4UNIA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 in complex with galactose
Total Genus 228
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
228
sequence length
689
structure length
689
Chain Sequence
HRAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMEQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis
total genus 228
structure length 689
sequence length 689
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-05-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uniA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uniA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uniA02
3GXPA 4GQRA 4Z2GA 2W67A 2FHFA 3RCNA 1QNQA 4HU0A 3UK7A 3TOPA 4LQ1A 5I2UA 2F7PA 3BUBA 1W3LA 3AHVA 3GRAA 3TTWA 1K6AA 3WL0A 1WNOA 2CBJA 3OB8A 1B1YA 3CUIA 1H2JA 3UCQA 1CS0B 1E6XM 2ZX5A 1TMQA 1UWQA 1QHOA 4I2NA 4AY1A 4AEEA 3VDCA 3CZNA 3TTXA 1CPUA 1Z32X 4IM4A 1ZBCA 3T09A 1B3YA 4QYTA 4WLCA 1JZ2A 2WJZB 1EHAA 3S5ZA 3I3EA 3SUWA 4CVWA 4ADSG 1GZJA 2GDVA 2V3EA 2ZXQA 2D1ZA 4PTWA 5CSYA 2CBVA 1GPFA 3RJXA 2G3IA 1KQZA 3WY1A 4CGTA 3EMQA 2W61A 2WANA 1JYVA 3DX0A 2RGLA 2ZX9A 1W9DM 1WZAA 5E9AA 2AD5A 2OWCA 1QWSA 2DQXA 1BPLB 3OGVA 4MPKA 3U57A 5CGTA 1P81A 1KTCA 2YA0A 1DP0A 5JIPA 1W2VA 5IP5A 3W53A 3N15A 4M1RA 1GORA 4UOZA 3WMSA 4ATWA 3VVGA 2XPKA 2WZIA 3ARUA 3WMBA 4D6IA 1BLIA 3QHNA 3WNPA 4TX8A 4CU8A 3NUKA 2BY0A 2X2YA 3WL1A 4ZGGA 3ZQ9A 1E70M 2DSZA 2ZXDA 3EMZA 3UOWA 4J7RA 2X09A 5I6SA 4U3CA 5CQ1A 4D6EA 4AUNA 2WHJA 3N9KA 4HPGA 4FLOA 1PZ3A 1QNRA 1WKYA 1HKJA 5BXTA 2X2JA 4AISA 3CGTA 3PZVA 1OCQA 1BYDA 5A1AA 3AIVA 5A69A 3GNRA 4AIEA 2FHCA 1NARA 1H41A 4PSPA 4RE2A 4DO5A 3CTTA 3AZRA 4JFSA 1V02A 2Y2WA 2E9BA 3WD0A 4OOUA 1EO5A 3TP4A 3WD1A 5ABFB 3W37A 4QCFA 1UWSA 3DC0A 1GVYA 2UY2A 3WELA 1US3A 1E6ZA 3RHTA 2W66A 4QYXA 3VIFA 1UQYA 4MNKA 5A2CA 1CENA 1DWFM 2G41A 2WHMA 3ZT7A 4MB4A 3OLGA 3NORA 3ARRA 9CGTA 4JKLA 3WIJA 2EPNA 3EWNA 4UNIA 2YL8A 4GO9A 2VX7A 1E6PA 3EJRA 1JYWA 4B9ZA 3OZOA 4DWSA 4BFLA 3WQ6A 5EFDA 2ZUVA 4PXYA 2CEQA 3NDYA 2RK3A 4AEFA 2VRKA 4FLRA 1NOUA 1WZMA 1ZU8A 1U33A 3VMOA 2WVVB 1CGUA 1V3MA 2VI0A 2J7CA 2E40A 4W8BA 1UR4A 3UETA 1R7AA 3RJYA 3BCFA 3KL3A 3GBEA 1Q6DA 3PHAA 4MB3A 5A6SA 4JQSA 2J62A 5IDIA 1JNEA 1R47A 3WH6A 3EJPA 2VCAA 3GTNA 4EANA 3ZJ7A 2W91A 4B3KA 3VIKA 2X0YA 2EPMX 3P9PA 2DH2A 3EDKA 1FH9A 2XG9A 3BXWA 3GBDA 1Q6GA 1CGWA 1GGEA 4HA4A 4X0NA 4EKJA 3AIBA 4W5ZA 2VRNA 2Y8VA 3THDA 4GI8A 3W24A 5ABFA 1E1FA 2WCGA 3GNPA 2YDRA 4HOXA 5A8QA 2XUCA 2W5FA 2WMGA 2HISA 3CC1A 1EOKA 2XN1A 5I24A 1KWGA 4ZDKA 2JFEX 2PBOA 3EZGA 5DO8A 2AMGA 3F5KA 3AS1A 5BXRA 2AOSA 1FFQA 3WDQA 5SY6A 2CYGA 3EJSA 3A6OA 1Q6FA 2O92A 2QF8A 3FHAA 2O9TA 3OIHA 4NSBA 3A21A 4F8XA 3DX2A 1E4NA 2PBGA 2AB0A 1G94A 4MADA 1GOMA 1GGJA 2J75A 1GQLA 2EO7A 4HZ7A 5HPOA 1JFXA 2DSUA 3RM8A 3A4WA 4H2CA 2WVVA 3O6AA 2ZE0A 2XWDA 1VF8A 1UH4A 4J28A 1W1VA 1KR1A 1KWKA 3PQ6A 4N0MA 4QAWA 3BUQA 2NSXA 3L4WA 3L4TA 3HG2A 2EADA 2R1VA 1HWWA 3W0KA 2XVKA 3SEPA 3ARVA 1E72M 3PQ3A 1VFMA 1WZLA 1GNXA 1OX6A 4ZXOA 3L4EA 1UASA 1I1XA 4U2ZA 2XHYA 1BAGA 3PZNA 1JL8A 4GPNA 4UQ9A 3G6LA 5DF0A 4LXFA 2X05A 4W87A 2OR3A 4UOQA 3N11A 5BV2P 5BRPA 1UR1A 4CD6A 4CN6A 1CWYA 1HKKA 3D4YA 3U5UA 3FAWA 1NQ6A 2NT1A 4TUFA 4ENRA 4N12A 5AC4A 3GH4A 5A3HA 3VTRA 3MUY1 2ZUWA 3VNYA 4AD2A 4MDOA 1Y7VA 4E2OA 2J7EA 2VRJA 1XYFA 3GNOA 4L4PA 5LA0A 1KR0A 1OIMA 2XIBA 3BAYA 5FL1A 1FH8A 1AMYA 3K8LA 1PBGA 4M24A 5JUVA 1CF9A 4AZBA 4PMQA 1M01A 1R75A 1R86A 2RGMA 1J10A 1OIFA 4E8DA 2F18A 1M53A 3HG3A 4AD5A 1H49A 1EQPA 1KXTA 4H8VA 3ARYA 1MFVA 3WD4A 3PQ7A 3NSXA 1KCKA 1TQTA 3SUUA 1OX4A 1VFFA 5GQBA 2XJ7A 3SUTA 2G4FA 1H1NA 3SCUA 1J0ZA 2DH3A 3HU7A 3VINA 3LPGA 5CLTA 4D1JA 2FHBA 2VZVA 3ZT5A 4BA0A 3LRLA 4UCFA 4B40A 3R74A 1R7OA 1PJ9A 2BNJA 3QHMA 3W38A 3W82A 5BXPA 2ZWYA 3ZR5A 3ZR6A 3UESA 3SUVA 3SCRA 3VD4A 2WHKA 4JFUA 1OWQA 3ZJ8A 3EBVA 3EJTA 2OW7A 3VM5A 4Y0NA 4OBSA 1KXVA 5CPTA 3MV01 2IUFA 3HG5A 1LL6A 1C3OB 3DHUA 2JALA 4F66A 1WDSA 5I78A 4ENVA 2XFYA 1TCMA 3PZTA 4PRWA 4WJXA 1UZ4A 4ZXLA 4JIEA 5I77A 1P7YA 4NF7A 3MMWA 2WVUA 4ZE4A 2XWEA 2VURA 3AIQA 3OT1B 1FH7A 3AIRA 4B3LA 1J0HA 1ZS2A 2DDXA 1TQWA 5E6YA 3GXFA 4WIWA 5CSUA 2O9RA 2YL6A 4ACZA 1W9VA 3K4AA 4LYPA 4KGLA 2AAAA 1Q4NX 3ZT6A 3WY4A 4UQCA 1V0LA 3A47A 3NSNA 1RP9A 3TA9A 3WDRA 3RM9A 3PN8A 3D54D 4CCDA 1GOIA 2CPUA 1E6NA 5EMYA 4V27A 1CDGA 2E8YA 4Y7EA 3UG4A 1OT2A 4BF7A 1UCFA 2VVSA 1UH2A 2WKGA 3B8SA 1I75A 4D71A 1MQQA 4AW7A 4UQAA 4PCSA 4Z2KA 2ZUSA 4W5UA 4WF7A 1CIUA 1W1YA 2EAEA 2E8ZA 1EOMA 2VXOA 3R75A 4FMVA 1LL4A 2YDSA 2ZXAA 5LYRA 2XM1A 2PC8A 1C7SA 2Y24A 1E3ZA 3IANA 1JIBA 1G9HA 2FH6A 1W9BM 1FHDA 3AXHA 3WN6A 1WDQA 4AD3A 2ZWZA 1JZ6A 1GPWB 4I4NA 5CJ5A 3MGKA 3AI0A 2ESCA 1VCNA 1CXLA 3T0AA 3KE0A 6CGTA 1K9DA 3OLIA 4GZEA 5DFAA 4OKDA 1J18A 1QNOA 3ZIZA 4AZCB 5ABGA 2YWBA 2A3CA 5KZ6A 4XUYA 1JF5A 1UD3A 3WUGA 1JZ3A 3II1A 3HZ3A 3OT1A 4GZJA 3F5JA 1N82A 2RK6A 4B9YA 2OSXA 1QHZA 4PSRA 2D24A 3MIIA 1CBGA 1SOAA 1O7DC 4CD4A 2YLLA 4DUXA 3WEOA 3AMDA 3NSMA 1A9XB 3AMCA 3ZSSA 3BGAA 3FSEA 4EE9A 3P9RA 1W32A 3RMEA 1BTCA 1KBKA 3IJ8A 3AS0A 4CN1A 5EFFA 4PEEA 1BSIA 4CD8A 2XGBA 1QWUA 3AICA 1S46A 4W85A 1DTUA 3IK2A 2WK2A 1ISVA 2W62A 