 3KEOA 4D6DA 1S8DB 3WMGA 3ZBQA 3SKOA 1LO3L 3T1NA 4XVHA 1UR1A 2XGIA 1E7SA 2Z1NA 3CPLA 2YPKB 4XEUA 3VMMA 3ZDZF 1FVFA 4MJID 5T3UA 5HJ5A 4UTAL 4GECA 3OPUA 3TGWA 4C0WA 4D92A 2XYBA 2P26A 1V6TA 25C8L 2Z31D 4OJFL 3PJGA 3CU2A 4NLLA 3QXSA 2VDQB 4ETMA 2P4HX 4GI9A 3VIPA 4TQEL 2CHUA 4V0KA 4YSQA 2QQNH 4KV7A 2DQTL 1G87A 5CEYA 4LCSA 1UB6A 1XKLA 1HA3A 4RVCA 4CI0B 3D0CA 1IXPA 5GJSH 3FBWA 4CM9A 3CHXA 2W60B 5EJIA 2OEKA 3KKEA 3KT0A 3VWKD 2CZEA 3W2NA 1DOZA 5DT1L 3ATEA 3LKDA 2NVUB 1L9SA 2HKFH 3PR2B 3OZ7A 4B3TB 1NIBA 4RZQA 4X1YA 5ITZB 4PMJA 1AKRA 2OHVA 1GN9A 1UD8A 4FQ2H 1YJBA 3K4HA 3EZXA 4RFEA 3TVMC 5HHPB 1ZCOA 5BO5A 4IBYA 4DAOA 5IVHA 3OAYH 5DMMA 4YNYA 5G5DB 2DVTA 3K4DA 4IIDA 3TA3B 4JQXA 2XUZA 4NE2A 2ECPA 4QIHA 3EDYA 5C1OA 2UY5A 3MYOA 2GGSA 4IGFA 1A8QA 2P40A 4QHMB 5TQ0B 4JKPL 1BXAA 1LNQA 1BPLB 1IEHA 1BTMA 4XXCA 2WSBA 4DKJA 3P81A 4NONA 3HN3A 2JHAA 3ZWYA 3CVVA 2NP6A 1SQ0A 1AHWB 1KJQA 1A2BA 1FZJB 1I3UA 1UOVA 5TQ0H 4KN9S 3NNDA 3UKDA 1RQGA 2D73A 2WIKA 1ZT7A 3GUHA 3P52A 1T1YA 5F7ZA 1WVGA 2XZOA 1JR6A 4OMUA 1CG9A 1J9CT 2OMVB 3U79A 2Z56A 4IRSA 1MWAA 5AALA 4F15B 3JSSA 4R0LC 2B8OT 2BFVH 2EO9A 5D1ZB 1RIFA 3GARA 3DI0A 1QLRB 3MA7A 4ZW5A 3O7MA 3WFHB 2WF6A 4UTOA 2YZ8A 3WDJA 1HZJA 4MUYA 3S8WA 3OXSB 3CW8X 5GRUH 4JOMA 1NLDL 1FZMB 2YD7A 2YASA 4FOTA 1MEIA 4QEGA 3GGPA 4KPHH 2GBLA 5C0NC 4IXMA 1IU1A 4HAOA 2XADA 1E5CA 4ANXA 3DMMD 4I9JA 3VMOA 3D48R 1WISA 2ERXA 5A2KH 3H42H 2BFMA 1NC2A 1RQNA 1B3BA 3QRGH 3CXHK 3WMQA 3L40A 2X4TA 2Z5FA 1D2AA 5FAGA 2W2NA 1PDKA 5K69A 4ZMGA 2PMFA 2HHHB 2ID9A 2V38A 4WFEE 3K4WA 1GC1H 4PJHB 4MP3A 3MUNA 1QWUA 2OXHB 2OILA 1JOIA 4YWGH 3ANTA 4CLEA 3ILQD 3L48A 3SIKA 2E37A 4OMCA 1SO4A 3D4OA 1XE3A 5EGSA 3KR3L 5F5XA 3NZGA 4PV7A 4DXDA 3B1UA 1WZKA 1OFUA 3KJEA 1U4EA 2RGUA 2AKEA 