4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
molecule tags Hydrolase
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
3PBGA 4EAMA 5I23A 1E56A 2FHBA 1JNEA 2XSBA 3L7NA 1R34A 3IANA 1E71M 3BXWA 4D1JA 1JZ6A 5BXRA 1GOKA 4GXPA 4JKLA 2AD5A 3AHXA 2NSXA 2VCCA 3CZLA 4OFWA 1V6VA 4FNTA 3CUGA 1K9TA 1VCOA 4LYQA 4UQAA 1PDVA 1DEDA 2E8YA 2ZX5A 1QWSA 3FXYA 2R1TB 2BVTA 4ZENA 3WDQA 1GOOA 5FL1A 3N7TA 1CGYA 3KLKA 2BV9A 4CN6A 3EMZA 2YA2A 4QLLA 3KKLA 3SCVA 1KXJA 4QYXA 3UGJA 3MS8A 4WSKA 4KMQA 3LRLA 3FY1A 3HG3A 1FHDA 1H4PA 3AIRA 4Y7EA 3VD9A 1E1EA 1C93A 3GXNA 4UFIA 4DM1A 3WUFA 1NWUA 2QMKA 2G3IA 4E2OA 3ARSA 2VX6A 4PMNA 1TCMA 3GDBA 2EPMX 3VDHA 4PMDA 3L4YA 4AD0A 1E1FA 3EBVA 5CZKA 3NSMA 3CTTA 1JD7A 4PMVA 1VHQA 1JL8A 3GXDA 3WF2A 1LG2A 3VD4A 1TZ7A 1QNOA 3AZRA 2UY2A 1JNDA 3K46A 2GJXA 3CHFA 1ITXA 3VMOA 3VU3A 4U2ZA 1D2KA 3MUAA 1S1MA 1W9BM 2W92A 1H49A 3VNYA 3BH4A 3SCTA 1W9UA 4IISA 1FFQA 1YQ2A 3PZ9A 5A6MA 4JFUA 1IV8A 3L2MA 1CXHA 1UD2A 2XF2A 1UOKA 4AIEA 3DHUA 3UMMA 2ZUVA 4HPHA 4ZFMA 1TQVA 3WY4A 2WMIB 1ZS2A 3EWNA 1GJUA 4RKYA 4AIUA 5A8MA 1WDPA 4AD5A 2C7FA 1QVZA 4N12A 1XCWA 4M1RA 2YJQA 4OJYA 1BYBA 1QI2A 2J77A 3THDA 1TG7A 3H53A 1QHOA 2YOCA 1Q6CA 3L4VA 3WH6A 3OG2A 2BNJA 3GH7A 2WC4A 4CD5A 4HOZA 3B36A 1ECEA 3VIFA 1MQPA 1SZNA 4FNQA 5D8ZA 5EFFA 1J0JA 2WLZA 4AC1X 4Y1RB 3CZ9A 4K68A 1TE1A 3EJTA 2DSVA 1OB0A 4UFJA 1XYZA 2DSZA 3ER6A 1G9HA 4AEFA 4CD7A 1XRVA 3VO0A 4D1YA 2EADA 2GSJA 4TTUA 2FGZA 3AS0A 2WANA 1XV8A 3SCWA 1UASA 3PQ4A 4JFTA 3ARWA 3IJ8A 4OGFA 2OYKA 7TAAA 4HPGA 1ZB5A 4KGLA 3BCFA 2IXUA 3A6OA 2VO5A 1NQ6A 3D50A 1HKIA 3WUGA 1RD6A 5AC5A 1GHSA 4UQBA 3LMYA 1E6SM 5AYIA 4P2GA 1P7ZA 2ZXBA 2FHFA 5EMYA 4BQ3A 4CU6A 2QHAA 3GTNA 1UD8A 2VURA 4K2HA 5ABFA 4W8AA 4YPJA 5JBDA 1KXTA 5BWFA 5A2BA 4U5IA 3TTVA 4BQ4A 2D0FA 1R47A 1CGXA 2VVSA 1EQPA 3GXIA 4J3XA 1FH8A 1E43A 4U31A 1G94A 3ARUA 5CPSA 3VMNA 1SR0A 2GJXB 4ZXOA 4UNIA 4ZEPA 1R75A 2PB1A 3CHDA 5A6BD 2ZICA 3CGTA 5A6BA 4MTCA 1CBGA 4P7LA 1GCYA 3S5YA 2BY2A 1J18A 2YLLA 1EDGA 1LWHA 2VUYA 3ZO9A 3DX0A 3CMJA 4E5VA 1GGEA 2VCBA 4ENPA 4NSBA 1SMAA 2DQXA 2AB0A 1QHZA 3MMUA 4WF7A 1CTNA 2VRJA 1PEZA 5E6YA 3VPLA 4D6HA 3B9EA 2X05A 4P35A 3BVTA 5I78A 3VIJA 4J27A 4JQSA 1NWTA 3UK7A 3ZT5A 1H1NA 2PI6A 1R86A 1PDWA 4ZDIA 4D6EA 3HN3A 4NRRA 2QV4A 5BXTA 5I5RA 3N12A 2GUYA 3A3HA 1HN1A 3DYOA 1CIUA 1FH9A 3WNOA 2YWDA 4AW7A 3F5JA 2UY5A 1VCNA 4HA3A 3T2OA 4MB1A 3LXCA 2YKKA 5I24A 3AI0A 1G0CA 1PBGA 4W8BA 1J0ZA 2J78A 4B31A 3ARRA 4LYRA 3VM5A 1GGJA 5A6JA 2ZUTA 4XUYA 1M6VB 3A5VA 1EDQA 2XWDA 3ARVA 3II1A 1GJWA 3T0DA 2VTFA 4JFSA 2G41A 4RE4A 1QF7A 4QFUA 3CZSA 4JZ5A 3EJSA 2WCGA 1J10A 4FNRA 1QNRA 1BVNP 2IUZA 1GVIA 2VZSA 3SUSA 3RM4A 5JZOA 2VVNA 3OA5A 1DP0A 4BFLA 1W9VA 3L18A 4W86A 3I3EA 4YHGA 4KGJA 1MWOA 5ABFB 1VJSA 2XVNA 3WF1A 4QP0A 3VSVA 3KEHA 4PCTA 5BXSA 3SEPA 3VD5A 3KL5A 1CEOA 1PX3A 3WF4A 1QI3A 1HX0A 1RPKA 3GH4A 3VGDA 4AZ6A 1BGAA 2OWXA 3W38A 3VINA 3VIKA 4WIWA 3RPMA 5I79A 3NOVA 1VFOA 1R87A 1E4IA 1JF5A 3BLBA 2DGAA 1JDBC 1B1YA 3M7SA 2EEXA 4Z2HA 5EB8A 2Y8VA 4TX6A 5I0DA 4OBRA 1VFFA 1C3FA 3W29A 1CGWA 4TTGA 4OOZA 4PMYA 2F7OA 1QNSA 4AD3A 2DIEA 1PV2A 4HA4A 1UA3A 2OW7A 3H55A 1GPWB 1OGSA 2ZWYA 3GNRA 2NV2B 1P7YA 3VIHA 3LPFA 4GE0A 3I3BA 2X2YA 1UKPA 3VDCA 3ZSTA 2VC9A 4ACZA 3AS2A 4B3KA 3D4YA 2WMGA 1UR0A 1XHGA 3OGVA 1JI2A 1HL8A 4I46A 3A21A 1WZKA 3H54A 1VF8A 1KBKA 4ENWA 5D9NA 3J7HA 1TQSA 3WFLA 3THCA 5BRPA 1BFNA 3WNKA 1V08A 5SY4A 4HA1A 2E8ZA 1KQYA 1J0IA 4J3WA 4ZE4A 4MB3A 2EBNA 3AMCA 3WNPA 3ARPA 5M5DA 1P80A 1TMQA 2CBJA 3ZT7A 4FNPA 1WP6A 1N82A 4W84A 1ZBKA 4WJXA 4V28A 3IJ7A 4MDPA 1ISWA 1WPCA 1V3HA 4OOUA 3VGGA 1KFWA 1WCGA 3PZGA 3K4DA 3CH9A 4KRUA 4R5EA 3IGUA 5M3WA 1PS3A 3WD2A 1JXJA 2VX4A 2GJRA 3N17A 4AMCA 2DDXA 1OBAA 4PBGA 1I75A 4M56A 1OM0A 5A6SA 3KWXA 2WKGA 4E8CA 1U33A 2V5DA 2WM0A 1L9XA 3CZEA 3RCNA 1BXRB 1I1QB 3UR8A 1LJYA 1HIZA 1UD4A 1HWWA 1MQQA 1JVNA 1BVZA 3ALGA 4L8WB 3LXAA 2WMKA 3AS1A 3HG4A 1E6RA 2LXNA 5HPCA 3OLIA 2EQDA 4PTWA 2VX5A 4GI8A 2D2OA 2VZOA 3PQ6A 3K8MA 1HJWA 4PMXA 2ZIDA 1UR2A 4OZOA 1XH0A 1RH9A 3BAWA 1W91A 2VQUA 5E70A 4KWUA 4P36A 3FHQA 3MMDA 1HJUA 2RK4A 1GQKA 2QPUA 4QLJA 3DDFA 2WHJA 1HTYA 3W6LA 5FD0A 4OGZA 1O1YA 3CZJA 2WKLA 1VBRA 2YBTA 1GVYA 4CVUA 2ABWA 4NF7A 1WDSA 2JF7A 3OLEA 5HXMA 1ODZA 5CG0A 4ACZB 3APGA 2JFEX 4GI9A 4JL2A 3WQWA 1UR4A 1H5VA 1BHGA 2WMFA 1JIBA 5AY7A 3W28A 3D54D 2EACA 3GBEA 3RO8A 4ZDJA 3HJEA 4W8LA 1R7AA 1SY7A 2RK3A 1BYAA 4OQ4A 3VOCA 5AYBA 4CD8A 2PC8A 3B3AA 1IPHA 3CZAA 2X2HA 3QHNA 4CKQA 1KR0A 2W4XA 3ZJ8A 1CGUA 3ALFA 4D1IA 3NVAA 2J7DA 2E9LA 4NZCA 1UH4A 2VOTA 3BVVA 2G3NA 5CXPA 4D6GA 2YA0A 2WJZB 1MW3A 1PZ2A 1EHNA 1CS0B 4GZIA 1OSEA 3VNZA 2V3EA 2J8GA 1IZJA 3WQ5A 5HDRA 3WY1A 3W26A 2OW6A 4XZWA 1CENA 3MO4A 3FAXA 3WEZA 4RE3A 4BTEA 3L2LA 3OT1A 1HKJA 1E70M 1PZ3A 3NOQA 1XH1A 4M81A 4N0MA 4FLOA 3L4XA 2CKRA 3WNNA 2E3ZA 1HVQA 2A3HA 4GQRA 3EJPA 4PTMA 1EXPA 2D7JA 3A23A 2VI0A 1UH2A 2XFFA 1E6QM 1KXHA 2AAAA 1ZJBA 7CGTA 3AHTA 5JIPA 2YL5A 1X6LA 1GGHA 3WUEA 2FEXA 3P9PA 1E72M 1I7QB 2J7EA 4W87A 1PJ9A 1OD0A 4IUGA 4J28A 3WD0A 1GGFA 1TQTA 4Q7NA 2NT1A 1GNXA 3ZM8A 