4ENPA 4BQ3A 4D1IA 3WQ4A 4C7FA 2W92A 2YOCA 4UOJA 4P7RA 3WF2A 4W7VA 3VGGA 1EDGA 4LYQA 1PV2A 3VX1A 2WHLA 3WD2A 1LWJA 3VMNA 2ZUTA 1J0JA 3ZOAA 3F5LA 4D6DA 4GUDA 4CN4A 3WNLA 2VR5A 4MGHA 5BXSA 1V6XA 3VGEA 2YWDA 1H5VA 3LPPA 4P8XA 4QP0A 5K4AA 3DYOA 3POHA 1VBRA 3PQ2A 1GW1A 3MU7A 4WK9A 5IXEA 3J7HA 4UFLA 1ZL1A 3O2LA 1WPCA 1F4HA 3WNOA 4HU8A 2VX5A 3VSUA 1NM9A 3VSVA 4W84A 3VD9A 2UY4A 4AZCA 4FNQA 4CKQA 5D4YA 2WMIA 3HMCA 1MW3A 2VX6A 1O6IA 1CLXA 4JCMA 4KWUA 3DYPA 4WINA 4MNLA 3UEQA 5M3WA 5DT7A 2YA1A 1V3HA 3SF8A 3WY2A 1B30A 4ENQA 4S3KA 5I0DA 2J8FA 1EO7A 4W93A 4P34A 2QMKA 1HJQA 1WDPA 2JIEA 1XD1A 2XSBA 2NW0A 5BCAA 1C8XA 1ECEA 1NOWA 3GYCA 1KEEB 2GJPA 4BQ4A 2F2HA 1ITCA 5A94A 4RL3A 2XVGA 3GXNA 1P80A 4TVCA 3ARZA 3WNNA 2E3ZA 3CUHA 1HJWA 2J7DA 3OLDA 3WUFA 4F79A 4L8FA 4Q22A 3K46A 4FLSA 2V4UA 1XSJA 1M03A 2FEXA 3AMGA 3POCA 1NWRA 1JZ4A 1JNDA 2VRQA 1FYEA 4BQ5A 2XVPA 4HOZA 3SCQA 3R76A 4ATDA 1PAMA 2TAAA 3E1F1 1UA7A 3W25A 2DT3A 3N18A 4DWSB 2WMFA 1NP2A 4BCEA 3CY6A 2CITA 3WF3A 2V3FA 2WC3A 1ISXA 1KFWA 4I46A 4H7VA 2J7GA 4HMEA 1NOFA 3OA5A 3WH9A 3O9NA 4Z2JA 1OGGA 5F7UA 3L4ZA 1E71M 1TUXA 2XGIA 2WAGA 4NXKA 1QOXA 4A3YA 1UD6A 1O7AA 4H04A 4W7UA 4L4OA 1E5NA 2V38A 3VD3A 3WNKA 1M04A 1MFUA 3BAWA 4PCTA 2ALWA 2WYSA 2DSKA 2WZEA 1NWTA 2WMHA 1C7TA 1UD4A 1S1MA 4D6GA 3ZMRA 5M03A 3WF4A 4ZDJA 1TQSA 3ZO9A 5DT5A 1G1YA 4P8UA 1GGKA 1V03A 1QF7A 1R9GA 3UJNA 3NVAA 4MDPA 2GDUA 3MV11 1HTYA 5HXMA 2XM2A 1EH9A 1P5FA 2VOTA 5ABHA 2CCRA 1JAEA 4YHGA 3GXDA 3BVVA 1VHQA 3D3AA 1UUQA 4FNSA 3FHQA 1IZJA 2VX4A 4E4PA 3UR8A 3OG2A 3AQUA 1HXKA 1XH1A 3L2MA 2CKSA 2PB1A 3AMLA 2WLYA 4L78A 3PZ9A 5JBFA 1JF6A 4AZGA 2OSWA 3ZJ5A 1U30A 5A8NA 3CZSA 2EPOA 5I3DA 1QI4A 3BCDA 1GJWA 4FNTA 1WL8A 3CZKA 4DUVA 3A23A 1G2IA 5D8WA 1E6RA 4W89A 3WH8A 4E5VA 5A6AA 1CE8B 1M6VB 1J0IA 2WMKA 2G3MA 2A9VA 4FNUA 5I23A 2FDMA 3D4ZA 2PWGA 3KL5A 5BROA 2EJ1A 2D20A 1KGWA 2YL9A 1V6YA 4PMYA 5AYBA 2R1VB 2FGZA 1Q6EA 2IXVA 1HL9A 1XRVA 3CMJA 4MJ2A 2DGAA 4NRRA 4ACYA 3PBGA 1GOQA 1CXHA 5A2BA 4PMNA 3KL0A 2DEPA 2CXGA 1GUVA 3VIOA 3WY3A 4J3SA 4KH2A 5HNNA 3D5HA 3CBWA 1D7FA 2D0HA 3DX3A 3NOVA 1VJZA 1JG9A 3CZ8A 1ZJAA 2F61A 2ZX7A 1E15A 1PS3A 1MXDA 3W6MA 3VD5A 1XSIA 5EB8A 3L2LA 2XFFA 4OGFA 3N17A 5GPRA 1D3CA 4CVUA 4DO6A 1MXGA 2J7HA 3AHYA 3MKKA 4AMCA 1BYAA 3W27A 3EFEA 1EDQA 2GUYA 1SYTA 3AHZA 1JYNA 4LGXA 4ML4A 4UZSA 3WBAA 1BYBA 4RE3A 1GONA 4GO8A 3VD7A 4B2YA 3MMDA 1QBAA 1RD6A 1X6NA 4IUGA 2VQTA 2J8GA 4AIOA 4PUDA 3AOFA 3AS2A 2CBIA 5GNZA 3S5YA 3ZJ4A 1OSEA 3WH7A 2WBKA 4BS0A 5KEZA 3WFLA 3N04A 4GE3A 2WCSA 5C70A 2XVNA 4AD0A 5HBFA 1T0OA 3CZ9A 4NXSA 2J4GA 2VC9A 4P35A 5JZMA 4M82A 1JXKA 3EJUA 3A22A 4JKMA 1G0CA 1OX4B 2J7FA 4CU6A 1ISYA 1C8YA 4J3XA 1CTNA 1MYRA 2EEXA 2BY3A 3MUIA 1FOBA 4GXPA 1VAHA 4UQEA 4PTMA 3WF0A 4KMQA 1C93A 3MSDA 1ZBVA 4UR9A 5CPSA 3H54A 3I3BA 3EDDA 2D23A 2OYLA 2GK3A 2Y8KA 3CNEA 3CHEA 4P7LA 4AZIA 5A95A 2CHOA 4V28A 3HG4A 1VJSA 4JL2A 2ZUUA 4M56A 4D6JA 1JD9A 1GOKA 4PMOA 1PDVA 1W3JA 1UWIA 2JEPA 1W1TA 4U31A 3P9QA 1PX4A 1TE1A 3WNMA 3KEHA 3B38A 3NOQA 2VR4A 4JCLA 4FNRA 1UWRA 2X2HA 2WKLA 1TR1A 1V6VA 4U5KA 3VILA 1E43A 3APGA 3T2PA 3WEMA 3ARPA 1JZ8A 3GXTA 3NDZA 4RKWA 3OLEA 2V3GA 3RO8A 2QPUA 5ECUA 5JIWA 4U2YA 1CXIA 3GXMA 1ZB5A 1H09A 3BLPX 4X9YA 3SOZA 4XZBA 4MTVA 2A3BA 1O1YA 4ACZB 4UFKA 8A3HA 3EN0A 1J0YA 4YN5A 3VGDA 1B3VA 2WZHA 2C7FA 3ARSA 1PPIA 1BXRB 2XTKA 3SCPA 2WC7A 3BVUA 3JUGA 2VDJA 1JZ7A 1CYGA 1BFNA 1CGVA 2QLYA 1W9PA 1GOOA 4PMUA 1JZ5A 2EQDA 4DUWA 4OJYA 1TVPA 1GJUA 2J7BA 1EQCA 4HZ8A 1CZ1A 2ZUNA 7CGTA 1ESWA 2WW5A 1G5AA 1OT1A 4OIFA 5BRQA 1B90A 3W28A 4F9DA 4Z2IA 4GQQA 4BTEA 3BUPA 1KXHA 3GXIA 3K1DA 2VKTA 2GFTA 1NWSA 1U2YA 3WQWA 1LLOA 3TTUA 3SCNA 2ZX6A 4TOQA 2QMJA 4B5KA 1V6WA 3WUBA 5C71A 1TG7A 3BWEA 4AULA 1IV8A 3SCSA 3DHPA 3PZQA 5FIPA 1A3HA 1B2YA 1KXQA 1QX1A 2GVYA 1LG2A 2PWEA 4S0ZA 1UZ1A 4N0RA 3W6LA 5A6LA 3CPUA 4HP5A 1QVVA 1JAKA 4AJ9A 3EDFA 5JBEA 1JDDA 4H41A 1JFHA 1JD7A 3NOOA 1KBBA 3VX0A 1E0VA 1HP4A 4HCJA 1WZKA 1I1QB 4B16A 2WSKA 1HL8A 1ISZA 3ALGA 3CZLA 1W91A 4NX0A 4AC1X 2YKKA 1VEMA 1V3LA 1AQHA 1MW0A 3BSGA 1E55A 4IPLA 1DWJM 3W26A 2VCBA 2UY3A 1H3GA 3QR3A 4DM1A 4FNPA 1IZZA 3VDHA 1LWHA 4TVDA 2YBTA 2PWHA 5IHRA 4UQDA 3LXBA 4NZFA 2EPKX 1VFUA 2ZXBA 4AMWA 3U7VA 4QLKA 4Y1FA 5GNYA 4NI3A 5E0FA 2EXOA 1WE5A 1GQJA 4HA3A 5IFTA 3MUZ1 3LX9A 5GNXA 4MNMA 4XV0A 2X0HA 1ODUA 1KQYA 1WCGA 5SY4A 3PZGA 1MQRA 1VEPA 1CXKA 4J3UA 4W86A 2VZTA 3ZR4B 2Q8XA 4W8AA 1W1PA 4GKLA 1VRXA 1LF1A 1KB3A 5CGMA 2VZSA 1ISWA 1V3JA 2J78A 3WQ8A 1EDTA 3VOCA 4PN2A 4XX6A 4WKHA 3M46A 3KLKA 2IXUA 1J42A 3PQ4A 2H2WA 1SZNA 1ZBKA 2YFNA 1X6LA 5D9NA 1QNSA 5FCZA 1ONSA 1XHGA 4B15A 3CMGA 1KGUA 2FE0A 4ZFMA 4MB5A 1OINA 2DIJA 1B31A 2BVYA 1CECA 2FH8A 3WH5A 3OZPA 2NV2B 3ZJKA 2X2IA 2WMIB 4ZDIA 2BHYA 4P7QA 1J12A 2VUYA 3TTQA 1PX3A 1C30B 4BZYA 1QW8A 2J47A 4ZE5A 4UFMA 4AWEA 5D9MA 3U5YA 4LPCA 3UG3A 1E6QM 1K9VF 1UD2A 3K8KA 2IGTA 3KWXA 1ZJBA 1QI5A 2CHNA 1B3XA 2A3HA 2CERA 2JF6A 4M29A 1PDWA 3L3BA 4OGGA 2Z1KA 3VGHA 3SF8B 2XIIA 2WWCA 4MNTA 1UKOA 5CZKA 4GZIA 1DHKA 2F8QA 1CGYA 1TFVA 5AYIA 1UD8A 2OWWA 2BY2A 3WDHA 1C90A 3WDIA 3TTOA 3S6TA 1JVNA 4HMDA 4HZ6A 3BUDA 3H55A 1Q2UA 4HA1A 2QHAA 1DWAM 