4UNNA

Mtb tmk in complex with compound 8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
184
Chain Sequence
VLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 71
structure length 184
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unnA00
2EU8A 2VIIA 1IY0A 1FNNA 4WBSA 3ZGXA 4ZKDA 2FGKA 4DSUA 3HU1A 3KTAA 2JLZA 3CRW1 2O8CA 3X1DA 5HCNA 1CKEA 3TR5A 1XXHE 4Q01A 3KKOA 1N2CE 4UXIA 1KY2A 3HPRA 4FMCB 1E2KA 1FMLA 4JYBA 3ASZA 1G16A 1T9HA 1DAKA 3O8DA 1U0JA 4LHXA 3L0OA 1XU4A 2ZAOA 5L3QA 4A15A 3PQCA 5F9FA 1KKLA 2KB0A 2XSZA 2BWJA 2Z0MA 4HDCA 4KBGA 2RGCA 2F1HA 3FHCB 3ZVNA 2I1VB 2RMKA 1QHSA 3HYRA 1QHIA 5CDFE 1E2GA 2ZRFA 4QGAA 4DEYA 2NO6A 4V03A 2VBCA 5F2EA 3I92A 4ESVA 1P2SA 4AG5A 3K0EA 1T8UA 1I4LD 3PUVA 2ONJA 1R5BA 4PO8A 5IHPA 2NO9A 2NMVA 3UPUA 2GJ9A 2WSMA 3N2IA 2P6RA 4PZYA 4UNPA 3Q3JB 1TTTA 1KI7A 2J87A 4PPFA 2CBZA 3BFXA 4LHWA 2GCPA 2WMNB 3GJ7A 1BKDR 3G0HA 4HZIA 1HH4A 4O2RA 1UADA 1XTJA 2ZRLA 1MKYA 1FUUA 4QM7A 2OBNA 3SZRA 2VP6A 2R6FA 1NVVQ 1IXSB 4ZDJA 1P5ZB 2P2LA 4LBYA 2C04A 5FOVA 1VYUA 4G0NA 1KSGA 4OHWA 4JMPA 1Z06A 2D3WA 4IFBA 5EP4A 4B76A 5LB2A 4G5SA 4XVUA 4JLJA 4X8HA 1KSFX 3LD9A 1MO3A 3AEZA 3SQWA 4HAXA 4NZYA 3NHAA 3K53A 4DXAA 2EYUA 4Q47A 4C0KA 4WZAE 1TPZA 3BH0A 3AGPA 4I1UA 1R10A 1OPXA 2A2ZA 1WQ1R 4HLQB 2J41A 3EC1A 1IBRA 4JLMA 5FOWA 5B58C 5KDOA 4DLTA 1YZNA 2ZRCA 1G21E 4MUBA 3RC8A 2FZ4A 4G3XA 2JCSA 2YC4C 4LV5B 1T5IA 3TQFA 4DT1B 1X8KA 3F3YA 3AVXA 1II8A 4TMVA 2O8EA 2QGNA 3LBHA 1MR3F 4MGYR 3W5IA 1P61B 2OT3B 3TW8B 2V54A 4LY6A 3D31A 1RFLA 2VEDA 5EE3A 1IOZA 3AKEA 5HE9A 4DCTA 4U7DA 3B85A 4GZMA 2EQBA 3CNOA 2GK6A 3TQCA 1MH1A 4PC1A 1N3BA 5BW8A 4LHZA 3HJNA 4DLYA 4WOPA 3ADDA 2ZRHA 1ZINA 2ODEA 1KK0A 2P0EA 3RS4A 4EPYA 1J70A 1R8QA 4CYMA 4II7A 4OI4A 2NIPA 1AN0A 2DPXA 1W5SA 2O0KA 2H7VA 5TDHA 2P5TB 1YR7A 4AYWA 4Q4LA 4DCSA 4D6PA 4HB2A 4A2QA 1N5LA 4G5GA 1RJ9A 1TF5A 1XBTA 3AVQA 4FINA 4LDJA 1GZSA 1ZD8A 2ZS8A 4WW0A 4DJTA 5AK0A 1CXZA 2Q9BA 3ADKA 4BFYA 4ZKEA 2CHQA 5JHGB 5EUMA 1W4AA 1JR3E 3T06B 4R71A 5C2JB 1ODFA 2OAQ1 4WVFA 2QGZA 3FFBA 1WRBA 2JLYA 1TEXA 4A2PA 5LPNA 2ZRAA 3PUWA 4HDQB 2WWHA 3AF1A 4H1VA 1OB5A 1G5TA 1YVDA 4ZIRA 4CEJA 1AJEA 1JR6A 2KI5A 2ZU6A 1Q0UA 2WWYA 3RYTC 2ZSAA 4KAXA 5IK2D 3TUZC 5J4YA 1T6NA 1XXHA 2DWQA 4F4CA 3RDPA 5CJ2A 5JSZA 5M04A 4UXHA 2XOKA 2EYQA 3LAWA 1Z28A 2RHDA 2GEVA 2QT1A 1ZJ6A 1WCV1 1OYWA 1T91A 4EPTA 4DUGD 2QMHA 2NZ8A 3C15C 2EFDB 3LXRA 4HLUC 1ANKA 5CDFA 3WNCA 1EFRD 4IVPA 4DLVA 3MWKA 3ZJYA 1W36C 4CW7A 4M21A 1VPLA 1KI3A 4Q1EA 4Q66C 2XSZD 5HR5A 1J7KA 2JJ1A 3IBYA 1W0JD 4CT4B 4GP6A 1GIAA 1VCMA 2OEPA 2REOA 3CH4B 4LJ9A 4PSVA 5GJVC 3FHOA 4D4KA 3ICQB 1G20E 2H8KA 2GA8A 2C96A 1UDWA 2ZU0C 4V0OA 3U7EB 2OUKA 1H8HA 4KODA 4OK5A 5BN5A 1M2OB 3QG1A 3F8TA 1RYHA 3AB3A 5BYJA 5TB5A 4FCTA 2BBTA 3PUZA 3SN6A 2FFAA 1S96A 2V6JA 4PC7A 2ZEJA 3FMPB 1P2UA 1QVAA 5TY0A 3MG9A 4DSNA 3GLHE 3QXXA 3T1VA 4OHVA 3QKRB 2B92A 3B1YA 1WE2A 1J2JA 3BOSA 2E9SA 1KI2A 2VA8A 2RGAA 2OXCA 1Z83A 2C9CA 3GLFE 1U99A 4C0SA 1U8ZA 4A0GA 4Z1MA 1ZC4A 2GESA 2FPMA 3C8UA 1F2UB 2A78A 2ZJYA 5FPTA 2AKYA 3PEVA 3TVDA 5AUPB 3ZQJA 1G9XA 1LB1B 2BEKA 1US8B 1XWIA 2AK2A 3P32A 1KY3A 4WXPA 4XWAA 1E0KA 1TAGA 2A5GA 2IYZA 5JRJA 3MLEA 2ZJAA 4NCJA 1E69A 4BRWA 2LCFA 1UBGA 1AGPA 4LOAA 1SXJD 2LWIA 5C18A 1RRCA 2ZUCA 2GAOA 1LF5A 1PJRA 1Q1ZA 2WIBA 4Q4JB 5DYGA 1XMIA 3H4MA 1AKYA 3RS0A 1E6CA 2HJVA 4BEBA 5FL7A 1ZU4A 1SXJB 2YKGA 4MDEA 4GBMA 2BM0A 4ZCMA 4MYCA 2WZQA 3MD0A 1UKEA 5KUTA 2WAYA 2AFHE 3I62A 3A1UA 4IFEA 1CR0A 2ANCA 3NVAA 1JEDA 3C14C 3NHBA 3X1YA 1LF0A 2OCAA 2DFTA 3LLMA 3CW2A 1D2EA 3ZYCA 1NN1A 3CUEF 5EE0A 2YYZA 2J5XA 4YDHB 2GZAA 4LCBA 1JAIA 3Q7PA 3K09C 2A7QA 4EQ6A 1VHTA 3NC0C 1GL9B 1X1RA 3K09A 3WYFA 2OBMA 2DFKB 4A1FA 5A5GA 3GLIA 5LD2B 1KDPA 3ND8A 4K81B 4LHYA 1IAQA 2OILA 2JLVA 2JEOA 2W00A 1N6PA 3L43A 3EZ2A 4XTRA 3U7FB 4C2UA 2IHYA 1PZNA 2XAUA 1MO6A 4A8JB 1QDEA 4C30A 4JVLA 3K0AB 2AXPA 3OZXA 4LX0A 4PHFA 2HT6A 1GNQA 1SVMA 4PC3A 2VL7A 1JEEA 1LFDB 1MABB 1YHNA 4RD2A 2H92A 2BCGY 3A37A 1G6OA 3PITA 5DI3B 5JZVA 5K8IA 2GJKA 5DH9A 4DHEA 1WBBA 5DLQC 2C95A 1A4RA 2W6JA 1PUJA 4S35A 2FH5B 5KDLA 3ZD7A 1UKZA 5C4MA 4D26A 1JR3A 2F1RA 5SZJA 1TU3A 1U0LA 1YR9A 3WRXC 2PZFA 3GJ6A 2P5SA 4LHVA 3C5CA 1PLLA 2AFIE 3LX8A 2J3EA 1QZXA 3MJRA 3DO6A 1QHXA 2VP0A 4RZUA 5GJCA 4DB4A 4TYQA 2FX3A 2CJWB 4BPBA 4Q03A 1AIPA 2DWPA 1CBUA 1FTNA 4TT3A 2OM2A 3DDCA 1MOZA 1Z0DA 2WSSD 4IOLA 3MSXA 1RW4A 5H68A 1F5NA 2V4ZA 3UXMA 3QVVA 4NCIA 1E2QA 1SVIA 4Q02A 3IIJA 1SKYB 3TW4A 1G8HA 2MSEB 3I72A 3EPLA 2QROA 3IDQA 3BK7A 3ZD6A 3GLGB 5IT5A 3PUYA 2W0MA 2XOKD 3OEHA 3IBGA 2EFGA 4RVCA 1KAOA 2Q3HA 1QG2A 3C16C 3I3SR 4CRWB 4LC0A 5TMPA 1P6XA 3LW8A 2VHCA 3QNUA 4DDTA 1XD2A 2IYXA 2PL3A 2O0HA 1IN8A 5EP3A 4B75A 1Z6YA 4RKEA 1VG8A 2GHIA 1XEFA 3BFKA 4HSEA 5B64A 3QIAA 2N46A 2ORVA 2EWWA 3VR3A 3ZZTA 2GCNA 2DBYA 2ZRDA 4AIIA 1G3QA 2G3YA 1ZD1A 5AJYA 3WY9A 4WIAA 1G7CA 1KO8A 1JJ7A 3GLHA 4FMDF 1F2TA 1OXUA 2ZSBA 2B8WA 2REXB 1G7RA 4KCGA 5KNBA 2MSDB 3LFUA 4PAOA 3CB4A 4YMSA 5FTJA 4YXWA 4LYAA 3GLFA 5CM9C 2HEIA 3P20A 4MUAA 2WAXA 2ZAMA 3OAAA 3EIEA 1DPFA 3A1WA 3KXLA 1Q20A 4HI0E 