4F9JA 3QOMA 2EPKX 4H41A 2YL9A 3RIKA 1V6UA 1UYQA 3EJUA 3VD3A 4AULA 1W2VA 3T2PA 4N0RA 4V27A 1M01A 3PN8A 3DC0A 2O9PA 2XGBA 3SCUA 2PWDA 4H8UA 4P34A 3WF0A 1I1XA 2W63A 1C7SA 3ZJ7A 4BQ5A 2EABA 2ZX6A 3A4WA 2DSUA 5EFDA 3BC9A 1H0IA 2RK6A 1C92A 2F7PA 2WBGA 2X2JA 5A6LA 4DUVA 2EPLX 3VILA 5E9AA 1O7DC 3LPPA 4MNTA 5TD4A 3EJRA 2XHYA 1HJQA 2DSWA 4D72A 3VX0A 3OIHA 3W82A 4FMVA 3AYRA 1E73M 1W1YA 3WBAA 1V03A 4MAZA 4P8XA 3MUY1 3NIYA 4M82A 3WD4A 2D73A 3TONA 1OX5A 4QCEA 3ZR5A 3T0BA 3VIPA 5ABEA 1RP8A 4Z2KA 2ZUWA 1WE5A 3BAXA 1AMYA 4AD1A 3EJQA 2EXOA 3VGEA 2IUFA 1B90A 2VT0A 3SCOA 3UJNA 4CGTA 2VMFA 2EO7A 1JDCA 1EQCA 1KEEB 1W32A 4CU8A 3JUGA 2EJ1A 2VR5A 1SFSA 1B0IA 1JAKA 1R85A 4OBSA 3WMSA 4H8VA 5SY6A 1GQLA 1B3YA 4FLQA 1OT2A 3DHPA 3SUTA 3G6LA 4GZEA 1UD3A 1HXJA 2XVKA 3OT1B 3LPOA 4WK9A 2GK3A 3HZ3A 3NOOA 3AIEA 1H09A 4BIMA 1UA7A 1WDRA 1PIFA 4MB4A 2VPIA 3NSXA 2UY3A 1JFXA 3PZVA 3ZJ4A 2F18A 2WZEA 4J3TA 3NJ3A 1C3OB 3U57A 2WVUA 3ECQA 4WLCA 5I3DA 3TTXA 1UKOA 5I6SA 3AOFA 1HJSA 1EO7A 1R7OA 1B30A 2BVYA 2J47A 4GUDA 5A8OA 3BAYA 2JF6A 3NDYA 4PSPA 1VEMA 4DO4A 2D0HA 3OLGA 1E3XA 1V0MA 4MGHA 1KGWA 1JZ4A 1F4HA 5A8PA 3WH8A 3CIVA 1CWYA 2DIJA 3P9SA 5HBFA 3B9AA 3WNLA 3NYDA 2VQTA 1QOXA 4UQCA 1MXGA 1DWIM 1VEOA 1GQJA 4Z2LA 4HTYA 4A3HA 3SUVA 2IGTA 5IFTA 2VZVA 2WZIA 1JYVA 1DTUA 3SIMA 3FHAA 4QCFA 2A9VA 4Z2GA 1QWUA 2CYGA 3WDJA 3SF8A 3KZSA 1B3VA 3BLPX 3MI6A 4YN5A 3ZJ5A 5A2AA 4FLRA 5ECUA 2CIPA 4FK9A 4URIA 1W1TA 3AIWA 2X2IA 4XX6A 3EYPA 3FW6A 2ZXDA 4TVCA 3CHEA 1GQIA 5BROA 3BVUA 4RE2A 2JIEA 2XN1A 1ZU8A 1ONSA 3DX1A 1XSIA 2BY1A 3LPGA 4MNLA 1MW1A 2FH6A 7A3HA 1PAMA 3AIUA 3R74A 5CPQA 3POHA 1R8LA 4U5KA 1CF9A 4EK7A 1FYEA 1JDDA 5K4AA 3SCSA 3M07A 3AIVA 3KE0A 4M24A 1BLIA 2J4GA 2PF0A 1JYXA 1JGIA 2UY4A 2XFYA 3SCRA 2G8ZA 3MV11 3WD1A 1XCXA 4DM2A 1EIBA 3EDJA 1KTBA 1WAWA 2PBGA 1EO5A 2BXZA 1R46A 5A8NA 1W9XA 2ZUMA 2OYLA 4UFHA 4NZJA 4X9YA 2ZOXA 2E4TA 5LA2A 5M17A 1IZKA 2TAAA 4J3SA 4PXYA 1QPKA 4CD6A 3U7VA 1EA9C 4B15A 3L4UA 3ZIZA 5LIRA 3SUUA 1E0XA 3BUQA 1U9CA 3VSUA 2CBIA 2YBUA 4MAVA 3KLLA 3SCNA 4OGGA 3M46A 3AXIA 3AIQA 3CC1A 1KB3A 3PTQA 3BGAA 1TA3A 3LXBA 1W3JA 2XUCA 3AHVA 1Q6DA 1UH3A 1DWFM 4Y0NA 3WD3A 2YWCA 1QBBA 3QGVA 3MIIA 3UOWA 1NM9A 2BXYA 1JZ8A 3L4TA 2BVDA 1JDAA 3VIGA 1KCLA 2WHLA 4D6JA 3PZNA 1BGGA 2OLHA 2NV0A 4A3YA 3TTYA 3BVXA 3W25A 8A3HA 1UR9A 4P8VA 3SF8B 4BA0A 2DT0A 1WZLA 3DYMA 4XZBA 4H8HA 4IPLA 2WW5A 1KR1A 1N57A 3EDFA 3WDPP 1D7FA 4L78A 1FA2A 2D23A 2DPEA 4Y1GA 3SCQA 3D4ZA 2JEPA 5JZMA 3QHMA 2PWHA 5D9PA 1E5NA 2X1IA 3RM9A 4P7NA 2XIIA 1UWQA 1KCKA 1SYTA 3PZIA 2CBUA 3MUIA 3HG5A 1BTCA 2A3AA 4L95C 3PZMA 2CERA 2ZUUA 6A3HA 3T2QA 3MSGA 1W3KA 3WDRA 1E4LA 4UCFA 3AFBA 1YHTA 1Z32X 2XN0A 4HCJA 4JKMA 3BMVA 4XV0A 1MW2A 3VD7A 2WVVA 1G5AA 3MKKA 2W7TA 3CPUA 2XFRA 4CCCA 2PWGA 1NP2A 5CLTA 2WCAA 3CMGA 2YL8A 1QWNA 1G01A 3AIBA 1OX6A 5BRQA 4GINA 5CGMA 1LQ0A 3L4WA 1J11A 3N04A 3ZJKA 1UKTA 4UFLA 1CZ1A 3GXTA 2FDMA 3WEOA 2BFGA 1A9XB 1GG9A 4KRTA 1J12A 2WB5A 2GHRA 3F4VA 4EE9A 4CCEA 1JG9A 3DYPA 2V5CA 1V3IA 2O9RA 1V3KA 3HU7A 5JUVA 2E40A 2ALWA 2CKSA 4WXYB 4JFVA 1UWSA 4AEEA 3WQVA 4QYTA 3ARYA 4OUEA 3L4ZA 1I7SB 3U5UA 3WY2A 4GIAA 5LYRA 4WSJA 1ISVA 1TA3B 2GVYA 2OYMA 2XVLA 3ZMRA 1CLVA 1ISXA 1UZ1A 2XM2A 4IM4A 3NDZA 1E0VA 4W7VA 3A4AA 1ZL1A 3WSUA 2WMJA 2XM1A 3UG3A 3CUHA 1H3GA 4W7WA 2VRKA 1GOWA 3MMWA 1JZ2A 5FKYA 4X0VA 3POCA 4PMQA 2CEQA 1QDLB 4W88A 5KEZA 1VRXA 1NWRA 3HG2A 1UKQA 3S6TA 4B5KA 1AQ0A 3B9DA 5IDIA 1O6IA 2WBKA 3VTRA 2YWBA 5GPRA 1PIGA 1XD0A 1MQRA 3AMGA 4H7VA 1KBBA 1Q6EA 4NRSA 4AD2A 4LQ1A 5DFAA 1PPIA 3AXHA 5ABHA 4TOQA 4J7RA 4DO6A 1BAGA 2CHNA 4KH2A 3TTTA 4S0ZA 3UCQA 2VL4A 3NSNA 3ZR6A 3AZTA 4L4PA 4S3KA 3NUKA 2E9BA 1CPUA 2XIBA 1O7AA 2RGMA 1KGUA 2WVTA 3ZSSA 3BUIA 1UR1A 1UD5A 3O9NA 1VIWA 4PRWA 2XG9A 3P9QA 3WMBA 2J8FA 1B3XA 1MFVA 2OSYA 1QI5A 3K8KA 4WKHA 2WVVB 2F1BA 4AZIA 2EAEA 1P81A 2WSKA 2XYLA 2IXVA 4P8UA 4B7AA 3L4EA 3WNMA 3U7BA 2ZUSA 5DO8A 4HZ7A 4AZCA 3OZOA 4OIFA 1CXLA 4YHEA 2J7BA 4D6DA 4PSRA 1WZAA 4L7QA 4AISA 1ODUA 2V3DA 3FAWA 3MV01 3CBWA 4JL1A 1V02E 4DWSD 1V0KA 4XB3A 1G2IA 3PQ2A 5JBEA 3FNDA 1LLOA 1UUQA 1OD8A 3AMLA 2CITA 4W7UA 4X0NA 3PQ7A 1XD1A 1J9YA 5DEZA 4CUCA 3HMCA 4JAWA 2J25A 3AMKA 4CN1A 3EDEA 1FP8A 1W2PA 1MYRA 4UOJA 1J0HA 4BCEA 5M03A 5A6KA 4XLLA 1JZ3A 1OI4A 2OR3A 1C8XA 2X0YA 5HOSA 4H2CA 1FFRA 3QHOA 1HKKA 3P9RA 4I4NA 1QNQA 1HNYA 2R1TA 4RKWA 1PX4A 3RJYA 2PWFA 3TA9A 1E5JA 4B9YA 1Q4NX 1BG4A 1J01A 1UQYA 2F7QA 3A47A 1EGZA 2R1VA 3L3BA 1NOWA 5BYWA 4E08A 3CY6A 2V38A 3A4XA 3R76A 1R33A 2D20A 3TTSA 2DH3A 2WSPA 4AYSA 5E0FA 5CLWA 1Q6GA 9CGTA 3AYSA 3D51A 1IZYA 2D0GA 5CSUA 3QOKA 4AIOA 2GK1A 5AC4A 3AHYA 1OX4A 3D52A 5D9OA 4GZJA 4CCDA 5CQ1A 3WEMA 2DSKA 4GQQA 1HJVA 1CGVA 1CLXA 2VJXA 3VGFA 2YFNA 4PTVA 3RM8A 1HL9A 3BVWA 4EKJA 1V3JA 4P7RA 3PTMA 1QNPA 2CCRA 3FIJA 2QLYA 4CU7A 3WQ4A 1ZBVA 3PQ3A 4AZCB 5KZ6A 3CNEA 3BLKA 1F4AA 2Y5EA 1J42A 3VX1A 2X09A 1GONA 3NONA 1HT6A 3VDAA 4UZSA 1R9GA 4B2YA 2CHOA 4AD4A 5EBAA 4NX0A 3TTQA 2ZX8A 4NI3A 2WNWA 2D1ZA 3UG4A 3IAQA 3I3DA 3WENA 4WINA 3ARQA 3TP4A 4AZ5A 4PTXA 2DEPA 3TQIA 2NT0A 3EJ6A 3K1DA 1Q2UA 