4UNNA

Mtb tmk in complex with compound 8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
184
Chain Sequence
VLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 71
structure length 184
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unnA00
3HU3A 2GK6A 2CK3D 1SXJB 1RRFA 3DL0A 4RD1A 1GFIA 3IBYA 4KV9A 5EUQB 2FPKA 4ITRC 1UEJA 5AJXA 3O8DA 4LJ8A 3OESA 3RS5A 1XMVA 3THYA 4BZPA 2PZFA 3ND9A 5JCZA 3MJHA 4LYFA 3EA5A 4Q02A 4R98A 3L82B 1OLOA 3WNBA 5JJIA 5DI3B 3B13B 4MYCA 121PA 4MGYR 2J0VA 4BZQA 2D2FA 4FI3C 4WZBE 1IN6A 4HLQB 3TRFA 4C7OB 2BBOA 3THWB 2ZREA 2GILA 4URZR 3FKQA 2X19A 3O8CA 3K70B 2ZRNA 5KDLA 4LI0A 5F9FA 4R2HA 4MITA 3W8RA 4BFZA 2NZJA 3AV0B 5M04A 1LVGA 4LK2A 4UNRA 3GLIB 4I4LA 3ZZ0A 4LY6A 2R44A 5BW8A 2ZEJA 2NGRA 2LCFA 2H17A 2WJVA 1S1MA 1II9A 3GLGB 4PQFA 5FTNA 5B57C 3QXSA 2JAQA 4EFMA 3VR4A 2QPTA 2VP5A 2VHJA 2AN9A 4B33A 1ZM9A 4TLAA 3AEZA 5DIFA 3F8TA 5FOTA 1UM8A 2CEAA 1G8YA 1RIFA 3DZ8A 4TWZA 1OPXA 1FQJA 1GOTA 3VR6A 2O8DA 5FTLA 1OFTA 4G3XA 2ODNA 5EE9A 3EAQA 2FEMA 3RS2A 1EFCA 4PZYA 1SKYB 3M4YA 3MD0A 1U8YA 5H1YA 1M1YE 3DMDA 1YE8A 3CX6A 4RD0A 3OAAD 3ECCA 4V0LA 3NVAA 1M6NA 1XTQA 3FMIA 4I1OA 3GJXC 4CIDA 1R4AA 1W2HA 4PR0A 1SXJE 4HAZA 3IQWA 2BBTA 3IBGA 2ZAOA 2ZRCA 3ICEA 1GITA 4EPVA 3W8NA 1QRAA 2A5YB 1H8HA 5JEEA 3AF1A 3OEED 2G0TA 3WBKA 4PHGA 2P65A 3CW2A 4AKEA 3CBQA 2ZSEA 1Q3TA 3RHFA 1Y63A 2UVQA 4NZYA 4TL6A 4PC6A 4C7OA 1D8TA 2OSBA 3IO5A 1N6RA 4PZLA 1JBKA 2NPIA 4B44A 4QHSA 1E32A 4JKIA 3NBXX 3SJBA 3GEEA 4HAXA 1NG9A 5CM9C 1VCOA 2VPPA 3JVUA 3GLFA 4B3GA 1TPZA 2BEKA 1UKYA 2QRNA 2HUPA 3OIYA 4TYPA 4X8LA 4XWOA 5FPKA 2OAP1 3WBJA 2YOFA 4MDEA 1KSFX 3BS4A 1LF0A 2GA8A 2OEPA 1VTKA 3F3YA 3FTQA 3GJ6A 4KO8A 2B6HA 4YMVA 1KI1A 4RVCA 4TLBA 1AJEA 4LHXA 5K8UA 2ZE8A 2XNSA 4GMXA 4KODA 3BH6A 2BKEA 4MRPA 3NC0C 4JLKA 4ZKDA 2BJVA 1UKEA 4YDSA 2ZRMA 1NL3A 1G17A 1X1SA 2IYYA 2ZVPX 2ONJA 1PUJA 1TF2A 2C95A 3KXIA 5L3SA 3H2YA 3W5IA 1GNRA 2WWYA 4BLTA 1ODFA 1P73A 4JLOA 2NO0A 1E99A 4GOKA 4MRRA 3KQNA 5H68A 1P9WA 4TYWA 1KI6B 1SVMA 1Q1ZA 2PBRA 1EWQA 2HT6A 1U9IA 1SKYE 5E4FA 1KKLA 3LAWA 3TSZA 5DH9A 5FBLB 4DXAA 1CF4A 2IYZA 4JT2A 2OFOA 3AF3A 3CNLA 4LJ6A 4OQLA 4DSOA 1KDTA 2OCBA 5EXTA 4Q4AB 2ATVA 4DLZA 3KJHA 2ORIA 3H86A 2RGBA 3T35A 1YZNA 3CIOA 3V9PA 2DWPA 2QY9A 3K9NA 1S3GA 1UJ2A 2FZLA 4U00A 3FKSD 3R8CA 3FMOB 4A2WA 3O8RA 1CIPA 2DFNA 4H1VA 4NONA 5GJVC 2IWHA 4BFYA 1NRJB 1KK2A 3L0PA 4WAUA 4EAQA 3VKWA 2BOVA 2ZRDA 2F1JA 2CDNA 3TH5A 4FCWA 4C0JA 221PA 5JWOA 2R65A 3HYTA 5EZ5A 2E87A 1US8A 1CLUA 5KO2A 4M1YA 1U99A 4V03A 4HYYA 1YHNA 5FBWB 3AP2A 2PEZA 1ZD8A 4W5WA 1HY3A 4IOLA 5F2EA 2YC2C 3KKNA 1E79D 2ZTSA 2I4IA 4GZLA 3I92A 3U7EB 4TMZA 3TW8B 2F3RA 