1G4MA 5ALPA 5LBSA 2GUOA 4K6CA 4HR7A 4B9GA 4FI3F 4P3XA 4UFOA 2DIJA 3H85A 2K9FB 3HAEG 1SZFA 1IGCH 4NQCD 5A9RA 3TZVA 2ZDQA 3LHTA 1ONWA 3JQ7A 5HR5A 4HH4A 1RJLA 1XCQA 4UF7C 4O1DA 2YJTD 3I34X 3CLTC 5EIVA 4HUMB 1IZJA 2YDSA 4HDNA 3MOIA 1ICSA 2GGEA 1FRNA 5JVLA 2RB8A 2PDNA 1UB5B 3OQPA 5TQ2B 1BYPA 3ZSSA 4AD0A 2XUPA 4A1FA 4L05A 4IDJL 1DG3A 1FX0A 2FA9A 1ULHA 1G5RA 4UATA 5D1XD 4EYSA 3REGA 4PPFA 2F4NA 4YASA 2YXVA 3B3BA 3BWMA 5T8KA 1S2MA 2I9LB 3OZCA 4FXKC 1Z5HA 1R5YA 2GXUA 1U5VA 3PQ2A 2GXAA 3HO1A 1VPDA 5T1MB 1FOEB 1QNFA 1WXQA 3WDIA 2CN1A 2FHFA 2DQDH 3W7HA 4M8KA 4ZTPH 3OVRA 4EHIA 3ARGA 1OAYH 3HQPA 3H5IA 4K3UA 4EG3A 1A6ZB 3L7FA 5H8DA 2QNIA 5K6AA 3REQA 2F67A 5FIUA 3HKEA 5CFQA 2F53A 3R2JA 1QZ3A 5BY2A 3IP8A 2AAAA 5D71L 4JELA 4D3SA 1V6VA 1BQSA 1W56A 1W85A 3TNOA 1P7PA 1U7DA 3KXFE 1NGQH 2ZYRA 4MJ3A 1AG0A 3KVQA 5FESA 3D3JA 4LHXA 4N7MA 4M4SA 2I76A 1NPJA 4JCOA 1D1QA 2FGBA 4TM9A 7A3HA 4UQ2B 1NTHA 1HR0B 1SRDA 1SZNA 4OGAD 3IPEA 5AAMC 1GW1A 4FK8A 3KCJA 4LVUA 4PN2A 2XUKA 4AGOA 2AJ3B 3W70A 5G4NA 2E6FA 3I2JA 1QP1A 2GHZA 1SMAA 1JNNL 4QLAA 1N5AA 3D0QA 1YPXA 3GIPA 3MINB 5FH9A 3GBML 4WV1A 3KPWA 5FOTA 4FLEA 3PRYA 5IRCD 5FEWA 3ZHYA 3VGAC 3CVIL 4QBHA 2X0FA 5EZYF 4MX8A 2BIMA 1AQFA 3MB5A 3T3MB 2PR2A 5A7GA 3G2OA 4ZGWA 4LVOC 1NYTA 4UZFA 3OW1A 1P4HA 4LDCA 4GOMD 4IGKA 1Y0BA 2WT8A 5D1QB 2QPUA 3IETB 2A57A 4H7PA 3V9AA 1RUQL 3EG9B 3L82B 3UANA 4GQ9H 2V9RA 1RJYA 2JFXA 5E3IA 4LBEB 1HEYA 2VNIA 2M83A 2G2RA 4GUPB 4MS1A 2R1VA 1CFQA 4M1WA 2H16A 2JL1A 3RADC 1FK8A 2A85A 4LDEB 2PUCA 4KFPA 3BICA 2WN2A 2DRUA 5E1AB 1S1RA 4QYXA 4XZNX 1DMRA 2V6FA 4HEA1 1XM3A 5IHWA 2REQA 1UZ1A 3LXMA 3VXRB 1YNTB 2SCUA 1ODJA 3CMOH 1JIIA 2YXOA 2J6BA 5I0DA 4G43B 2C7UA 4MQ7B 3S3TA 5GS2D 4EOUA 4BLPA 2W6CX 1K9FA 1J12A 1LEKA 1QPOA 