3F0TA 1G291 1IY1A 4GRAA 4QBIA 4HATA 1VG1A 3FFAA 3QBTA 3QPVA 4G5RA 3SR0A 3W6OA 2Q9CA 3RLFA 2PZGA 4OI1A 1S1CA 1E2PA 3KJIA 1CF4A 1XNJA 2FF7A 4Z1MD 3KQUA 2JDIA 2P6NA 1VYTA 4BLPA 5JWRA 2J0SA 3KJGA 1AM4D 3E5HA 1R6BX 2H1LA 2JGNA 4OL0A 4FCVA 2K5UA 2BKUA 3FKSD 1A5TA 4CEHA 3AF4A 3MJHA 4PX9A 1L4UA 3T1OA 5J4LA 4V0ME 1G4UR 4P4SA 4B2LA 1QHHB 4P0TA 2QU8A 3BH7A 4ABYA 4YMTA 4A0HA 4ZI2A 3DPUA 3THXA 1UDXA 4CVNA 2YJTD 4I81A 1OSNA 1NKTA 2IS6A 4DDVA 4EJSC 1UAAA 3MWLA 4V0LA 4PPGA 2V1UA 1PLJA 2YOHA 121PA 4RFVA 4TL9A 5EZ5A 1WF3A 4EJSA 4C3ZA 2JLXA 4Q9IA 1D8TA 2VSXA 3ONWA 5DGXA 3CIOA 2XX3A 5E7JA 2AD5A 3E70C 2ZYVX 3ZIAA 4L8GA 2RHMA 1FP6A 3M6AA 3UATA 4M1SA 4PQYA 3AUXA 4QGGA 3AVUA 1U9IC 1VIAA 1UM8A 5KSZA 3QUSA 4HUTA 1P2VA 3EZ7A 5EE5B 2IWRA 4A9AA 1U9IA 1E9BA 3I5XA 3RSLA 1TL7C 1NG9A 1NMXA 1ZM9A 2QE7D 4FWIB 2FV8A 2RGEA 3TNFA 1OF1A 5FBLB 2GCOA 2X19A 2ANBA 3QPUA 1SHZA 5CYOA 3U3JA 5A0FA 4GL2A 2R6CA 2REBA 3P26A 4HAWA 2ZE6A 2XTMA 1ZD9A 1GRNA 1K8RA 3R8CA 3WYAA 1E2JA 4DLXA 5DIFA 1OIVA 1ZUHA 2W6JD 2BJVA 3KKMA 3MGCA 4YMWA 3RWMB 2HXYA 1CRPA 3SJZA 1JR3D 3C4JA 3QXJA 3T12A 2QRZA 4US0R 1XCGB 3VAAA 4L5BA 1Z6GA 2BCJQ 3EA5A 4NYJR 4TZ6A 1E79A 4GOKA 1SHKA 1RC8A 3T1QA 4HB3A 2F9MA 5FTMA 2UZIR 1KI9A 2DWOA 3WP0A 2KSQA 2HXSA 5LBIA 1GKYA 4FMBB 1T5LA 3IO5A 4FI3C 4AD8A 3I32A 1OH5A 1DS6A 4TSFD 3U60B 2PH1A 3RC3A 1BYIA 1R0ZA 3IILA 5A4JA 2OXRA 2PMDA 4LC1A 2G6BA 2VRWA 3CF6R 3UMSA 2W2VA 1E9CA 5G3YA 4EAQA 1NN5A 1GL6A 1SVKA 1UJ2A 4D0LB 2Z5FA 5FI0B 4M9XA 2GNOA 1U94A 1CLUA 4BFUA 2ZYWX 4JVMA 3CM0A 2PT5A 3OEEA 1CR2A 4Q4AB 2FA9A 4R9UC 4ARZA 2I1QA 1VCOA 4LJ7A 4AI6A 5FUXA 2CNWD 3B9PA 4B35A 5FUVA 3EASA 4RZ2A 2CE7A 4M2LA 2G1KA 2HV8A 1Z0KA 1XEWX 3CRVA 2GRJA 4TQUS 1YR6A 5AJZA 3BXZA 4QJ3A 4AC9A 1IXZA 1OYYA 2D2EA 2O8BA 2FE4A 2BBSA 3CBQA 1TX4B 2QAGB 1CJTC 3KB2A 3U3RA 2WM9B 5DHFA 3AP3A 2PCLA 1AGRA 3LV8A 3VX3A 2XJ9A 3EXAA 4JBYA 4ZPXA 2GVZC 2VHTA 1DO2A 4Q9LA 5TV2A 3THOA 2J7PA 2OCBA 2FDCA 1D5CA 4ASUA 3W8RA 3REFA 2VHQA 4LV6A 4BQSA 4GZLA 1LS6A 3TE6A 2W6IA 1FL9A 4B47A 4DIDA 3OAAD 2QTVB 2X77A 1RPZA 2IUSA 4C7OB 1E1QA 2HYDA 2R6AA 1A1VA 1KMHB 3GEIA 2IWHA 1FX0A 5DE3A 3GP8A 3CONA 2GJ8A 4RCZA 4R7ZA 3VTKA 2JA1A 1WXQA 3EPHA 1DELA 1YE8A 3DL0A 1ZIPA 3LW7A 2FG5A 4Q1FA 1OFUX 2JJ8A 4OJQA 4A36A 3B8HA 1GNRA 1HURA 3LNCA 1E98A 1SVSA 4QG7A 2ZREA 2W58A 2XITA 4MKFA 3QEJA 1VMAA 2WV9A 2OLJA 2OAP1 2PZEA 2FEOA 3SBEA 1E32A 4OQLA 3WMFA 1Z0AA 1PUIA 4QKQA 3HR8A 3VR2A 4Q9HA 1X1SA 2QT0A 4B33A 2QAJA 1E2DA 2O5VA 1DG3A 1G18A 3I4LA 5E7MA 1PV4A 1GAJA 4WA7A 1QF9A 2O8FB 1EX6A 2P65A 1W4RA 3M4YA 4IDPA 4IXNA 3A1VA 1ZM2A 3SEAA 1GVNB 4XTCS 1G1MA 3P27A 4TTQA 2A3RA 2F55A 5FR1A 621PA 4KV9A 4OHYA 4N0EA 2GF9A 4GFDA 4B6FA 3EZ9A 5E4FA 2VSOA 4O25A 1A2BA 3EW9A 2WJGA 3UMFA 5AUQA 4B32A 2GXSA 4F7WA 1S9DA 2CEAA 4Y0AA 3FB4A 1PVOA 1XF9A 4LBWA 4IOKA 4QNRA 2WMOB 1TQ6A 4EUNA 1XDBA 4TMZA 4M8NE 1S3SA 4P31A 1KI8A 4IOMA 3GQBA 4PO1A 2CCKA 2IS4A 1G8GA 4X8OA 2XNDA 3B13B 3R9IA 1NVVR 1OV4A 5DI9A 2D62A 4Q1DA 3K70D 3F5FA 3O8BA 5KDDA 1P3JA 3GFOA 3ECCA 4POAA 4QBGB 4D2IA 1OKKA 1YZQA 5AUNB 4RFSB 4WAUA 2FOLA 3E2IA 1MRSA 2GAAA 1DTSA 2YWFA 2D74A 5J4VA 1IXRC 1FPMA 1KI1A 3A8TA 2RB4A 2ZR7A 4JSTA 1XP8A 1W48A 4JL5A 3DOEA 4IW3B 1E79D 3TBKA 1ZM4A 2FJUA 2J9RA 4XJXA 1DBSA 2X2EA 2J59A 3IQXA 2GBLC 2JAQA 2D7CA 3G5UA 2X8AA 2VP9A 3CWQA 4KYIB 1DADA 3VU9B 1ZMXA 3PXGA 1F2UA 1N6RA 1G3UA 2JASA 2FNAA 4L9SA 1F6BA 1KZGB 2FN4A 3WXMA 1DARA 2YWGA 4F4JA 2WVJA 2W2XA 3LLUA 1US8A 4HZUA 4LJYA 3VX4A 2IEYA 1R5OA 5DSZA 2DR3A 1BMFA 1TADA 2J0VA 5EP2A 3LWNA 4BZXA 2ZR9A 3SHWA 3WNDA 5CB6A 5C1BA 4IHQA 1KOFA 3CF0A 4KHZA 4NP6A 3W90A 3UIEA 1HA3A 1NBME 3OEED 4BLOA 1X86B 5JJKA 3U44A 2J0QA 1SXJC 3LRPA 821PA 1MT0A 5FUWA 3EAQA 2RCNA 3KX2A 4IDOA 4M1WA 1IQPA 3B1XA 4PC2A 5K8LA 4BFXA 3O47A 1AS0A 1R4AA 2Q6TA 1BH2A 1KK3A 1N6OA 1JNYA 1ELOA 4HEJA 1T0HB 2ZJOA 3HYTA 2XZOA 5JJLA 3DM5A 3DMDA 2QG6A 1Z2AA 3AKYA 1IN5A 4A6PA 2ODWA 3AVOA 3R9WA 4MYTA 3T35A 1KJWA 2J7PD 4XVRA 4ASUD 2ZJBA 3WMGA 3X1WA 1ZM3A 5LD2C 4PPQA 6Q21A 1G41A 4DLZA 4KITB 3KKQA 3GLIE 3H2YA 3ZDQA 1XJCA 2J0UA 2VYFA 3P4YA 4D0NA 2W6ID 4DKXA 1L8QA 5HE8A 4ITRC 4A8JC 1I2DA 3A4NA 1P7CA 4IJMA 3WBJA 2CCGA 4R98A 1E1QD 3B1WA 4MA4A 4EPRA 4Q9JA 5BWMA 4KXFB 4D80A 4TWZA 1EGAA 1KGDA 1NN3A 3N2EA 3A4LA 4JIMA 4GOJA 4XSHA 3SJCA 3HU2A 1S8FA 3PR1A 3S1AB 4B43A 4DBLC 1YZLA 1MABA 4NL4H 3PCRB 2QP9X 3AP2A 1ZAKA 2B8TA 2G77B 5DI3A 1OJLA 1Z2CA 4TMWA 4QJ4A 5ANRB 1E99A 4TTPA 5L3RA 3W9YA 2FFQA 3AGQA 4KU4A 4NPHA 3QXHA 1SULA 1S3GA 3R7WA 1N5IA 2ZJZA 2OSBA 2F7SA 4MKGA 4RSGA 3DHWC 2HJGA 3GD7A 1XD8A 3U4QA 3RS2A 5AJWA 3TVTA 3GMTA 1KO5A 4OK6A 2X1VA 2YWHA 1LVGA 4LSGA 3Q72A 1II9A 1GKUB 5D3QA 3VR6A 4KFRA 5B2ZA 3DKPA 1ZW6A 3K1JA 4DLRA 1CJKC 2NO0A 5JEEA 5K8TA 4C0HA 4G5QA 5HZHA 2Z6VA 4CIDA 4QJ5A 4MGZR 3HDTA 4M1YA 3NXSA 3K0FB 3EPJA 3R8FA 1RRGA 3PV0A 3WHKA 4A0RA 1HY3A 2QP4A 4C9BA 2QA5A 3RABA 2AWOA 4IDQA 3L2OB 3BORA 1TUEA 4TQ9A 1AZTA 1VYVA 3QKSA 4JVNA 2OZEA 3QOFA 3KTAB 4HLUA 1U81A 3CPEA 2QMEA 4TMXA 3KL4A 1YZTA 5EE9A 4EDHA 2QMOA 1GP2A 2GVDC 2PX0A 4RCYA 3JZAA 4E07A 5K8UA 5L3QB 2V8OA 5C4GB 4B74A 3CX7A 1NNEA 