3SCPA 3VDBA 2WLYA 3VIOA 4NXSA 1CXIA 1H0GA 5DT5A 1CNVA 2OWCA 1DWGM 3AROA 1W9PA 1JD9A 3VVGA 2XSAA 4JHOA 2F1AA 2VNCA 1WO2A 1E0WA 3AZSA 4P7OA 5I77A 3SOZA 1C7TA 5A94A 1VFUA 4AYGA 1UWRA 2O92A 5GNXA 4AJ9A 4Y1RA 2W62A 2HISA 5A95A 1UKSA 5D8WA 2FE0A 2J75A 4UZUA 4GKLA 1QW9A 3WH9A 4ADSG 1EOKA 2E9MA 3EMQA 1E6XM 1V3MA 5F7UA 3WIJA 4RL3A 1EDTA 4UR9A 4JFWA 1GHRA 1XGZA 3SUWA 4TVDA 4PMRA 1PX8A 2BS9A 1TQWA 3CYFA 2R1VB 3BCDA 2YL6A 4HMEA 1QVWA 2A3CA 1XSJA 3GH5A 4FF5A 3F71A 2D3LA 4B3LA 3DECA 1GPMA 4P8WA 2H2WA 3FN9A 1G1YA 3GXFA 1FH7A 1QVBA 3CZKA 1KWKA 4U2YA 2Z1SA 2GJPA 2DT1A 1KXQA 1H2JA 2GK1B 2W5FA 4BQ2A 3BAKA 4E8DA 3IK2A 2C8NA 1OX4B 1TR1A 3EMCA 4ZXLA 4MNKA 1Q7RA 3OZPA 1X1NA 1WNOA 3BAJA 3VKKA 5CJ5A 1BPLB 5E1QA 1OIFA 4ML4A 2CPUA 3GNOA 5CGTA 2ZUNA 3ZOAA 4PUDA 5C70A 1CXKA 1QX1A 2OSWA 1T0BA 5GNZA 3LX9A 1CECA 1VFMA 1BQCA 4BS0A 3O6AA 4HMCA 4PMUA 4HU8A 3GXMA 2JALA 2J7GA 2WC3A 1LG1A 2CNCA 1UWIA 1VJZA 4WKAA 3W81A 1E4MM 1UWUA 4QDMA 1CXFA 1V6XA 4DWSC 1PE0A 3BSHA 3CZGA 2VZTA 1XC6A 1NARA 3F5KA 3K4AA 1DWHM 2AOSA 1M03A 1K9DA 4AZGA 4Z2JA 1BF2A 5A3HA 3LRKA 4UOZA 2F8QA 1E6PA 3M6DA 5GQBA 3SURA 2OWWA 5IHSA 2CETA 1Y7VA 3GNPA 3PZUA 1LF1A 1JAEA 3AS3A 3RJXA 3ARZA 4HZ6A 1P6WA 3N1AA 3GBDA 1OINA 3PQ8A 1VB9A 2BHYA 1U2YA 3WL1A 4LRUA 2YFOA 1UHVA 3W37A 5CPTA 4H04A 3WN6A 1V6YA 4UQEA 1JYNA 4ATLA 2ISSD 1W3HA 1T36B 2WXDM 1V3LA 4OKDA 3CUFA 4JCMA 5A69A 2O9TA 3WUBA 1QVVA 2EPOA 3OGSA 3WF3A 2C0HA 5GNYA 3UG5A 2VCAA 3TTOA 1IT0A 3VM7A 1AQMA 4UTFA 1B3WA 4J3UA 5FOOA 4AUMA 1A47A 1V6WA 1JYWA 1AQHA 3CZ8A 3BWEA 3BUPA 1TVPA 4NZFA 4MADA 1QHPA 3WQ6A 4W89A 2ZXAA 4M8UA 1GOIA 3BAIA 1B2YA 2V3GA 2D22A 1FP9A 3T09A 1XYFA 1E4NA 3WL0A 2QF8A 2BY3A 1CGTA 3NCOA 1GZJA 4AXNA 2W61A 3BSGA 3AISA 5LA1A 4JHZA 3TTWA 1OT1A 1JZ7A 2DH2A 2EPNA 3EDDA 2VR4A 4A4AA 1KA9H 5LA0A 2J7FA 1U30A 4P7QA 1C8QA 1UCFA 2OSXA 2Q8XA 4AY1A 1H41A 4AMWA 1W3LA 4R7GA 3CV5A 3NORA 1C30B 1I1WA 4F9DA 3E1F1 3FSEA 2HVMA 2WWCA 4UQ9A 4MB5A 3CUIA 4M80A 3WMCA 1P5FA 4NXKA 4TX8A 5IFPA 3RHTA 1CYGA 3T08A 5C8BB 1QW8A 1J0KA 4AZ7A 1GW1A 2QMJA 5FCZA 4C7GA 3BUDA 1KWGA 1HP4A 2Z1KA 1NOUA 3KL0A 4PUEA 3W27A 1K6AA 2YIHA 3CLWA 3W4RA 4E4PA 1C91A 4S3JA 2W91A 1SMDA 2Y4SA 1FHLA 1KQZA 4B9ZA 2FYVA 3W53A 1Q6FA 3N9KA 4W85A 1US2A 4ACYA 6TAAA 1JXKA 4LPCA 2WZHA 4PYSA 3O2LA 1J0YA 3VMPA 1NH6A 2UWFA 4AWEA 3MUZ1 2FGLA 3RMEA 4LYPA 2J79A 4F79A 4HMDA 1OWQA 2F7RA 2YWJA 4ATDA 1EOMA 1GUVA 1GOQA 2CBVA 1BG9A 1TUXA 1B9ZA 5HPOA 1ESWA 3PTKA 2XGIA 1GGKA 4M29A 8CGTA 3CHCA 4Q22A 1UQZA 4LXFA 3A24A 2WMHA 4AZBA 4ZGGA 5A6AA 1CDGA 3WBEA 2WCSA 2ZX7A 1E3ZA 3AXXA 4C7FA 4HOWA 4D6IA 1FY2A 5JIWA 3B38A 3F5LA 4B16A 4PMOA 1T3TA 3GRAA 1LL4A 2PBOA 3UETA 1DHKA 2PWEA 1W1VA 2G4FA 1ZBCA 1A3HA 2XPKA 1KTCA 3KL3A 1EHAA 4FNUA 4W93A 3TOPA 1BSIA 1C90A 5SY9A 2WC7A 1E6NA 3WDHA 2J62A 2DT3A 4PMZA 4N42A 3T0AA 1WKYA 2W66A 3CO4A 3WELA 4D6CA 2VZUA 3N18A 3PZOA 4AUNA 2Y2WA 5HNNA 4EANA 2CXGA 2VRQA 2CESA 1OCQA 5BV2P 3WH5A 2FH8A 3VUPA 4JCLA 3ZJ6A 1JI1A 5FL0A 1WB0A 3AJ7A 3DX2A 1E15A 4L8FA 4R27A 1WL8A 3BHNA 3OGRA 4D71A 1ITCA 1E9LA 2ZWZA 2J7HA 4MNMA 4FLSA 3WKZA 4WKFA 1JF6A 1TVNA 4V2XA 2VRNA 4GO8A 4BZYA 3DDGA 3BMWA 3MSDA 1V0NA 3K8LA 4LGXA 4TUFA 4MDOA 2O9OA 3WY3A 1WZMA 4LX4A 3AICA 3N15A 2D3NA 2YDRA 5BCAA 1S46A 4Z2IA 3VIMA 2ZXQA 2V3FA 1OGGA 2D24A 5E6ZA 1VBUA 2RGLA 1DWAM 1VENA 2XN2A 3EN0A 4BF7A 2ESCA 1L0PA 2J7CA 3AMDA 3GZAA 3DX4A 4AZHA 4W5ZA 1B3ZA 4TVUA 1VCMA 3U5YA 1CE8B 3OB8A 2B31A 5D9MA 4L8YA 3GXPA 4JKKA 4ZDKA 5JBFA 4CD4A 1X6NA 4U3AA 5A1AA 1M7XA 4MJ2A 4W5UA 1JZ5A 1H11A 4HP5A 4HOXA 3N13A 4UFMA 4Y1FA 1OIMA 2NW0A 4U3CA 3TTUA 2WK2A 1HF6A 2WWDA 2WPGA 3D5HA 1K9EA 1UR8A 4U33A 5DT7A 1GORA 2WHMA 4ENRA 3VSTA 2ZX9A 1MFUA 2VKTA 5E09A 1UWTA 1E40A 1M04A 1T0OA 3GYCA 3ZR4B 3GM8A 4I2NA 2W67A 4HU0A 4AMXA 4F8XA 1HXKA 1XSKA 2ZE0A 4IPNB 1HKMA 1LL6A 1NP0A 5DMYA 2WAGA 1TFVA 2FHCA 4ENUA 1IZZA 3IJ9A 4UQDA 1OY1A 5E0CA 3MANA 2R1UA 1C8YA 3D3AA 1MW0A 5D4YA 1M53A 1E6ZA 3CZNA 4GPNA 1V02A 4PEEA 2YDQA 2DT2A 1LL7A 3DX3A 3EFEA 2WHKA 1MXDA 4DWSA 4Y1EA 4ENVA 3MU7A 3B8SA 4HZ8A 3F5DA 2Y24A 3AHZA 3RDKA 3OBAA 5A2CA 1L8NA 1VEPA 4CVWA 3WH7A 1HVXA 4PN2A 5IXEA 3W0KA 6CGTA 4ENQA 3R75A 3VGHA 2G3JA 2Y8KA 3ZT6A 5I2UA 2GFTA 4C7DA 1OGBA 4MTVA 2XJ7A 3VIIA 1NWSA 2JE8A 3PQ5A 3AQUA 3ARTA 1K9FA 2WYSA 3UR7A 1LWJA 3WFZA 4DO5A 1V0LA 1KGXA 1MVYA 2A3BA 4GI6A 3UERA 2YDSA 2WVSA 1DWJM 2XTKA 1HJXA 5C71A 4DUWA 3W6MA 1RP9A 2J74A 5CSYA 1QBAA 5A8QA 1XH2A 2BY0A 2GDVA 5FIPA 2AMGA 1HP5A 1SOAA 3S2CA 4MJ4A 4FNSA 2JEQA 1W9DM 4MNJA 1QI4A 2VX7A 4D6FA 2V4UA 5ABGA 4QLKA 1W1PA 4UOQA 2MANA 1GOMA 3W24A 5BXPA 2G3MA 4AUEA 1TQUA 3A22A 2A3EA 2F61A 2XWEA 3TV8A 2YLAA 4JIEA 4F66A 3VGBA 2BHZA 3PZQA 2VXOA 3WDIA 2X8RA 4GO9A 1UZ4A 1VAHA 3EDKA 2QPSA 2F2HA 2GDUA 1JFHA 2XVGA 1UG6A 3PZTA 4MPKA 3CUJA 3N11A 1K9VF 2E0PA 1ISZA 1B31A 1ZBWA 1QI0A 3MGKA 3QR3A 1AVAA 1GPFA 3OLDA 3LRMA 4CN4A 4LGYA 5IP5A 3EZGA 1EH9A 3M3PA 4B40A 4L4OA 3UESA 4ATWA 4UFKA 1KXVA 1E55A 4J3VA 3VU2A 1BYCA 5IHRA 4ZE5A 4ENTA 1US3A 3WQ8A 3UEQA 1D3CA 1FOBA 2XVPA 4DUXA 1BYDA 4TXEA 4GE3A 2WMIA 4DWSB 3BUBA 1NOFA 3G6MA 1UD6A 4P5PA 1ZJAA 4PCSA 3ARXA 2VDJA 5SYAA 2YA1A 3ZQ9A 1CXEA 2JIWA 3S5ZA 3RILA 4ENSA 4QAWA 1ISYA 1WDQA 5DF0A 2X0HA 2BHUA 3PHAA 3IAPA