4PJ5E 3TMQA 4OAPA 3IMEA 3Q3HA 4CN8A 2JLCA 4OQXA 3R7BA 5IVXE 1X97A 2DQKA 3RTQC 5CM2Z 5ARDA 4L1SA 2OQHA 1TA3B 1V5JA 4YIQB 4NQCB 2H5IA 25C8H 4MAYB 4OJFH 4PCTA 4N8PA 3FAZA 4ZW8A 5LQJA 4LCWA 4ZYTA 4GRAA 1YR1A 5KVAA 3GZPA 2C9UA 1Q63A 4K68A 2DTDA 2IH3B 2Y1WA 4BFIA 3EFDL 4IILA 1OW0A 5E5RB 4H4EA 1B3OA 3NCXA 2BF7A 4WDUA 3IBSA 3G0BA 1JH9A 2CPCA 3NQEA 2EG8A 4QYMA 3SQOH 3DURB 2BHRA 3GXBA 2HT1A 3EA2A 3VW3H 1PT6A 3MBEC 2X0JA 4U1LA 3BCFA 3F8WA 1QCCA 3GGCA 3ETJA 4JJ5A 4KFZC 1NCUA 3BEVB 2UYLB 2ZJSH 4R2JA 5HMLA 3CPRA 4QR7A 1AMNA 1A7OL 2O8DB 3HBPA 2Y1KA 1T1WB 4V0SA 1KB5H 4WADA 3LKNB 4M1GL 5EU6B 4RDCA 3PXXA 4IAOA 3TFCA 3CBKB 5DNVA 3K94A 3O3BB 3DYMA 2C42A 4Z08A 3GLRA 4NM8H 4E6MA 1PZAA 3SJVB 3EKLA 3SUTA 2BAGA 2R6JA 3EOLA 3KPPA 4X5PA 2HVMA 4XQCA 1R5WB 1T22A 4WZBB 4P4UA 2AZXA 5IQMA 3C60D 2RI1A 1A6ZA 1YE3A 2XZ9A 2O1AA 5CLLA 1CYEA 2XN9A 3MLEA 2B21A 1ZANL 1IK6A 3FYPA 1Z9MA 1A2KC 4BE4A 4P5RA 3JS5A 4ATWA 4EYEA 4X8HA 4BJHB 3VKWA 4BMCA 1VYUA 4DVRH 1P2BA 2E87A 2XCTB 3R1GH 4XP1L 2AN1A 4P2QB 2Y89A 2E1RA 4F8JA 1CUOA 1ZGHA 4RPJA 5AW5B 3NTVA 2VEMA 4DB4A 4I4WA 1NGYB 5KSZA 1FL5A 4E14A 2E4YA 3U7HB 4A7TA 4HGMA 1II8A 1KCKA 1NYQA 1T66C 1VHQA 2B69A 3UMBA 5MI0C 1F2UB 2EZ0D 1WHOA 3OMNB 4QRPD 4Z1OA 1YX1A 2YW9A 5LNSA 4BX9A 4KUEA 5BW6B 4M5ZH 4LF3B 2L0XA 5CJXC 4FSHA 2WT9A 5E9XA 5B3JF 5ERYA 4BSVB 1JLKA 3DG6A 4IJTA 2QF7A 4A1OA 5DMHA 2VISB 3W1RA 2LBPA 3B2PA 5M94B 4HXEB 2GD0A 2LP4Y 4Q16A 1GC1L 2FZBA 3ZNNA 4B0PA 4L3EE 4YSOA 2WAQA 3RSCA 5E03A 2J7CA 2APSA 5KNCA 1T6ZA 1A9QA 1GQRA 2VXYA 4KI7A 2A84A 1J5CA 2DKSA 4LECA 4PVCA 4DJDA 4PJFE 4Q6KA 4ELME 3UETA 1KZYA 2CLMA 1L7EA 4PPYA 3C98A 4ZW6A 1ZVKA 3HJGA 1F2DA 2E86A 3PC8A 5F2IA 4LOVA 2WWHA 1RWKA 3P0GB 2MJLA 4C6EA 4DTIA 1T96A 4PMZA 5F88A 4GUPA 4ZB5A 4FAAB 1S5WA 