5F3WB 1TNDA 1TF7A 2J7KA 4IRUB 4LJ5A 1YZKA 2WWWA 1K5GA 1EXMA 3HPQA 1CTQA 4ILEA 5L3VA 2HF9A 1SVLA 2XNDD 3K0CC 1YKSA 1G7SA 4RY2A 4FMDB 4GSYA 3B1ZA 2WHXA 1GRRA 1XFAA 2Z4SA 1R8SA 3UMRA 1UEJA 5JWOA 3DOFA 2BOVA 2AN9A 4M1MA 2G9NA 2IC5A 1OKKD 2TMKA 1T3HA 1JALA 4WZ6A 3SOPA 1N5JA 1IONA 5KO2A 2CL7X 2ZXUA 3KUCA 3H0KA 1K5DA 4G5OA 5FH9A 1X3SA 3BB1A 3AF0A 4HLCA 1XMJA 2BBOA 4ZDKA 1FP7A 1Z29A 1X6VA 4TL8A 5FI1B 1AZSC 3TSZA 1J8YF 4Q9KA 1U8YA 2CLSA 3CKLA 4TL6A 3AF2A 1M8PA 4I1OA 3VNUA 2O8DA 4HAYA 1P75A 3PJRA 1ZC3A 4N0DA 1NBMA 3EWAA 3V4RA 1KKMA 4MQBA 1KK2A 3VR5A 4Q7LA 1GG2A 2IXFA 1IN6A 1BMFD 1QRAA 4MRVA 5UKDA 1P62B 1M7GA 3KB1A 1CR4A 1ZNZA 1Z0FA 4V02A 1GITA 3LVQE 4M1OA 3RNLA 1JQLB 3CR8A 3UWOA 2C77A 4X8LA 5JLJA 1UBCA 2CE2X 3IKJA 3GFPA 2QPOA 1NIPA 1Q3TA 2F1JA 4RD1A 2CHGA 1MO4A 1E2IA 1LW7A 1VHLA 2YOGA 4LJ6A 4FIDA 4UNSA 1OH7A 3QE0A 3TH5A 4B3FX 1ESMA 1SVWA 1G8FA 1DAGA 5EP1A 2KE5A 2IT1A 2QL6A 4IDHA 1ZNXA 2QMUA 4XH9B 4BLRA 2O8EB 1II8B 5IF9A 5E95A 3SJBA 2FSIA 2P6UA 2RH5A 4PR0A 3BWDD 2IYWA 1AS3A 2WJYA 1TEVA 3QXSA 3SYNA 4NU0A 4OI2A 1E9SA 2R9VA 2UZ3A 3GPLA 2A5JA 1NIJA 2ZJ5A 4BFZA 3W34A 3OHMA 4O3MA 2NGRA 4ESHA 5GJWC 2BMJA 1OIWA 3VQTA 2XZLA 4M1TA 2ZRPA 3QEOA 3C41J 3BFVA 3QJYA 2XXAA 1OXXK 4MRPA 3RHFA 4JLDA 3DVLA 1EESA 4TQAA 2IXGA 3TAHA 4EFMA 4AG6A 2BV3A 2JLUA 3PEYA 1CJUC 1J8MF 2ZYTX 3CR7A 1W1WA 3W6NA 1D9XA 1GNPA 4JL8A 1NY5A 2WOOA 2ZROA 5EZ6B 3U3MA 2PJZA 4RD4A 4AY2A 1K6MA 1E2FA 2LKDA 4ON9A 4IEIA 1E1RA 5CLQA 5FBVB 1TU4A 1ETUA 2BMEA 1A82A 3TSOA 2OE2A 1Q21A 2QNRA 3A58B 1GRQA 2JIZA 3A6PC 4NYIQ 1EFTA 1XEXA 1R2QA 4YMVA 4OKSA 4KFUA 4MITA 4KLZA 2WKQA 4Y0VA 2YV5A 1YJ5A 4ERNA 2ZRIA 1R7RA 4B71A 1DE0A 1XPUA 5KYKA 4BFTA 1P72A 3B5JA 2IYTA 1E2HA 2ZI6A 4HAVA 4OQMA 1U98A 4B34A 1KO7A 4ZIRB 4CEJB 1EWQA 1DAFA 1KJZA 2QBYA 2JLQA 4EKDA 2A5DA 1NRJB 2BVNA 3IPYA 2IYRA 4LJ8A 3TR0A 1ESNA 1XXHB 4B6EA 4LPSA 2RGNC 2GWHA 1NF3A 2AXNA 1G8PA 1CU1A 4NE2A 2BBWA 2QTHA 1FNMA 4IVQA 5FTKA 4JLNA 2Q21A 3EG5A 3ADCA 3KJEA 4MKIA 2KWIA 5E7IA 3ASYA 3QVUA 1YZGA 3W3AA 4HB0A 4GPTA 1KSJA 3LQRA 3T61A 2JJ1D 4C0JA 3LBNA 1W36D 5DISB 1P9RA 1UKVY 1YQTA 2FPLA 5HCIA 1W4CA 2QAGC 4LV8B 4F93B 2HYIC 1YRAA 3OE7A 2R8RA 1H8HD 4CEIA 2PMKA 1E2EA 4CGZA 3NEJA 4QRHA 1FW6A 2CL6X 1RKBA 3OIYA 4TYPA 1PLKA 5KNDA 5FOSA 4IDNA 4A4DA 1QVRA 1F60A 2UVQA 3C7KA 3ND9A 3WRYC 221PA 2Q0HA 5JCPA 1FUKA 1GM5A 5HPYB 3BAFA 5HZKA 1HE1C 4JLOA 5CB8A 1TQDA 1H8EA 4M9QA 1CEEA 1Z0IA 3VHXA 1XTSA 2B7BA 4Q4HB 4C7OA 1E2LA 5FBQB 4MGKR 3ZQ6A 2ZETA 4UKDA 4KYUA 1M74A 3L8YA 2QM7A 4M9SA 3QF7A 2AK3A 4LZZA 1Q1BA 2IHBA 2BJWA 2ZJ2A 3BERA 4MGIR 4IOJA 5JECA 4O2LA 4BLSA 4TN1A 1A7JA 1NBMD 2OCPA 4FXPA 2WOJA 1XB2A 521PA 2RGDA 4JLPA 1GL7A 5GVSA 3TAUA 3DEFA 5FL7D 4PZZA 1CJVC 4FN5A 3ETLA 2DFNA 3QF4A 1G5PA 2GDJA 1XTRA 2WKPA 4CDGA 3FDIA 3L0PA 4HLDA 4KLNA 2G0TA 4JLKA 1UPTA 1YU9A 4YONB 3THYA 4KVGA 3NC1C 4PZLA 5TXGA 3ZVLA 2O8FA 1OH6A 5EXPA 1R5NA 1Q22A 3IUYA 3WYGA 2FSFA 3AVWA 5KHOC 5KSOA 1KDTA 2YHSA 4W5HA 3FGNA 1EK0A 4H1UA 4V0KA 3CPHA 3KXIA 3EPKA 1JBKA 2IUUA 2ZSEA 1DAMA 2ZE8A 3DZ8A 3CZPA 4IEEA 2IK8A 1H65A 4BLTA 1KDOA 4US2R 2QENA 3NBFA 4C4PA 3IO3A 2EVWX 1G17A 2NPFA 4B44A 3NWJA 1D2MA 3CLVA 3JZMA 2FFBA 3QY0A 4B48A 5CK4A 4S2EA 1QG4A 5FR2A 3GFTA 4TLAA 5JFGA 3AP1A 3BC1A 4BFVA 1Q44A 3B6EA 5EUQB 5BYKA 4PHHA 5CK5A 1BIFA 1V43A 3X1XA 3SNHA 3SE0A 4E5UA 3VKHA 1IHUA 1Z3IX 1IN7A 1J99A 1I4DD 2WKRA 4QGHA 4CT5A 2XJ4A 1IY2A 4JZKA 2DY1A 3ZVMA 3D7MA 2IYVA 2ZPTX 1E1RD 4M1KA 1DAEA 2QSYA 3FMFA 4DC9A 3ADBA 3MAAC 1UKYA 4TT3D 1OIXA 1F48A 3LXXA 3P4XA 3SFZA 1W46A 3U3OA 3FPAA 2VF8A 3RS3A 3SI7A 2OG2A 2QQEA 1NMZA 3RRYA 3MRSA 1GWNA 3FYHA 4R2IA 4I4LA 2IX3A 4LWZA 4M4SA 4Z54A 3T34A 1G4AE 2KBEA 2ZRBA 3OEHD 4Q19A 2ATVA 4R2HA 2QRNA 2DB3A 2ERXA 4AKIA 1I2MA 4ZDWA 3U5ZB 2QP3A 4TYNA 1NL3A 4GMXA 4BECA 1JECA 4DEXA 2XZPA 4Q18A 1IM2A 1P9WA 4FCWA 4OHZA 3SFVA 1KI4A 1ZCAA 1ZNYA 2WWXA 4JT2A 3VNVA 4F91B 4JLVA 3AM1A 2VSFA 4URZR 1ZVQA 3AKDA 3B82A 1XD2B 5AUOB 5L3SB 2FPKA 2NQ2C 1ZIOA 1NMYA 1S9HA 2NG1A 3QI2A 2CMKA 1SGWA 1OFIA 4FD2A 4LRWA 4US1R 5FBWB 3N5CA 3NBXX 2PJRA 3LQQA 1SXJE 3LA6A 2F43B 1TF2A 2IEZA 2IYUA 4PXAA 2L0XA 2RKOA 1II0A 3OE7D 4NTZA 5FPKA 4DT1A 2ZRNA 4YXWD 4QHYA 1XMSA 2WPDA 3WMEA 3U6BA 1RYFA 4A2WA 3J81k 5FBRB 3GLHB 1F2TB 1E4VA 3GJ5A 3K9LA 4JYCA 2J45A 2VF7A 4G1UC 4HAUA 4RZXA 3GLFB 2YVUA 2ZI4A 1COWA 1S1MA 3U6KA 4MKHA 3SBDA 1WA5A 4URWR 1OE0A 1ZYUA 4F4IA 1XPOA 3GCGA 2NOAA 3EA0A 3H1TA 5P21A 721PA 1H8ED 1G8YA 2QI9C 2V7QA 3T5DA 4QBHA 1ZNWA 2B6HA 3BS4A 2JDID 5JHHB 3AVPA 1KMQA 4RD0A 2GKSA 1MRNA 2ZJ8A 3TLXA 1X8LA 2B7CA 2EFEB 4KVAA 1OH8A 3DZDA 3ZS9A 1IJEA 1OLOA 4QC2A 4NCHA 5DNYB 3P1JA 4TLDA 3EZFA 3QSYA 4TLEA 1O3YA 2IYLD 1E9EA 1HTWA 3I8SA 4XOIA 1W44A 4CEHB 2QPTA 3HWSA 1KSHA 3Q7QA 1OFTA 2ZANA 3KFXA 4TZ0A 3TJZA 4P4TA 4P4SB 2Q3FA 1JPNA 1GTVA 3FOZA 2ASEA 2H18A 5D3MB 3L82B 1KNXA 2C98A 2WICA 1XCMA 4Z8YA 3VR4A 2NPIA 4DWJA 1UEIA 4CF7A 1E0AA 3VMFA 4C0AC 3THXB 4CZ2A 3PFIA 2R6GA 2OESA 3ZIAD 4QXAA 1E2MA 1NSFA 5FUYA 3L8ZA 4RZ3A 5EQTA 1HQCA 2HCJB 1EFHA 1SQ5A 3E1SA 3K0SA 3OIUA 1BYUA 2NTYC 8OHMA 1CRQA 1DVRA 4LBVA 1SKYE 5EE1A 4J0QA 