4Y1GA 5TD4A 4IISA 1SY7A 2VQUA 3WQ5A 2D73A 2VNCA 2GJXB 4C7GA 1T3TA 2YLAA 3RM4A 3K8MA 2JIWA 3AIWA 2YWJA 1EA9C 4UFHA 2BXYA 3UR7A 3AISA 3A3HA 7TAAA 3T0DA 5SY9A 3MO4A 4D6CA 1E0XA 1VB9A 3TQIA 4PUEA 4GIAA 4FLQA 1BF2A 2X1IA 3CHCA 3CUGA 5IFPA 2EABA 3EJ6A 3PZIA 3MSGA 3AYRA 3PZMA 4CCEA 3VMPA 1E1EA 1K9TA 3DX1A 3TTYA 3WD3A 1UWUA 4JKKA 3VDAA 2V5DA 2ZIDA 4QFUA 2D7JA 5D9PA 4ENUA 1W9UA 1V0NA 3T08A 4LX4A 1I1WA 3W81A 2D2OA 3W29A 4W88A 3WMCA 3NIYA 4IPNB 3U7BA 3AFBA 1VENA 3PTKA 2DSVA 1HXJA 4ZENA 1CXEA 3N1AA 5EBAA 4PMDA 4HPHA 1I7QB 1XCXA 5FKYA 3BVTA 2V3DA 4AUEA 2R1TB 4CD5A 2VPIA 1UWTA 3CHDA 1GHSA 5A6KA 2DT1A 2E9MA 4B7AA 1YHTA 5JZOA 3SIMA 1BYCA 1H4PA 4JFVA 3BAKA 3BLBA 1WAWA 4ENWA 1VBUA 1EIBA 2YL5A 3L4YA 3VIPA 4WXYB 4OOZA 4QDMA 3KZSA 1QBBA 1OB0A 3NYDA 3NJ3A 5E09A 4TX6A 2CETA 4UFIA 4GE0A 4PMZA 4JFTA 3T2OA 1RPKA 1CNVA 2GJXA 3QHOA 3G6MA 1B0IA 2PI6A 2IUZA 3WKZA 1BG4A 1MQPA 2W7TA 3IAQA 3VPLA 2D0FA 3ALFA 2DIEA 4U3AA 4TTGA 3CO4A 3VIIA 3M3PA 3TV8A 1HN1A 4AZ7A 3A24A 1E40A 1QHPA 2W4XA 4WKAA 1XH2A 4L8YA 3DDGA 1VFOA 1PEZA 1BVNP 4D72A 3N7TA 2F1AA 3GDBA 1IZYA 5CXPA 4AZHA 4P7OA 1UD5A 2BFGA 2WPGA 1TQUA 3EJQA 1GPMA 2R1UA 5A8OA 1DWIM 3ZJ6A 1PZ2A 5E0CA 1GHRA 1XCWA 3M6DA 3LMYA 4L95C 2CKRA 2ZX8A 3ECQA 4HMCA 2BVDA 1J11A 3B3AA 2E9LA 1SFSA 1E4MM 2OYMA 2G3JA 3OGSA 3VIJA 1GQKA 3ZM8A 5BWFA 2R1TA 5FL0A 3FN9A 4R7GA 5BYWA 2VZUA 2CNCA 1VEOA 2JE8A 1QVWA 1OBAA 5CLWA 2X8RA 1E3XA 4WKFA 4AMXA 4KRTA 3WDPP 2WB5A 1IPHA 2MANA 3KLLA 4UTFA 1UR0A 1UOKA 5CG0A 2A3AA 1R85A 2WVTA 3VM7A 1B9ZA 1UHVA 1B3WA 1WDRA 2VCCA 1R8LA 3SUSA 3EDEA 1HJUA 3MI6A 3TTSA 1HF6A 3B36A 4FF5A 4OBRA 3N12A 4PMVA 2DT2A 5E6ZA 1KGXA 1XGZA 2C8NA 3I3DA 4MAZA 4Z2LA 3WUEA 2D0GA 4AYSA 3BAJA 2BY1A 1HX0A 4UQBA 3NONA 1NWUA 3FXYA 4DO4A 4B31A 3PTMA 3UG5A 1AQ0A 4M80A 1GGHA 1P6WA 5CPQA 3AXIA 4QCEA 2XYLA 3BVXA 2ZICA 2J79A 3THCA 3H53A 5I79A 3CHFA 4JHOA 7A3HA 1UA3A 1ITXA 1JI1A 1CLVA 4AZ6A 1HP5A 3TTTA 3BAIA 1ZBWA 1FA2A 1VCMA 1OGSA 1TA3B 3QOKA 1U9CA 3AHXA 1V0MA 1D2KA 1KTBA 4MJ4A 3ARXA 1E6SM 2ZUMA 1LL7A 2WMJA 4P8VA 4M8UA 3EYPA 1V0KA 4J3TA 2WVSA 1YQ2A 3LPOA 2DSWA 4EAMA 3BH4A 4D1YA 3W4RA 1C92A 1V3IA 1V02E 1Q6CA 2A3EA 3AIEA 5A6MA 1HKMA 3CUJA 2JEQA 3VKKA 2WNWA 2PF0A 5E1QA 2ZOXA 2OLHA 5AY7A 2FGLA 2GHRA 3CH9A 2VL4A 1BGAA 1UR9A 3AROA 4PBGA 4X0VA 2BVTA 4Z2HA 2PWDA 1I7SB 3RIKA 3F4VA 3LRKA 1TVNA 1KCLA 1EHNA 3IJ7A 4R27A 4P5PA 1QPKA 1PIFA 4P8WA 3AYSA 3D52A 2GK1B 1R46A 1UYQA 4HOWA 3LXAA 1F4AA 1SMDA 2XN2A 1FP9A 3FW6A 3IAPA 2O9PA 4QLLA 2F7QA 4V2XA 2CESA 1UKQA 1OD0A 1RP8A 2CBUA 3AZTA 4XZWA 1PE0A 1C91A 3BHNA 1KA9H 4LYRA 1H0IA 4D6FA 3PZUA 1E0WA 3T2QA 4D6HA 3VIGA 1XH0A 3MANA 3BC9A 4TTUA 4J3VA 3FAXA 1UKTA 3CUFA 1QVZA 2YJQA 1DWHM 3DDFA 4GI9A 1PX8A 1X1NA 1JDCA 4EK7A 1TA3A 3N13A 3ARQA 1BGGA 2DPEA 1QI0A 1UH3A 3F71A 4JHZA 3S2CA 3OGRA 4NZJA 4Y1EA 4KGJA 1MWOA 3K4DA 3WEZA 2J74A 1XV8A 3SCWA 4DWSC 1HJSA 4MTCA 2UWFA 3LXCA 3CYFA 5I5RA 1HIZA 2NT0A 3HN3A 6A3HA 3AJ7A 4CUCA 4S3JA 1JGIA 1GGFA 1JXJA 3NCOA 4E08A 1QNPA 1T36B 1SMAA 3BLKA 4PTXA 1UKPA 3AHTA 3WF1A 4NZCA 4LGYA 4ENSA 1DEDA 3T0BA 1LJYA 1B3ZA 1H11A 4C7DA 3EMCA 2GK1A 4GI6A 1L8NA 3ER6A 3ZSTA 4PMXA 2Y5EA 2O9OA 1VIWA 1OD8A 2DT0A 3PTQA 4MAVA 2VTFA 5E70A 2EACA 2YFOA 1A47A 4WSKA 4GINA 5AC5A 4W7WA 4YPJA 3ARWA 1QW9A 3AZSA 4TVUA 1T0BA 3ARTA 4L8WB 2VO5A 3TTVA 3FY1A 1IT0A 2WLZA 3B9AA 4MNJA 4WSJA 1CEOA 2J77A 4AZ5A 5DEZA 3VGFA 4H8HA 3VU3A 2UY5A 2EPLX 3VSTA 1G01A 1XYZA 2BHZA 1ODZA 4CD7A 4ZEPA 2FYVA 4AD1A 2ISSD 3PQ8A 5FOOA 3TONA 1WP6A 1TQVA 4JL1A 5LIRA 1LG1A 2F7RA 2WBGA 2XSAA 1L0PA 4E8CA 2J25A 1OY1A 1V08A 2VJXA 2YBUA 1J0KA 1QI2A 2OW6A 5A6JA 1R34A 2QV4A 5A2AA 5LA1A 3VNZA 1V6UA 2ABWA 4Y1RB 3MUAA 1E4IA 5A6BD 4CCCA 2VVNA 3AMKA 4TXEA 3WQVA 8CGTA 4XB3A 1E73M 1IZKA 2YIHA 2YWCA 1JI2A 4BQ2A 1E9LA 6TAAA 1H0GA 1BVZA 4P36A 5FD0A 1XC6A 4K2HA 1R33A 1OX5A 1UR8A 1FP8A 1WB0A 3UERA 4OFWA 2E0PA 2F7OA 1GQIA 4Q7NA 3DYMA 3UGJA 4FK9A 5HPCA 1J01A 4OQ4A 3AS3A 5SYAA 1BHGA 3QOMA 2XF2A 2GSJA 4UFJA 3OBAA 3SURA 1OM0A 3B9EA 2WSPA 3CZJA 3GM8A 3A4XA 2G8ZA 1E5JA 1MW1A 3EDJA 2YA2A 1FY2A 2F1BA 1QDLB 1W2PA 4QLJA 4RKYA 3L18A 2RK4A 1HVXA 3CV5A 3WSUA 1C3FA 5DMYA 1E56A 1EGZA 2OYKA 5JBDA 4ENTA 1BG9A 1GG9A 3CZEA 4JFWA 2BV9A 1L9XA 4PMRA 1GVIA 4NRSA 5ABEA 4AD4A 2XN0A 2PWFA 2G3NA 4PTVA 1UQZA 1GOWA 4R5EA 5D9OA 4CU7A 1JYXA 1HKIA 4AIUA 2BS9A 2OWXA 3M07A 3VGBA 2JF7A 1XD0A 1RH9A 3FNDA 1UR2A 4YHEA 1W9XA 1EXPA 1M7XA 4XLLA 4A3HA 4Y1RA 1NH6A 4F9JA 1JDAA 3MMUA 3WBEA 4J27A 4M81A 2XVLA 3D51A 4BIMA 4OUEA 3AIUA 2Z1SA 1VCOA 2D3NA 1QVBA 4J3WA 2Y4SA 1FHLA 2NV0A 5M17A 3BUIA 3PQ5A 4P2GA 3VDBA 4L7QA 1AVAA 4KRUA 5LA2A 3BAXA 1JDBC 3UMMA 3GH7A 4A4AA 3CZAA 4OGZA 3DECA 2W63A 3RDKA 2CIPA 1TZ7A 4U33A 1UG6A 1UKSA 4ATLA 3CIVA 1K9EA 2HVMA 2VT0A 1E4LA 3VUPA 4DM2A 2WCAA 1Q7RA 3CLWA 2OSYA 2WXDM 3A5VA 3HJEA 2C0HA 4HTYA 1PIGA 2WC4A 4AUMA 4UZUA 2EBNA 4AXNA 3WENA 4P7NA 3LRMA 3QGVA 3SCOA 1MW2A 3L4VA 3VIMA 1SR0A 4JAWA 3P9SA 1W3KA 1W3HA 3FIJA 4AYGA 1QWNA 3B9DA 3MS8A 4W8LA 1DWGM 3GZAA 1HT6A 3BMWA 3F5DA 1WO2A 2GJRA 1LQ0A 2BHUA 4RE4A 3KKLA 1US2A 4JZ5A 5IHSA 2WWDA 3A4AA 1GCYA 2VZOA 5A8PA 1OGBA 1NP0A 3RPMA 3PZOA 1KXJA 3AXXA 1AQMA 1HJVA 3VU2A 1P7ZA 3LPFA 4MB1A 3VO0A 3L4UA 2QPSA 1QI3A 4PYSA 1K9FA 5HDRA 3L7NA 1FFRA 1V3KA 5A8MA 1HVQA 3BVWA 1MVYA 5A6BA 4H8UA 4U5IA 3DX4A 4DWSD 3RILA 1J9YA 3D50A 1CGXA 2BXZA 2E4TA 5M5DA 5C8BB 2YDQA 3WFZA 3BMVA 3L4XA 3VIHA 4URIA 3GH5A 2D3LA 1N57A 4OZOA 1OI4A 2V5CA 3CZGA 1CXFA 1C8QA 2B31A 5D8ZA 1HNYA 3SCVA 1CGTA 2XFRA 2VMFA 3IJ9A 2LXNA 1R87A 3M7SA 3WDJA 5HOSA 4LRUA 3SCTA 1HJXA 4N42A 1BQCA 3IGUA 2D22A 3BSHA 1XSKA 2WM0A 4K68A