1VDZA 4DADA 3KJNA 3NHKA 1HZHH 4INJA 2VDLB 3JZYA 4V33A 2JIRA 4Z0XA 4U1SB 4ODHL 3HEIB 5AKHA 3REVA 5KCMA 1CLKA 2H65A 1J7KA 3RNQB 4EPBC 4H7IA 2M1ZA 3T06B 2HQSA 4JB9L 3F58L 1LG2A 2BTEA 1BQUA 4MRBA 1OIWA 2DR0A 1MVUB 1JFXA 3C52A 4Z9YA 5I73B 2V9PA 3SDXB 3GKZA 1XNRB 4RELA 1TTAA 3ZY7A 1QT1A 1CRWG 4N76A 1JR1A 1RJ9B 2V63A 1E6RA 4HUKB 3ZM8A 1GTJ1 1AIPA 5IUSA 2X9GA 1B8VA 3KQWA 3MOAL 3GNMH 3JT0A 2CFIA 2PPEA 4XZWA 2EC9T 3EEGA 2PXYB 4B7LA 4GH3A 4INAA 2MNWA 5JSFA 4AX7A 4U0RC 4LRSB 5BXFB 1KSRA 2EH7L 3ELQA 4DGUA 3QT2A 1ECFA 3CO0S 4DMUB 1ATIA 2XXMB 2PFHA 2CBOA 2NV0A 1MNZA 1TYAE 1WZCA 4B27A 1SF5A 4XZBA 4MAYD 5KVEH 5HQLA 2YZMA 4K2AA 3N58A 1FL6A 1UKVY 1OV8A 4XW2A 2PT7A 1S8OA 2R4TA 5JS8A 3N0XA 2OD2A 2KL6A 3HB3C 1XBTA 3I2CH 3VU3A 2OJPA 5L0QB 4QROA 2KDYA 3FSGD 4KWIA 3PHSA 2PLRA 3QR3A 4B3DA 4GMFA 2O6EA 2H9GA 4OLVL 3P0YH 5JCZA 5ELXA 4MDOA 1I1FB 5EF1A 1KV8A 3PFGA 1ZTVA 3QEAZ 5JZVA 4CM3A 2BIHA 4E4FA 2P8SA 3K2UL 5FPHA 4XP4H 3WJLC 1R9XA 4FFYH 4YNYB 4XMKL 2QADC 1T8XA 4JBRA 1VFBB 1LLFA 1MQQA 1MJGA 3L6EA 4DA7A 4CT0A 5TT1A 1MRSA 1TZJA 1I3CA 2IPGA 4YY3B 3FOEC 2CGRH 1MG2C 3E1ZA 1U0EA 2KBGA 2F3RA 1Z6YA 4XDYA 5BWAA 4LSQL 3CVIH 4ZO7A 4XX1A 4NBXB 3WMXA 7ODCA 3ZPDA 4W4OC 3W3AA 3H5AA 4B3ZA 1ZOLA 1CFSB 1HQKA 4IHCA 3BAFA 3VOBA 4OIAA 2ZS9A 4F8QA 2A9RA 2OPCA 3RMEA 5IKOA 3AVOA 3V5HB 3SYNA 3L0CA 2CLLB 5MN5A 1S7TA 5EO9A 1X1DA 3RX8A 4LSZA 1PUDA 4Q9KA 4U6HB 4Z3TA 2PZMA 4CW1A 2ZWMA 4ARBA 1MMFA 3HYRA 4UWMA 3VXPB 3KOXA 3BVPA 1KM5A 1KE1A 2J0UA 1IMJA 5ABEA 1AO3A 3OZDA 1W34A 4YN3A 2CIIA 1MJHA 3FYCA 1YN6B 5I3GA 3KPJA 3V9EA 2Y6ZA 4X64B 3EIUA 5CBPB 3HGQA 1YEDA 5C2XA 5L3QA 3PSVA 4CL0A 2J72A 2NY3B 3HAEB 1JH8A 1DNPA 2IUEA 3OPNA 3I37X 1AGFA 3PWNA 3U36A 3O6AA 6TIMA 1X9GA 4P7QA 5IDIA 1YFZA 1TJGL 2W8BA 2BTQA 