5JRZA 1R0XA 4LJ4A 1E94E 2HF8A 4BUJA 2OFWA 3GLGE 4GI7A 3GJ4A 1ZU5A 2ZM5A 4G01B 4DUGA 2GCOB 2PEYA 4KFTA 4QNMA 4W5WA 4UNRA 1OW3B 3BGWA 1T8TA 4EPVA 1EFRA 1KAGA 2ORIA 4ZCIA 3I5YA 4Q21A 3FMOB 4OQNA 1C4OA 1RZ3A 1NP6A 4RD3A 5GJBA 5JS8A 4DSTA 1W0JA 3NDPA 3AH8A 3K70B 1NVUQ 3BIFA 2OBLA 2DFLA 1FZQA 2ORWA 1EFUA 2XGJA 1B23P 4JBXA 1CS4C 2FFHA 1Q1QA 2CLCX 1N6KA 3BE4A 2D4HA 4EPXA 3L0SA 4QL3A 3QKRA 1EX7A 3A1TA 1W5TA 4DLSA 4HDOB 1M34E 3WP1B 2R44A 3HP1A 3VKWA 4BASA 4ZDIA 4Z8XA 4OK3A 1XTQA 2OHFA 2A5YB 1HT1E 1WDTA 2ODNA 1NSTA 2GBLA 5EXSA 5DYIA 2ZR0A 3OFNA 5SZHB 3EX7C 3CZQA 2FZLA 1FOEB 4I1VA 4TL7A 1Z47A 2OV2A 1JI0A 1Q57A 1C1YA 2DCUA 4XWKA 4PAQA 1N0WA 2GZHA 3U7HB 3NBZC 3CH5A 4GT1A 2WJHA 3H86A 4P3YA 4MYHA 1KNQA 4OBEA 4Q1CA 5G3ZA 4Q4JA 4B2PA 2QTFA 4N1AA 1E4YA 1CP2A 2JLWA 1N6HA 2N42A 1OXSC 4V0NA 1SXJA 5BQ5A 4NH0A 4UXJA 2ZE5A 1M7BA 2YNMA 3ICEA 4ARZB 4NHOA 2A9KA 2VPPA 4P4UA 3WHLA 4B3BA 1LNZA 2OFOA 1RVDA 4L4UA 3TUJC 4D82A 5J47A 1N6LA 2IF0A 2EFCB 1W4BA 1W0KA 4M9ZA 1GILA 3KQKA 3THWB 2O8BB 2WJIA 1QHYA 3I73A 2CVHA 1Q12A 3PENA 1JPJA 2F6RA 3TIFA 1E3MA 5EXXA 5AR1A 2G88A 2RGBA 3OIWA 3RVBA 4Z51A 4DIEA 1W2HA 3GJ8A 2AX4A 1ZRHA 3K9NA 2WPDD 3PEWA 3I61A 4AYXA 3KKNA 2F3TA 4ZCLA 3X1ZA 2D2FA 4B2IA 4MRNA 3SQXA 2CLDX 3SYLA 1U2RA 4A8JA 1COWD 1G5RA 1KI6B 3K0AA 4MH0R 4PSAA 3U3KA 4LPKA 4OYHA 2GK7A 5G41A 1D6JA 1Q1EA 4K8OA 4QHSA 1W49A 2G1JA 1A2KC 1G19A 1Z63A 3SJAA 3CNNA 4WZBE 2I4IA 4JLAA 4JT4A 4QM6A 2V7QD 2AR7A 3EWSA 4URVR 1FX0B 2IA5A 3KDSE 2B21A 4L15A 3WNBA 2G83A 2IYQA 4PANA 3OESA 1W47A 3IHLA 3FWYA 1UBEA 3FTQA 3L0IB 3GJ0A 2BDTA 1XRJA 3MFYA 5LDDC 4GDFA 5JJIA 5TVKA 1YR8A 5FOUA 1VCNA 1VG0B 4TYYA 2ZI7A 3TK1A 4D4JA 2ZE7A 1S0UA 4HUQB 1XJ0A 1AKEA 4ZO4A 2C9OA 1E9FA 1Q3HA 3CF2A 3TKLA 3KUDA 4UQOA 4D25A 1P73A 5J40A 4QBFA 3Q8XB 2G0NA 4UNNA 3KFVA 2QSZA 2CJWA 1NG1A 1KZ7B 2O0JA 2OO7A 1QHGA 1HEIA 2C9YA 5E3HA 4DVGA 4PC6A 2C78A 5EJEA 1S4QA 2Q3MA 1N6IA 4AKGA 3D8BA 2KBFA 5FPHA 1KYIA 4IKEA 3ZZ0A 2ZI3A 2ZS7A 5KPJA 1KTVA 1Y63A 1Z8FA 3W3ZB 3N70A 5DN6A 2WSSA 1AK2A 3VFDA 3ZS8A 1I4TD 5CJPA 5HTKA 5FTLA 2R2AA 2F9LA 3GLGA 1N25A 2BKEA 3RS5A 3V00A 2ZITA 4LYHA 1X8JA 2O8CB 1HE8B 1FQJA 3KJHA 3D6TB 4EFLA 2ZVPX 5CIWA 4YLGA 5HKKA 3TMKA 421PA 3LO5A 1WP9A 4PSKA 5FOXA 3TRFA 2CDNA 4FMCF 2WWGA 2PT7A 1VECA 3TUIC 1HUQA 1ZUIA 2FGJA 4YDSA 1U8AA 4NBSA 5FTNA 3RRNA 1O87A 4BRUA 4XD7A 1VG9B 1DAHA 1JXMA 2GJSA 4IXMA 3V9PA 4MDFA 2RGGA 3QENA 3K0CA 4C2TA 3EIQA 3QG5A 1OB2A 4BGDA 3MMPA 1R0YA 2P67A 5AJVB 3CWZA 3Q9LA 5H1YA 4GP7A 1D9ZA 2HDNB 1G6HA 4BZPA 2OLKA 4JL6A 3AVVA 1S2MA 2R62A 3T5GA 2Q9AA 3AVTA 1XJQA 3BD9A 1GSIA 3I8XA 5ELXA 2W2TA 1VKJA 5GADl 3KQHA 3EARA 1NLFA 4YMUA 5FL3A 3C5HA 2Z43A 4KO8A 5J4KA 1UF9A 3IIMA 2QN6A 3CRRA 3NEYA 5JEDA 1C9KA 2YC2C 2ZSFA 2C5LA 2FMXA 3DKVA 3MWYW 3OFND 3QKTA 4Q4HA 3RANA 2C99A 1M6NA 2HLDA 3KZ1E 2ZSDA 3NH9A 3AV0B 5KSYA 3ZH9B 1W7AA 3H84A 4F92B 2X2FA 4LI0A 3FKQA 1XD9A 3W5JA 2C03A 1KIMA 5CITA 4LJAA 3RAPR 1QHHA 1OFHA 2HCBA 4HZUB 4A0FA 1G3IA 3FKSA 4WXRA 5SZKB 4PHGA 3RSOA 1P2TA 2R65A 2SHKA 4DRZA 5J4HA 2WJJA 1XCPA 4KI0A 1ONBA 1RRPA 1D2NA 3U7GA 1G3MA 2QEQA 4F38A 3TSWA 4C0QC 3U44B 2WTUA 1SVOA 1NJGA 5G53C 4BLQA 1Y3AA 1ZUNB 3B78A 5GVRA 2ZRGA 3SC3A 3PEUA 1P9NA 1JB1A 5B57C 4JBWA 2YWEA 1AQYA 1W0KD 2N1BA 2C8VA 4DDUA 1JXOA 3U61B 2E1RA 4E22A 3AKCA 1JQJC 2PX3A 4C0BA 1CIPA 1WMSA 1TQ4A 2CK3A 4N3NA 2QORA 1XEWY 3IPXA 3LVRE 5H70A 4NONA 5B30A 3QKUA 2GZDA 2XTNA 1XMVA 4TLCA 2DHRA 2A30A 1Z6TA 4NYIR 2CXXA 2J0UB 5CIQA 3ZVRA 2BMDA 3MCAA 4XWOA 2BHRA 2QE7A 3PVSA 5BN3A 1BS1A 4OHXA 3BH6A 3T15A 2MSCB 3NIBA 4URXR 4NCNA 2F1IA 4MYUA 2P3SA 1JAHA 4ZI3A 2ZIAA 4D4LA 4LBZA 3KQLA 2CHVA 1RJ9B 1XX6A 1LTQA 2V9PA 4ACBA 2C2HA 2H17A 2PEZA 3AUYA 4UJ3A 5SZIA 3AQ4A 2YZ2A 4GNKA 5CM8B 1RE0A 4QGFA 1ZCBA 1L2TA 4GOXA 3RWOA 1R0WA 2MMGA 1QBKC 2YOFA 1N5KA 4OQFA 1EWRA 3R7WB 3Q5DA 2E87A 1Z0JA 4AYTA 4A92A 1KDRA 4ACAA 4BFSA 2ERYA 2A5FA 1OHHA 2JJ2A 2NO1A 2CCJA 3GJXC 4TYWA 3U4QB 2GXQA 2BC9A 2VO1A 2FWRA 4E03A 4AKHA 3KQNA 1XTIA 5IRCD 3M1IA 2CVFA 1SKQA 1XZPA 3HR7A 4URYR 3CRMA 2BM1A 1P60A 3FMIA 1JJVA 3LX5A 3W8NA 2HT1A 4PFSA 1L4YA 2Z83A 5DN6D 5JMTA 2IS2A 3CRQA 2IBMA 5JSZB 4JJKA 3B1VA 4M22A 4TSFA 3GEHA 2AHOA 2QM8A 2RGNA 3KKPA 2UKDA 4LK2A 5FOTA 5TARA 4Q4AA 3SU8A 5F98A 4RJLA 1HYQA 2J1LA 5HKKD 1Z22A 3B2EA 4UNQA 4LYJA 1DO0A 5H8WA 3QKSB 4B3XA 1HQYE 1CR1A 4H9GA 3WBKA 1E9RA 2ZI5A 4PQFA 2CNWA 1XZQA 2QAGA 3QBVA 4Q1AA 3X2SA 4A6XA 2VH5R 5C46F 5L3SA 1W36B 3ZLJA 4XD7D 1VDZA 3NH6A 4OJKA 4XIGS 5BN4A 4GMDA 1LS1A 1HV8A 2ZVQX 3NTUA 2F43A 2DYKA 2D06A 2ZRMA 4LYFA 4TTRA 3AF3A 1XTKA 1OT3A 1N0UA 2ZRKA 4EPWA 2Z4RA 4KJZA 3SHFA 2ZQ5A 4LUCA 4P33A 4TMTA 2NO7A 4K46A 4W5JA 1AA9A 1ZM7A 3SDZA 3QQ5A 4YQFA 1WB9A 3IQWA 4L9WA 3CO5A 1KMHA 1UFQA 3OIVA 1UBFA 2H5EA 2J46A 4BE7B 5JWHA 1E9AA 1ZBDA 2VTKA 2ZUDA 1WBDA 3VKGA 1EG7A 2MMCA 1NVXQ 1G7TA 4JKIA 3REGA 2HLDD 3IEUA 4B3GA 1KK1A 1FFHA 2O8DB 2ECKA 3K9HA 4DZZA 3BJIC 1TMKA 1NKSA 2ZTSA 4FWTA 2VP2A 1GOTA 1DEKA 3OF5A 4MRRA 3VHLB 3UK6A 2ZYUX 5AJXA 5JI2E 1DOAA 5FPSA 2IUTA 2IS1A 4ZV4A 3RRZA 1FMJA 1KJYA 4JKYA 4QFMA 4DLWA 1Z5ZA 3Q5EA 1GDDA 2KJQA 