chains in the Genus database with same CATH superfamily
3DRQB 3FU0A 4PNPA 2FR4A 3LC1O 3W1NA 1NUSA 3MB9A 4NU7A 4HNLA 1XI2A 3HB9A 1F2UA 2NQDA 4KQXA 3NHPA 4P46C 2Z25A 3PV6A 4QQRA 4HYYA 2I7VA 4YIKA 3D0RA 5M2QA 1L2UA 4R1MA 4FMBB 1DRWA 3HAEB 3EGXB 2CZ5A 1X70A 4RK1A 4AY1A 4AEEA 4GLRI 4FOKA 4D3XA 2YQ3A 1ZLVH 1BHO1 4W9FC 4K15A 2QVHA 4L4VE 4PZCA 1BRMA 4QOFA 12E8H 1MLCA 1RUMH 2YTZA 5M5BA 4EFDA 1ZIPA 3RJXA 4J3OF 1SBSL 2O3SA 1ONXA 1I8MA 1CF2O 4DDVA 4AIZA 2HT2D 1RWBA 4HRXA 4YXLL 4I50F 1W9DM 2DV6A 3KYOB 2JG3A 3LH8A 4B9CA 3OYZA 4ZOBA 2DQXA 4MPKA 2EDMA 1YQUA 1P81A 2BP8B 3NBUA 5I71C 3CCFA 3JQQA 5L2KA 1TO1E 5JIPA 1P4RA 2AZMA 3SRFA 3UP8A 3BK2A 3UVIA 2PYFA 5CINH 2FZKA 3QA9A 1NFIA 2CBXA 1QNIA 4B5SA 2MKLC 2ADFA 5F12A 3W1ZA 2B21A 4XMPH 1U9YA 4TX8A 1K5HA 5AB3A 3NUKA 3F7VA 2R69H 4BV1A 2DKMA 3GDHA 1T4CB 3E9ZA 4I5DA 4EY7A 3GLFB 3MWDA 5M34A 5A1TA 2A58A 3MO1A 1BOFA 3PZVA 2KL6A 5EWMA 4NKRA 3TWOA 4OM0L 4AVIA 1H41A 1XEFA 4RE2A 3CTTA 5ESQB 2POZA 4GPVA 4JJ8A 2Y2WA 5ALWA 1TA0A 3MODL 4J0DA 3M17B 5K5YA 1KARA 3RHTA 1CFZA 1H8ED 3NO5A 1I1YA 1P7QB 4BELD 4AU1A 4KUGA 3UWZA 3A4EA 1DVQA 2DX7A 5AXDA 3ZW7A 4JQVC 4U2EA 4D79A 4IMCA 4WI4A 4Q6XA 2VHLA 4BLOA 1JYWA 3RBZA 4ZCTA 4XZUB 4ZUTB 4IGBD 4XP9H 1ZXQA 4Y2OA 4O1AA 2Z24A 1EJVC 1TM1E 1OAZH 1WZMA 1OI2A 1WYJA 3KUMA 5IW6A 1JHUA 3LBYA 4WHCA 4D0DA 2O8FA 3TBKA 4U7KA 3FFCE 1OXYA 2PBZA 1XDUA 4L9ZA 3BC1A 4B90A 5HHOA 1EB3A 3DE3X 2VFDA 3P9PA 3DMYA 3PUEA 1ABBA 5BWOA 1RVGA 3UAYA 3V0TA 2ERCA 3MA0A 4X0NA 4TWIA 3G08B 4R4ND 1MNZA 2VITA 4IQ4A 4W8OA 2Y8VA 3RS9A 2FQFA 2EYRA 3B0XA 5ABFA 2VDVE 3FBGA 2OYRA 1G6HA 4YUEL 4LV6A 4RFLA 1X8JA 1E65A 1PD6A 3O2WH 3UGXA 1EOKA 1YXYA 3TW7A 1I3CA 3EXHA 1Z4JA 3AU6A 2ZWKA 4I81A 4WDIB 4ZCSA 3G8YA 3HJZA 3SRKA 3I6GB 1TO3A 3WX0A 2P26A 4O2LA 2MOKA 4CCAA 4DJMA 1FMFA 4KJZA 4BE6A 5G0WA 4G2TA 3EPLA 1FWRA 2Y92A 4Q7DA 1QKJA 1TM3E 2OFQA 2XWTA 4S1DD 3EAKA 3CUYA 3EZ7A 4PPQA 5B1DA 3QA3B 4Z4QA 4U1MB 4DKAA 2B14A 4D7AA 2I2DA 3A6ZA 4K9DA 4NTZA 2WKSA 1LBQA 2IP1A 5AYUL 1D5RA 3H4HA 2P24B 1X7SA 4LVAA 3OSZA 5T5QA 3GGWB 2VTEA 4PRLA 4WU5A 2HLHA 1EJUC 4ERNA 4MGZR 3FYEB 4HYWA 2OGYA 4J3OD 5AW4A 3FT2B 2Z6QA 1YRKA 2FPOA 1YVUA 4LZOA 5F21A 3QEQD 4JCCA 3ARVA 2H52A 4WERA 3A10A 4BJ6A 5AICA 4C89A 1WZLA 5D5MB 3Q2LA 1T2XA 4ND5A 1GRRA 1OX6A 1V8BA 1UF9A 1I1XA 4WKXA 3O2VH 3EX2A 4XUCA 2Z28A 3NT0A 2X6AA 5F9JB 2Z4TA 2XVMA 3T1NA 5HGAB 3FDXA 3SDXA 4I18A 2O8CB 3QYJA 2QNIA 3OKEA 5GHWL 5D2LA 1U7PA 3U0WL 2VHTA 3E9EA 4B3XA 3D4YA 5GGVH 3A4LA 5IFJA 3CSYA 3WGUB 2NSDA 1LNQA 4JRFA 1NIAA 2HBXA 2DUZA 3RVUD 1MGOA 3TFQA 5KOMC 5IXSA 3MSPA 3H6OA 3H56A 3D7SA 5IJBC 2OAGA 3F7PC 1A95A 3W5BA 4OGYL 5IVOA 4AZBA 3FQ1A 4PMQA 4MV7A 5LHDA 1EE1A 2QORA 3VI2A 4IOJA 1SOXA 4NWTL 1M1NA 2G8LA 1QUFA 1MFVA 3WV4A 2Y1XA 1DKUA 4CAGA 3L7RA 2QI9F 1USZA 4QAMB 5ECYA 1X9HA 5GQBA 1U1IA 3GMOB 5E9JA 5AOIA 4A2RA 2Q2QA 2W2VA 1RH8A 3AADB 1TR9A 4NJEA 5JXGA 4QLBA 4UT7L 5C08D 3LSOA 2VZVA 3ED5A 3FLMA 4QGFA 2FTYA 3UGKA 5F6HJ 8ATCA 2A1WH 4FXLA 1X92A 2Y1WA 3QVTA 1ZJZA 4FK8A 5DKFA 4LSQH 1U8OB 2Q4BA 3IMWA 1O60A 2B77A 3RIFF 3CNYA 4DQUA 1ZITA 4BE5A 3TNLA 3PRYA 1V7PC 2OW7A 1ZLPA 4Y0NA 1R17A 3P9YA 2AK1L 1TVKA 3VC6A 2AVNA 4FZIA 1M2EA 2WTPA 2C4VA 3PZTA 3OEHD 1R6WA 2FHPA 5BMOA 3N6JA 2PANA 2HTLC 2CMFA 2VHJA 4JIEA 3ZTWA 4PS0A 1S5IL 5T5NG 3T4AA 2BW4A 3GZKA 2VRAA 2IAMB 4GP4B 4AJ0A 2XWEA 2Z7GA 2E6UX 2QDKA 3NWRA 3EYOB 2CCWA 3LHKA 1MW9X 1NJ9A 4DIXA 1M33A 3QFRA 3QVSA 5AKRA 2O5XL 3GQYA 3EZJB 4WCYH 5HAOA 2DAPA 1FDRA 3LCRA 3W3OA 1MCCA 1I7TB 1FWCC 1Q0RA 3CDYA 5KMYA 1BJKA 4GUPB 5CZXC 4IGFA 4Y7EA 1OT2A 5HVHB 3HURA 4XNQA 5FJUA 3WFDL 3GSUB 4HVLA 1EPFA 4ETQA 3LS5H 2Y1DA 2R6R1 4NYJQ 1IM5A 1LROA 5LNEA 4FMVA 4P2OD 3DX8B 4ZQKA 1RUPH 4Z8YA 4KQGA 2V81A 2QVXX 4JIMA 3E3QC 2A77H 4HAYA 1W9BM 1AS8A 5T3ZL 1WDQA 4DELA 4Q4AB 1UT9A 1GPWB 4TLAA 5TDPA 4GRWB 2WSRA 2V1XA 4TIMA 2DE0X 3COSA 3T6KA 1C5DA 1U3NA 4MQ5A 1F42A 1DPMA 4TSFA 4DCQA 2IWGA 2CGRH 4EVRA 2HFGH 3UXAA 2AZUA 3ZVNA 4WXRA 2VQ3A 2IXGA 2C3OA 1JF5A 1UD3A 3WX7A 1O94A 4EXAA 1N82A 4YRQA 4PV9B 1F58H 4WFEE 3JR3A 4NVTA 4FEEA 2OXIA 3KQLA 2NVUB 1X8FA 4NHEA 4L6AA 3TGWA 3VU9B 3LD9A 3QV1A 4EE9A 1T9AA 5A3SA 5JE8A 2IKHA 4JYAB 4EPVA 4EHJA 2PMBA 1QX3A 5IIEB 2FZMA 2N3ZA 3UWMA 5ALSA 3WHXA 4NU8X 4UIOA 1M1YB 2AQIA 2J6XA 1NGXB 4GUIA 4FA6A 1US8A 1ZISA 3ET4A 3KHSA 1EE2A 2Q7YA 3WFBH 3KGUA 2G7ZA 1U22A 4J8QA 3HN2A 3VUEA 3ROOB 2UZPA 2R2EB 4CF4A 4IIFA 4D8AA 2R8ZA 4C5BA 1A21A 4QHNA 1EUTA 1H5VA 3G0BA 1X42A 5CVEA 1PBTA 4NIYE 1PR6A 1JDZA 4EX4A 3KQKA 3POHA 2VSMB 1QG2A 1K8IA 2GCYB 1T41A 2YC1B 3MU7A 4WK9A 3GLGA 1NBYA 3O2LA 2V3CC 3PVCA 1IL1B 4AYFB 2ZANA 1HWGB 4OX9B 1NL3A 2AJ3A 5SV4A 2GTQA 4X7RA 1NM9A 1HG1A 4FQIH 3PF9A 5LGYA 1OIXA 1FZOA 1BZDA 4OJDH 