4MW0A 5KG9B 1RU3A 3TT3L 5H37G 1O4VA 4HZUA 2OW6A 3ESRA 4AG4L 3K1TA 4WFHE 1W9MA 3X1DA 3OZBA 5CZJA 2O8FA 2IGFL 1FYTA 5IJWA 2P4SA 5B57C 5JS6A 4MDPA 3NJNA 5BSTA 3GSNL 4HYRA 3FTGB 4EVQA 1MCQA 3CB8A 4TWZA 4F2PA 5DSXA 3AFNA 1Q7GA 3SR4A 4ZA0A 3SHSA 1JHRA 2WOYA 3RVWD 5KBYA 5EF3A 1G1AA 3BPCB 3Q85A 1CEOA 4FMPA 2GZSA 2CK3D 3RX5A 1IJBA 3I50L 3AQUA 3WXVL 3M6MD 4ABYA 4BTEA 4EABA 3ZWMA 1RP1A 3EWCA 4RM3A 3LW7A 4XC3L 3MDJA 5EU4B 1TRDA 1UW9A 3WK7A 4W8LA 5KC9A 3W2JA 1K6EA 1CVRA 1OT5A 2G04A 3N2YA 4QKTA 1Q92A 4ZAFA 4E0CA 1U3TA 5DLEA 3V0UA 3MPUA 3BUVA 3CO8A 5KU7A 4YWIA 5LFAA 5FJOA 2W0PA 4ZXLA 4B9JA 3TYDA 3KV3O 1SZGA 2MNRA 5CG7A 2FMHA 4JVWA 3W8NA 2LGNA 4L4UA 5ALSA 2JKNA 4DGIL 3UBXG 2TODA 1R34A 5C0ND 4CIBA 4JLRA 3GSXA 3B36A 4BBWA 4F9DA 3TEZA 1GGCL 4K3JL 3VC3A 3W0WB 5A3VA 4ARSA 3ZCVA 4C21A 4XWYA 3BQUB 2NY7H 2ZVRA 4MIEA 4TXMA 5I6MA 3V7NA 1WP6A 1EFPA 2XISA 3A4TA 2FNBA 1TJPA 1UR8A 1IN6A 1W1PA 3P9SA 1XGYL 4YRLA 1UKTA 1E9SA 5F2EA 3UQNA 4F7TB 2PUVA 3KO8A 5IK2D 3EXHC 4QHLB 3UCFA 1YRRA 1FFBA 5DIFA 5LXTA 3LTPA 3BM5A 1Z44A 2HV9A 4F04A 3DXXA 1OZAA 5KOMC 3ITEA 5FM5M 1YI8A 3LK7A 3QWAA 2FEEL 1UHVA 5AFDA 5D7BA 1AHNA 2WXHA 4MA7L 2FQYA 2PBOA 5A2JH 1V0NA 4G5ZL 5KS9E 1DOAA 1SUEA 5LA0A 3W1VA 1XTZA 5EHQA 2VE6B 4EJSC 4GJJA 2H9GB 4KVNL 1CJMA 7CGTA 5LLDA 3SN6A 3C8MA 3INRA 4DQ0A 5C8JB 4FI7A 2C29D 3VR6D 3O2DA 3AMGA 2PCXA 3FFAA 1X7YB 4KQ0A 2BS71 4F9EA 3IU3A 1Z5GA 3UF9A 3MSGA 5D7KE 3EDOA 3LYAA 3MXOA 1QG0A 2BWJA 1XEWX 5CUQA 3FPFA 4E2XA 3S0JA 2BFEA 1UJBA 2VW7A 4QUIA 5DHQA 2LAAA 3RFZC 4MW4A 4RMTA 4GPBA 5CMAB 4EE2A 1P9OA 3LX6A 5E4EC 3AIMA 1UMLA 3MOSA 3BKCL 1PDYA 4YOKA 1MU0A 3TDKA 1N4XL 3NGXA 1JDBB 5EHGA 3AVXA 3PNKA 1PEDA 2P2DA 4LX0A 4DQKA 4XJXA 4F3YA 3EMZA 1E5XA 2OTPA 3RC9A 4AYID 3V5KB 2H1WA 1E42A 