3JVVA 4I1SA 3IGFA 4X8MA 5D3MA 2GXUA 4PHTA 2EW1A 1ZP6A 2ZI9A 4D0GA 2ZRJA 1G64A 5CYPA 2RAPA 4A82A 1W2GA 2JLRA 2QUZA 5CLLA 2FSHA 2XNSA 3A1SA 2W83A 2FEMA 2BIFA 5KSPA 3SYKA 4EQ6B 5JCZA 3PIRA 4Q5IA 4P32A 3GLIB 2VLIA 4BWYA 3K8YA 1E2NA 1N6NA 1FQKA 2CK3D 3D3QA 2V55B 4XVQA 4M53A 3TGPA 1BOFA 3UG6A 1AS2A 1TUIA 1NN0A 4URUR 1RRFA 3LH5A 4Q7MB 4XSGA 1T3LA 1CULC 3UKDA 2BEJA 2PCJA 4E09A 1YZUA 4B73A 4NDZA 3QXCA 1M1YE 1F3OA 3NKVA 1TQ2A 1NI3A 2AWNA 2IF2A 4HB4A 3M0EA 1U0HC 3BBPA 4BZQA 5FFMA 2V6IA 4W7SA 4BEJA 3NG1A 5JBQA 2EFHB 2ZS9A 2XXAB 3A4MA 4AK9A 1VTKA 4OQXA 3EZ6A 3K70C 4KFSA 1V5WA 3EC2A 2XEXA 3G82C 4JS0A 2GXAA 2BMFA 2I3BA 5JI3E 4W9MC 4RFSA 3I1FA 4HYYA 3RRMA 1E9DA 3FE2A 1KHTA 2XTZA 1DAIA 3W6PA 3BB4A 1L7VC 1T4GA 2JIZD 2V3CC 4RD6A 3UANA 2V1XA 4PTLA 3R20A 2GJAA 1P4SA 2WWIA 2JJ2D 4PPNA 1OHHD 5DO9A 2RGXA 5G40A 2R6DA 2VQSA 4KSBA 4B3DA 5AWFC 1XEXB 2PBRA 3B60A 4KBFA 3DM9B 4EFNA 3O8CA 3VU9A 4PAMA 3UG7A 1LY1A 2EWVA 4YC7A 3NDBB 1HT2E 2CL0X 4AURA 3O8RA 3MWJA 1B0UA 4Q1BA 3CX8A 2QQ0A 3CX6A 2H57A 3LDAA 1GUAA 4DCVA 5BXQC 4D81A 2WBLC 4DLUA 2QBYB 1VCIA 3BB3A 2GEDA 1BO6A 1GKIA 1EFCA 3Q85A 4Q7JB 4PQRA 4M0LA 5KTYA 3R9XA 3FVQA 4NYMR 4BFWA 1AQUA 4DDWA 4I99A 2VP5A 3GJ3A 1OXTA 4QOSA 2VHUA 3UWKA 2FU5C 1T3SA 4DCNA 4NYJQ 2Y8EA 4NKRA 4JVSB 1E0SA 1NLZA 3PG5A 4MRSA 1KO1A 2FSGA 4NMMA 1YRBA 2AL7A 4QHTA 3IEVA 4D4MA 4TLBA 4Q48A 3THWA 2WJVA 1XPRA 3DMNA 3B9QA 4CEIB 3A36A 2IL1A 3SS8A 5IDVA 3LY5A 2OFXA 3HU3A 5LB4A 3IIKA 1M7HA 2GILA 3KXKA 1Z07A 5J5CA 5KU1A 3CNLA 4JJZA 3PUXA 1T0JB 2GF0A 2AKAB 4NYMQ 1MO5A 3CPJB 3U2QA 2PLFA 3T1TA 3VR1A 1GFIA 5L8VA 2IXEA 3QPWA 2ODBA 3FHTA 3B7GA 1MV5A 2PLRA 2QY9A 1KI6A 3IHWA 5FPYA 2WIAA 4LGMA 2GEUA 4JSYA 1FTSA 2OCYC 5KNCA 1NJFA 4HAZA 1E96A 1G3RA 2O52A 3S1AA 1DG1G 2YINC 2H16A 5KOYA 3RS7A 2JATA 2QPAA 1KO4A 2WWFA 4TMKA 4UJ5A 2VP4A 4DCUA 4DSOA 5F9HA 1Z6AA 5KPDA 3K9GA 4JLBA 5DHAA 3AVYA 1VIYA 3GEEA 4V0MA 2XB2A 3MUFA 2NZJA 4IVRA 1LV7A 3BRWD 1Z6XA 4RKFA 4PO9A 4OI0A 4AWXA 1J90A 2ONKA 3LBIA 2GETA 2W0SA 4DB2A 4HUQA 4C0LA 2JLSA 4KSCA 1E0JA 1OXVA 1IJFA 4Q00A 4U5XA 1N0VC 2GTPA 3QF4B 3EIHA 3NBYC 1CJMA 3ZZUA 1QHNA 1Z08A 4EJSB 2F3RA 2VHJA 4B3CA 2ATXA 1NVWQ 1SZPA 3V4FA 4O0MA 4Q7KA 2XB4A 1NY6A 1U90A 1RIFA 3JVUA 2AD1A 2QZ4A 4L16A 4U00A 3THYB 4NCKA 4EIWA 4AKEA 5JS7A 2D7DA 4FW9A 3K0FA 5IK2A 2LKCA 2IYSA 4U02A 1NLYA 2ZUBA 2HUPA 2IYYA 2IW3A 5EXTA 1IN4A
chains in the Genus database with same CATH superfamily
1K7SN 2EU8A 2VIIA 1ZGJA 1FNNA 1GZ5A 1KERA 4LSWA 2FGKA 3QWBA 4X85A 5K20A 2I6TA 3CKKA 1KRWA 1ZIDA 1PDOA 1QCCA 2BFFA 1QNFA 2RHHA 3EGOA 4UNIA 1XXHE 3I2YX 3IQGX 4IV5A 3HE3A 1KY2A 4KQ2A 1A7UA 2EIHA 4LHXA 4RVSA 4URHA 3WIBA 3O8DA 4FFRA 3K0SA 1UFRA 2FG7C 5HQ3A 2HPZA 3QVJA 1KKLA 2O7QA 2Z0MA 3SWWA 4NG4A 2F1HA 1FDIA 3NXKA 1T4BA 2QRHA 3KALA 2O4CA 3DJYA 3FTDA 3SM9A 3SS7X 1W5AA 4NCXA 1NJ5A 3ZD9A 1FSGA 2B1IA 3DV2A 4IILA 1E2GA 2H54A 1SPBS 2ZRFA 5FJIA 3ZDCA 4V03A 5IKMA 4EJ6A 4EVRA 1K9VF 1OWLA 1Q5PA 1XQ1A 1NR5A 1P2SA 1IHOA 3A1FA 3GCDA 5ALQA 4PYRA 1AMOA 5CA0F 1I4LD 1TRHA 1T26A 2UYOA 4G0PA 4KN6A 2ONJA 1QK3A 1SVNA 4IJVA 1JXQA 1L5QA 2CFRA 4NZZA 4HC4A 2PBLA 3MWEB 3H1PA 2FQWA 4ZRMA 3LRTA 4ENUA 4CUKA 1IZ7A 4IJKA 5F4BA 5C4IA 3I9JA 3KHKA 2ZT6A 4J9VA 4XLLA 2VI5A 4Z4CA 4F2GA 1EEHA 3U4AA 1BKDR 1ZEMA 3EMVA 4B17A 3LT2A 1W59A 4LOJA 1V3UA 1UADA 4BP1A 1VKOA 3R5FA 3DEZA 4ZZ3A 4J29A 5TE9A 2F3UA 2Y3IA 4NOJA 4RESA 4WEQA 4WJZA 2GYWA 4MIKA 3SZRA 2VP6A 4OATA 1QK4A 1V35A 5TRTA 1P0PA 2I4MA 3DGEC 3E8SA 1T8SA 3FYSA 3EHEA 3P71T 1ZA2A 3UAOA 2P2LA 3ISJA 1OLXB 4B40A 2QVCA 3FFWA 4DREA 4L5JA 1ULSA 4YGYA 5FOVA 1VYUA 4G0NA 3NYRA 3GCZA 3PFFA 2K6GA 4LGVA 3PGMA 5CNMA 1Y1RA 3VVCA 1U63A 1O97D 4KMSA 4B83A 4JLJA 4X8HA 4C01A 4XVUA 1K66A 3JTEA 1EIWA 3LD9A 3NHZA 2HCFA 1EVLA 3LI2A 4BBJA 4BUZA 3SE7A 4NZYA 3WC4A 4QJBA 1B15A 2OG1A 4K6OA 4NQRA 3WB9A 1TPZA 1WNFA 3AGPA 3DT9A 1R10A 1MAVA 4FOSA 2A2ZA 2VFAA 4R69A 3V8VA 3L5KA 4ZJYA 3CUTA 4HLQB 4LYDA 3CCBA 3O95A 4YJ3F 1IBRA 3OT1A 4JLMA 5L3SB 3JD4A 4C6TB 4DLTA 1G21E 1MNQA 2DUNA 2WYHA 3A10A 3A9SA 3PF9A 4NMWA 5FV7A 3FNQA 1OAAA 3UFXB 4DT1B 3QTBA 3TQFA 4ZGBA 3WRWA 2I2CA 3G6KA 3G79A 1FP2A 1JTFA 2QGNA 3LBHA 3Q11A 1E66A 3FYUC 4OOEA 5T67A 3W5IA 4DUYB 1SXGA 1P61B 4HTFA 5IN5A 3JU3A 4Q9DA 4XCQA 2H1WA 1DBRA 2CD9A 2V54A 4BCDA 1PK9A 5JVDB 5B7NA 1IOZA 3ZDDA 4HDKB 1NT4A 4WOJA 5JQGB 4N76A 4S3MA 2HIHA 4U9UA 1L5WA 3CKMA 2GFIA 3CNOA 3TFOA 5EWJB 2Z98A 1D0SA 1FU4A 2GB4A 1TECE 2M6LA 9LDBA 2ODEA 1KK0A 4P98A 2W70A 3RASA 3RS4A 1J70A 4NAUA 1T4MA 3KC2A 4FKMA 4LCJA 3T6KA 3L1IA 4RYLA 1PK7A 1MIHA 2CB9A 3L1HA 2P5TB 3AILA 5AKZA 1AV7A 2XMPA 3IR7A 3SXUA 2GBFA 3HO8A 4D6PA 4X6XA 2QLBA 3H3FA 3TPZA 3SGLA 3DEKA 3PWKA 3BIOA 2G7MC 1RJ9A 2TMYA 3QYPA 2NU7A 2PZBA 3M9XA 3C87A 5EKXA 5ENZA 3STUA 1OWMA 3V32A 3I2KA 4EMUA 1ZD8A 3UGJA 5ARDA 2CJPA 5AK0A 1T9ZA 2OHVA 3FNHA 1IL0A 1JDZA 1AB5A 3EVBA 1XAGA 2NU8A 3RSCA 4HRYA 4BFYA 3OLCX 5EUMA 1KE1A 3PA8A 4EAAA 5BW4A 5L53A 4HAIA 3T06B 3R3ZA 5CDGA 4K9NA 1E20A 2D00A 2IZ7A 2JIOA 4YRCA 5JBIA 3ZJ5A 1ODFA 3HO1A 1GZ4A 2MINB 2JLYA 3Q87B 1T6ZA 3AEUB 2J9XB 4JOQA 3EWNA 4YCAA 2QQFA 2VR1A 1ZOOA 