1ZIOA 3AF4A 2MQ0A 3L0YA 1DQDL 3WK7A 3X17A 2MINA 4HCLA 4I08A 5ALHA 5CDTA 1SC1A 3COJA 3D3WA 3E5HA 3H3BC 2HPOA 3SF8A 4ENQA 1PNRA 3I3SR 3P9LB 1V5IA 4YSRA 4ERSL 2X0UA 4L76A 4J6RL 4KBYA 3WBJA 1K6QH 2XQYG 1XM3A 2JIEA 3MRGA 3LUGA 4WU7A 4LG1A 3ULUL 1FH5L 2NW0A 1U5BA 1ECEA 3Q8XB 4ZNCD 5ACZA 5E24E 4PJ5B 4F9PC 5D4HA 1E8WA 4ECAA 1UEXC 3HFJA 1P80A 1JV2A 1R3JA 4G41A 1Y5IA 3Q98A 2ZUQC 3DEAA 4DTGL 4EJSC 5CS7A 3E80A 3K1JA 3N8DA 2KZBA 3MCLL 1KMHB 3DROB 1XCPA 5JOPD 1EEXA 3RI5K 3K5IA 1UA6L 2GJ6D 2H4ZA 1F1DA 1XHHA 5EORL 1MFEL 4Z7QB 3P0GB 2OBGA 4O51B 3BHIA 4LSUH 1J8KA 3I4KA 4LDPA 1HFWA 1Z7AA 1G5RA 3DAQA 1Y5VA 4W7IA 4G8IB 4Q1DA 1AY1H 1ISXA 4ZS7L 2JCGA 1U6JA 1E3DA 2ZR7A 1RJFA 5IB1A 1SVZA 4XB1A 2NO7A 3SKXA 3QBUA 1LTKA 4XTRA 2ZR0A 4RH3A 3VZXA 1UD6A 3PFBA 5IM7A 2YCIX 3SBPA 2J6VA 5GS0H 3WAGA 1XDDA 1MFUA 4Z7NB 4ELKA 4OATA 1JKXA 4EYOA 4PH6A 1Q8AA 1KPRA 5SWSE 3BMNA 2VD8A 5JH7B 1Q9KB 4N3AA 2UVEA 4KKBD 5NLLA 2AG0A 1FNGA 4HDRA 4LTDA 4G7VL 4M02A 3TOVA 4X24A 3F6CA 4MMZB 1UIRA 1G7HB 4YHGA 3MTWA 1OFEA 1RT9A 1CB0A 4YJHA 5DBIA 5IQ9A 5I7AA 2VX4A 2NXJA 1NPUA 2I62A 4AF6A 5DIFA 4FFVD 1IULA 1X38A 4K73A 4GMGA 5L2KE 3AMLA 5MDHA 2NU7B 3RTGA 2VC2H 4HKPA 1ZVKA 1JBJA 3MACL 1BJ8A 1EWKA 3LT0A 4PLCA 3IIMA 4N0UB 1TJXA 3HB3C 5CT4A 4XPGL 3VI3E 1IMJA 4QJ4A 4KOAA 1RWKA 1KGCE 4AM0A 3OAYK 3L6RA 4MLIA 1KO1A 5ESAB 2ZXGA 1H3FA 4OQMA 4S1QH 2E4FA 3IFNH 1M6VB 4WO4B 2IBSA 1H3XA 3NIWA 1LQBC 4PN6A 3TDMA 2MPVA 2PU1A 1MWAB 1H9BA 3UYOD 4BWTA 4E5TA 4LOUD 5F52A 3I50L 4H1LB 1NBWB 3STFA 3OM1A 1E9QA 3N14A 3PR2B 3BRDA 2X1PA 3MVSA 5B57C 3MC5A 3EJZC 3NIFF 1N8ZA 5F1SA 3WQPA 4IRUB 4QRPD 5BPHA 1A5UA 2HU2A 4J16C 2PX5A 3MRCB 3PLYA 5CG7A 4XXDB 1PLBA 4WEMB 1QGUA 4LDEB 4KAJA 2N7AA 1A7NH 4O0ZA 4LC9A 5DWPA 1MRAA 3PC7A 2ZX7A 4WFFD 1MF2L 2G37A 1BN7A 3JSAA 5FR2A 3VPDA 2JAPA 4JE0A 4G1CA 4O1CA 1IVTA 1ESEA 4WZBE 2D0IA 4Z4FA 4X6FB 2ZRBA 4X84A 3G6AB 3KYJB 2VAJA 3QDJB 4DKFL 2WA1A 3G9UA 3PXDA 3QNMA 5GS1A 4H0HB 5XINA 1EDQA 5BS0A 4U1GC 3HDTA 4PYRA 5BMVB 4EMSA 1BYBA 2X12A 3BP7B 3IDZA 4YPFA 1GONA 3ORHA 3TWCH 4KXFB 1VKNA 4GEKA 1SVDA 3IDGA 5DTJA 1Q6RA 2P1FA 1MZRA 3DZIA 1G7TA 2QX6A 4GI2A 3Q58A 4X5XB 3ZJ4A 3BKYL 3LXXA 3N04A 1KEGH 2EINB 2DWTA 2EQ5A 2IYNA 2Z00A 2NTNA 1OSPH 1LNUA 1RJZA 3R4RA 4RF4A 3A7DA 3DZJA 1PG5A 5CBAA 4RJLA 5BQ7A 2P9YA 3M3DA 4LHUD 4PQXA 5E8OB 4Y4KA 2OAQ1 2R8RA 3J81k 3SN0A 3D4NA 1TAQA 3GB7B 1GQSA 3HHMA 4NZ3A 2ZDRA 1BBJB 5ITVA 1D5XA 4OQLA 2YXMA 5K59F 3EDDA 1J0BA 4L22A 3ITEA 3V8EA 1Z5LB 1JJ7A 2I29A 2RR3A 3IJLA 4GIPD 1J5OL 5A95A 5BV7L 2CZGA 2MCPH 5EIFA 1B6RA 2PYED 4A1FA 3K92A 3JW8A 1GPAA 2WTNA 1XCOA 2O48X 3L1JA 3LKRA 3JQAA 2WXKA 3FONA 1BFTA 2EKPA 1TW3A 3TYAA 3VD0A 5FF0A 1XMOB 3OECA 3U6RB 3KM0A 3KX2A 4NQSA 6FABL 4DBSA 2GERA 4NO0A 5FKPB 1ZR4A 3APGA 3RJ5A 4DQXA 2K9FB 3T2PA 3WEMA 1GL9B 5C5EA 3UTSB 3LI0A 1XQYA 2V6BA 1OSYA 3OLEA 4RKWA 3EOYG 1GPH1 5HJ2A 4DAGH 3CLUC 5AI5A 2FR8C 1I4TD 3QORB 5JYCA 2E55A 1ZMTA 1ZANH 3HXLA 5IJAA 4WI5A 5C0BB 1X97A 3PPXA 2DQJL 5DM1A 2B4CL 3HCDA 5HY9B 3BPCB 4DIDA 2QCGA 2OV0A 3F7NA 2PKDA 3AMVA 2E1WA 2H7YA 4YXKL 3VTZA 4ER7A 2KBGA 4GPIB 1CGVA 3AACA 1NDTA 2YR0A 1THFD 3DENA 2G2PA 2X3CA 4EARA 3HK2A 4A8LA 2ZUNA 1J39A 5HDWA 1WWBX 4Z0PA 4NI5A 3SDXE 5KVMC 3B7TA 5EU6D 3QVKA 2Q5EA 5C1OA 3DFPA 5D2LE 3NSJA 2YYYA 4HDCA 4JY4B 5ARCA 5ICZA 4EPWA 4AKPA 1KPUB 2B82A 4HCRL 2PH1A 4E22A 1GT6A 1OLSA 3NHBA 3VCLB 1ET8A 1QO2A 5A4JA 2FZEA 2NUWA 2BEWB 4YBQD 5KS9A 3PJSA 5DNDA 4IOSA 2ZRFA 3WJSA 2BP0A 2WAOA 2EC9T 3MR9A 4MASA 4U9IS 3REWA 4JQYA 3OFVA 4NAQA 5D7NA 2CMGA 4O5LL 1T3ZA 2OWDA 3QH3A 3PGVA 3C0QA 4Q5IA 4B85A 4UF7C 3MTIA 1KM2A 9LDBA 4GEIA 5TIMA 3EG9B 3K3QA 4GRMA 2ATCA 5CXUA 4GI3A 3SQNA 2V5YA 4LE8A 1MEXL 3ZGHA 3U9PL 2NOYA 3GO4A 4XI9A 1R0WA 5D01A 3UAJA 1HOXA 4EMZA 3GJ7A 2YBTA 3TI7A 2PWHA 4QRPE 1QNFA 3MZ0A 3ZZMA 4BNGA 4UT6A 4YAQA 2YXNA 1ITUA 5DVKA 5DHFA 3U4QB 4KQ6A 1JJFA 3ZHNA 3QX9A 4KN9S 4OFXA 3CQFA 2JIZA 1BMZA 4RMQA 2VDQH 1YEDA 3TI9A 4NZRL 5E1MA 2BMEA 1T2DA 3QMWA 4XX1A 3VNAA 1KH1A 4MY9A 5CGMA 4OZFA 4B8ZA 5LAPA 5F5LA 2YWXA 1GPYA 4O16A 5IG2A 2G76A 4WKHA 4JRYB 2J1LA 4B81A 4O1HA 3VNJA 3S2ZA 3RRNA 5DJ8B 4AVOA 1QNSA 4UJ5A 3TBFA 2VGLM 1JWAB 3ZYIA 1UZUA 4TL8A 1B31A 1IXQA 5IEHB 4PJBA 4FYIA 3EPJA 4L3EB 2H7CA 1DJXA 1NNLA 3ZJKA 4C6FA 1GT8A 4KFRA 4JR0A 1NPTO 2V5JA 4ZE5A 1ZENA 3U4FA 4IGSA 2W2KA 4I4WB 3LZFL 3LZPA 1LBFA 2Z7ZA 1PDWA 5SWUA 3BWSA 2ZCLL 4LMQE 1G64A 1OWMA 5JFOA 4JN2B 1KC3A 3ER9A 5JV5A 2Y7DA 3GK8L 1M1UA 2XIOA 1JFFA 1DX9A 4CDGC 1KBLA 4HGXA 1M6OA 4G01B 3UTQB 4JTKA 2ZRJA 3EOAB 1NRWA 4LV5B 1K6MA 3WLOA 1RABA 2AF4C 2JZOA 2VABA 1PB0A 4Z7VB 4KMOA 3CASA 3GEHA 4Z9XA 1H3VA 1MLBB 5J6SA 5LYJA 4AG4L 5KUKA 1R9NA 3IUQA 4WNYA 1ZJWA 1T3TA 4OZHE 3VI4E 3E3HA 3HXQA 3A3HA 3DX6B 3MFGB 2KPNA 3BQ9A 1PZFA 1SC4A 4D6CA 4I3SL 2I2XB 4EGCB 1IJKA 3ABGA 1K8ZA 2C3VA 3RU9A 2JLQA 1P0EA 4MUJA 2HIMA 3REVA 4YECA 1U3TA 4ABQA 2VEKA 1P4IH 2N7BA 5SZJA 4EPTA 4MQXD 2F9FA 3S36X 4HU2A 3T5MA 3OZDA 1S96A 1O5PA 4X6XA 5KAQF 4WZAA 1V3QE 2XZTA 1ZY9A 4W88A 1X4YA 4YRZA 1SKUA 4R6XA 5DNVA 3VC2A 5DQJB 1Q0YL 1SXAA 2P8BA 2QUNA 5EBAA 4JNMA 4NKDB 3G2MA 3SZ6A 1IAIL 3UMFA 1SBZA 1SJEA 3UC2A 3T8VA 4K3EL 3B20A 2H5JA 3DT6A 