4X7TA 3VNDA 4YTQA 4K88A 1U65A 4TVPL 1KY2A 4JFPB 1X7WB 3WD5H 1VE6A 3PL6B 5DF1A 3WFZA 1EHIA 3NGJA 2H32A 5HJ2A 3HJFA 1M4KA 3K3QA 3X1KA 2H2WA 4TL9A 1QP0A 1UUOA 2QQEA 3RSQA 2V3VA 3PZQA 4MGXA 4FEIA 1OIXA 1RULL 3BSGA 4U4IA 4XIJA 3CTTA 3PUEA 4O1HA 1TVBB 3KWWB 4LHYA 2H2GA 1TELA 3D6HA 1AXTH 4K6MA 2ZSVB 4KWVA 4D1IA 1PKEA 4DJDC 2BVNA 3X3FH 5D3MA 3PB3A 3F7LA 1LPPA 4OSPA 1IJEA 4WQOA 4AY8A 5AI0A 1VI5A 4ZKDA 2H47C 1VYPX 1JHTA 2VYFA 3H55A 2BEVA 1L7DA 2OQIA 2DL9A 4ORGA 3BMQB 4JLKA 1W3LA 4YO0B 1PJQA 5MFPA 3B0UX 4GWGA 4KQ2A 4L78A 3VG0L 1JNYA 4KBYA 3IDYC 3L6DA 4MQXD 2YAOA 3GDMA 1T4CB 3AFOA 3D8RA 2PQ2A 5CJXA 4UTVA 4BO9A 5AW6B 8FABB 5D5MF 4LH8A 3PDWA 1Z4LA 4W9JC 1P5VB 3T4UA 4QC2A 2QR0B 5HILA 4N3TA 4ZI7F 2Z5LA 2X05A 3ZI0A 4KDTC 1UK9A 4Y16C 4WZBE 3V1HA 3RT9A 2O6CA 3L13A 4HK0A 4TMZA 2DKNA 5JHLH 1GAWA 4YHLL 5C9JA 3P77B 1FSFA 1G7JB 5GGTL 1IAOA 2QGNA 4I4TB 3COJA 3C3JA 3MSCA 4R90H 2CXNA 3TBHA 4U6VL 3EEBA 3OZ9L 5I3CA 3T71A 2BEUA 2RHRA 1BHSA 3EW9A 3G2IA 5LBTA 2CV1A 4R27A 4JXZA 4HZLA 2UUCB 4JAMA 4FNLL 3F96A 1B0GB 2FDXA 3O41A 4H20L 5D03A 5CB6A 4MHHG 1NMBL 2Z7WA 4NKCA 4BELD 3GHBL 5B7YA 2HG5A 2R29L 5LQUA 1PXGA 3OT5A 4MA0A 4NBTA 3O3DB 4G6FD 5A7FA 2FEPA 5HMFA 4EN3C 2B6HA 3MN1A 4CPDA 4P2RB 3HKDA 3SG0A 1UC9A 1DCMA 1L9XA 2P5WB 2DQCH 1JBKA 2QYOA 5G5IA 1U8AA 4TYUA 2X0RA 1GOTA 3PG9A 3NCYP 3WUWB 3MB9A 1Z6QA 3V9FA 4ODSH 1FBTA 2QJJA 3MMXA 3EHBB 2Y69B 1ZPDA 4UJ5A 2B0SH 2PKDA 4DNFA 5I4IA 4U7GA 1II8B 3LNIA 4HADA 3UVIA 2GZXA 1KCUL 3N2KA 3EJCA 2HF9A 4X7SL 1RK0B 4NRXB 2CDBA 1YAIA 3TTYA 1BMFD 4DVBB 4J75A 1WDSA 5CIWA 1URLA 4NUQA 3NL6A 1K72A 1OW0C 3AUOA 1JLLA 3FF4A 2R27A 4ZAXA 4W87A 5F7LB 4BH8A 2GI0A 3NJJA 2B61A 1P0CA 2BNQA 4JODA 1HYSC 1GUDA 3JVEA 2YD4A 2QVKA 1KQPA 3TWAA 3ANYB 4IHJB 3NNSA 1ADSA 3EXEA 