chains in the Genus database with same CATH superfamily
5I5IA 5IKMA 2PGRA 1QLRA 1E71M 1JZ6A 1C1DA 4RF2A 4MSWA 1OXMA 1ZGLA 4L05A 4MNQE 1FTQA 4OGKA 4OFWA 3D4PA 3MINA 1MF2H 4Z8FH 4Q6KA 3LEXB 4XXHA 1ORSA 2E8YA 3TJXA 2QTAA 4YVUA 3GIVA 1CFQB 1F3WA 4ZJZA 4DSUA 3KM0A 1XF4B 1RZ3A 4R1UA 4A4DA 4GMEA 4V0QA 4CI0B 4HWZB 2OBGA 2AITA 3S7TA 4AYTA 2WB7A 4G1UC 1E2JA 4TS1A 4MZDA 1H4PA 4M3HA 3I6LE 3UPTA 3IAEA 2I78A 1C2YA 5GS1C 3PDIB 1T2DA 1OOAA 3WLAA 4CFZA 2G3IA 4AQAA 1YFKA 4B2DD 5HW0A 4FZ5A 1ZS8A 2O6LA 4WBSA 2WWKO 5AZ2H 2OCZA 4UOW0 4MEAA 1TUPA 2LLNA 2P2LA 3ABRA 4GG6F 2Q3DA 1G5IA 4WZBE 1FO0H 2QLVB 3B9KA 1VLXA 3IUMA 4XTRC 2RKWA 4I9MA 5JY1A 4RD6A 4W9TA 3N59A 1URPA 3F2LA 1TZ7A 4U1RA 5G2HA 1X8KA 3DCJA 4IX0A 2J73A 1KUMA 1FJGB 3GSOB 2GC7C 3UPRB 4ZU6X 3A05A 2MFNA 2AEEA 1KFKA 2O2YA 2BF4A 4UV7H 1FFQA 3EAQA 3ETBJ 4RADA 3CL8A 2I25N 3SX0A 3N75A 3I0MA 4X6DB 1OW0C 1UOKA 3EGSA 1Z0SA 2Q5OA 4ECAA 2ZUVA 3RL2B 5D9SA 1RHUA 3U60B 3CLVA 5XIMA 3BSMA 4ICNA 3O0FA 2QD2A 1YCFA 1XCWA 5IUCA 3QQWA 2NY5L 3JQFA 2YYZA 4DLPA 4NBTA 1GG0A 3F12A 4GXTA 1QHOA 4B4KA 1GGUA 1R5JA 4RXTA 4J0JA 1QLRB 3B36A 1C1DB 3GU3A 4MSWB 1ZGLB 3OQPA 1XXHE 2H5UA 3DFIA 3R1GH 3CZ9A 3MINB 2F7FA 3HHRB 4P48A 1ORSB 2H7VA 2NTNA 3V8NA 1A6WL 3QMTA 3OJMB 1SEBA 3CH1A 3GIVB 2O5NA 1ACLA 2XKKA 4OGFA 2G2RA 7TAAA 4BHTA 4YA6A 2E7ZA 5D7BA 5F1UA 4NMHA 3T71A 4QNEA 3SR7A 3H2GA 2R11A 1GIAA 3MUUA 3UGKA 1LLFA 4MGGA 4LOEA 2SECE 1T6MA 2XB6A 3SCZA 3KQKA 1P7ZA 5HIMA 2KBGA 3KS0H 4XI5C 3C4VA 1YIOA 1ZD3A 4AQAB 3ZZ1A 2Y2YA 3JD4A 1ZS8B 5CVUA 3U1BA 5F5LA 4DQAA 3L2NA 5D7LB 1XPRA 3ABRB 4H08A 4UAGA 1VLWA 3PEUA 5HILA 2AFHA 2PR2A 4PMEA 3B9KB 2HKAA 5A2BA 1EUQA 3D64A 3RU7A 1GNPA 4JZJA 2X1OA 2EDFA 4FFVD 3WVNA 1P4BH 5IZ7A 3MNMA 2V6JA 3ZE6A 5B1KA 3U30B 2V03A 4N6FA 5G2IA 5JXJA 5LBGA 1ODFA 4HAUA 1X9HA 5IVNA 3C0QA 5A6BA 1NSYA 4P3YA 5DMHA 1KFKB 3QC3A 5E6IA 5T5NG 2V7UA 1JLLA 2GC4C 3A9UA 4OQXA 5B3KA 4PCKA 4Z0BL 4GAEA 1RQ2A 3EGSB 2F8VA 3PWJA 4ZMBA 4OH2A 5JW3L 4KYIB 5D9SB 2J46A 2VH5R 3CAQA 4G6CA 2VYND 2XGJA 2WQRA 2XV0A 4YIKA 4C91A 3F7NA 2QV4A 1KN4H 1R16A 3APMA 4QARA 3F12B 5BQ7B 1V8FA 3LN3A 2VTEA 2YWDA 3LMJH 1K3IA 4FOOA 4EE2A 5G4WA 3PR2A 3O3RA 2VXBA 1LB1B 3DURA 3FTSA 3FCOA 4YCMA 2RIKA 1JIIA 5EE0A 4M6NH 3M5VA 2FX8L 1ALDA 1LQBC 3CFCH 4GMKA 4WADA 1TZJA 5J4YA 3QKEA 1GGJA 2D5IA 3V4BA 3M6UA 1SEBB 1NYQA 2QTCA 2C3XA 1BOFA 5C31A 1O5OA 2B16A 2G2RB 4QG7A 1E8NA 5EQTA 3DNMA 3HZRA 4BNLA 1FDIA 4MD0B 3RC3A 3TR5A 4F3YA 4LHUD 1GNQA 3DN5A 2BKXA 3V48A 4I2XE 5FSEC 1E1CA 1HUVA 4NCHA 1DNPA 3FTPA 1HI9A 1YJ8A 4B3ZA 1YJXA 3FCEA 3UDWA 2VLIA 4D3ZA 1L8XA 4XBSA 2WM9B 1FQ9C 3N05A 1WIOA 1JA9A 2MNJB 2ZI6A 4MS1A 3G0IA 3ACCA 3FHOA 3NHPA 3BP6A 5HHVL 1ODSA 2AFHB 1WZ1H 3H6GA 2JHFA 3KBOA 4JZJB 3DR3A 4FHFA 2IW0A 2BGLA 3VXOA 2WLKA 4CMAA 2P3ZA 2ZVQX 3NOVA 3DBLB 1VFOA 3AU6A 1N92A 2GJJA 2BEJA 4AKGA 4YPOA 3JWJA 2Q87A 5E6IB 3WFJA 4KK6D 1R0MA 4RXFA 3SPVB 4RZ6A 1JLLB 2Y8VA 2Y1YA 5ISZD 2WD7A 1BM3H 1VFFA 1L5VA 2DLCX 1C3FA 2H1HA 3PWJB 5FYQA 1K3UA 3QUMA 1QNSA 2NY2B 1Z8DA 5A5VA 5F9DC 3L3IA 1O3YA 3TQOA 2PUFA 2APJA 4UU7A 4LV8B 1MZYA 2X2YA 3VDCA 1J48A 2G95A 3OZCA 2PUQT 1EPXA 2GWNA 3UBXA 4KZ0A 1CSEE 3COTA 3AM8C 2ZP8A 1RWXA 3DH7A 1CJCA 2Z2BA 1MZHA 3H54A 2P8JA 3PR2B 3LDFA 1F3EA 2GW5A 1LRNA 3DURB 2OWEA 5I1EL 3QEAZ 4C4KO 1MCEA 2Z64C 2Q8BL 4RZ2A 2J55A 4FQ7A 4OHXA 3UYLA 4XMKH 4HSAC 1P80A 2XXJA 1BYNA 3E2VA 1VPVA 4I5IA 4WSOA 1R1DA 2CLZA 2N75A 2H54A 1YMVA 3JATA 4ZI8A 3GDOA 1NBME 3VZQA 3W70A 4GPAA 3UWKA 1E1CB 1NASA 2W83A 1RIVL 2FFRA 5LNVA 1QH1B 4JFRA 3ZD7A 4LQ4A 3AY2A 1YXCA 621PA 1CF1A 4H3KB 3LG2A 4CKCA 3E3MA 3BP6B 3RCNA 3X0DA 3UMNA 4LK2A 1E59A 4F9FA 3AS1A 5DULA 2ZRAA 4OCRL 2HRGA 4YX2H 2ODWA 3GBLA 2C9CA 3VXOB 4ZQKA 4NZ1A 3W7NA 1I6NA 2QAGA 4OKIA 4O58L 2XX0A 2C7BA 1DTEA 1ZGGA 4AG3A 2P77A 1HJWA 2OE2A 4H2AA 4NYMQ 1OGAE 2Z4GA 2XTJA 1YO4A 5E70A 3RG6A 4Y5XC 3R4RA 4QHYA 3RIMA 3NJHA 4DLAA 4X97A 4UXHA 1XTQA 3ZDEA 1E64A 2OCAA 1K3UB 3DDFA 4URFA 1NFKA 3L3IB 4RDIA 1X4YA 5CCJA 4J0CA 4LBZA 2L7QA 4IJVA 4PREA 2PUHA 2JFEX 3BC1A 1NV8A 2OL3B 3UBXB 4PFKA 2QPTA 5ALMA 2Y25A 2Q6ZA 1JIBA 4X1OA 4HQFA 2JCCE 3Q0IA 4YUEL 1CQJA 4PV7A 4OD1L 3IDIB 1E0JA 5E9DA 3KDAA 4FEZA 1EFXA 4H6XA 1NW5A 4JFFD 4LO9A 2YAFA 5GRVK 4BCZA 4MQ5A 5JVDF 2FLVA 5LD2B 2ZSKA 4PRAA 5H8PA 2J7DA 3NPAA 4XI5D 2BIFA 1NKTA 3VR3A 4M0DA 2P65A 4UUPA 4KSYA 5BO0D 3JATB 1USVA 3I1YA 2QM3A 1KNXA 2NYAA 1MQAA 5DD1L 1NMAH 3WFCH 4B9GA 1MW3A 5HGJA 3UTSD 2D3TA 2PGDA 4ZZ1A 3HJUA 2V3EA 1BHO1 2QDEA 1Y4SA 1IZJA 3TIMA 3DTNA 2A1WL 3H7BA 1TEFA 2BJWA 1HH6A 4GPD1 4W9JC 1XTTA 4OSEA 4QE5A 5EHQA 4ABTA 2EYRA 3HNOA 4N0FA 4NQZA 4CKCB 3A10A 4PY7A 2O4UX 2F3SA 4TLUA 2X1RA 4M81A 2CZ5A 4FLHA 2JKRM 3K1AA 3B2VL 3MGOA 4J90A 3KCWA 3EGXA 2QAGB 5KHOC 1U11A 3LT4A 4P05A 1ZCJA 1UH2A 1GZ4A 5E6RA 2XTJB 1L5NA 1WAAE 4LASH 4AX3A 1XIWA 4L6HA 3QU5A 4TVPD 1I7QB 1GGFA 2Y0PA 3TNFA 1BDIA 3M17A 3OP1A 2V6IA 1F3RB 3LPDA 1B26A 3ILEA 1F6BA 5CA0A 2KX9A 3FTXA 4V27A 4PXSA 4MJMA 3NVKI 4TTQA 4CDNA 2QCMA 