2QMHA 1XTSA 3OFNA 3QKSA 2XEXA 2D7DA 2IT1A 3B1YA 2I1QA 1SVIA 2IYTA 3U3RA 1P61B 4D2IA 2WMOB 3C16C 3JZAA 1NP6A 2Z6VA 3P4XA 1R5NA 1Z6TA 1Q21A 3LFUA 3MUFA 1H8ED 5FR2A 4FWTA 1LS6A 1R7RA 1TMKA 1W7AA 1XDBA 2VA8A 3T5DA 2OAQ1 2WVJA 1O87A 4URWR 1IY1A 1OXTA 4ZCMA 2ZI7A 1PJRA 4D25A 5B58C 1XJ0A 5IT5A 1ESNA 5BWMA 1RYFA 2IL1A 2V6JA 2ZU0C 2JA1A 1KDPA 4O0MA 1WBDA 3KQUA 4DC9A 2VEDA 2EU8A 1DBSA 2JIZD 2YOHA 2HYIC 3ZD6A 1VIAA 4JVMA 1II0A 3QJYA 1A7JA 5CLQA 4AYWA 3NTUA 5IK2A 5FUYA 2W2TA 2CLSA 4HDOB 3CNOA 3FB4A 3NKVA 3QVUA 2JJ2A 1Z0DA 4C0HA 4O2RA 5JEDA 4OI1A 1AKYA 4OHYA 2GZHA 3A58B 3GJ5A 3QBVA 5HE8A 2O52A 3B1XA 5EUMA 1L2TA 3ZIAA 2RH5A 3QPWA 1DAFA 3L0OA 2QE7A 4TYYA 4A0FA 1TQDA 1Z6GA 2VP9A 4HLDA 3T06B 5F9HA 1JR3E 4H9GA 4M1KA 5FOUA 1K5GA 1IQPA 3BWDD 3C5CA 4N0DA 3W3ZB 4LJYA 3U2QA 1AS2A 3D8BA 1N5KA 3N70A 1R0ZA 1YRAA 4MRNA 3RRYA 1DAHA 1KI4A 3FGNA 5J40A 5KNBA 1N2CE 4FXPA 5A0FA 3H84A 5TMPA 4NL4H 3A36A 5LBIA 2GXUA 5FH9A 2HJVA 5DISB 2CCJA 4ZDJA 1JEEA 3SYNA 5JSZA 1IAQA 4LHVA 2R2AA 2CCGA 1DEKA 2WJJA 5JMTA 1XF9A 3PIRA 1TQ4A 4PSVA 5KHOC 4CEIB 3ADKA 3REGA 3A4NA 2GDJA 2MMGA 3AUYA 1K5DA 1N25A 1LFDB 2Q6TA 1L4YA 4LBWA 1DO0A 2ZRIA 2LKDA 2P67A 3A4LA 4D0LB 2Z5FA 3MCAA 3K0AA 3GLIA 1BYIA 5BQ5A 1OYYA 2WIAA 5E7IA 2V54A 5FUVA 2ZAMA 1G8GA 3HPQA 3QF4B 2P5TB 1RYHA 4P0TA 4YLGA 4LJ5A 3QXCA 1VMAA 1GKYA 4K8OA 2E9SA 4TQUS 5JFGA 4LX0A 4JLJA 4JLMA 1G291 3PG5A 1SULA 2OO7A 1KO8A 1NY5A 3DKVA 4C2UA 2HF8A 2V55B 3KL4A 4DCVA 2PZEA 3D31A 1TU4A 4HUQA 4U7DA 1YR8A 1QG2A 2V8OA 5JBQA 2ZUCA 1VIYA 1GNPA 1TNDA 1XD9A 2AXPA 2PEYA 1OXSC 1T8UA 4FN5A 1YZQA 4NKRA 3B78A 3BBPA 2ZPTX 4Q1FA 2BMEA 1W0JA 4JLPA 5CK4A 4DDTA 1GIAA 3T1OA 2PH1A 1ZIOA 2V7QD 4F4CA 1EX6A 1BO6A 4L9SA 4QL3A 4CYMA 4QM7A 4TL9A 3LW7A 1N0UA 1Z08A 4JL8A 1HH4A 5GJCA 1NJFA 4AC9A 2JLXA 1NVVQ 1XPOA 1KO5A 2FSGA 4JLBA 2FEOA 3KXLA 2V9PA 4XVQA 1DVRA 4W5HA 4OHVA 1JAHA 2QMOA 4EJSB 1HE8B 5GVSA 3B9PA 4KHZA 1VCMA 4B47A 1LW7A 2ZRFA 3BIFA 1PUIA 4LC0A 1GZSA 3NIBA 3L8YA 4Q48A 3LVQE 4Q00A 3SBDA 1VG1A 4C9BA 4V0KA 1F2UA 1XD2A 1ZD1A 1E9DA 3R8FA 1E9SA 1HUQA 3HU1A 2IS1A 2A2ZA 4JYBA 1MO3A 4A8JB 2OXRA 4JJZA 2GZAA 4L8GA 1D9ZA 2XZLA 3G5UA 4DEYA 3BXZA 3HPRA 3RS0A 3BGWA 4OI2A 4LRWA 1S9HA 3AVUA 1AQUA 1GG2A 5TARA 1XJCA 3N5CA 1GSIA 3QOFA 4PHHA 4M1WA 2HYDA 1QHYA 3K70C 5AJVB 1IM2A 1QHGA 1E6CA 1CP2A 3EPLA 1SKQA 1BMFD 4DLWA 3K0AB 1FPMA 1QHXA 4ASUD 3EW9A 5FBQB 1A4RA 3I32A 1MOZA 4JMPA 5KPDA 4V0ME 4TL7A 5IK2D 2RGNC 2D2EA 5AUQA 2J0SA 2ZS8A 2O0JA 4JYCA 3Q7QA 3ZJYA 2NZ8A 1X8KA 3WYGA 1Q1EA 1I2DA 3CRW1 2XJ9A 4QC2A 3R9IA 3SC3A 3TNFA 1KDRA 2XAUA 3BERA 4MUAA 4QGGA 1P72A 1ZCBA 2GEDA 2QTFA 3CF6R 1KYIA 1E2EA 2YC4C 4P31A 2JDID 4A9AA 1P2UA 1OXXK 