1C9DB 3AF1A 4F8JA 2GEKA 1QB8A 3IMFA 1IBSA 1PE0A 1JR6A 2ZU6A 5A1TA 4O8CA 1Q0UA 1U2SA 1WAMA 3FYTA 4E13A 3GRYA 3WLJA 1GSHA 1Z45A 2NVOA 2ZB3A 4KAXA 2CXPA 2ACEA 3RDPA 3WO1A 5CJ2A 5M04A 1VLVA 4PYOA 3RO7A 4BEWA 4AKGA 3PYLA 1L5MA 2EYQA 2PGNA 2VWGA 1R27A 1L5HB 2XKJE 3A1NA 1ADGA 4OM8A 2IV7A 3N2NA 4LDZA 3RU7A 3QX3A 3V2UA 2FW6A 1T91A 1T4DA 2YR0A 4DUGD 4DDKA 4EPTA 4YRBA 2JLCA 4KQMA 3C3MA 1ANKA 1K4MA 1PX2A 3G89A 4HVCA 4JP8A 4K6HA 4CW7A 4M21A 5EMNA 1VPLA 3X2FA 1KI3A 2XSZD 2QXTA 4MIYA 1QV7A 5AICA 2JJ1A 3ZHRA 2PUVA 3QVKA 1X1DA 4L07A 5FB3A 3K73O 5GJVC 5C1DA 2H8KA 4GPZA 3WQQA 2H1IA 2OUKA 1CUBA 3M6UA 5CNJA 5DIZA 1TZ2A 5AW1A 1IM8A 1RYHA 2PU7A 3AB3A 3QM1A 3C1UA 4HJRA 3MOGA 4FCTA 2BBTA 2I1WA 3NM6B 1S96A 2EZ4A 2DQSA 5JISA 4PC7A 4JV5B 1QVAA 2HQBA 3T1VA 2CUZA 4QUAA 1A2QA 1WE2A 3AF5A 1J2JA 3GUYA 1QF7A 3KLOA 4B6RA 3BOSA 3L4KA 1S3IA 2C9CA 4C0SA 2WILA 1U8ZA 1YTUA 1UXJA 4LZPA 4M8LA 1G38A 1ZC4A 9ATCA 1XLWA 3MCWA 2FPMA 4JQOA 2QW0X 1TEZA 2A3NA 4Y6LA 2QIOA 1IDOA 3VO1A 4CIXA 4X7RA 3UMYA 1G9XA 2DQKA 1VXOA 2I8CA 1US8B 3P32A 4G25A 1E1CA 1KY3A 4XWAA 2J3KA 3PNSA 4ALLA 5BUQA 2A0WA 1E1KA 3WGJA 5B3JA 5F7ZA 2C1EA 1BS2A 2GKGA 1QYWA 1BCSB 2TRSB 2ZJAA 3X1KA 1E69A 3QLUA 1MA3A 4W82A 1RU3A 1H0KA 2J31A 4KQGA 4TPKA 1OBOA 2ICAA 3FPFA 1A9XA 1RRCA 2GAOA 3CGGA 3V1MA 4N12A 5DYGA 3SIWA 1DRUA 3H4MA 4MCAA 5I7WA 2P41A 3UYKA 1E6CA 2RCYA 2YKGA 1ZU4A 1Y5NA 3TBHA 4LE0A 1LC3A 4GBMA 1GARA 3FWKA 5EYPA 3IMKA 2CNLA 2PKWA 3E61A 3EEQA 4HWOA 4BS9A 1UKEA 1V3TA 1I3OA 1JYEA 2J30A 3A1UA 3HP4A 4B7ZA 4MRMA 3V4VB 3P5BA 5TMPA 2OCAA 1VM6A 3ZYCA 4LF4B 4JEUA 2IHVA 1NN1A 2YYZA 4R16A 2J5XA 2GZAA 4LCBA 1JAIA 3Q7PA 2WF9A 2A7QA 5F7OA 3AJAA 2IJGX 3H4VA 3K8QA 4RS3A 1GL9B 1MGOA 4QWWA 1ZHHA 3I1IA 3V4OA 2OBMA 2DFKB 4M36A 5A5GA 1LDGA 3WXBA 4BGIA 2IHKA 3ND8A 4K81B 4BVGA 1JHVA 4AB1A 2HJ9A 4XTRA 3U7FB 4C2UA 4I46A 2XBMA 4DWWA 2VPXA 3AY0A 3KUKA 5HQTA 4OHOA 4A8JB 5GIOE 1QDEA 3IALA 3OUTA 2PX5A 4UUAA 5IWAB 5F7JA 2AXPA 4DBVO 3OZXA 3G0DA 4LX0A 4OAQA 4OH1A 2HT6A 2R6R1 4JJ6A 5IAAA 5MGNA 5ITVA 1UMBA 4IJQA 1LNSA 4H6VA 5AI4A 1M2FA 2O23A 3KAKA 5A3JA 1SVUA 2JI8A 2WF7A 3F4BA 1FU7A 1C30B 4G81A 4JITA 4ER5A 3WQHA 2QRVA 2AXEA 1A4RA 3PU6A 3RI3A 3U1TA 3G85A 4KQWA 2FH5B 3L6UA 4F5WA 5JAZA 1P17A 5C4MA 2Q5IA 1BRMA 4BWVA 1J0XO 3W5DA 4FCCA 3AZPA 5CXSA 3VTAA 4Z4QA 1TYAE 2OECA 1I8TA 3DFUA 4KXVA 1K7FB 2DY0A 3LX8A 1QZXA 4HXGA 5THQA 1HE5A 3MJRA 3DO6A 1JA9A 2UUOA 4MOWA 2JHGA 2VJCA 3OCYA 4OJNA 2AIRA 5IBRA 1OASA 4DRYA 4UOQA 1VJCA 1B8OA 2REQB 4IHJA 2PYDA 4IJWA 5E6RB 2JGAA 5GQSA 3U40A 1N3LA 5A9SB 3EVEA 5BOSA 1JEYA 5A0TA 1FXWF 1U1DA 2OM2A 3MBOA 4M1QA 1P81A 1NRWA 2FZ5A 4X1YB 1DC6A 4BMYA 3SHTA 1J0DA 4FKZA 3V9AA 5JATA 5KVSA 4FQ7A 1RWOA 3BWYA 5LN1A 1MW9X 3E58A 3VU8A 4TUYB 5CP8A 1ODIA 4EHFA 1F5NA 1LPMA 2PD4A 3QVVA 1Q0TA 1E2QA 2BE7A 4MULA 1C9EA 3CUSA 3WWCA 4RHYA 3EPLA 2D3TA 3HBJA 1ZSVA 3IDQA 3OEWA 5IT5A 1AHIA 1FTYA 3ESDA 3KQSA 1KBQA 3OEHA 3PC3A 4TLCA 4RVCA 1I7DA 5I3CA 1Y3FE 2A0KA 1E5XA 1WB4A 2QN3A 2VDWB 4LC0A 4CRWB 2B82A 2JVKA 3GDHA 3P0HA 2IYXA 3AUFA 1EJ2A 3ZWMA 4CV0A 1P7ZA 2V98A 2ID4A 1QRDA 3GZNB 5EP3A 4OHMA 4EGCB 4IICA 2F90A 2GHIA 3EEIA 3PUKA 5EKSA 1CJSA 2QTLA 5B64A 1J09A 4GI2A 3ZLTA 1QIHA 2QKYA 4V1CA 3ZZTA 3B52X 1O6CA 2X9LA 1WWKA 1OXKB 4DADA 2G3YA 5LNK1 4R84A 1ZD1A 2VCYA 4ZP1A 2AI1A 3DHVA 3WY9A 1G7CA 3GLHA 4L0MA 1TGYA 5L4NA 1OXUA 3QLTA 5FI5A 2B8WA 2REXB 2HA4A 3EVFA 4YROA 3DAPA 1MQ8B 1M2EA 2RBKA 3CB4A 1BE8A 3ZHSA 3OLXA 4KQEA 1G55A 3H5WA 2VH1A 4ND1A 1PJ8A 3A14A 3P20A 1DQPA 1K2WA 2CLEB 2H1SA 1T2CA 2WAXA 2WJWA 2ZAMA 5I7AA 1AU9A 5IVIA 3C3PA 4HI0E 1H0HA 4WLUA 2PSFA 3IOEA 1IY1A 1T8PA 4F6RA 3PJDA 1ST2A 1VG1A 2OPBA 3FFAA 1DJNA 3QPVA 4TWRA 4UPDA 5LP6F 3W6OA 2R0QC 2Q9CA 3KJZA 3UJNA 1LLQA 4KQ1A 3S2YA 4YV0A 2CXRA 4FYVA 3NATA 2R96A 2IH5A 2WQZA 4AQ7A 2HK8A 4W5OA 3SICE 3CHYA 3EJWA 5C1IA 1H3EA 5LP1A 5C8YF 1YZYA 1SBZA 3RFFA 4EVIA 3QA9A 1LSUA 5JYEA 3D59A 4IG9A 5L51A 2FSVC 4MI3A 3RVMA 3FNGA 2B61A 1WPGA 4BQRA 2DU8A 1Y5RA 4G6ZA 4V0ME 1WUKS 4R9RA 3PX2A 5AM0A 1GTSA 4P4SA 4IH9A 3VNQA 1RWVA 1JNXX 1FYDA 1C3EA 3PJGA 1I4EB 4FE3A 3DPUA 1VPVA 3THXA 1UDXA 4CVNA 2J3LA 3H9QA 1OSNA 4OXYA 4GC5A 2RHOA 3KQPA 1J8DA 1PZEA 2HWUA 3MWLA 4V0LA 1UJNA 4PNHA 1XKLA 2O2CA 4G0OA 4PPGA 121PA 3TEJA 1WF3A 2ES4A 2GLUA 2NZWA 4C3ZA 1W7AA 4YCBA 8AT1A 4Q9IA 2ENWA 4ZQGA 1PG5A 2BF7A 5KTKA 2H2FA 1ABBA 1SD1A 2AD5A 2DUMA 2ZYVX 2YWRA 1I6KA 4IS3A 1JG7A 1JLLB 3EG9B 3VC7A 2RHMA 3OA2A 4EW3A 2GEBA 1DKPA 1RXWA 3MMZA 4MQFB 4NBLA 3AUXA 4KDEA 3OOYA 2VDMB 3MT7A 4QGGA 4RMHA 2HZ7A 3B20A 4YAIA 1SK9A 1JKMA 3BMNA 2QL7A 3ML1A 4G1VA 2IWRA 1T5BA 4U9HS 4ID3A 4RY0A 4A9AA 3J81A 1JDPA 3I5XA 1TL7C 2RH8A 2R751 4TV9A 5ADUS 1K8YB 3JR7A 2QE7D 3R44A 4MWSA 4Q9AA 1KEEA 1IEQA 5GONA 3L07A 1SURA 3VXKA 5KYXA 1GA6A 2DFDA 2CKMA 1WPXA 4MUNA 2WJPA 1P9LA 5BN3B 5T4FA 3WK9A 5DLYA 4GL2A 1E8MA 1T2EA 1ZCJA 3GG2A 4HAWA 2XXJA 1VCHA 5KOJB 3RHTA 5GINE 2XTMA 1NM5C 1ZD9A 1K8RA 3E2PA 4RKQA 1A96A 1E2JA 2FW7A 5DIFA 3U7QB 4DLXA 4YRKA 2FLWA 1JHRA 2W6JD 1L7BA 5EJAA 4MVJE 1YBFA 5CHYA 1Z6PA 2G72A 2VDUE 3HBFA 1WOMA 2HXYA 3Q41A 3A04A 4H59A 1BQ4A 