1V79A 2Q3CA 3FU0A 2FMNA 1XFPA 3Q2WA 5T5QA 4Y2DB 1M6WA 4E0RB 3QJSB 5EC1B 2DKOA 2I1WA 5LDHA 3FOBA 3VFSB 3V7AG 1ZK4A 4IVNA 6YASA 2XI9A 1SSGA 1R00A 1GQOA 1PK8A 2DMCA 2DM6A 1Z6GA 3GI8H 1PFQA 1VKNA 4KJXA 2WD7A 1K3IA 3T2QA 1ZRNA 3GLGB 5G0SA 4M8VA 1N67A 4YRNA 3FO1A 4N0MA 3URBA 5BW8A 3SC2B 4I7VA 4A7PA 3M81A 3WXVH 2XNDD 1WXZA 1M5UA 1F3DH 4EHFA 5B4TA 2I9UA 3L8DA 2WMFA 4HG4J 3CHPA 4F2TA 3PC6A 3EXRA 4GH1A 1DVZA 4EZEA 4UUOA 2ZWSA 3IT3A 1MDAA 4WLNA 4J1TA 3JTSB 3RROA 4OB5L 3VWJB 2Y99A 3KLHD 5KJ4A 4AS1A 4II7A 3BMNA 4ZVSA 4FFZA 4J0DA 3S8MA 5E8RA 1Y1RA 4IBTA 2CHRA 4B3JA 5AQEA 2HLDD 4MW2A 2FF7A 2CNCA 5HY9B 2C9AA 4RGYA 4GOND 3SMVA 2OMYA 1JAKA 1GKQA 2QMZA 4KMRA 5C7OO 4BWYA 3W02A 1QH8B 1PYWA 3OPYI 4E5NA 3E2SA 1IY1A 3LBFA 4AYBA 4M9QA 4AQ1B 4Q02A 4A7GA 2E28A 3M5VA 1S2TA 4RDYA 2QUIA 5BXFA 1MCFA 1BYDA 2LZ0A 3WWCA 5AR1A 1XGYH 3N0PB 5JYMA 4HRYA 2AR7A 3MACH 2NV2A 2EINB 3PXGA 4QQ8A 4GC3A 4N1AA 5HKOA 1HHGB 4DW2L 4LFAB 3P0VL 2PDQA 3RFXA 2BBOA 1UPTA 3CX5J 4B6PA 3PDIB 3EO1A 2WZ5A 4NU7A 1IR2A 1PZ5B 3Q43A 2PW2A 1N5YL 2VDQL 2JGJA 1C8VB 4K55A 3MZNA 3MBFA 3HG2A 2C1XA 3O4LE 4XHJD 3BCRA 4QPNA 3WJ2A 3UTQB 2BFGA 3T5WA 1Z36A 3DWFA 4P5TC 1YEJL 5L95A 4OZIE 2OXIA 2VL7A 3TKFA 1W29A 5FWXB 4M6OL 5AUMA 1QLRA 3K32A 2DQJL 4DANA 2F8VA 2P3OA 1QDSA 2DMHA 3D69B 3UJ8A 5JYLA 2ZFUA 3TIEB 2P2YA 2G5CA 5M2QA 4YC2B 5C0RL 3HUJA 3DEYX 3UTSA 2B36A 4JQ4A 1ML0A 2WNGA 3Q9UA 1B4LA 4RA9B 4AWXA 5DLCA 4NQUA 3KUKA 2YR0A 1JN0A 1B6RA 4MIYA 5CBEB 4NMLA 3OFNA 1NSNH 3QYMA 1UBJS 3B2XA 3GDTA 3WGIA 4NNPH 2NG1A 1RRFA 3IR6A 3AJRA 4WKPA 5I79A 2UVFA 3O3MB 3MBWB 3JYNA 2H7WA 4FGZA 3I74A 3W5CA 4RMSA 4UTFA 4RIFA 3TO2A 3CJTA 1ZLEA 5DANA 4X7MA 2WMHA 3Q37A 2PUAA 1JJFA 2ETVA 2QQGA 2NXEA 3KYJB 3O9WB 3C0SA 5F1IA 4B2YA 5C1MB 1C91A 4JFED