1JEDA 1SQ5A 2RHDA 4MYUA 4DUGD 2QGNA 3I62A 4CEJB 4MKFA 1NKSA 2HXSA 4X8HA 4G5SA 2B7BA 1GKIA 3WXMA 1KZGB 3B1VA 4F4IA 4ASUA 1QBKC 3L43A 1EFRA 5C18A 3EPHA 3KQKA 2QENA 3C8UA 2ZR7A 3REFA 2JIZA 1WCV1 2A5GA 5BN5A 2Z4SA 3ASYA 3R20A 1SVKA 2QT1A 2REXB 4TN1A 4EFLA 3WYAA 5CM8B 2OFWA 1MRSA 1QVRA 5FTMA 5E7MA 5JHHB 2CHVA 2Y8EA 4CEHA 5KSYA 3KX2A 3LRPA 2CCKA 2OUKA 4DLUA 4DT1A 3CPHA 3TW4A 4QBHA 2NG1A 1M7GA 3GJ7A 5DO9A 4IVRA 2EW1A 3D6TB 1IN4A 2W0SA 1TX4B 3RLFA 1GL6A 3RNLA 1G3MA 1QHHA 2RAPA 2DFLA 3FFBA 3OEHA 1A1VA 4O3MA 2ZJOA 4MYHA 1D9XA 1JPNA 2NO9A 5L3QB 1G6OA 5G3ZA 4ZCIA 1P2VA 1W5SA 3MWLA 3LDAA 1TF5A 4IDOA 5FPHA 3EWSA 3IIMA 4QGHA 2RB4A 3D7MA 1G5TA 3PUWA 1D6JA 4BASA 1U8AA 2WWHA 1E9EA 3ZYCA 5LB2A 3LQQA 3FDIA 2O8FB 1OKKD 1OB2A 1XEXA 3GPLA 2CE7A 3C7KA 2G0NA 1UKZA 1AIPA 1HQCA 3EG5A 1RJ9A 2AXNA 4HLUA 3VNUA 4KFRA 1W0JD 5CDFA 2XOKD 5DYGA 2V3CC 3RS3A 2WWIA 3PQCA 5DHFA 3ZH9B 4A1FA 1IXZA 4N3NA 2KWIA 1XEWY 2GJKA 3DZDA 4AD8A 1G7RA 3RSLA 2ZYTX 1FTSA 1SZPA 2FZ4A 2H16A 3CH5A 2WSSA 3DOEA 4FINA 4HLCA 4Y0AA 3QKSB 3SYLA 2C8VA 1P2TA 3EZ2A 3NBFA 4G01B 3OZXA 5E3HA 4LV6A 2GNOA 3GFOA 4DDWA 2IYWA 1E9AA 1E4VA 2A5JA 2ZUDA 4M21A 5J4VA 3U44A 1DAMA 3GFPA 3M0EA 2FWRA 5SZJA 1GUAA 3FWYA 1ZP6A 1UBFA 4PHTA 1N5LA 3LA6A 1QG4A 2GCNA 4BFXA 5IDVA 5L3RA 1Z6YA 4DT1B 4DVGA 2PX3A 2VQSA 1TADA 4PO1A 3UMFA 1EWRA 4B76A 5CB8A 4BLOA 3K9HA 1NSTA 4PSKA 4RD3A 1ESMA 2YZ2A 2DR3A 1ZBDA 3UWKA 4BLRA 1CXZA 1P9NA 4TLCA 3TLXA 2QTHA 2Z4RA 4DSUA 2FF7A 4HEJA 2NO6A 1KHTA 1G3RA 5FTKA 3BB1A 1NIJA 2QORA 2CXXA 1DARA 2R9VA 4HDCA 5HZKA 3QKRA 4D6PA 5KDOA 2IXFA 3B5JA 4UNPA 3TJZA 5K8TA 1NN1A 3Q7PA 4Z1MA 4FCTA 3R9XA 2YHSA 3T5GA 5EXXA 4B6FA 5CLLA 1G3UA 2PT7A 1KNQA 4D80A 1F2UB 1XD2B 2J46A 3FYHA 5HE9A 1G5PA 2O8BA 4URYR 1F3OA 4OYHA 4M1SA 4EPXA 3AM1A 4YXWA 1FX0B 1VG0B 5L3VA 2IYLD 3I61A 1Z28A 2OV2A 4OHWA 5C2JB 3SQWA 4F92B 5C4MA 2C9OA 1T4GA 4W5JA 4M1MA 2WZQA 2WV9A 1J2JA 4KITB 4Q7KA 4LGMA 2QMEA 1G41A 1CJTC 2XTMA 4D4MA 4DIEA 4G5GA 1P7CA 1Z8FA 1OJLA 1I2MA 2HCJB 1W49A 1HA3A 2P5SA 2Q3HA 1HEIA 2KBFA 1W36B 4PX9A 4A0GA 4LPKA 1E96A 1UFQA 5AJYA 1TTTA 1N0VC 4WA7A 5FBRB 1S96A 1E2IA 2JCSA 4HUTA 1EGAA 2GJSA 3CRMA 4DCNA 1H65A 5EP3A 2VP2A 4URXR 3DO6A 1A82A 4JIMA 2D62A 1ZINA 1R0YA 2C2HA 2VL7A 1YJ5A 2XTNA 1EESA 1G20E 2WWWA 4CZ2A 4XVUA 3RDPA 1WXQA 1NKTA 3QKUA 1MRNA 2IEYA 1DE0A 4MDFA 1ZC4A 1WF3A 2MMCA 1L4UA 2VLIA 1XP8A 2FSFA 3QI2A 4IJMA 1P60A 4EIWA 3K0SA 4FMDB 1NIPA 4NYJR 5CIWA 1CBUA 3LQRA 4E22A 1E2MA 1M2OB 1Q0UA 2AK3A 4JSTA 3CUEF 4MRSA 3R7WB 4LJ7A 5JS8A 4Q7LA 1Q12A 2EQBA 2ZI9A 3AGPA 4KCGA 3TQFA 2BBWA 4LBYA 2FMXA 4AK9A 4KFSA 3F5FA 1TQ2A 5EP1A 1V5WA 2XZOA 3I8XA 1N6LA 4HDQB 4DZZA 1XXHA 4IW3B 3THXB 