1F8GA 4GEKA 4WUTA 4K28A 1SQ0A 1XL0A 4B8YA 3HDGA 4RW0A 5KYYB 1XCGB 3BKWA 3VAAA 4E2XA 1G8JA 1UJBA 3EA5A 4HH1A 1BHSA 4UZSA 1E79A 3KELA 3FRJA 1AKQA 5KOIA 1RDFA 2G71A 3HXTA 3NS7A 3LDUA 1KZ6A 3H6KA 5FTMA 5T4EA 4XDHA 4C14A 4YR7A 1N1GA 5KTPA 4JYPA 3QEMA 1XNRB 2A6PA 3SZ3A 4PGMA 4H27A 5LBIA 1GKYA 1O9GA 1T5LA 1EM8B 2I6UA 4CETA 4WCDA 3DTTA 4TS9A 3HTXA 4ZYVA 3RC3A 3AESA 2XB6A 3QV1A 4FM9A 3UMSA 4X61A 4EAQA 1GZVA 5JS6A 3RYIA 4NFLA 4XAQA 1UM9B 3PNMA 2R2GA 2ZTUA 5KQMA 1E6EA 3ZWAA 1NF2A 2I6QA 2OCGA 3BXEA 2PKQO 2QHXA 5FI0B 4M9XA 2C2WA 3N8IA 1T5TA 2IX9A 4BFUA 4A1OA 1ZD3A 4Y2SA 3AR8A 3BFPA 3OEEA 1BTOA 1FTGA 3JWEA 4ARZA 2B35A 1VCOA 1YDMA 4MJLA 2Q6KA 5DNDA 5FUXA 3ZDRA 2NUPB 4KUEA 1CW2B 3K72B 4B35A 5B6JA 3EASA 4RZ2A 1YDEA 1E6LA 2CE7A 4M2LA 2FPPB 2R86A 4OFZA 4UM8B 4EELA 1Y98A 2GRJA 3FX2A 3OE5A 5AJZA 1SOUA 4AC9A 7ADHA 1ECGA 2X22A 2FE4A 3LHKA 2BBSA 1SIUA 2XOXA 5LYJA 5LOVF 2XMRA 3KB2A 3TB6A 2XZDA 5DHFA 3RVSA 2AC2A 3UV3A 3I2JA 3DBVO 1LPOA 1AGRA 3A70A 3PIDA 3LV8A 2XJ9A 3CEHA 2NUBA 2VHTA 1OLSA 2GO1A 1KEKA 1RRVA 4ZD6A 4LWQA 3NFRA 4S2UA 5ALNA 2BEVA 3WZLA 3IVCA 4BQSA 3I2FA 4HDRA 4L4RA 2EAUA 3OTQA 4M83A 4GZ5A 4DIDA 2BUAA 3OAAD 1ZCFA 2OVFA 3F5SA 4KMMA 4PWYA 3SVZA 4ALIA 4KPFC 1K63A 4CT0A 1T0IA 3A31A 1M8KA 1M73E 3A6EA 4C7OB 3ZKWB 1T2AA 4RK5A 4RTOA 3EFOA 1H2XA 4HQRA 1K86A 1A1VA 4XQGA 2IWHA 1FX0A 4QOHA 4C07A 3GRZA 1JEAA 3VI4B 2DHCA 3DCJA 2PAAA 3FJOA 1AK1A 4M99A 3AMVA 4WXYB 3MWGA 2Y1EA 4KB5A 1XTTA 1YE8A 1ZIPA 2PUTA 3QFSA 4WN3A 4Q6BA 2JJ8A 1MOPA 1FF9A 3B8HA 1GPMA 1HURA 2DUJA 1WVMA 4N9WA 1SVSA 4RE6A 1DCKA 4Q82A 1Z4KA 2OLJA 3TDKA 5LQRA 4G37A 3SBEA 1ULUA 1O6GA 4IQFA 4KVFA 1JPVA 4YJ2F 5EA2A 1C7ZA 4QKQA 4F93B 1LDMA 3HR8A 3VR2A 1X1SA 1GPJA 1O1YA 1ZHOA 2I55A 2QAJA 3Q9SA 3QVSA 4NNOA 1E2DA 3I01A 4I36A 3STWA 1MX3A 4IZHA 3T5TA 3ZNPA 3FCEA 3HCRA 5GZ6A 1UDBA 1EX6A 2P65A 3HRKA 3P9XA 3RKUA 4IDPA 5TLSA 4U8HA 1C7IA 4O4HA 6ADHA 1AO3A 3VJRA 4I3FA 1NFRA 4WSOA 4OP2A 4Y9SA 4ZI5A 1G1MA 1AE1A 5U4QA 1FMFA 1YWGO 4CM4B 5JDCC 3LECA 1QIMA 3NEAA 3LY7A 4LEIA 1XVLA 2V9CA 3ZK8A 5U9CA 1C3JA 4TGLA 3EZ9A 1J06A 1Q7CA 2BP7B 2OFFA 4BVKA 1BKYA 1VBMA 2FMIA 3JRWA 1AKWA 1I24A 2RH9B 2GKOA 4LKOA 5JXJA 4PU0A 3G1WA 3P4UA 4DZRA 1MHPA 1XF9A 2DULA 4LBWA 3F2VA 4UVIA 3BBLA 3WLEA 1Y33E 1XWFA 2AXQA 3UWMA 1PQYA 1TQ6A 3AINA 4JLSA 1DCFA 2Z5GA 1XDBA 3I30X 4KAFA 4OLFA 4M8NE 4PG5A 3UH0A 5TIIA 2AQ8A 4M6WA 1PJBA 1KI8A 4PO1A 2CCKA 2XUAA 4HX2A 3KVVA 3DBHA 5DYWA 2JCYA 1EUYA 2QJTA 2XNDA 3ZWWA 3NHYA 4DJAA 4HXYA 5K01A 3ZE1B 1Y8RA 2NUAB 4CJXA 4P3KA 4Q1DA 4AS2A 3GHHA 4L4SA 5LLTA 3GLRA 1P3JA 4K86A 1NZFA 1DC5A 4POAA 4PGGA 3HHPA 1KJ8A 4D2IA 1UFOA 4YJFA 3DE1X 4Q3NA 5AUNB 5A05A 5E9WA 4FU0A 4WGGA 5ICEA 1DXYA 4IKPA 1MRSA 3PUHA 2D74A 4RMJA 2PZKA 3A8TA 2H4FA 1UXHA 4I19A 4QPZA 1WB5A 2ZR7A 3BMOA 4YRRA 4H4CA 1ZG3A 3DOEA 1V71A 2Q0SA 1QH0A 1AUOA 1W8IA 4GXQA 5EQJB 2DTDA 2FJUA 1I0IA 3VZPA 2KYRA 1DBSA 3DWEX 1BEZA 1KEVA 3NHKA 1ZHFA 3O83A 2YL2A 1JFFA 1EP1B 2IIBA 3ESXA 2X8AA 3JQGB 2HBYA 1RIIA 4FLFA 2BFCB 4MX8A 4NZPA 2QUJA 4L08A 4A6DA 4TKVB 1F2UA 2C92A 3QPAA 1UOEA 4G9BA 3ND6A 4AKTA 1WZCA 2FN8A 3DE4X 3KQQA 3WXMA 5LZ4A 4KNYA 2IEDA 3Q2IA 2DF8A 1D2RA 1V1JA 5K8CA 1R5OA 1KZ4A 1TADA 2DLDA 1VI2A 3G2JA 5EP2A 1MCZA 2GPSA 3LWNA 4GPEA 1Q95A 2C3YA 1PJ3A 5C1BA 3DMYA 1TO1E 5TC4A 2HHHB 2B7LA 4KHZA 5C0OE 3SF8B 3W90A 3OZEA 1UJ4A 3R9XB 3BJZA 5EHIA 1SXJC 4EF6A 2XA1A 1ZUNA 2HREA 4I50F 5ECWA 2YNMC 2PIAA 1FFCA 3FI0A 4JU9A 5FPPA 4IDOA 1P29A 1OQAA 3WKCA 2MWMA 4WQMA 4ALMA 1KJQA 2YASA 3JQAB 3O47A 4I3GA 1AS0A 4EA8A 4ETIA 1KK3A 1N6OA 1KXZA 3W1VA 4IP0A 1R4MA 1YJXA 3MRXA 1X9IA 4B45A 3HYTA 2A86A 2XZOA 4NIMA 2EARA 3GH3A 3OSZA 4REOA 3AKYA 3R3SA 4WJKB 3NX4A 3VDXA 1IM5A 1P4GA 3AVOA 3PK0A 1PEAA 4P7BA 5F4ZA 4DM4A 2FZGA 2J7PD 2P9QA 4MVJM 4TSRA 5K4GA 1T10A 5HTOA 4ASUD 3LL7A 3GJZA 3KLPX 3RAFC 1CIVA 4KN9S 2WTMA 4PPQA 4C7BA 1D5WA 5CCXA 4CN9A 3ACCA 3KKQA 1VSQA 2FCRA 3X2EA 1H5NA 3H2YA 3ZDQA 4BAZA 2VYFA 2J0UA 1E7SA 2ZIVB 3Q7EA 5ICMA 3QLJA 3WLKX 4FOPA 4DS3A 4WNYA 4NXMB 3PKIA 3QMWA 1I2DA 4IJMA 2I66A 4A26A 4CKYA 1JIJA 1O8BA 2B94A 1VOTA 5A6SB 1E1QD 3B1WA 1P1FA 1QFZA 3KD3A 1KPGA 2HFJA 4N4AA 4IH4A 4JROA 1KGDA 2BONA 2FKNA 1R64A 1RTKA 2B4AA 3A4LA 5BSMA 5BR1A 3IE1A 2SECE 4LI3X 1SRRA 2HSJA 4RDXA 1DXHA 5DBIA 4DBLC 2HMWA 4HPXB 3EXHC 2H2AA 4X93A 2A9VA 4ZWNA 2PGOA 3BMCA 2G77B 2X8BA 4F4FA 1RWMA 4GSKA 1OJLA 1Z2CA 5DI3A 4AY4A 4BX3A 5KKCA 3RKRA 2GM3A 2PHZA 4TTPA 1TCUA 2X4LA 4KU4A 4NPHA 3AFGA 3OC6A 1X94A 3U1VA 4AN1A 2HQRA 1DJPA 3D4BA 4MI9A 4RSGA 4RZQA 3L8MA 4CLHA 2HRZA 2HJGA 3R0XA 1HT0A 5C35A 5J23A 1A5SB 2AQHA 2CMFA 2J48A 1FFBA 3GD7A 2BTOA 3WGUA 4CTJA 2N47A 3K96A 3S5JA 3FPCA 2K7FA 5JASA 1KO5A 2OAGA 3QK7A 2YWHA 4K1LA 4OK6A 2D5BA 4LSGA 3Q72A 4F5YA 4B4WA 4L72A 4GXRA 4R1SA 1E63A 1DIAA 1GZ7A 1JSXA 3VR6A 5JNRA 4NMXB 3PD0A 1PNTA 3CLUD 5K8TA 2J9FA 3A3KA 3FWPA 3JPWA 3D7NA 5IJ0A 5HZHA 2Z6VA 3B2QA 5EINA 3RWBA 5C8ZA 1CY7A 4QO7A 3FR8A 4JMLA 4RK7A 3NXSA 4XFKA 4AJJA 4DNOA 3K0FB 1RRGA 3N2ZB 4C03A 2FEXA 2PKXA 5ALHA 3H9UA 3PIIA 2QP4A 3UXHA 5A5DA 1MX5A 4RM2A 2OOSA 5EGNA 2XYRA 3G2IA 4IDQA 1W6UA 2Q5JA 3AJEA 