4PJEE 1Q21A 4MVJA 2ZJ6A 5C97A 2W63A 4GABA 2C9MA 7FABH 1U8LA 1H19A 1J5HA 3DDUA 4MIOA 1U2CA 4WFGE 2C82A 3OIVA 1CQPA 1P6AB 3WBDA 4CLDA 5E9DB 3VWKD 5EWIL 1K8RA 5LIYX 1EFXB 5JHDA 5IJAA 2EDWA 1HJQA 4BZXA 1GITA 4FMVA 1H0RA 3PDWA 1B6UA 1RA5A 4G01B 4NGHH 2YB1A 4HK3J 3BW3A 3NIYA 3C2YA 1JWMA 2UZ9A 1VMEA 3C6KA 4RDXA 3IHWA 1DJXA 1RP8A 3L3OC 3BX1A 1LHZA 2R8SH 2OC9A 5F96L 2Z1VA 4MITA 1TG8A 1TREA 1TT7A 4OD3H 3U7WH 5PTDA 4F27A 2D1SA 5D37A 1O12A 5LMNB 3GFQA 4WMLA 1YVRA 3FTCA 3H7BB 1JALA 4XQ9A 1XSOA 1LLWA 1HH6B 2K70A 1PZUB 3PC3A 2EYRB 1JHVA 4G07A 1PX2A 4N0FB 4G5XA 3TN0C 3DW3X 4GZEA 3VXSA 1ZITA 1H4SA 3RRAA 4PY7B 2DD8L 2FSEA 4XP1H 3OHPA 4KI5D 1J24A 4O50A 1XW8A 3PZVA 3ZJ4A 1P5UA 2FYYA 3GEHA 5C9KA 3MRHA 3K1AB 3MGOB 1E8MA 3OQHA 4J3TA 3F4WA 3N9GL 3NJ3A 3QUZD 3FT0A 3EGXB 3U57A 3O4IA 4GLFA 3T0IA 4H0FA 4R2LA 2VQFB 1P2UA 3R11A 1QRUA 1NBIA 1MJGM 1MJUL 1G8JA 3FWZA 5E6RB 4NQED 2JF6A 5KWYC 4YCOA 4KRXA 1XIWB 4Y2OA 2VTVA 3HFYA 4RX1A 1YI8A 4GU5A 4Q19A 4WNAA 2W9LA 1ME9A 3B9AA 1D2AA 2QD1A 1QE0A 5FHQA 4Z7JA 1RVFL 4N2BA 1TTHA 5B6IA 4DGSA 4EF4A 3V97A 2NNWB 1SCJA 3MTRA 1JYVA 4M5YL 1GVRA 3TPUA 1L6ZA 3OAAD 4GFSA 4NKIH 4Z2GA 3RRMA 4JTIA 1X74A 1U36A 2C7OA 3X1YA 1A50A 1KV7A 1U8LB 5A2AA 4OA5A 1G41A 4JBNA 2IEDA 4ACAA 2XVYA 3GO1H 1NAL1 4B3RB 1OZQA 2WLMA 5J5RA 3ANTA 3ZZUA 2V1UA 2EAWA 3JSAA 3N0TA 1GY2A 3GS6A 5JHDB 4PLNC 3UJHA 5JNUA 4BYHA 3QZBA 4PJ5E 3IIOA 2IHZA 2FBRA 3D2UD 3BKJH 2ONKA 4U7WA 2G5BA 5K9CA 2FMOA 3UZEC 3BWYA 3GOQA 3UB4A 3ZDRA 3UO1L 2ACRA 2QXTA 1MW1A 1JWMB 2DPKA 1ZC3A 3GDHA 3HIZA 4KV5F 1T4GA 4LT7A 2W4QA 2B4CH 3OJXA 4XGNA 3Q7QA 5K4AA 1CDOA 2R8XA 1FYVA 4X9XA 4FK8A 3UFXA 2QVHA 3KJFA 4D2NA 3CXHK 5J3JA 5K1NA 4KS0A 4BD4A 2QHRL 1FCUA 2P1YA 3NQDA 3I0ZA 5DHTA 1X97A 4A5OA 2BXZA 5F2EA 2GT9A 4OUOA 4F2DA 7PTDA 3PP4H 5EZIH 4CVZA 4DI8A 2CFSA 3JTSA 1QPKA 2FSEB 4AVFA 3OWHA 1NTDA 2YMQA 1TQXA 1OEZW 4DLMA 721PA 1P5UB 2XMQA 2FYYB 2PZMA 5CLLA 3MRHB 3ROKA 3RS4A 3PSWA 3VBEA 1MO6A 4IRSA 5D2YA 5HP4A 4R5VA 4PZLA 3ROLA 2AQPA 4I7UA 4NS1A 3JPWA 4Y2OB 1JOIA 2RDUA 4GO1A 3NIFB 1INLA 3KLBA 3OL2A 4JVLA 2ENPA 1Z2DA 4IDOA 1CUXA 3TBSA 3CEHA 1DBQA 4E5XA 5TDHA 5CFLA 1PDKA 3R20A 3TDFA 1AGXA 3ZWSA 2XEDA 3MUNA 4DOHE 1KCLA 3IPCA 3L0YA 2J9ZA 3Q12A 5E8OA 3M6XA 2V3CC 4O59O 3TPUB 4UTBA 4I9XA 1W6TA 3BVXA 3C75A 4DN4H 3NVTA 1GS8A 1DVFA 2ZYDA 1FL5A 2DI9A 3PYMA 1C5BH 2ZR9A 5IMKA 4FTVE 1O6GA 2OXRA 1XA4A 5TIIA 2C4FT 3G5MA 2NNCA 5TQVA 4QTYA 3BCSA 4QBGB 4ZJPA 1YZTA 4M8VA 5D9PA 2AMUA 1N8NA 2G5BB 2VPQA 5HDLA 3N91A 1U2PA 4IRZA 5KQPA 2CBUA 5KVEL 5I7SA 4WK2B 5G0TA 1M2VA 1N2XA 4J40A 4GKAA 3O8RA 1TJ3A 1YZHA 3A4JA 1SC9A 4MCZA 1R9NA 1UAGA 3MSGA 4Y1AA 5D96B 4BNHA 4FYSA 1R5BA 3UFXB 1Z7AA 1MW2A 1AA9A 3B6EA 3TU9A 1XWYA 3PI6A 4BLVA 3M86A 4DJDA 1RIUH 2W7TA 4CCCA 3IF1A 3AJRA 1SK9A 4EY5A 2RHLA 1FLRH 1Q0UA 2GT9B 2GEKA 4MWTA 4PJXE 4NLHA 2YL8A 4UHFA 3AIBA 4IK7A 2DE0X 4CVZB 5BZXA 3Q2DA 1SVKA 4ORMA 3JTSB 3C5ZB 4YJ5A 3MLZL 4LVOC 2BNRA 3GSNA 4HUNB 2GPZA 5EJ6A 4IGBD 1IXKA 1MD9A 2GAZA 2GHRA 4WOCA 5KTKA 4H9VA 3I9FA 1Z9AA 4EDWL 1SVIA 1IWAA 1V3IA 2G06A 4JG5A 4YK7A 3RYSA 1B76A 1P2CA 3INNA 4O8CA 1ZLVH 2NDGA 3CVBA 1KBGH 2M83A 2Z8XA 2JJTA 3DFMA 3HYSA 4IRSB 5IAEA 3R0MA 5F6IC 3L4ZA 4JOQA 5DD5L 1MCZA 4ZKDA 3ROLB 4ZX5A 3FCTA 1LY1A 4JP8A 4GC9A 4DK6A 2CWDA 1OAQH 2I76A 2QWXA 1XLWA 2Z1MA 1X3SA 5LO7A 1NM5C 1YAIA 1CLVA 3TBSB 4FCVA 4E5XB 5JHLL 4JBRA 1PDKB 4NYMR 4X84A 5FM8A 1XICA 3S2UA 4RTNA 3HC4L 4UTKA 1S2GA 3UYPA 3MMWA 1U8HB 1NC4A 2J9ZB 3ILDA 5E8OB 5JO9A 5C6TH 2PZJA 4XB1A 2Q3BA 4R90H 4OFPA 4W88A 4YMLA 1FGNL 1DVFB 1NWRA 2BFCA 3L5XL 1FL5B 5IMKB 2OR2A 3FOCA 5B7ZA 1EDOA 3AR7A 3DBRB 1WXEA 2HJ9A 3E5RA 4A10A 1DARA 2MNUA 3LNEA 5C8VA 3ZL1A 5LBUA 5DRNA 2F74A 4NCKA 3O8DA 2NLOA 4TVKA 2HWGA 3DTDA 4JO1H 5JW6A 4DV7B 3OV6A 1UG9A 3APCA 4S3KA 4D3XA 3S8YA 1ZT1A 3SHTA 2OORA 1M2VB 4PFSA 4MCZB 4Y1AB 1FJ1A 2WVTA 1ZLUH 4M1DH 4JOCA 1BP3B 3TN0D 1B3XA 4B3CA 5JZSA 3TOXA 3VI4E 4HPOL 1DIKA 1XIHA 3ZGHA 5HMFA 5FX2A 3RYIA 3IKMB 1JGMA 3VHLB 1KMNA 5K39A 4UUAA 3PUEA 1SIOA 3CHQA 3OZOA 2ABBA 1H6DA 3JTTA 3CU2A 2J7BA 4BP8A 5LIPA 3QSKB 2I57A 1CUJA 4ALIA 2M1KA 1SUWA 2BNRB 4YDMA 3GSNB 3KTDA 2GJ6A 4CF5A 3KYKH 3F3HA 1OCZB 2DU8A 3V0WL 3TFCA 4UILH 3E0GA 4NERA 1P2CB 2PZGA 4JDVA 2DLTA 4M5ZH 1URIA 2VUKA 1TGYA 4NQCA 2PCLA 1JHUA 4BVAA 4FF7A 3P5SA 4S3BA 3FCTB 2Q8ZA 1T3LA 2QQ0A 4JDEB 3IBEA 2WJDA 1HQDA 1SCBA 3G5VA 4Y1SA 1QORA 1AKEA 3I23A 1NFRA 4JJIA 3M33A 1VFHA 3FDXA 4CMEA 5AOIA 1GKEA 1Z45A 4B6GA 3UYPB 2GZXA 3SPCA 1NC4B 3U4GA 3HCVA 1W47A 3PWPE 4M38A 1SC1A 4I4NA 3WE7A 4QHLA 4L1KA 1JIKA 1TTAA 4XAGA 2H7YA 4ZVMA 3L8FA 3QUYC 2BFCB 4PZEA 2V8OA 1PBYA 4IXTA 2Q3ZA 3G6DL 3JVDA 1QV7A 2XAAA 1W7AA 4OUDA 1RBOB 3P8JA 5AHFA 4BFKA 1RRGA 2V5JA 2WSPA 3EPKA 3D7RA 4ODHL 2F74B 3F62A 3IS0X 3L6CA 5CLWA 4L0QA 3LFHA 3GT4A 3TOSA 3WLPA 5CSUA 1FWDC 3QOKA 3IMUA 3TVMC 4D0RA 2GCOB 3DUWA 1A8PA 1VHLA 1U6KA 4WI6A 1FJ1B 3CIOA 2YR0A 3TYCA 1UJCA 4TMBA 4PGMA 4EKJA 3BVWA 2YMMA 2PZAA 1SFHA 3CF0A 4MKZA 8ABPA 5K0TA 3ZMEA 2N47A 1FG2A 3LO8A 3PTMA 3OUZA 1TUIA 1DT3A 4EF9A 1TM2A 3GJ7A 2PA0A 3RYIB 1KI8A 3APFA 1LF5A 4IJTA 