3AVWA 4IOKA 4S35A 1GWNA 2Z43A 1KI3A 1LNZA 2C9YA 2ZS9A 4LSGA 3AVOA 2H18A 2QPAA 2OFXA 3GJ0A 2WIBA 1OXUA 4OQNA 4TSFA 4GP6A 4XSGA 5JSZB 5JRZA 4B2LA 2GEUA 3X1YA 3ADDA 2BM1A 3GCGA 4D26A 2GRJA 2G77B 4RKFA 1XEWX 4GDFA 3LVRE 2GJ8A 5EJEA 5TXGA 4PHFA 5FUXA 3B7GA 2VSFA 4NBSA 3IGFA 1C1YA 4QXAA 4UQOA 2ZJ2A 4Q1DA 3ADCA 2WPDD 2XSZD 3PV0A 5TV2A 3C41J 2D3WA 5CIQA 2ZSDA 2O8EA 1G6HA 1U2RA 2GJAA 3VTKA 3SFVA 4QHTA 2JLVA 4DLVA 1OE0A 2EFCB 1QHSA 1KY3A 4AYTA 1AN0A 1D2EA 2FNAA 2JLWA 1R8QA 3W6PA 1X8LA 1YU9A 1F2TA 1YR9A 4JVSB 1J90A 2P6NA 3I5YA 1OH8A 4KI0A 2J0QA 3FKSA 4Q4JA 5EP2A 5GJWC 4XJXA 2Z83A 3GQBA 1N6KA 5FFMA 2QA5A 1Z3IX 5K8IA 4DHEA 1NBMA 2ZRKA 1OIXA 3DHWC 3SHFA 5HPYB 1W5TA 3W90A 1DOAA 2VHQA 1EX7A 2R6GA 4GSYA 4DSNA 3V4RA 4QNMA 4WW0A 5LB4A 1U9IC 3FHOA 3LLUA 1NSFA 3IHLA 2PJZA 1CJMA 2JJ2D 1G21E 4FCVA 3AF4A 1WE2A 5KOYA 3AVPA 1XU4A 4PTLA 2IK8A 4M1TA 5LD2B 3U4QB 3UWOA 4JZKA 4CEHB 3NG1A 1DG1G 5EP4A 1SVLA 2REBA 3U6BA 1CKEA 2PJRA 2QGZA 5D3MA 1CU1A 2GJ9A 2OBMA 4TLEA 3L2OB 1PZNA 4OK5A 1E4YA 3QNUA 3K0FA 1KO1A 1AS3A 5FTJA 2CBZA 2IS4A 2VSXA 3MLEA 3QG5A 5J4HA 3W3AA 3EA0A 2VF8A 3NWJA 1OFHA 3V4FA 1G7TA 2ECKA 2BCJQ 3BRWD 3G0HA 2A5FA 2MSDB 5GADl 5JRJA 3PITA 2WBLC 2P0EA 4TMVA 1XEFA 4ILEA 1UEIA 1KZ7B 2ZE6A 3K70D 1U81A 2Q9CA 2WM9B 1XCGB 3OEHD 4IHQA 1BIFA 2NTYC 1WDTA 4GT1A 5EXPA 1KKMA 4KXFB 1WP9A 1AM4D 3BK7A 3EIHA 2WOJA 1U0HC 3A1VA 3UIEA 5DI3A 1US8B 4DCUA 2O8CB 4OL0A 2GCPA 2QRZA 3LBNA 3SI7A 3ZVMA 4RKEA 1XXHE 2RHMA 4Q9IA 1T91A 1GVNB 2ZJ5A 5IRCD 4Q1BA 1XCPA 2ZI3A 3RANA 2OILA 4A0RA 3I73A 3OHMA 4LJ9A 4E5UA 1J8YF 4V02A 2XZPA 2FSHA 2GXSA 2IS2A 3B9QA 1R5BA 4X8MA 3FPAA 3KXKA 3KKPA 3WMGA 3ZLJA 4L4UA 2YYZA 4OQFA 2W58A 4NDZA 2XB2A 2GCOB 1KIMA 4HAYA 1II8A 1KO4A 3X1XA 4NYJQ 5CJPA 3CF2A 2O8FA 1G9XA 2PMDA 2BMJA 4IVQA 1E9CA 1ZD9A 2H5EA 4DDUA 3A4MA 1AGRA 2G3YA 2IWRA 3MSXA 2F43A 2DBYA 3CPEA 2C9CA 2ERYA 3AF2A 4D82A 3PEYA 1JI0A 4Q9JA 2IYVA 4LYJA 3U7FB 1NN5A 1E2QA 4B3XA 4YMSA 2QUZA 3Q5EA 1MR3F 3KB2A 4C4PA 2WPDA 2Q0HA 2XSZA 4MRVA 1E2PA 2J0UA 2J7KA 4Q4AA 1E0SA 3LLMA 1GRRA 4AYXA 2D06A 2KJQA 1S2MA 3GFTA 2B8TA 4TMKA 1DAEA 3D3QA 1AK2A 3CNNA 3RWOA 2L0XA 1SVSA 2W6JD 3Q9LA 4R2IA 3VFDA 4DB4A 3LBHA 4B3FX 2IYRA 1W47A 3A1TA 4OI4A 3BH0A 5JHGB 4QG7A 2JJ1A 1VDZA 3KQHA 4IXMA 4KSCA 2EFEB 5CB6A 2QEQA 5KNDA 1DTSA 2XB4A 3TGPA 4PFSA 2V6IA 1NF3A 4TT3A 2JLRA 4BFWA 4RZ2A 3U7HB 2WOOA 1OH6A 4NYMR 2Q3FA 4CVNA 1N6IA 4DDVA 2FU5C 2FFAA 3A1UA 4E03A 1KK1A 2ZRBA 2JEOA 3EASA 4FMBB 2FJUA 1NN3A 4AG5A 4BFSA 4ZI3A 3ZQ6A 1YZTA 2IYUA 1XZPA 3PCRB 2BVNA 3SEAA 5JS7A 3PVSA 5FOVA 3KJGA 1T8TA 3QKTA 1EFTA 3ONWA 4IEEA 1DAGA 3T1TA 4EDHA 5AK0A 4DLSA 1G16A 4HAUA 4C0QC 1W1WA 2C77A 4UJ3A 4WXPA 4NU0A 