2DT1A 2J66A 2E9MA 3UIZA 2R44A 1USGA 3IGAB 6LDHA 1S5TA 4I55B 1Z0FA 4YCLA 5I0XA 1LYXA 1P1CA 4MFDA 1ZCBA 2AVDA 1AO7B 2YH2A 4PJCA 1Z29A 3M6FA 1A9BB 4KVZA 3KZSA 4LNCA 1YDMA 3UXDA 3EF7A 2NTFA 4R4FL 2AMLA 1RZ3A 1ST2A 4TMXA 2QJGA 1HXMB 1D8WA 4TX6A 1EDHA 1IZ7A 3FU9A 1L3NA 2ERYA 4XVDA 2CE6A 1ZP3A 1MJGM 1ESOA 5DEGA 4HVCA 2XZAH 1M6HA 2R8SH 1OZTG 2XETA 3Q85A 3HH8A 4TQUS 2LR0A 4JDBA 4IRZA 4RPKA 1E1RD 1P7QD 3VISA 3OD3A 4L8YA 3ECVA 1H6AA 4MWEA 2G75A 1IZYA 5JAIA 4B96A 1D1QA 5CXPA 2HJFA 2YNMC 8XIAA 4RD0A 1EXWA 3P11L 2WPGA 3U56A 3H4IA 4FXTA 3IRUA 1BEYH 5LOVB 4GI4A 2PSSA 4MVBD 2YUZA 4G6ZA 3OGSA 2YBEA 1EFCA 3Q5TA 4F91B 1K9SA 1HE5A 2INZA 3TNDA 2R1TA 4BO7A 3DKVA 1U8EA 4HUQA 4JPGA 3CJJA 2EXWD 1XLDA 3WMXA 1E7QA 3KLLA 5DVLA 5FWRA 4MAAA 3CKKA 4D96A 3P9ZA 4K7VA 3Q7JA 4N3GA 3SSNA 4O4JB 3LEXB 5DASA 3CW8X 3E3MA 2HUPA 3GDMA 1JPMA 5EKUA 1VL5A 2BF7A 4NJJA 4P7JA 5B7NA 5XIAA 1VHLA 2FLRT 1HJUA 2JS7A 2CUZA 3ANTA 3FOMB 4FYVA 4APXA 4V02A 1U80A 1N3YA 2F5BL 3WA6A 3WXWL 3K5PA 3APTA 2QMEA 4WH0A 2YWRA 3LNIA 4H20L 4P31A 1Q9WB 2WDZA 1G20B 4G8GA 2Q9AA 4U00A 4PG6A 2W65A 4FEMA 3BJIC 2BY1A 3TH4T 1G9NL 4KV9A 5LBIA 4B31A 2ZAMA 1VCBC 2AC4A 3Q40A 2DETA 2VEDA 1NI4B 4K6AA 1RJPA 1YX1A 3DUHA 4JLNA 1OTSC 3UTTA 2JFVA 2J79A 3TGLA 1AK2A 2AFIA 2IQAA 4Y9DA 1TPB1 4JHOA 3TLRA 1IEWA 1VLLA 5EGNA 2FATH 5IQNA 2PS0A 3OBBA 2CDNA 1Z4LA 5J5VA 3URQA 2VDNB 4EXKA 4LLYA 1Z0ZA 2WU3A 5E8DH 4GRWF 1D2KA 2Z29A 4XJSA 1E6SM 1KBVA 2V03A 1T2UA 2ZUMA 3JYOA 1COWA 5CUQA 4DWVA 3ULUF 1NR1A 4DNLA 1JKFA 3FW1A 3GP5A 1UR5A 2B5IB 2HMIC 1Q6CA 3CDZB 3CWQA 4W6YB 1DVFB 1CCZA 3HMWH 4UDNA 1J9CT 2ZOXA 1M5TA 1N34B 1TKBA 1UZMA 1NMAH 2IANB 3CVVA 3K3PA 2MR5A 4AH2B 4E41B 5CNJA 4YAUA 3BEVA 1DEKA 1YR7A 5IRPA 4ZSOE 3T54A 3TOSA 4EVQA 1PIFA 3OOEA 4ES8A 1R9ZA 2I9UA 3LHUA 1DBAL 1M56B 3OFSA 2CDEA 4UXDA 3QPQD 4ZHQB 1VB5A 3BW3A 4YSQA 1PSCA 1GUZA 3HKCA 4LGMA 4G7QB 3URNA 1PE0A 2CRMA 1UJ6A 4YP7A 2CJFA 4NCNA 4GBXC 1O5OA 1KA9H 3M1CA 4D6FA 1D9KC 4MKIA 4IOFD 3C3YA 4E1AA 5ANRB 2PZLA 1A6ZA 3EPPA 3V4UH 1I4FA 2CGYA 3SOBL 4LSGA 4L5FE 2NR6C 3IEXA 1I0LA 3Q2VA 4ERXA 4WNAB 3L8YA 2Q9BA 2QCDB 1DQSA 4CQLA 3U7FB 2VW7A 1KZGB 4AZ3B 4C6KA 4E9YA 3BSZH 2VB5A 4IMDA 3JVGA 1IB6A 2DEWX 4X92A 1BD0A 3V1TC 2QN7A 1JCVA 4WUVA 3AXSA 3IE1A 3CEUA 3WL9A 1RHKA 4MYDA 2MR6A 3MXVH 3QVLA 1WB9A 2AOTA 3WQDA 3HN3A 1MO6A 4WTOA 5CVCA 2PPGA 3AJ7A 3DJTA 4NLLA 1XBTA 1NMEA 3O41B 3MD9A 3KCPA 2SCUB 3NPSB 4BN4A 3L3IA 4BVHA 3RKSA 1UKPA 3AHTA 4LGYA 1H0DB 3NP4A 3S40A 2OBLA 1KACB 3S1GA 3DVRX 4PWYA 3M7FB 7REQB 1GA4A 3HGQA 2ZRWA 3N43B 1Y6FA 1F7VA 1NY1A 3THXB 1FVEB 4KTEH 4WSKA 4BQ8A 5AC5A 2VZ1A 3L8FA 3IU3B 4WCJA 4AIRA 3VKJA 1R5WB 3B51X 2OMKA 4FQXC 4ALDA 4AVYA 2NNRA 1AZTA 2C7PA 4TNVK 3PEEA 4Y5VA 1YD7A 3OI7A 4Z7QF 2WIBA 3DDCA 4HNNA 1D6EA 4Y7DA 1UGNA 1NAMH 4MY8A 1E6MA 5HVNA 2VEMA 4A7PA 4AD1A 3KBVA 4YHMH 3NEEA 4LTMA 1I8JA 2C2MA 4LVHB 3CFEA 1WP6A 4AJWA 3PVFA 4JL1A 1VBGA 4MF4A 2CLKB 4AVKA 3LZLA 4NU0A 1IVLA 1KT2B 4XKJA 2CDFB 3VXQB 4WNQA 4EZIA 1G6Q1 3NL5A 2E4WA 4LEBA 3GCZA 1QI2A 2HPIA 4Z7NF 1XZDA 4FP9A 5BT9A 2NYYD 3H2WA 1E6OL 1U2TA 5KSWB 3RRFA 3U39A 3RRQA 4GRLD 2I26N 2J8TA 1M67A 4DLBA 1YPZB 3F04A 4PRHD 5JH7F 5I0VA 3EX4A 3MLXL 8CGTA 2QVGA 5JW5A 1VL0A 4JEUA 1SZPA 4N82A 3ZXUB 3NV7A 1X3LA 1UCTA 1H0GA 4LF4B 4FSDA 3THRA 3LZ6A 4B3MB 1ASQA 2CLEA 4DBVO 4EA6A 1DQKA 4GKNA 3SCMB 3WLBB 3D64A 4M1DH 1KGIA 2CJYA 4PY2A 4CIVA 5EL0A 1GQIA 5FWYB 2QVLA 5F2NA 1PV4A 1FO0B 4P4KC 3DYMA 5I1EH 2HSAA 3W1WA 1KJZA 4D3CL 2XMRA 3GEGA 1MREL 1VFPA 5CHNA 1S7XA 1CBUA 4BEJA 2XIJA 2BH0A 4CV3A 3K0YA 7PAZA 4XGQA 3T0EB 3GUFA 3TZCA 3NAZA 3B8YA 2WSPA 2BOGX 3I2YX 5FL7A 2HKAA 1DRUA 4LCYB 3BHMA 2BAGA 1YVPA 4D9HA 2WP3O 5BT8A 2E9JA 4RMGA 2F1BA 1R19A 1AO3A 3UU0A 3HP1A 1ND0A 1TLMA 4YVXA 2EW1A 4X20B 1QMLA 4BLPA 2E87A 3IB3A 5ALKA 3TJRA 3IEBA 3MRBA 2DFKB 4OQTH 1T2FA 1OCOB 4F33A 5JROA 1NUUA 1FIGH 4Z6AT 2G3YA 3AL3A 2HBZA 1Z5VA 1ENYA 4KRYA 3AZOA 2J6BA 1QJCA 5C0JB 2BZ7A 4AL8H 3MBXH 5CP3H 3V52L 2AQKA 3RRJA 1FRNA 5C1IA 3VJKA 3LS9A 4XIJA 3BK0A 1HTTA 1EXPA 3W7CA 4KDWA 4OIAA 4FZVA 4PJEA 4E1BA 2Z1PA 1VXRA 3T8XB 2JFXA 3MMUA 3WBEA 3WGQA 5F2OA 2YK1L 1DEEB 3TVMA 2BFFA 2A7NA 1OE3A 4IVQA 4PBTA 4C6OA 3WKAA 3UB2A 1ERNA 4QHMA 3BAXA 1JILA 4BKOA 3FN3A 3B9KB 1TQXA 4KERA 3U2ZA 4L02A 1K9EA 3IDXH 1V6AA 2RGNA 3VUPA 4G7EB 2BKXA 3FWNA 1EBGA 2ZZ7A 4JX9A 4X4KA 2WXDM 5CFLA 1JPEA 4YDNA 1XZAA 4DR3B 5CPNA 4RABA 5BMVF 1Z2NX 4N2IA 2EBNA 2QYHA 1Y48E 1U6AH 4MHHG 3KYCA 4Y9EA 3FRUA 4I5RA 1P7TB 4BQEA 3MAJA 3FPFA 1G55A 1OILA 1FO0L 3O3UN 4CGZA 3BAEL 4F3FB 1E6WA 3H4VA 2UY7B 3QQ4B 4PXAA 4PJ5D 4BLQA 1H5BA 2YPKB 5G3YA 4BQNA 4NO3B 1U3FA 3HC0A 5LNGA 3U9UA 1FRFS 3WYNA 1E1CA 4ZXBB 5TQ0B 4EEXA 1KTNA 2ZSFA 3NDJA 4PWJA 3BL5A 4C6HA 3IFPB 3H2BA 4NO5A 4XNMB 3I02B 4R2IA 3MJ9L 2HPAA 4G8BA 3IIJA 4KU1A 3ZE2E 2VK2A 1AGPA 3RVWC 4PJBE 1OSNA 1H7PA 2UZ1A 1DTWB 3THAA 1YA6A 5A8MA 4PTTB 2GSIB 3UJCA 4HIPA 1MFMA 2B7PA 3GROA 4JXCA 3GTFA 3BZDA 3FNFA 5AVVA 3MJEA 1RKUA 1G9XA 5K1JA 1HE4A 4N2YA 2KZKA 3MLWL 3KHTA 5CA1A 3IVXA 4JJ5B 2W71A 3OC0A 1DIOB 4QDXA 2A67A 1MVUB 4BINA 1CE1H 5C31A 4LOAA 1UJPA 3P3YA 3O7MA 3WZLA 2DQZA 4UAVA 3BZGA 3HY6A 3RTQD 1MAUA 3H8AA 