5K39B 1DQKA 1LO4H 4QRHA 3JTTB 4JN2B 4M9XA 3C14C 3OC8A 4C7JA 2NY3B 4HNNA 4TYQA 5CILL 1Q63A 3GDWA 3RK8A 3AG6A 2FUTA 2GJ6B 3VKHA 4NI3A 2D1ZA 2Q8NA 2WGNB 3UFYA 4OOEA 4MYHA 3TQIA 1GRNA 2NM0A 5I6OA 1CTOA 3GUGA 4TUKL 1FZTA 2YQ4A 2HFGL 5EIFA 3LPWA 1CXIA 1IBKB 1R0SA 2B6NA 4FB4A 4S2CA 3G5VB 3ND8A 4QLRA 4A8TA 5ADOH 3AVWA 3UX9B 4PWHA 4W6WB 3E3HA 1JPTH 5JJCA 5LVAA 1XLGA 1IM3D 2W62A 4TPRH 1P0FA 4EG8A 2FSSA 5GZ6A 3HCVB 2Z8RA 4ZHQF 3CG0A 4CGYA 3ESVF 1X7QA 3LQ1A 4RQAA 5JSHA 4QE3A 4QHLB 5ILQA 1IGIL 2ZJBA 5J89A 1XRQA 5C2BL 4PMRA 3SDCA 15C8L 1V8PA 1N7KA 2BS9A 1Z25A 3CD4A 2E9JA 2YMXH 4HMEA 4PV8A 1XBZA 3VOFA 1NMBL 1HG0A 3SDYH 4OUDB 2HLAB 4QDXA 3X3GL 3SE3C 3QA3A 1I5EA 4P8WA 3IGFA 4LT9A 4CT5A 4JMNA 5KYUA 1P74A 1FTYA 5K3DA 3DAOA 2PUBA 1PFYA 3LQLA 2I27N 4LNVA 3KIPA 1V8EA 4M0KA 3B8IA 4BQ2A 3BAKA 3ZZSA 4C1KA 5A9SA 4NXMB 4RGNE 4RKFA 3E1SA 1IC5H 3QXHA 4IFBA 5CG2A 2M2IA 4PYMA 2QP9X 5FI1B 2X38A 2Z8ZA 5IB5A 5JTWA 3IUIA 3LCGA 3SQXA 2ZUNA 2N01B 1LVGA 3EB3A 1FG2B 1H65A 5HMEA 1D6JA 3N5CA 4J3OG 1XF3A 2DSNA 3KFTA 1Q74A 2IYWA 3T0WA 3KKOA 3NA9H 3MREA 5AJVB 2NX9A 1G66A 4WACA 2ILLA 2WWTA 3B7PA 3OKCA 2GDJA 4LJRA 1IC6A 1QBMH 1ACJA 2Q9AA 3SGEH 4D3CH 5BXYA 3CVOA 3DX5A 4AEHL 3CLUC 4LY6A 2Q7YA 4YFDB 1JN6A 3R0XA 4ZQTA 3CRZA 1Q5PA 3M6DA 3SN4A 1TPDA 3LF1A 3REWA 1UUSA 3TMLA 2CETA 3KDMA 3O0KA 3MBOA 4O2EB 1KFBA 1FVXA 1A0DA 2QW5A 1JIQA 1ZTVA 3EWZA 4K6HA 3N1AA 1Q20A 5LC1A 4CPDA 3C5SA 1XFBA 2GZ3A 2OXHA 3ETDA 5NLLA 3N2YA 3T54A 4MWSA 2ICSA 3WL1A 3ME3A 4YJDA 3JUZA 3WN6A 1QNIA 2I0FA 4X6DF 4CQMB 1BEZA 3H2JA 3B03A 4HK4A 3ZUCA 1TTPA 2OL3H 4NUMA 2ZWLT 5FUQA 3G1UA 2O5EA 1OZFA 4IV0A 3G5AA 2PBLA 4WUTA 2WB2A 4AC4A 3NV7A 2OX4A 1U5BA 4DCJA 2DFKB 4XDGA 4O53A 1JZDC 4PV8B 4UB0H 1EZVY 4X92A 3P81A 1OILA 2E1WA 2FQYA 3DKHA 1Q9WA 2PODA 3FOLA 2GBIA 3M1IA 4I4CA 2RA1A 3QA3B 5IX8A 3NFPA 1E5XA 3RKRA 5KYUB 3DA0A 3FGCA 1O5QA 4IFKA 3MJWA 3W7QA 1QEXA 4BE5A 4KFMA 4CDRA 3UMTA 1RBYA 4ZDHA 1RXWA 1C7RA 1P48A 3PQYE 4I4TA 4XUEA 3TCKA 2ACQA 5A9SB 5IHUH 5DCWA 1TIBA 4K9LA 2VR4A 4YVPA 3E0IA 5JTTA 5IB5B 4M9OA 1TYCA 1M7UA 1AA1B 1F58L 1GZDA 5A7BA 1AHNA 4IF4A 2XCTB 2ZG6A 5DHDA 5BZWA 2CYAA 3GDTA 3ZCTA 1XF3B 1GZGA 1SBSL 3E05A 2GWGA 3MREB 5J1TB 3MLXL 5KSYA 1LBMA 1WDWA 3B7TA 5FYKD 3NWRA 4NOBA 1Q19A 5LP6C 1Y18A 1FSKC 4E5YA 2WY3B 1GSIA 2Q7YB 2IFFH 1JN6B 2G09A 3L05A 4I1NB 1T9KA 2M6SA 3HJAA 3REWB 5DFVD 4YREA 2BMVA 3KDMB 2WLHA 4WI1A 4NO5B 5H4GA 1KFBB 4WDRA 4PUEA 1Z48A 1HILA 2I2BA 4HIQA 3TECE 4DXVA 3QEMA 2QMEA 4A6YL 3C5SB 4NNYA 3GW3A 3PEEA 1LT8A 2OXHB 4CJ0A 1FHLA 4G7VL 3MXOA 2Y07H 3N9KA 2P5ED 4JC5A 1YZZA 1SDYA 1BG6A 1LT7A 4G5OA 4ZSOA 3GLFE 3QUYD 2Z4SA 3KZNA 4HMDA 1TTPB 1HNWB 4IPJA 3NO1A 3D02A 5J11C 3HI6H 3FS9A 4M6ML 4YLCA 3O3CA 4NM4H 2WR8A 3W39B 1P1ZA 3A24A 2R29L 1OGJA 1NA8A 1QRNA 1JXFA 4G6AC 4P2QD 2AJVL 4NATA 5F72S 4HGKC 1U5BB 2XWXA 4RO0A 4YXKL 4BO6A 2PGIA 4I14A 4UMBA 2CRYA 3ARGC 5JUEH 4IFTA 3P4YA 1LL4A 3PRYA 1DHKA 5ABPA 4BGEA 1RV8A 1Q9WB 2XWQA 4ZEVA 4FNUA 3TOPA 3NFPB 3FWHA 3OEHA 3FGCB 2BWDA 3C3NA 3K5HA 3TKLA 3E8VA 3P93A 4IFKB 5AYUL 5BYBA 4U7JA 1VCAA 3PWAA 4OGLA 2EYSA 3I2CL 4LHQB 3P9XA 3DC2A 3RLGA 2GKGA 4KERA 4I4TB 2BM8A 3QEJA 5D87A 3JZDA 1CYDA 3GVVA 4YQXL 3VA2C 4G3YH 2YD2A 5EOCH 2PA3A 3QVAA 2P4SA 2I4OA 4PFQA 2ZXWB 3SQOA 4AEIL 2KLTA 4GNJA 4NU6A 2FVXA 4RPLA 5IBXC 1E2WA 1SUSA 3R5JA 3DPUA 3VOTA 3WKZA 1YMYA 4U1MA 4LB3A 1UEJA 1VQTA 4BZYA 3LOWA 2O61A 3U6XS 4EVRA 1ISFA 1WDWB 4PUBL 1PMYA 1DEKA 1WZMA 2WQDA 3W05A 4KPHL 4DANA 1A4BA 1BXKA 5M2QA 5LQMA 1Y18B 3W5BA 1EFRD 2PAAA 5AJZA 2JATA 3W0WD 2CFOA 2V3FA 1NDGA 3VTMA 3ZIYA 1BVUA 1G4HA 3IQFA 5LIWX 2DWDA 1W1B1 3GMQA 1YFJA 2DU2A 3L6UA 5A71A 3PDUA 1HILB 1SXJC 3LN4A 3QEMB 3UROR 4YZFF 2AFIE 4ZQFA 1OWNA 4NNYB 2GIMA 5J12C 3A2NA 1JILA 5LWYL 2FFAA 4LWZA 5GRYA 4L5YA 5D9MA 4XVTH 1ODTC 4PJ9A 1X6NA 3RLVA 3MV8D 4JUTA 5L2JA 5LKRA 4ZSOB 2DZWA 4XPBL 4MVJH 1S5IL 3KQSA 2SHKA 3D1LA 3D0QA 2FU5C 3J2PA 5KZCD 4JMXA 3ENEA 2Y0CA 3REQA 4HS8H 4DF3A 3D5HA 4JLJA 3NH7H 3OPYB 1P1ZB 3H6KA 4G0ZA 2K9UA 4V1CA 3SDDD 3HMQA 5DC0A 1YJDH 1PX0A 3PQEA 1QRNB 2E5DA 1LX7A 1PW5A 4FFWC 5DHFA 5IESH 1RZKC 4QAJA 4X9BA 4P4SA 3VA6A 5GQSA 1M04A 1G3RA 2ZR7A 4P7KA 2VDPB 4WZHA 3JYOA 4FXFA 5EQJB 3T42A 4M8IA 4YHLH 2CFTA 2WHPA 1ZIBA 1KPGA 2WSQA 4IPNB 4KO5A 1AKRA 4RELA 4OQEA 3K2QA 1TFVA 1UC4A 2E21A 1NW8A 3UW3A 3NL6A 1Q84A 4CHTA 1R9YA 2EYSB 3NVQA 3VV2A 4F4IA 2UUCB 4MV8A 1MW0A 2CRMA 2JKAA 4QTXA 4AN4A 1N2ZA 2VDOL 4ZD3H 1YA6A 3S27A 2VS1A 1TGVA 4RFOL 3MB9A 3K2KA 1TLLA 1PVNA 4ZB5A 4NH4A 3CLUD 1ECJA 4U1MB 3PV6A 5C4GB 5DWUL 1O94C 4WGXA 1CJVC 5FCSH 5HDBB 2O61B 2FZ3A 2NUPA 4KFSA 4PBFA 3G9AB 2A9OA 1MRFL 4RRPG 3FFSA 4ENQA 1ZGZA 4LC1A 4FN4A 1H3NA 4OGYH 3FYUA 3MRXA 5J2TA 1FBAA 2XJ7A 1NDGB 3SE4C 5ER9A 3RDTC 1UADA 1SG0A 1KK2A 2X6BA 2WP8J 2DWDB 3GMQB 1XMEB 1O9GA 1UA6L 2WIDA 3LN4B 3DO7B 1W8SA 4PJFE 4FC6A 3CUZA 5ANMA 2Y77A 3LQAH 1G5TA 3A6KA 1OAKL 1RMQA 1L4MA 4PJ9B 3AYVA 1DXEA 2AK4A 1T3FA 5L2JB 1HP5A 1AMOA 3DCPA 4P2CG 2YHGA 2R82A 2EVHA 5ESDA 2B8TA 1T4BA 3HC3L 4GVLA 2PT6A 3TF4A 2FWIA 1GOMA 4V1CB 2Z35A 2VEOA 4E3VA 3S8EA 4XX0B 2R1ZA 2YPIA 