4UXJA 3SDZA 1E0KA 3CWZA 4WXRA 3GLFB 5AJZA 2HCBA 3AB3A 3PUYA 2QSZA 1M8PA 3RS7A 3X1WA 2GXQA 3BFXA 5J4KA 4Q47A 2WICA 5DSZA 4JJKA 4B35A 4Q1AA 4QJ3A 1KSHA 4V0MA 1G19A 1RRPA 3K53A 3LY5A 4TMWA 2VHTA 3RC3A 3U3KA 4CGZA 5DN6A 4DLRA 4BGDA 2HEIA 3RS4A 8OHMA 1J8MF 1QHNA 721PA 4IFBA 1U8ZA 3JZMA 4N1AA 2ZR9A 4ZV4A 2BKUA 2F55A 1R0XA 2CVHA 2D7CA 3U7GA 4X8OA 4EPRA 4LHZA 3C14C 3PENA 3CR8A 1VHTA 1QDEA 1JALA 4Y0VA 4BLSA 4TYNA 3BB3A 2ZS7A 4NE2A 4D0NA 4R71A 1UBGA 1KJWA 1OHHD 1D2NA 4B3DA 3SBEA 3IILA 4DEXA 2BJWA 1X8JA 4A82A 2IX3A 3TAUA 4QOSA 2GTPA 2VTKA 4NCJA 4BEJA 3KUDA 2B7CA 1R10A 2QAGA 3A1WA 1JECA 3SQXA 4L5BA 3CM0A 3H1TA 4MUBA 1KMQA 4YQFA 4TYQA 3MJRA 3BJIC 3QPVA 5FUWA 1XJQA 1DG3A 1BS1A 1L8QA 2ZSFA 4II7A 1W4BA 5C46F 2O8EB 4JLAA 2BMDA 1E9BA 2W0MA 3RC8A 1GL7A 1P9RA 1GNQA 1JR3D 1IN7A 1XMSA 4M9QA 1KK0A 2P2LA 4Q5IA 4GP7A 2YWHA 1H8EA 1P75A 3K09C 2XTZA 3QF4A 1OSNA 1RE0A 2A30A 2W6IA 3AKEA 4AG6A 3GLFE 3FHTA 2AD1A 1B23P 1FMLA 2IEZA 1JAIA 1E2LA 3ETLA 3IHWA 3QG1A 1G1MA 1GTVA 1G18A 2BCGY 2X77A 4LC1A 3NEYA 3MGCA 4XD7A 1P2SA 4HLUC 2WJYA 1TQ6A 1ZU4A 4KSBA 4US1R 2FA9A 5ELXA 2FGKA 1G64A 5AUPB 4DLTA 3K0CC 3U3OA 4OKSA 3QEOA 4UJ5A 4UXIA 3LW8A 3VR3A 4IOMA 3KKQA 3Q3JB 2ZJBA 4DLYA 2VHUA 3X1DA 3IIKA 5KSOA 2N1BA 1JR3A 2JJ8A 2JLYA 2KSQA 1VCNA 3DDCA 4ESHA 4ON9A 4QM6A 3FE2A 5K8LA 1W36D 1FMJA 1TF7A 2JATA 1UDWA 3AP1A 4LHYA 3ZGXA 5D3MB 5JWRA 4NP6A 2QT0A 5CYPA 3NBZC 4URVR 4FMCF 4AKGA 4KJZA 5E7JA 1RC8A 2HF9A 2W2VA 2YJTD 1ZUIA 4URUR 4IEIA 4POAA 3TSWA 4DCTA 3QXXA 2FN4A 1WB9A 5IF9A 3CZPA 5G40A 2EFHB 2A5DA 3B6EA 1Q57A 2ZRJA 4D81A 2QQ0A 1Q44A 4EQ6B 2JLUA 5AUNB 2JLSA 3CWQA 1HT1E 2H57A 3P1JA 2N42A 4KVAA 2QBYA 2WSSD 1K8RA 3BH7A 2AL7A 3X2SA 1YZUA 2CJWB 1E94E 3NXSA 5FI0B 4PAOA 3TR0A 3ADBA 3A6PC 4M53A 1HE1C 5HR5A 3RRZA 1J70A 1T0HB 4KU4A 3TUJC 3VNVA 2J5XA 4XOIA 1W4CA 4KBFA 2WKRA 1R8SA 2XXAA 4MA4A 3QVVA 4HZIA 3HR8A 4RY2A 3ZD7A 3EWAA 4RCYA 1NVVR 4TQAA 2NPFA 3ZVRA 2JDIA 2HT1A 3NHBA 3CKLA 5A4JA 2WJHA 1XPUA 1XTJA 4KFTA 1WBBA 1R0WA 4KYUA 3RABA 5KTYA 4XIGS 3KTAA 4QJ5A 3WRYC 1IY0A 1ZM2A 4QJ4A 1Y3AA 3ZVNA 1NVXQ 4AIIA 4BFUA 4B74A 3SR0A 4HUQB 2IHYA 1XPRA 3SS8A 3QBTA 3I5XA 3UG6A 4W7SA 3HDTA 5FL7A 3W9YA 2ANCA 4PAQA 2W83A 3A8TA 1TUEA 1MABB 2ZE7A 2YNMA 5EQTA 4A36A 3VR5A 2QNRA 1UDXA 2RKOA 1U98A 2P3SA 3AVTA 3O8BA 1NBME 1CJKC 1QZXA 3K9GA 2X8AA 2EYQA 1TU3A 4PSAA 2F43B 5GJBA 1BKDR 1OF1A 621PA 5J47A 3NBYC 4Q1EA 4OJQA 4DLXA 1EG7A 1JPJA 2OZEA 3TK1A 4HZUB 2YINC 1I4DD 1LTQA 3C15C 4KYIB 2ZANA 4HATA 1N5JA 4ZO4A 3MWKA 2CJWA 1VYVA 3BFVA 1WMSA 2F1RA 2YV5A 3LV8A 2NQ2C 2ZRPA 1GRQA 5A5GA 3GLHA 3TVTA 2NO1A 4B75A 3T12A 1S9DA 1XD8A 3N2IA 1MO5A 5HCNA 2C96A 3V00A 4B6EA 1Z0JA 3RSOA 