1HUVA 3KBMA 5I9BA 5FF9A 2APXA 4UVEA 1HINH 1R37A 2X0KA 4RX0A 3LN4B 5AVTB 2WNKA 3CFBB 4J1QA 2R5FA 1S6YA 4FNLL 3TOPA 1GZGA 1CERA 3R5EA 5IH7A 3SEZA 2WLKA 2XDQA 2QRMA 2R29H 3QUZB 4FO4A 2BUBA 3R18A 1Z0KA 2BMFA 2AV7A 4X8GA 5HF9A 2NV9A 2OQHA 3LNEA 2I9EA 3RYHB 1QHOA 4PRHE 5J9PA 3JZEA 5ICMA 1UH5A 3T95A 1NVVQ 3KELA 3E6FA 4DPQA 4XP4L 4ZTPH 3NDPA 3P4NA 3P2IA 3QJXA 3TOCA 2FPYA 2B4TO 1MBZA 1QIHA 1HHHA 3QNYA 3BFKA 1YZUA 1Q3NA 4MR8B 3QG7L 3WWZA 4JFYB 4NYUA 2GNAA 3S2YA 2G3IA 4GK8A 4TVSa 1OFRA 4WZAE 1FRGH 4ZYWA 4AKGA 4JT9A 1OW0A 1WTLA 3QO1B 4XRCA 1G5PA 1HT1E 1HYEA 1QLJA 2AD5A 1C29A 2V4ZA 2PDCA 1NRXA 5IMKA 3UROR 3SKNB 5TQ0L 4XQGA 5F78A 1SWVA 5EHIA 1ZAKA 5CCEA 3B34A 3MBEC 3BGVA 5DK0A 2Q8LA 2ZXEA 3KDSE 1ZV5A 4XUGB 2IDSA 1EP1B 4PICA 4BQPA 3ARUA 4WO4D 1WMSA 1MRQA 1EO8L 4ADGA 5AKVA 4G81A 4PJCE 2R85A 5C18A 4CU8A 4G0NA 1Z9MA 3ZDDA 3OEWA 3GLIB 4AC4A 5F1NB 4A1RA 1SUAA 1D6VH 4JIQA 4WXPA 3PT5A 4MQBA 4AUNA 4X6YA 1RJYA 4ODXB 3BORA 2WHJA 1CZLA 3LBCA 4K2UH 4HS6B 2AHIA 4UAGA 4ZAXA 2ZCKH 5A1AA 3NT5A 5A69A 2C04A 4I6VA 2CYCA 4ZO7A 5C8XA 2WJZA 1V02A 2EARA 2QP4A 2FJFB 4GIOA 1EM8A 2FUEA 2SECE 3WEXA 4WMLA 3W37A 3EY4A 4EK9A 5I1GL 1GVYA 3WELA 2RAUA 3S6JA 3RAJA 4BZPA 13PKA 4YGAB 1YBQB 5CFQA 3QDJD 5IHUL 4QYXA 4BN5A 3UM9A 2EFJA 2OLSA 2C1OA 5G5DB 3ZHKA 1BYUA 1N9GA 3MZNA 2C29D 2WHMA 1FFNA 4MB4A 3LNGA 2IEAA 2OMUA 1FP7A 2VX7A 3MLZL 2R97A 1JR3A 4ARVA 4MUZA 1F4PA 4PXYA 3SOTA 4AEFA 3JQFA 1NSNL 4WRRA 3UA3A 3ETDA 2JFFA 1M7DB 2F64A 4W9ZA 3L7EA 1TK2A 3PRZA 4FZ3A 2JJSC 1TDQA 1K72A 3G5XB 1EB9A 1UJBA 4MUKA 2VXQH 1VJ0A 4L9LC 1CY6A 5I9MA 4HTFB 4KX5A 3FCUB 3CAVA 3L3OB 3PWIA 3GHYA 4YYZA 3JQCA 3L8GA 4PM4A 2VBFA 2EDXA 1R5YA 1U11A 3IBSA 4WWKC 3AVTA 2ZRHA 1U0BB 4TOIA 5T6BA 5KOVC 4Z5XA 4CMHB 4IJ5A 2DLGA 1HCZA 4KRNA 3JQEA 1Q7MA 4CCYA 1F3JA 5CT6A 2QX7A 4G8GE 4ZEOA 1EAYA 4NNAA 4NKQB 3MROA 1T6BY 3E6HB 3TL2A 5B7MA 1XN4A 821PA 3V3KA 4MNGB 4PM1A 1UEMA 1BXCA 2BDNL 3EJWA 4MLZA 4Z7VF 3O3MB 4QXUL 4MDFA 5LJLA 2WTRB 1R3IH 4XCYA 4PYJA 3USBA 4ZMPA 1KWGA 5A7BA 5C07B 2X4IA 1MI5D 3EO1A 1PDOA 3UTSD 1VJTA 2AFIE 2PZ8A 3B8DA 2YXLA 4B7IA 4MDHA 3WDQA 2BH9A 3E1SA 4BSVB 2JA1A 2ZB7A 1NBQA 3ITCA 3G22A 1WHOA 2OAP1 3IB6A 2VP9A 2J5BA 4V2BA 4DR4B 4JFPB 5C0BD 4Y16C 4O1DA 4NSBA 1S7SB 3A21A 5EFIA 1NXSA 2HD4A 3FWPA 5CLXA 4PU0A 3UAAA 4K0KB 2XNHA 4LLAA 1SLWA 1Q7EA 4N41A 5CD1A 2EOAA 6ABPA 1JI0A 4DR7B 4IFBA 1EZSA 4C4KT 3GHPA 3PUKA 3U4GA 4RTLA 2GNOA 4A92A 3EOBB 4N0MA 2NXGA 4RJJA 4Z23A 5I1JL 2PDFA 1U0TA 1ZHBA 5DD6A 2DZXA 3C5WP 3GSWA 4ARZB 1A4BA 5CLIA 3ADCA 1E72M 4W5WA 2ODQA 4RCXA 1K92A 4QT4A 3I8SA 2C2OA 4EG3A 3ROLA 2H11A 5J40A 4OD2B 3TE6A 4WDTA 4GPNA 5TGTA 1DL7H 5DGRA 3AXMA 4YP0A 5H80A 3BV7A 4YXWA 3R7NA 1JHMA 4RGNE 3SZ3A 2C7UA 5C0IA 2QP9X 1BCSA 1BQGA 4WWPA 5BRJA 3ZDQA 2MPAH 5FECB 4MWFB 2E6QA 5B1JC 3VFMA 4XIYA 3W7RA 4GM4A 2XPGA 5CU9A 1YFKA 1YZZA 5KAQG 1E67A 3ZTYA 5CNIA 5LCVA 2NX5D 4RFNC 1S2GA 4D97A 3KLDA 1XIWB 3RYCB 2D4AA 2YIDA 4L4PA 4R4JA 2Y7SA 3GDCA 2WUCL 4BEWA 2VM4A 2DIKA 1C12A 3RU2A 3C8NA 2VSKB 3L13A 4YRLA 1ZGLB 2XMPA 3QTGA 2QTAA 5KSAB 3RSCA 3LIZH 4UM9B 4P80A 4QTIH 4RSVA 3HN8A 3ARFA 2UZXB 2XMCA 5JHLL 1S3RA 4OJCA 4YUAA 1L5HA 1UM8A 5CFZA 5LOVF 3I9PA 5FAGA 2C2GA 4YGYA 4HNCA 1CUDA 5T8IA 2DH3A 4MUNA 3H11B 1TUBB 3TZLA 5CLTA 5I7RA 4Y5YB 2GZAA 1TQBC 3QHFH 4F8EA 3S4SG 3ROZA 1L4GA 1TYJA 4BH8B 2OZ4H 1QWGA 1HF3A 1U0FA 3QPUA 1XMSA 1I1FB 2ZWYA 1LLAA 5A2LH 4OXYA 3K35A 4JRYD 1JQBA 4TGLA 3C3NA 3VD4A 4BJ3A 4JFUA 3T52A 2FJGA 3CXDH 4ZKDA 4PLTA 5IR1A 1KLFA 4JZNB 2W4QA 4XEUA 3HY3A 5DRYA 4AMVA 1B23P 2OLJA 3W87A 3NCTA 3HG5A 5EZOH 3OQRA 4L3ED 2R6GA 4C7MA 1DUVG 1YE3A 4ENVA 1BQ4A 2XFYA 2ZKYA 1IIGA 3BK7A 1UM4L 4ZXLA 4P9HC 4AGMA 4X4XA 1MHPA 4U3SA 1AURA 4QXMA 4LCBA 1YEJL 3U83A 3HCBA 3ULVL 3KXFA 4ISVA 2HTMA 4AZ0B 1UDXA 1IHDA 2X4TB 4N6FA 4JU8A 4F93B 1YZ3A 1DE4A 3PC6A 3WN5A 3B9OA 4KKLD 3UC9A 4CI0B 2RG7A 5CSUA 4IAOA 4CXMA 2YL6A 1LNZA 2X1MA 3KGSA 1Q4NX 3QI9B 2EX1A 3AY4C 3IKVA 1KELH 4DGUA 3NSNA 4FR0A 5SV2A 3N86A 4PVBA 3QR2A 2ZSHA 1QPQA 1RI5A 2KHAA 5HI4D 5DI8B 3ZWAA 1WD5A 4EY8A 2JIRA 5LQNA 2E8YA 4BF7A 2JC3A 4B5EA 5GXBB 4K9MA 4F40A 2WMNB 4LWWA 5JOQA 1NAKL 2QPTA 4C88A 2BF4A 3IJEB 1C7ZA 3UTPE 1KFAH 2DQIH 3F5WB 2Y1LA 3UXHA 2ZCVA 5AVWA 2AFRA 4QWWC 4KIFA 3TSWA 3HKZA 1E20A 3R0DA 3RVOA 3QGKC 3WL6A 2CF6A 2IPGA 3UUWA 2AABH 1MI5E 1AACA 1X98A 1RC1A 3V4BA 2EZ8A 2D8AA 1BRLB 2J1WA 4HKJB 3WK1A 1TZ2A 3VAZA 2R6AA 1UMYA 1P2CB 2CZDA 3PB2A 2VDRB 2YL2A 1NJ1A 4ZAKB 2ESCA 3DO6A 4GAEA 4MLJA 2XC8A 2FX5A 4ZDHB 1QP1A 1JEEA 1E6UA 3LGGA 3SKJL 5T8KA 3NIDE 4BNUA 2VDPB 4JQ4A 3ZIZA 3MX0A 4L7ZA 1UMCA 1TZGL 5BW5A 3D02A 3II1A 1I3VA 1BTMA 4DEWA 4DQDA 5P21A 1GEEA 1IEVA 3A9VA 4NIKB 2Y69B 3NWOA 1AO7D 5CNHA 3GMLA 1XYVA 3X3GH 5L4JA 3MNZB 1SUIA 3SPGA 4FLHA 1U91B 3RMEA 3BDBA 4LW8A 2XGBA 2BTQB 1XIVA 1Y9EA 3FOKA 4PJEE 1ISVA 1X8XA 3MV9D 3EXSA 4N0PA 4OCYL 4LSRL 3WQ4A 5T33L 3R11A 3IFSA 1KD0A 2AD1A 1XO8A 2OL3A 1R3YA 4COOA 4J4PC 4A6YL 3VBCA 2B4YA 1LD9B 3GFZA 3KKQA 3I30X 1OVGA 5DBOA 1R3UA 1KTIA 4YFLI 5DEFA 4Q97A 2NX5E 3INPA 2OCZA 4FI7A 4V11A 4FL4C 1I1OA 4L4VA 1XBVA 1KERA 2CJ3A 2BMKA 1ORQB 1UPPA 4U1NA 3T0WA 4C4KO 4CC4C 4GYPA 3I6TA 3PAOA 