4P4SB 1WGVA 1M71A 2FRDC 3H2PA 3CU5A 1CZUA 1VAHA 2WZDA 4S1VA 1YB7A 1TCAA 2K4AA 3E7XA 1E7RA 4IO1A 1GRVA 5HYIA 3QVLA 4AZ0B 2VR8A 2X9YA 3BB3A 3RKDC 4Z9FA 2GPSA 1UC4B 5L2KE 1ZBWA 3Q9PA 1JECA 1E0KA 4FQHA 1PCXA 4OLZH 1YDWA 3EIUA 4XCVA 4NPAA 3C2RA 3L7KA 5LJYH 3C5HA 3BH0A 4XB2A 5TNVA 2FEEI 3KRZA 4PN7A 1LBQA 3EF4A 1RZQA 3QV6A 3UIEA 2EHDA 3MGGA 1NYTA 4S0HA 3G2KA 2BCGY 12E8H 2ZIXB 8XIAA 4F9PA 5AKQA 4RJTA 3PV6B 2FZ3B 2NUPB 1Z22A 4CM9A 3CZPA 3FPHA 4PAOA 5JDSA 2AW3A 5IANA 4QOGA 1VDZA 1VSUA 4ERSH 2I60H 5EBWA 4RK6A 2PTTA 3FYUB 5J2TB 1SEVA 4HTAA 1OHLA 4GRWE 4D0CA 1K9TA 5T57A 2DLGA 4JX8A 3LZQA 4UQAA 1PDVA 1OSZB 4AQDA 3ESYA 5ANMB 1H8HA 4TXMA 3N7TA 2D3VA 3I10A 3PABA 1OASA 1M2WA 4E0BA 3WLMA 1QACA 2CJSA 1QAQA 5EN2A 1OV8A 2AK4B 1T3FB 3PUDA 4G6AD 3CFQA 4UTBH 4L4XA 1DAFA 3SGEI 3IS1X 4QCIA 4N9GA 3IRZA 1U7ZA 3ARGD 3UT0A 4YCSA 2QMKA 3DOPA 4MAYB 3OM8A 4FMPA 3B8VA 1RLBA 4IVQA 4DA6A 2Z35B 3ARSA 4KH0A 4GB9A 4LHWA 4R97B 3BZGA 3NESA 3QGMA 2QCDA 1OQFA 4F7PA 2HBVA 1M71B 1NCCH 1X7DA 4BJ3A 2ZSWA 2H57A 2ID5A 1F51E 2XTZA 1QNOA 4NYIQ 2C8LA 3ZW8A 5C0RH 5FJOA 3A32A 3UBXI 2J13A 1D1TA 1H49A 4FQHB 1LDPH 4TKZA 3W3AD 1W35A 1I9CA 4IMFA 4CKZA 2EKLA 1WUJS 3PANA 1GNTA 5E1GA 5TPWA 1TK3A 4LZLA 2B7DT 4HPHA 1MI5D 1JJBA 3G82C 1GJUA 1NQKA 1PWHA 3T7KA 1F6YA 1NJ6A 1N5OX 1XO8A 4CZ2A 3GSNH 4M55A 3GBML 4ODSH 3EH4B 4B0MB 3O0TA 3VG0H 5AKHA 3KVPA 5MI0B 5JDSB 4K9EL 3ZIUA 3RJ5A 1J5EB 2JMRA 2YEQA 4WZ9A 5EBWB 4W9EC 3OG2A 2PTTB 3RT1A 3P97A 3JT0A 5HE9A 2NCMA 2FR8A 4CD5A 2CALA 3QPXH 3ZXUB 5D8ZA 1ZK2A 3L67A 1J0JA 1IE5A 4FLMA 4D0CB 2GM5A 5KC9A 2CE6A 2YXOA 5TTRA 4O3FA 3CPHA 5TSDA 1MY5A 4N4QA 3BLLA 2FGZA 3PQ4A 4P9HL 3PABB 5AVXA 3STBA 4ADGA 3KXKA 1UVQA 4QRTA 3OLXA 4J4TA 1TJHL 5EXDA 5EHXA 4FFWD 3QCUH 2F5BL 1FMLA 2R4TA 3CNKA 2P2GA 4OXYA 1J9GA 5KYYA 1I3VA 4EF3A 3ARDC 4QCIB 1RYDA 4N9GB 4WHMA 3BLFA 3QEQE 4QJ4A 1E6SM 2HLFC 5FKJA 2ZXBA 2O5ZL 3CQFA 1F2TA 4MVJF 2D4DA 3S6JA 1HYSD 4NUQA 1HDEA 4YMZA 1WFIA 1Q3KA 4F7PB 2RKXA 2B3IA 2H0JA 5FF6B 1QFSA 2DHQA 2H6UA 3VR6A 2UVEA 2IPTL 1RLTA 2ZT5A 4EXKA 2C59A 3RYCB 2D0FA 1IMHC 2ZSWB 5E4TA 3DCYA 4HHAA 5LQNA 2B3DA 1SR0A 1U0HC 4ZUTA 2ZJ5A 4P7GA 1Z7EA 4PCUA 1V5EA 5EYPA 2HC9A 1GR0A 4OA8A 5LNK6 2FZVA 1PTGA 2V6BA 1I9CB 1V39A 4DJ5X 3GHHA 3VO1A 4ZGBA 3R8XA 4LSSH 1Q6RA 4E22A 3GPCA 2NY1D 5TPWB 4X00A 2NVOA 3M6FA 2DQXA 3RUBL 4FI3F 2IBGA 2Z65C 1ECQA 4WDIA 3BREA 4DM4A 3TJEH 2A99A 3VPLA 3TX6A 3NHSA 4K3DH 2DQDH 2PUTA 3GXOA 3KPYA 4FE9A 1IVLA 2PWPA 4YDNA 2CHEA 4FFTA 3RDTD 4A7PA 5D5MA 4UQOA 2Y5QA 3HI5L 2BFEA 5C54A 3N2XA 1U0RA 1UBOS 1Y6GA 4R98A 3KBWA 2CG9X 3IQXA 4WFKA 5EP3A 4PS3A 1FBIH 2SNIE 1VB3A 4GUIA 5KCMA 4EJ0A 3PUIA 1KDPA 3LBIA 3KQHA 4RNHA 4QRAA 5I30H 3MFYA 4EXPX 2YKKA 3FFBA 3QKUA 4AHOA 4R3UC 1RIHL 3ELBA 3K72A 1NVKA 2ZRZA 5A6JA 1JQ5A 4X7FC 2ZJSL 3MSXA 3NIFF 2BGMA 5PGMA 1Z36A 4QRTB 4EHDA 2PMBA 3GUZA 3Q5GA 4P0TA 1XLHA 3IX7A 1YEEH 3UTZB 1IOZA 1VSCA 5KYYB 3WE1A 3UAJA 1GVIA 3AXLA 5ALTA 4PC8A 1F05A 4S3CA 1ZN9A 5CB8A 4QJ4B 1FO0A 2FR1A 3G2HA 4C30A 5AYZA 1F2TB 3QPUA 4AG4H 3RFTA 3T7DA 4X7PA 3RKDD 1XQXA 2EGUA 5MN4A 2CBQA 4UTLA 4JGMA 2ADAA 1I7TA 1SOSA 4JROA 5KKCA 5T1KD 1DKMA 4G0NA 4HDNA 3I3SR 4ZFGH 4MJJA 5K8LA 2YMOA 4HHAB 1OCRB 2BRRL 4MVJI 1ZRNA 3EYAA 1KTIA 2AYZA 4OT1H 3ARBA 1DQMH 5EYPB 5FDYA 1NQXA 3JS5A 3JTEA 3LUKA 2X1WL 3MPCA 1Y42X 3IDGA 5LPNA 3DHMA 1DJLA 4F91B 4FR2A 5C8ZA 1N8KA 4JI2B 1BIHA 3B8YA 4AGOA 4WDIB 2I56A 4TL9A 2FN4A 3TEXA 1U94A 1PV2A 1UA3A 5AOUA 2ZWYA 3O06A 3E6AA 2ZDHA 3GF4A 4TWIA 2BGNE 4XBPA 2HRLA 1FQKA 3HJZA 1Y8QA 2ECQA 5LUBA 3TEFA 5D5MB 5DX8A 4YR7A 2BFEB 4UDTA 3CH4B 1WFJA 2NY7H 5IBUG 1QX3A 4UF7C 4Y6PA 3N8KA 4U9UA 4Y19E 3K6RA 5AZ1A 5F7WC 1IKFH 1Y80A 4QXGH 1RYHA 3T1NA 3THRA 4KDEA 2NSMA 4K8RD 4Z0HO 4M61A 3K72B 5IAOA 3GEMA 2DBZA 4F7CA 2H1PL 2ED6A 4LF6B 5M5DA 3ZWPA 4K8GA 4ZYZA 4HNQA 1R6AA 3PA8A 1N6PA 4WJXA 3VWJD 4HV8A 1IXYA 1TOAA 3E8UL 2DICA 3R77A 1JRHI 3AXLB 1MHEA 3GO2A 5M3WA 2ZSJA 4RVDA 4ZYXA 1JXJA 1FO0B 3FVQA 3L7DA 2HLDD 2HS6A 4G9FE 3EAKA 3FF7A 2A4AA 2QN7A 4JS7A 2OCJA 3E9EA 1Q6LA 3C1TA 2PDGA 1YL5A 2OB3A 1P0BA 2X6CA 2PDQA 2VN3A 1I7TB 4F37K 1WK0A 1HWWA 4KX5A 1P6QA 4NZ9A 3TFOA 3BZ4A 1T80A 4HDNB 4C7BA 3GP8A 3EHDA 2E68A 1EANA 4LSRL 2FD6L 4LISA 4TM8A 2FTAA 3Q0TA 5EL0A 2ZXGA 4MHTA 2XH7A 5FUCE 1VJIA 3VA7A 3V4FA 4YRSA 1SU8A 4ER5A 2X77A 4F71A 3IDGB 1D4FA 5EU3A 1BN6A 3GLEA 1MJ7L 4ZKEA 5HGDA 1AW5A 2X2FA 1S5TA 5LDHA 3T38A 4V2BA 2DF8A 4XBPB 3FSTA 1RYEA 2CDFA 3WMFA 4CVUA 4NF7A 4O14A 4G0VA 3W1MA 1PB0A 1Y8QB 4C4YA 1CYEA 4UDTB 3HE7A 4YI3A 4N5LA 1VHJA 2CXRA 2PMCA 4KVNH 4NKOA 1NC2B 4G70B 1K08A 5GS0H 3ZVIA 3LU1A 3C09B 4B2LA 4Z76A 3QI9A 4BY3A 2PFGA 4ZDJA 5TT0A 1CCWB 4D2JA 3DE7X 1P4HA 1R7AA 3AY3A 4MX7A 1MRNA 2YWYA 4KTDL 4OQ4A 5CBEA 3VOCA 5FHBH 3K1JA 5LA6A 4M61B 5JSYA 1JP5A 4F7CB 4WNJA 4HVCA 2X6MA 2HN7A 5G4LA 1S2AA 3KZ1E 2D2FA 1EP9A 2A9NH 2PKWA 3QIBA 4ZRDA 3GUHA 2VP3A 4RTMA 4HV8B 1BQHG 3VI3E 4C5YA 3B3FA 1PSKL 4NENA 1QUNB 3RRJA 1D2CA 3TRIA 1M34E 4MVXA 3D3VA 5JMUA 1N2VA 1MHEB 2QJRA 4N0UE 3CCHA 2O6HA 4FHAA 4FCTA 3JTBA 4EAQA 3ZBUA 2GAOA 3KB2A 3T1VA 3ZDDA 4AE1A 3DMDA 1FWNA 1Z4JA 