1J99A 1YKSA 2EVWX 1G3IA 2WWGA 4JLVA 2XXAB 3ASZA 1EK0A 2PMKA 2PX0A 5LDDC 4NCIA 1P4SA 3EC1A 4L9WA 2VSOA 2F7SA 2OHFA 3AKCA 4WIAA 2ZSBA 5FPYA 3ZS9A 2IS6A 1A5TA 2IXGA 1NLZA 4FIDA 4TTPA 4TTQA 5BYKA 3CONA 4I1VA 2F6RA 4LCBA 2YWGA 4BPBA 4V0OA 1Q1BA 4MGIR 3QE0A 4A8JA 3KDSE 1IN8A 4BQSA 1SXJA 4EPTA 4OHXA 3LXXA 421PA 4F91B 4AI6A 3FHCB 2YKGA 1XBTA 4IDNA 2HXYA 1G8PA 3VU9A 1N6HA 3N2EA 3AKDA 5DNYB 5HCIA 4BFVA 1Q1QA 1T3HA 5E95A 3VHLB 5EE3A 2OG2A 3GLGA 3K09A 4ZKEA 2ZI5A 3EX7C 2JLQA 4AY2A 4FMCB 1N6OA 1ZNYA 2ODBA 4HB3A 4OK3A 4QBGB 2CMKA 4B48A 1HYQA 4O25A 1YZKA 4M0LA 4RFVA 3GJ3A 2W6ID 4MYTA 4G0NA 4NH0A 4TT3D 3EPJA 3THWA 3EZ7A 1CRQA 2ONKA 2ZE5A 3QQ5A 3S1AA 4EPWA 3PEWA 3SYKA 1VCIA 3HU2A 4HB4A 2PZGA 2JJ1D 2PCJA 2FFQA 2EWVA 2K5UA 4GZMA 1XZQA 4JBYA 2BBSA 1E9RA 4ARZB 4ACAA 1GL9B 1G5RA 2OBNA 2RCNA 3EZ9A 3OIWA 1JJVA 4LOAA 5KPJA 4LUCA 3CX8A 5TB5A 2VIIA 3C5HA 3CH4B 1C4OA 2R6AA 4A6XA 4RSGA 1OB5A 1E2NA 1E1RA 2ZRLA 2ZITA 1OFUX 4PQRA 4NCKA 3DVLA 2Q9AA 1ZYUA 4PC3A 5UKDA 1JR6A 4RZUA 5JWHA 4EJSC 1UPTA 4BEBA 4IVPA 3T61A 3VX4A 4OK6A 1JJ7A 1QHIA 3UG7A 3SFZA 4ACBA 3U4QA 3R7WA 4CF7A 4PANA 1M34E 1T5IA 1LY1A 1KGDA 3NDPA 4G5OA 3K0EA 2CVFA 1NBMD 2Q21A 3IEVA 4BFTA 1GAJA 1COWD 1FL9A 2BHRA 3EXAA 3B8HA 3CZQA 1P62B 3L8ZA 5DE3A 5CYOA 3AF0A 1KMHB 2GETA 4OI0A 3AUXA 2AKYA 4YMWA 3E2IA 2RGAA 2FFBA 1DELA 1OFIA 2Q3MA 2WHXA 2RGGA 1FX0A 2UKDA 4QRHA 2G88A 2AWNA 1XTIA 4GL2A 2CHQA 3E70C 1BH2A 1ZU5A 1G8HA 4PAMA 4LYHA 1E1QA 4D4LA 3WRXC 2OE2A 3CO5A 3BORA 4I1SA 2QAGB 3RVBA 3IPXA 4DKXA 4PPFA 3CRVA 3TUZC 2NOAA 4TTRA 2X1VA 3NHAA 4E07A 1Z0FA 4C0LA 3LH5A 5JJLA 1UKVY 4O2LA 5IHPA 4Q9KA 3ZIAD 2DB3A 1E9FA 2ZJAA 5B64A 1BMFA 2DWOA 5KSPA 5F3WB 2XITA 4CEJA 5KSZA 3LNCA 4XD7D 1E2HA 5F98A 2EFGA 2HV8A 3C4JA 3TAHA 4ABYA 1KI8A 4IFEA 1CR2A 5SZKB 2VP4A 1G8FA 4V0NA 1KI9A 1N3BA 1XEXB 4G5QA 1WQ1R 1Z47A 3Q85A 4LJ4A 3VQTA 1ZNXA 2FX3A 3WNCA 1SXJC 3THOA 1ZW6A 4Q18A 3PUXA 4ZPXA 3RRNA 1X3SA 1LB1B 1ZM3A 4AKIA 2IA5A 1CR0A 3CF0A 4JS0A 4EUNA 2FE4A 1LS1A 2C04A 5TY0A 1E2FA 1CJVC 1KO7A 1SVWA 5JI2E 5FOXA 1CTQA 3GD7A 2PL3A 1JQLB 1CEEA 2A3RA 2BIFA 6Q21A 2FDCA 3CR7A 1ZNZA 1IXSB 2LWIA 4WZAE 1W0KD 1ONBA 4IDPA 4KVGA 1EFRD 2XNDA 3WYFA 5AWFC 3CLVA 1FNNA 1A2KC 1J7KA 1KMHA 1XWIA 3B2EA 4JVLA 1YZLA 4EQ6A 1UF9A 1KTVA 1Q3HA 4JBWA 4CRWB 4GOXA 3AVYA 3VKGA 1KAGA 2GHIA 1W2GA 2R62A 3M6AA 1UBEA 1Z0IA 2J9RA 3PFIA 4GNKA 3M1IA 4NYIR 2IUSA 2YVUA 3CRQA 2CNWD 1KAOA 4AWXA 1X86B 3QENA 1FUKA 1ZMXA 4PC2A 5J4LA 1KSGA 1FOEB 5EE0A 1QVAA 1RPZA 3T34A 4B3CA 1E2DA 1XMJA 1HT2E 2DYKA 3MWYW 1CS4C 4CT4B 1FW6A 3WNDA 3GLHB 2QZ4A 3FOZA 1P6XA 4D4JA 2WKPA 2H7VA 2AHOA 2CNWA 4C0AC 4L16A 5HKKD 2ZETA 4MGZR 2QP9X 1Q20A 2A7QA 4ZDKA 