3QKSA 3QOFA 3U4IA 4JVNA 1A71A 3IXQA 5DNUA 2BFFB 4YRJA 4W63A 3G8CA 5A3VA 2FB9A 2QMOA 2QZPA 3MTBA 4I4IA 5K8UA 4WTOA 4F5DA 5IZCC 2NV6A 3DXZA 5BV7A 2VWHA 2B1GA 4B74A 5HQ3B 5FYDA 5L6MB 5F3WB 3ESAA 1QUFA 3WNQA 1D4OA 2WWWA 4WKBA 1K5GA 1EXMA 4HNSA 4YACA 1EXWA 1NWCA 1PGJA 2HMYB 2QT9A 5ER9A 3E9MA 2W48A 2CFTA 3KG2A 3T54A 3TLYA 3UAXA 3WGVA 1MEJA 1XFAA 2Z4SA 3F67A 1R8SA 4Q37A 3GCWA 4BB9A 5A2GA 4ML3A 1N57A 5CVDA 1N9GA 3K8ZA 1OKKD 4G67A 1FY2A 1UBLS 4JP5A 1N4AA 1K98A 1S7GA 1YK1A 2XKBA 5B6IA 4GM0A 3LP5A 1JJBA 5KO2A 1Z5VA 4G5OA 3E9CA 5JD6A 2I6SA 5FH9A 2XPCA 3R6GA 5JH7F 4CQNA 4HLCA 1XMJA 4ZDKA 1Z0UA 2FSSA 5T8KC 5KJ6A 1O5TA 2OK8A 1J8YF 4Q9KA 4JXXA 3SC4A 4TXMA 1GN8A 3BF8A 4TL6A 5KKAA 3AF2A 4I1OA 4NNPA 3UJ9A 3VNUA 2PTGA 4FNGA 1P75A 1POWA 1QYDA 3HS3A 1F0PA 1ZC3A 4H1HA 4M7OA 2WJZB 3A1DA 3P9IA 5HK9A 5KC8A 3BJMA 1NBMA 1UR5A 4AZTA 4B8WA 3UW3A 1KK2A 3C74A 3IEKA 1GQOA 1GG2A 3AYZB 3MCVA 4N0QA 1L8LA 2YHUA 3SR4A 1FYEA 4MW9A 5D85A 2JFNA 3OKFA 3WJ1A 3LMKA 5UKDA 1P62B 1M7GA 3DAHA 1KWKA 3DL7A 1CR4A 1Z0FA 2GTHA 1PR2A 1GITA 5LDGA 2EXXA 4D4IA 5FBHA 3RIEA 5LFAA 2FPOA 1BD4A 3KP1A 4JOSA 2OB2A 3IAHA 1CVRA 1NBEA 3O84A 4RADA 2AN3A 4IUYA 4WNIA 3WV5A 1Q3TA 3EFBA 1MO4A 1TJPB 1LW7A 2WVAA 4HNRA 2AYYA 2YY6A 2C8JA 2J4FA 1O95C 4FIDA 4IDDA 4HXEB 1Z2NX 3Q1LA 3QE0A 4J7CA 3GI1A 1WV0A 4MRAA 2ZJ1A 3OT1B 1GKLA 3QA3E 3NI2A 3QMPA 3X44A 4BV2A 4G56A 1EK6A 2QY6A 5F33A 3KVNA 2QL6A 3I64A 3AHFA 4IDHA 1LKZA 4BLRA 3U4DA 3UJCA 1WSBA 2QGFA 2QD3A 5TS2A 2Q3DA 3SJBA 3ANTA 1FVFA 5DCLA 2JG3A 1CYEA 3BWDD 4EHJA 3NDIA 2P78A 3KXDA 4UUOA 3T7KA 3HCPA 4D9EA 2ZJ5A 5JD4A 1CUWA 3ESRA 1OX4B 2E4VA 2HF2A 1FXUA 3OHMA 2NVWA 2NGRA 4ESHA 4TWIA 1JLKA 2HAEA 5GJWC 4EZEA 4M1TA 1QWSA 2XZLA 1V26A 1G66A 2AG0A 2ZDGA 3N0TA 2JC3A 3QXGA 4OQEA 4BPRA 3ASUA 5DX0A 3F8WA 4PLVA 3K16A 4PONA 3QJYA 4WCFC 5AOBA 4NK4A 2ID8A 3I9V1 4A8PA 4GUAA 1WSAA 1FDWA 4OYLA 1CDOA 3RVJA 4OMDA 1JVSA 1V37A 4MRPA 4GX1A 2OQIA 4JLDA 3S99A 3DVLA 5J43A 3SXUB 3TAHA 2HBRA 3EULA 3L92A 3M33A 3TZ6A 2BV3A 4AG6A 4EFMA 5JTTA 2JLUA 3W6NA 1J8MF 1AH2A 4JL8A 2C29D 2WOOA 2EKZA 5EZ6B 2P6OA 2NU7B 2Z2YA 2PJZA 4JI1B 1K6MA 3EFEA 4J2TA 4X84A 3I0ZA 5FBVB 3FCYA 1ZPDA 1MVNA 3NTRA 5DBGA 3TTTA 3TSOA 2ZJ7A 5TS3A 2NU8B 3TVYA 1Q21A 3DCYA 3A6PC 1H2FA 5B1YA 1EFTA 1R2QA 1WULS 4YMVA 3O74A 4FHEA 4KLZA 4MS1A 1IMJA 2D59A 2OPHA 1YJ5A 1R7RA 3WJ2A 1DUIA 3K6KA 4O33A 2JKYA 3O4RA 5KYKA 5TQ2B 5E4TA 4B34A 4IZ6A 4OQMA 3OG9A 1L4KA 4ZTUB 1U98A 1PR5A 3QNMA 4HYTA 3RUHA 4JNKA 3CO0S 1ADBA 2A5DA 1R0LA 4G5XA 4R2WA 3TM5A 5IJWA 2EP5A 2PO5A 3BHMA 3TFWA 4RLFA 3FYCA 1RQNA 3U49A 1ESNA 3ZNNA 4B6EA 2VYVD 5HRAA 1A0OA 4XCVA 2RGNC 1NF3A 5B1DA 1G8PA 1UANA 1EWTA 1L7PA 1JG3A 4HMQA 1PK8A 1MJ5A 3QLEA 1NF8A 2P4EA 2BBWA 2PXHA 2VK8A 1D09A 1IZ0A 2PR2A 4IVQA 5FTKA 3SXJA 1LZLA 1VL2A 3DBIA 2WSLA 3EG5A 3H5TA 3UV7A 4TV8A 4WLVA 1YZGA 4HB0A 2DJIA 1KSJA 3AOEA 1SNYA 3WGOA 5LQCA 1UKVY 1TCCA 2HSZA 3K35A 1W4CA 2QAGC 4ND7A 4M89A 4U1RA 4RKRA 2HYIC 2JFUA 4QUBA 2ZYSA 3HB7A 3Q6NA 1JDTA 1NBOA 3Q7IA 4P53A 4WK0B 4ZO7A 2PMKA 4F3KA 1E2EA 4DA4A 5ALVA 2BGGA 2FRXA 3R5SA 1YF3A 1PLKA 4JU8A 4GM4A 3Q1KA 1L5GB 2QIPA 5KNDA 3L6BA 4JR1A 4A4DA 1Z5PA 4P8RA 1GTG1 1F60A 1YNSA 3C7KA 4D98A 5AD1A 3R5TA 221PA 1JR2A 3COVA 5JCPA 3U56A 2QV0A 4K0KB 5F52A 2D1FA 5HPYB 4HVAA 1B0AA 5MHTA 1T9GR 4RHCA 2PU5A 3M4NA 1HE1C 4JLOA 2W90A 2QZZA 4ND2A 4YRTA 3MAJA 3YASA 4F9FA 3FXAA 1JP7A 1XTSA 2B7BA 4NATA 4Q15A 3C70A 2EGGA 4Q4HB 4QTZA 3VOSA 2GPBA 2R25B 3IEMA 3DBRA 5FBQB 3NNNA 1E62A 2I0FA 4A0RA 2ZETA 4UKDA 1ORRA 2OHGA 1K97A 4G0VA 3L8YA 4X3PA 4OHKA 4X00A 1NLMA 5IX8A 3E3LA 4KC0A 2ODPA 3RVNA 4FFMA 3H3XA 4O2LA 4TTAA 4TN1A 3UJPA 4CMBA 1E1CB 2OCPA 3TLZA 5CCDA 1SCKA 1XB2A 2OR3A 4IS2A 3VR5D 2PUHA 5SY9A 3JYQA 3H5NA 3DEFA 5FL7D 2POCA 2V6GA 1CJVC 3OQBA 4UW9A 1DQNA 4OTZA 4CN8A 2ODAA 4K26A 2XWQA 4I4CA 4GPBA 4E6EA 1JFVA 3EPPA 4UEWA 1QHEA 4RIHA 3UHFA 5CLGA 5IM5A 3BHNA 3HFRA 3UCXA 2MU1A 3SKVA 3GG9A 3OURA 4XUGB 5CW2A 2R7NA 6REQB 1I32A 4XGKA 3VH4A 4AQYB 3S2FA 5JC1A 2VK4A 4DV0B 2AF3C 3U5TA 3IUYA 3VH2A 1KMMA 3LP8A 5KHOC 2MJLA 1KDTA 1BQEA 3A6JA 2RE8A 3DOHA 2YXNA 1I7QB 3IUEA 3CPHA 3KXIA 2Q1SA 3S1LA 1ZK2A 1JMYA 2ZSEA 3DZ8A 1W35A 2FXIA 3HCAA 3RFUA 2Q4TA 3MGKA 3PEFA 3UBTA 1GPWB 1M8GA 2DGDA 1H65A 3GARA 2O3QA 2WDPA 4H2DA 2QENA 2B83A 3E4DA 2JJQA 3KRTA 4C4PA 5BVGA 1V8FA 4M7RA 2CWDA 4RJKA 1CK4A 3DZJA 3KYDA 3O3OB 2FMKA 1FP1D 3QY9A 4HYEA 4M7WA 4D9FA 1U28C 3U0BA 1RYNA 3QH4A 3DZCA 2CLMB 2R8ZA 1DXOA 2ZOSA 3QY0A 4B48A 5BSKA 5AVSA 4YRZA 1ECPA 2O2EA 1AKRA 3E3AA 1RJDA 2KHZA 3OMXA 4L5IA 4MV7A 5JNUA 1QG4A 1UMBB 2D1TA 1PT7A 3R5JA 3QPDA 2B0CA 4FONA 4JXKA 1JHXA 4R2XA 4D4HA 2P9YA 4EUHA 5DMXA 3ZHOA 4BN4A 3THSA 2QRVB 2VP3A 2JEZA 5ILOA 5KX5F 3IELA 3KDPA 2F00A 3X1XA 2E1PA 4PZUA 4V24A 4DCOA 2FR8A 1R6UA 3MINA 1V7ZA 1J99A 4CT5A 2WKRA 2P27A 4EY6A 1IY2A 5KYGA 2E48A 2OXTA 2RHBA 5ERYA 2IGBA 1ZGCA 2C3MA 3FWNA 1W52X 2OGZA 4KLRA 1E1RD 1TU0A 2XZTA 3AFIA 2E4ZA 1QQTA 1U3FA 2AHRA 1UC8A 3JYHA 3ZE0B 5LWHA 1Y1KE 2QRGA 4TT3D 2BZGA 3CU5A 1OIXA 3G2PA 3GXBA 5HJ2A 5CD9A 1E58A 1I6WA 4B9EA 1W46A 1LPAB 3JTMA 4H7IA 5I9MA 4HGNA 3SI7A