2VLJD 3HQPA 2QDKA 3HRZC 4E2VA 1K8QA 2FMFA 1PGJA 2DBJA 3D43A 1FNMA 1XDLA 3SAJA 4GMTL 4WFFD 4YSAA 3EEFA 5IMSA 3MY9A 5JCJD 3DO3A 3B7SA 5CU5A 1QVOA 3FPXA 3G6JE 3FSZA 4J9JA 2B0MA 3TIEA 4YSRA 4ZB0A 1PFKA 2W9DH 3QG1A 3AHTA 1ZJBA 3U37A 1W0KA 1IQUA 1NBVL 1NWCA 5T4HA 5K45A 3TW7A 5H59A 1S02A 4FERA 4YT2A 4HJ1A 4J28A 1K8DB 1K8XB 1PR5A 3MLRH 4Q7NA 5HGDB 4WOPA 1U4EA 2VHXA 2QP3A 5DCYA 4JEHA 1IBGL 4RZKA 4ZPTA 1V48A 4C03A 2RGWA 2CDFB 2GYVA 5A1TA 2WWIA 3COVA 5C0CD 2IWFA 4BQ5A 1AGDA 3HE7B 5EFDA 5AB1A 2VLKE 1EEUA 2OFWA 3S2YA 4Z76B 3QI9B 3KPVA 1CDZA 1DSFH 1DANT 1QRDA 1WEHA 1RLOA 1YN6A 1E6WA 4MX7B 2Q07A 5H9WA 3A14A 5LA6B 4NTZA 1I8LA 1CE1H 3OIHA 4BZ1L 2IAMC 4DNOA 1XXXA 1Z7GA 2A9CA 2HN7B 3A6CH 4F84A 1R2SA 1ADQL 4LOCA 1GOFA 1E79A 2A5LA 3ZR5A 3VIPA 4E2BA 1G6HA 3R5EA 3BAXA 2AHIA 1D0IA 4NENB 5BS0D 2F9FA 1Q92A 3G79A 2DVUA 3W8EA 3BVNA 1VIZA 2FGBA 1SU7A 1B90A 2F8LA 5CHYA 1KFLA 1KLFA 5A4FS 3RAEC 4JUSA 4BQFA 3CCHB 3S4SA 3GR4A 1SFSA 2DV0A 1RJ9A 1WIPA 3AG3B 4HWPA 1V6TA 1MOZA 2VDPH 4LYKA 1Z7JA 1E2FA 3TNLA 1NGSA 3HR5A 3W11C 1B74A 1LBTA 3QA9A 1GYVA 4Z9BA 4CM1A 2ZPKL 3MWLA 2O0HA 1F1BA 2G76A 1MEIA 3NSJA 3GIWA 1I8IA 1BVKA 1QVOB 2GXAA 4JKNA 2D1TA 3TIEB 2WPDD 1ZUHA 3RVUD 5A8OA 4NHCL 2XJKA 3BAYA 1XDZA 2PGAA 1ZNWA 1NGZA 3SQOH 2EDJA 4DO4A 3HPLA 2Q7DA 3QC0A 1F4HA 4IXMA 3BMOA 1DQPA 2XZZA 1DCKA 2G40A 3U49A 4RQQA 1WCIA 3CJQA 5AUQA 4LVHB 1GQQA 3TXYA 2XLLA 4ZPTB 4R7DA 4V3CA 1DWIM 1VEOA 3KKQA 1T3ZA 3EA0A 5F1KA 3L45A 1YZFA 5H8DA 3WNDA 1GYUA 2WNZA 2WOYA 3A0UA 1UMBA 4DEPB 4Q7BA 4A39A 5KKNB 1YGPA 2ZI4A 2R7NA 4ZUUA 2YS4A 3M8OH 5ALDA 3FV9A 1DIGA 1PNCA 1Y8BA 3KG5A 3HGRA 4TVCA 5FQOA 2XH2A 1WZEA 1LNZA 3CF4A 5I28A 3OFND 1R6BX 3AILA 1FYTA 4DIEA 5JARA 2PSEA 1J1OL 2QAIA 1AOZA 5EKTA 1P9MC 2X16A 1EWQA 2I2WA 1FUKA 3AIMA 3Q2OA 1QMPA 3AIUA 4U5KA 4WFHD 3ULUE 4WLFA 4QREA 1IGJA 1O03A 4PH8A 2QUBA 4EK7A 3T5PA 3BVNB 3QYAA 3PPWA 2YXWA 1UM4H 1KLFB 1PY4A 4LLQA 1A5BA 3LHDA 4KT2A 5AQ0A 3NT0A 4JXXA 5D4QA 2WCPA 1EXMA 3HR4A 2ETVA 3S4SB 2C4UA 4YC7A 1WAWA 2PBGA 2QZRA 3P3UA 1RJ9B 2V8ZA 1RTTA 4BJ6A 4W99A 4FW8A 4RWYH 5E95A 3EUEA 1IZKA 1G69A 4UQ2B 3T5MA 4B82A 3HR5B 4EPVA 3Q72A 5A3SA 4ROPA 5EKSA 4ABQA 3WHE0 1TV3A 1JDBB 3TQPA 2Q3AA 4DT1A 5IDVA 2FV8A 3RAOA 3SQBA 5ICXA 1I8IB 1KSGA 1BVKB 1V8DA 1YCGA 3E82A 2CD0A 1D5BA 4IRJA 3J8F7 1NGZB 3HPLB 3QMSA 1XGTA 5HOEA 3TJ4A 1QBGA 5MERA 1LLZA 3BMOB 2VJAA 3ZV3A 2YWCA 4RQQB 2IX9A 1WCIB 3FH5A 3OQEA 2BVDA 4R7DB 1AY0A 1RJLA 4EW6A 1O5TA 4CWAA 5BYJA 4FVTA 4DNHA 1J1PL 2OLHA 5HJ3A 5BRNA 2ZWNA 5B8CA 1UMBB 1FK8A 1LORA 3UMBA 1WA2X 1WA1X 2CD7A 4ZUUB 3D2LA 3ZHNA 3F5MA 2CXPA 2G1PA 5C4IA 2E37A 1EGVA 1VLVA 1JU9A 1THCA 5L0QC 3D4ZA 2JKEA 1T1WB 3FH8A 2JEPA 4PG2C 1FYTB 3LI0A 1W37A 5DX0A 5EKYA 1BCSA 1SYTA 2W6NA 2F48A 2A3AA 4IIQC 2DTSA 3QTTA 5EWLA 2ZUUA 4DG9A 1IGJB 1YXDA 4W70A 2I29A 1F2DA 1YEHL 4LLQB 5DYFA 5I1KH 1A5BB 2XN0A 3NACL 2PUAA 3DETC 4EOWL 3CPUA 3TEVA 1GHTA 3HS3A 1QX4A 4DLNA 1PG5A 2WCAA 2XNDA 1AHPA 1G01A 4MZIA 5E95B 4YHYC 2Q1TA 3T7SA 2XYVA 1CUAA 3N2OA 4G37A 2BS8A 5I76A 4GAFB 4UFLA 5ALIA 5FWDA 3T40A 5TRTA 3KJ4B 2IUUA 4DT1B 4UNNA 1NEYA 4L5ZA 1BJTA 3B6JA 5EFZA 1G0OA 5B7NA 4BNWA 3SQBB 5DGTA 2Q8AL 4M7ZB 1Z69A 1FWTA 3AFLA 1XX6A 1DBWA 3WQVA 3WMQA 4QG6A 3FVTA 1X9GA 1D5BB 4IRJB 3IAS1 2SODB 4PXAA 4MQXC 1FVHA 4I4TF 1XGTB 2LCFA 3DLQR 2DMCA 3P7MA 1KEWA 3CBJB 1ZCRA 3JWOC 5IK3A 1H5QA 4PZPA 1UZ1A 1S7TA 1GGNA 3FZNA 2BBFA 1LVEA 5DY3A 4K0RA 4DV1B 5CCGE 3D25A 1NAKH 2GF0A 2NU7B 2HQSA 2AZAA 1RJLB 1GS7A 3EA1A 1OGPA 1YNOA 3SJNA 3FUDA 1VH7A 5DJ6B 1OWMA 2H29A 4B90A 5B8CB 2MSNA 3H1AA 4H0NA 5LHFA 4II2A 1EZVX 2D2IA 3Q6FA 2B15A 2DJLA 2IAMD 5AZUA 2LWIA 4XIGS 3HIJA 2R6JA 4LQLA 3VVVA 1FYDA 3O7WA 3SE9H 4MYPA 2GVZC 4P3OA 5G4KA 1CF8L 1V2HE 5CD3A 1EGVB 4LBUA 4AD2A 5K59F 2A7PA 4AICA 1L9OA 1G87A 3AXHA 2XTSA 1F3TA 5JXED 3UPBA 5J23A 1BAGA 4FQIH 1OFEA 4L3ED 2J1LA 4H9UA 4XOUA 1BCSB 2ZROA 1UK6A 2QG4A 5BNIA 5K8IA 1K2WA 5EWLB 4JOSA 3NEOA 4MS6A 4ZL1A 1OXUA 4LSPH 3OY7A 1VIWA 3ILYA 3QFWA 1UM9A 1ZIXA 3H99A 2RGXA 3UP6A 1D6MA 1RAAA 2QSZA 3E7DA 7MDHA 4UZGA 4N8UA 4M1ZA 5FYLH 4M7LH 5CCKH 4AWBA 5EMKA 3LQZA 4PJBE 3GDKA 2NQLA 1P2VA 4OIFA 1OWOA 1LNSA 4H1UA 2FUEA 1R66A 5I76B 1S8DA 2KT6A 2IE8A 4PR5B 4BQ8A 2RHHA 2WBJC 5ALJA 5J58A 3ME5A 3NDJA 2Z7KA 3OVUB 1H3FA 3MV01 4JTDA 1D9EA 1V0KA 1FNDA 4Y90A 4MXWH 1YS6A 3PT5A 1EAYA 1S7QA 5TPWH 3GB7A 1E9CA 3C3CA 1YC8A 3VNQA 1A2YB 2CBPA 3H16A 5AHRA 4YB8A 4M62L 1W5TA 4TSCH 2V9DA 1YL6A 4PC3A 3VFNA 1FJXA 1I3NA 3SBWC 3F2IA 4JT2A 5IK3B 3T78A 1W2PA 1S7TB 3D25B 4O5OA 5AC6A 4UTPA 1EM8B 2HMCA 1YWGO 4F3HA 3VPGA 3NK4A 3DUFB 5T4EA 1F60A 1N6LA 2GGIA 5EBUA 3W9BA 4RKWA 1EPUA 3B9RA 5HDBF 1ID8A 4BCDA 3C70A 3RJYA 4G86A 1W36B 2CA3A 4BXVA 5IM4A 3Q6FB 4FMKA 5HK9A 3MLVH 2VP0A 1M73E 3NV9A 5G4KB 4EVSA 3H5LA 1MNQA 2D1RA 3IOBA 5CD3B 3QAZB 4N5IX 4JEUA 2F43A 3Q3HA 4RMTA 4DB7A 4KRPD 1TTUA 3EAUA 4MCAA 5DHXB 5C35A 1MAJA 1GGCH 4II3A 3ND6A 5C07E 3MIZA 4ZU3A 3RCBA 5EH1A 4G63A 4KETA 5ALSA 3F7JA 2X8BA 1V10A 3ORRA 1CRZA 5MENA 1QSEE 1P1JA 4WQ6A 2VDQL 3HO8A 2VH1A 1NX9A 1CUIA 2OP1A 3L49A 1Q6QA 5FEUA 3MWJA 3GSOA 4K9PA