1DAKA 1FZQA 4XVRA 4OBEA 3Q72A 4CEIA 1G7CA 2PLRA 4LYAA 4ZDIA 1W4RA 2HLDD 1ELOA 1ZC3A 2WTUA 3NDBB 1IXRC 2JGNA 4KLNA 3W6NA 2AD5A 2F3TA 1F2TB 1C9KA 4E09A 2RGDA 3BOSA 4XSHA 3MG9A 1ZM7A 3FFAA 2ZRAA 1CJUC 2CLDX 3IEUA 2QPOA 3IDQA 1Z0KA 4JT4A 4NYIQ 3TQCA 1CR1A 1XCMA 3B60A 3EIQA 5FOWA 3LX8A 2WMNB 5AJWA 1OW3B 3KJIA 3HYRA 1IOZA 4BZXA 4RD6A 3TR5A 3ZS8A 4LV5B 1QF9A 2MSCB 2NIPA 1ZIPA 3QSYA 3OF5A 1R6BX 2WAXA 2ZIAA 1KDOA 2P6RA 5FL7D 2QP4A 2FPLA 2IW3A 3H4MA 2HLDA 3L0SA 3GJ8A 3KTAB 1Z6AA 2E1RA 4LV8B 4M9SA 2OCPA 3TSOA 1GDDA 1NG1A 3FMFA 4GOJA 3I8SA 3UANA 4A2QA 1TEVA 2WJIA 1COWA 1JB1A 3AH8A 3OFND 4K81B 4P3YA 4D4KA 5BXQC 3UPUA 5G53C 2ZUBA 4XWKA 1GP2A 5JZVA 2ORVA 4XTRA 1HQYE 1DS6A 2R6CA 2N46A 3EZ6A 1Z5ZA 3JVVA 1XTRA 1MKYA 3CRRA 5FPTA 4A92A 1GM5A 1XXHB 3THXA 2ZRHA 2ZROA 3ZZTA 4UNQA 3DPUA 1FUUA 4M22A 3SU8A 1T9HA 5CITA 4GBMA 4C0KA 1UBCA 3GLHE 1ZCAA 4DRZA 4NPHA 4C0BA 2ZJYA 2PLFA 3VKHA 3TVDA 2G6BA 1RRGA 1VG8A 2CK3A 1T5LA 2IYSA 1FNMA 2OCYC 1RZ3A 1S3SA 2RGCA 5DHAA 1VYUA 2DFTA 2GBLC 4HB0A 2WJGA 3LD9A 3W5JA 2BWJA 4YDHB 4TZ0A 3SN6A 4Z1MD 4I1UA 4WZ6A 1E69A 5L3QA 3SOPA 4LDJA 4MQBA 4RD2A 4A6PA 2BV3A 1RJ9B 1T0JB 3O47A 1GRNA 3FVQA 4WBSA 3S1AB 1Z0AA 1KI2A 1W44A 4PXAA 3VX3A 2V4ZA 3MMPA 2FPMA 3SJZA 1L7VC 3AVXA 1TEXA 3OIVA 5L3SB 2BMFA 3UKDA 2B8WA 2A9KA 3AKYA 2IUTA 3OAAA 3ZDQA 5EXSA 4A2PA 3AVVA 4P4TA 5SZIA 1MO4A 4Q4JB 1R2QA 3UXMA 2XNDD 3I4LA 2F9MA 1OV4A 1S0UA 3P27A 4M9XA 4Q7JB 1TAGA 3SJAA 1E2KA 1KJYA 2DCUA 5CK5A 3DOFA 4Q1CA 1LV7A 4LHWA 4Q01A 2B21A 4BWYA 4ZI2A 2C78A 4EPYA 2YWEA 3A37A 1AKEA 2FG5A 3GEIA 4DSTA 2W00A 3DMNA 4CDGA 3B82A 1Z22A 3WY9A 2GXAA 1WRBA 1FTNA 2REOA 1PVOA 1XX6A 3DM9B 3PEUA 2GF0A 4GPTA 1KNXA 3I1FA 1VHLA 4QFMA 2TMKA 2EYUA 4QHYA 2FV8A 5H8WA 4C2TA 1PLJA 1Z83A 4R9UC 3PJRA 1N5IA 3UK6A 1NY6A 4DB2A 4Q03A 4L15A 4MKHA 3ZZUA 4YXWD 3FMPB 3PR1A 3QEJA 4PPQA 3QXHA 2UZ3A 4MKIA 3NH9A 2KE5A 2XJ4A 1NN0A 2ZYUX 1IJFA 2OCAA 1OH5A 3KFVA 4Q4LA 2GK7A 2O0KA 1HTWA 4B2IA 4Q21A 5J5CA 5JLJA 3OEEA 4QKQA 2I1VB 1MV5A 5G41A 5TVKA 1DPFA 2H8KA 2KBEA 4P33A 4QNRA 1IY2A 2QM7A 2IXEA 3SJCA 1E0JA 4RZXA 1W46A 4TMTA 5AUOB 4B43A 3AGQA 5J4YA 1NMYA 1E1RD 1HURA 4N0EA 3I3SR 4DIDA 2Z0MA 2LKCA 3U61B 4IDHA 2WKQA 2FGJA 1ZAKA 4JVNA 4BUJA 3W6OA 3IQXA 2QAJA 2CL0X 3E5HA 3X1ZA 1OXVA 4ZCLA 2C03A 2ZR0A 4F4JA 1MH1A 1NMZA 2J1LA 4MKGA 3QPUA 1E2GA 1U94A 2C99A 4IRUB 2ODEA 1G3QA 1KJZA 1KOFA 1NI3A 4DCSA 2RMKA 4QBIA 5H70A 2GWHA 4US0R 3AQ4A 4Z51A 3MWJA 5C1BA 4RCZA 4RFSA 5HZHA 5FOSA 2YOGA 4TLDA 1NLFA 4UKDA 3QIAA 1W4AA 1DO2A 3LWNA 4P32A 4ARZA 1MT0A 5L8VA 4PPGA 1ZUHA 4LPSA 4TZ6A 4NCHA 4ERNA 1IBRA 2QU8A 4NTZA 3ND8A 3IO3A 5BN4A 1OT3A 3T1VA 2J59A 2OM2A 2VP0A 1S1CA 4U5XA 1P3JA 