5I66A 3STGA 3SAZA 5E0KB 4JK0D 1ZFNA 1EVKA 1TQDA 2VUHB 1UC4A 5D4YA 1ZO8A 1JGLL 4M1CD 2PLCA 4UTBL 4D7PA 3W02A 3IDNA 2HIHA 2FKNA 4MVJF 5BR7A 3HABA 4FA3A 5EUOA 2X4UA 2F5AH 3WLPA 1XA3A 3SW6A 4KVAA 2XV6B 1NM5A 3EPHA 5GRJL 1QCZA 4JGUA 1RD5A 4QUHA 4FT2A 5FV1L 2RTTA 5HJBA 3FHOA 5K4GA 3GBPA 4ZMSA 1V7QA 4GQBA 1NEZG 3TBBA 1YO4A 4Y2HA 3W78A 3FOFC 2NAPA 2DUNA 2BB0A 2MYUA 3GF4A 4M6OH 1N0XH 4HOYA 3LY9A 2W5PA 5I48A 4DDMA 1I2CA 1JMXA 1WV0A 1CIVA 3EFFB 4QHUB 3J7AC 1G6RA 3C12A 1VP9A 3OQPA 1JZ4A 5DHTA 1RULL 1T8QA 2XIQA 2GVEA 1PJTA 1E51A 3UACA 5TS3A 4LBWA 2X4QB 4XE0A 1JHQA 3ZDYE 3G77A 3PJFA 5DU2A 1U2GA 3AABA 5BN3A 3AEKB 1KSRA 3L9BA 4QPCA 1NVEA 5D00A 4O4YH 4DGWC 2FZBA 4IBVA 3QM3A 3M6IA 2WC3A 4CRPA 5T57A 4MK4A 4E9SA 3LTSA 5BOFA 4I46A 1TJ1A 4NFYA 1CYWA 4BNVA 1JJVA 4GW1B 3QNFA 4QUAA 2ZRAA 3DDHA 5T5NF 3CH4B 1RU3A 4FFDA 4NPKA 1PBNA 2X1UA 2GJLA 3L5HA 4ZB5A 2WAGA 4J5VA 4U0RB 2UZAA 4HK0B 4MVJP 4TX9A 4CW1B 1FIEA 4GD0A 1TVHA 2JRLA 2PD4A 3RH0A 3R0IA 4RUKA 1DVFD 5IKMA 3W74A 4Q6IC 2P47B 3BXNA 4HKXA 1H2RS 3LT1A 2IAND 1VPOL 4RVDA 3B8IA 1U2HA 1YEGL 3DBIA 3TZKA 2V54A 3WE1A 1MPAH 4W6XB 4ILDA 3H17A 5AHEA 4N22A 4X1YA 4XODA 1NMZA 1W0JD 2X2EA 3OMXA 1BFOB 4Q33A 2R59A 4PAWA 3SJVA 2WPDD 5AAWC 4DM4A 3DHDA 1WG8A 3JCZA 1VSVA 5JALA 2UX7A 4B87A 4QFCA 2DVTA 1N5OX 3OM0A 1L8PA 4B7UA 3R0UA 2VYVA 3QSKB 1ZBDA 1S9KC 1AS2A 1B0RA 1ITBB 3L9EA 4F7PB 4I5GA 2J6HA 2WSDA 3DHNA 2CO6B 3CZSA 3CE1A 3HE7C 1G21B 4I6GA 2XJLA 1V7ZA 2XWPA 4LF5B 3ZDZE 4NCC1 4GVIA 2H0AA 3L16A 3SDBA 2V6MA 1DKOA 3HBFA 4JELA 1Z5OA 1H4VB 4W89A 4QO8A 2VH2A 2O2DA 2E21A 1XRFA 4HZLA 1HILB 1BO6A 2V58A 5A6AA 4NI8A 3B1YA 3JVAA 4ARBA 3GT7A 2GDQA 4LJ8A 3UBFA 4IDCA 2OOGA 2XV1A 2D20A 2E7DA 2R1VB 2LOEA 1PTJC 2H9GB 3MV9E 4MXVE 5I4IA 2HWGA 1H85A 2WLTA 2VLKE 2P8MA 2DGAA 2NQLA 2R9VA 3WEBA 3P2OA 6Q21A 4AWJC 2Q1YA 4J75A 4ACYA 4IKLA 3QRGL 3EA4A 4QDJA 4KQHA 5A2BA 3ITNA 2R1LA 4UTWA 5I4KA 1SVIA 4RMTA 3BKCH 3IDYB 4RDQG 2WO3B 1PI3A 4K6OA 3SBQA 2GTZA 3NOVA 3QPBA 1KY7A 3IPXA 1E18A 4KVFA 2J0SA 3QF0A 4Y2VA 3KU1A 3OYXA 3SJNA 2XJ9A 5EZIH 3CH5A 3OESA 1IEBB 3VD5A 4YHLL 2QLJA 3ULAB 2A92A 2A4MA 4UT9L 5E3JA 2ADGA 3JTMA 1MXGA 1U2QA 3O9MA 3ZJYA 4HWZB 3WBAA 5ELIA 4JTLA 3C3JA 4MIYA 4RE3A 5BW7A 5JS1A 2FMKA 3D1JA 2QDWA 3N5KA 3GC3A 3IGSA 1RACA 3AS2A 5AVNA 3N50A 4DEPB 2VLJB 3M1BA 3URBA 5AJXA 5H8WA 5IMSA 4LY3A 3M64A 5SZHB 1TQCC 5AW0A 3DE0X 4LPSA 3EJUA 4KE6A 4QDWA 4CU6A 4MDIB 4OF0A 1J21A 3DOJA 1GY8A 3PEWA 1NQ5A 2O1WA 4J3ZA 5ENDA 2GI0A 3WCZA 2HXTA 5K99A 1J93A 4ZRNA 1FXWF 3B89A 1RCQA 1HQCA 3I3BA 2F48A 3KPYA 1Y1QA 4NMHA 4XP1L 4PN3A 2UYCA 1AODA 1D5MB 1UWKA 3EVNA 4BQQA 4YTUA 3O8XC 4V28A 3RRAA 1N3NA 3GI9H 3O3EB 3GB9A 3ROKA 3ENEA 4DXXA 5BZWB 2XDAA 1OB2A 2FQDA 3L79A 3JZFA 1W1TA 3SCMD 5TY0A 1PDYA 5FIUA 4IK6A 5KANG 4JCLA 3Q11A 1M1XA 1XJ5A 1JRBA 1LGYA 2ZPKL 4LE1A 4I9WE 3ICEA 1H8EA 5GJWC 5K33A 5CCHE 3PSWA 4S3CA 1XQKA 1Z3CA 2RGRA 4L8DB 3FO1B 5FV7A 5HG0A 2QLBA 4IP0A 1L5ZA 2P9GA 3MRQB 5AWFC 4KKPA 4HLUA 3T0ED 4I3FA 4RESB 4OY3A 5TNVA 4HHLA 2HCTA 1E8XA 4W9HC 4X54A 4RLHA 4IGBA 3ITDA 1L0YA 5FCDA 4O14A 4AICA 1P4CA 1SZGA 4QQUA 2QKIA 4K37A 3UK2A 5L7XH 3RP1A 1R8YA 1NFPA 4J0QA 4L0QA 1J87A 1Q7BA 2BOBB 4V2CB 3DJSA 1THTA 2GJAA 3GFVA 4U0JA 3OTQA 3ISWA 3LN5B 3WRYA 4B60A 3GWQA 3GDGA 4Q0XH 1MA3A 4ZVNA 2R14A 4LCUA 4OQNA 3OJWA 2RGWA 3R4CA 1YYCA 3AV3A 5KTKA 4KC3B 1B90A 1IR2A 1AN9A 1UAGA 4OB6A 3HGMA 4GQQA 4AJYV 1U2YA 3N2KB 2PLJA 4XZNX 1Z9LA 3PXAA 1EXHA 2FZNA 4PQRA 3SCNA 3TN0C 2QQQA 1NT4A 4LASL 1EXGA 1IV8A 1KQNA 4NNYA 2IIQA 3PZQA 3I12A 3B9KD 3L3GB 3RWCA 4Z0BH 1E6JH 3KUCA 1MXFA 12E8L 3ORJA 3WGVB 3CQHA 2J31A 1LJ8A 4X97A 1RUML 1YNYA 4YWJA 1JFHA 4A6DA 2D2CC 1E2PA 4KNWA 2ZF8A 1KBPA 4KDTC 3ZY3A 1IAKB 3TCTA 4MKXA 4B2DD 1ZV9A 1FVFA 4G8TA 4XWAA 3W2DH 5LBVA 1JZSA 1T6BX 1NG1A 3GX9A 3UWPA 5MHBA 2NO4A 1LDNA 3K6DA 1PJAA 5CBIA 2XWJB 3V0HA 4EUEA 3MQ2A 4HQOA 1TTQB 4BV2A 4UMEA 4RJ2A 3EB3A 1UC9A 5IHRA 4NZFA 1JWUB 5CINL 2EPKX 2X2PA 2RC6A 2Z2ZA 3U2IA 1OLXA 3PDOA 2OCIA 1YDPA 4M8IA 4LL9A 4TUKH 4XMPL 1L4EA 1TR7A 4GQAA 3MWKA 3HA0A 4ZXBD 5F70A 4Y9RA 4KXUA 5SV3A 4X9IA 2DPMA 2RBEA 3TLGB 3BA6A 1VEPA 3TB6A 1CE6B 4EUPH 2R65A 4RVUA 4I50A 2R69L 4QOHA 3PUCA 4O50A 3HXMA 2AL1A 2IZ7A 2W38A 4GXWA 3QF4B 3AHIA 3V5FA 3KMDA 2P6NA 1J42A 3UT6A 2Y5TA 2NMVA 2PO6B 3AXLA 2HCVA 1UATA 3FHCB 5KVEH 3SJBA 1HFEL 4FU0A 2V3WA 3HKFA 3MLPA 3IXAA 4JKIA 5EEHA 1CBJA 4JPQA 3FGOA 3OZPA 5AMXA 3TIXB 3DG3A 1F6FB 5BOOA 4OVVA 1W8SA 1NBMD 1XIIA 4ZEVA 2VMJA 2X3BA 5I1CL 3QH4A 2Q0XA 3LNFA 4NKIH 1E6QM 3M4YA 4Y9GA 2P50A 4MQEA 4FDVA 3O16A 3QUCA 3ZDBA 1I60A 2JRCA 4OGGA 4M6PA 4HU4A 4QNEA 4LZKA 2VM9A 3B4UA 2JD0A 3OGCB 3NIFB 2WJ3A 3U4CA 2OO7A 3QUZD 1C9KA 2FRDC 3BEWB 3KW8A 1UD8A 4XP9L 1SNRA 2J57A 4EEKA 3ABRB 2BHFA 5TFSH 5C7IO 3JQ7B 3S6TA 4WGFA 3C6MA 5TDHA 2OR2A 4V0NA 1V47A 2AVFA 3VOJA 4URYR 2YZMA 3D8RA 2GUGA 1T43A 5C08A 3EGWA 4LCCC 2EDAA 4P08A 2J4CA 2G40A 4K36A 2LNDA 4GP5B 4YRMA 3PVSA 3T0DA 1PKYA 1OVDA 2XKNB 1TAHA 4XN9A 4IMGA 2GQ8A 1FH2A 2EABA 2W79A 3PZIA 3PPSA 1D6JA 4C29A 3FTYA 3PZMA 1W76A 1RE0A 1K9TA 2R00C 4O4VA 4JQIA 4HZ1A 3WD3A 1UWUA 5CEZD 2YZNA 2HLNA 5KYUA 4Z9KB 4AN0A 2A3NA 3MLBA 1I1WA 1VPYA 3WUWA