3UMSA 1EXMA 3TUIC 2CL6X 5TDHA 5JI3E 4B71A 821PA 2J45A 2V7QA 5FR1A 5JJKA 1W36C 2GVZC 2ZM5A 4BLPA 4OHZA 1FFHA 1ZUNB 1GILA 1KI7A 4NMMA 1SVOA 1VG9B 1E1QD 1XFAA 2ASEA 2VHCA 2WSMA 4GRAA 4Q9LA 3TIFA 2CHGA 2ANBA 1T3LA 3DM5A 2IBMA 4EJSA 5DN6D 3PEVA 4PZZA 2MSEB 4A15A 5P21A 1A2BA 4DBLC 1Z06A 4J0QA 2ZQ5A 4QGFA 1IN5A 3OE7D 4Q4HB 3HJNA 1M74A 3MAAC 4OQMA 1QHHB 1XNJA 4HI0E 2H92A 2RGXA 1JQJC 3U3JA 2J7PD 1SHZA 3MRSA 3IPYA 2HJGA 3NEJA 2SHKA 3CX7A 2AX4A 4JKYA 4C30A 4KBGA 1I4LD 4F38A 2VF7A 3VHXA 3LO5A 4UNNA 4C0SA 4ZDWA 4QBFA 4R7ZA 4PO8A 3THYB 4I99A 3U3MA 3VR2A 2CL7X 2UZIR 3PUVA 1PLLA 5EE5B 1LF5A 3NC1C 4PPNA 4YONB 3B1WA 1S8FA 1Z2CA 2J41A 2C5LA 1G7SA 1K6MA 1SGWA 2GBLA 4TSFD 4BE7B 3VMFA 1YVDA 1Z6XA 1W48A 3SNHA 3P32A 1NVWQ 2GCOA 1F48A 1ZRHA 2Q9BA 2W2XA 5KNCA 1E3MA 4C3ZA 2V1UA 4RZ3A 2ZXUA 3EC2A 2FSIA 3U44B 4JL5A 4GFDA 3VU9B 4TQ9A 3PUZA 1Z29A 1F5NA 4DWJA 5EZ6B 2YWFA 4JSYA 5C4GB 4GMDA 2O0HA 3HWSA 2A78A 2ERXA 2ZJZA 5GVRA 1RFLA 5FPSA 1M7HA 3F0TA 4LBZA 2CLCX 1ANKA 2BDTA 1E2JA 2JASA 3KKOA 4HAWA 1XTKA 2DY1A 2G83A 4EFNA 1OYWA 3WHKA 2QM8A 4Z54A 1EFHA 3K9LA 3EZFA 3WHLA 4P4SB 3U6KA 5B30A 2ZI4A 1ZNWA 3SHWA 2ORWA 4G5RA 2VH5R 4BECA 1AA9A 4OQXA 3GP8A 1Z2AA 1BYUA 2R6DA 3P26A 4M8NE 4Z8YA 2ZSAA 1MO6A 4LBVA 4BRUA 2R6FA 4YC7A 3QUSA 2RGNA 5EE1A 3VAAA 2AR7A 3Q8XB 4U02A 3ICQB 2QSYA 5DGXA 4CW7A 3IUYA 2EWWA 3TBKA 5B2ZA 3KJEA 1I4TD 4DJTA 2GEVA 1AZSC 1S4QA 1N6NA 4Q4HA 4NHOA 1OKKA 2OESA 3KB1A 1E0AA 1TL7C 2IC5A 5D3QA 3EIEA 4Q66C 1YZGA 2DHRA 4XH9B 2O8DB 2DFKB 2ZI6A 4MGKR 2FFHA 3HP1A 4KAXA 3EPKA 4IKEA 2ZJ8A 1AGPA 2IF2A 3EARA 3G82C 3K0FB 4RJLA 4B3BA 4EKDA 1NLYA 3CB4A 1N0WA 4M2LA 2IUUA 2AFHE 4FD2A 3GMTA 2IHBA 1GKUB 1U0JA 4US2R 2HDNB 4LJAA 5CJ2A 2DPXA 4I81A 4JBXA 4UXHA 2AWOA 4F7WA 1YQTA 1NMXA 2ZYWX 4JL6A 4G1UC 5FBVB 2O8CA 2W6JA 3WP1B 1RW4A 5KUTA 1NNEA 1VECA 1ZVQA 2KI5A 4MH0R 1XRJA 2NMVA 2G9NA 2J3EA 3B1ZA 3TKLA 2ZRGA 4PQYA 3MFYA 4S2EA 1E98A 3SZRA 4IOJA 2IF0A 3I72A 2J87A 1XB2A 4JLNA 1UAAA 2BM0A 5KDDA 1RKBA 2GAOA 3L0IB 3WMFA 1BOFA 3P20A 2BC9A 1AQYA 3Q5DA 4CT5A 4ZIRB 3GJ4A 1CR4A 2BEJA 5LPNA 1G4AE 1KY2A 2XOKA 4M4SA 3LX5A 2FH5B 1VKJA 1B0UA 2F1HA 1NJGA 2QTVB 4KFUA 4FW9A 2IYXA 2VYFA 3QF7A 2WAYA 4LWZA 3UATA 5DYIA 1OIWA 2VBCA 1E79A 4B73A 2OBLA 4PC7A 5DI9A 2O5VA 4DUGA 3P4YA 5BN3A 4A8JC 5SZHB 3RYTC 1AZTA 2J0UB 2VO1A 3TE6A 4YMUA 2X2EA 4P4SA 2RGEA 3RAPR 3KQLA 1XMIA 2OLJA 2OT3B 2F9LA 2QP3A 4K46A 1YR7A 4XWAA 521PA 4IDQA 3IIJA 1Z63A 3R9WA 4QGAA 3K8YA 2C98A 2GESA 4FWIB 1CRPA 3NH6A 4P4UA 1FP7A 4WOPA 3KZ1E 1V43A 4ESVA 2AKAB 1PLKA 2CE2X 1AS0A 2GKSA 4TL8A 2JLZA 1SHKA 1NVUQ 3E1SA 3B85A 4M1OA 1JNYA 3QY0A 4AKHA 4UNSA 4RD4A 4BLQA 3K1JA 1UADA 4NYMQ 2AK2A 5BYJA 3PXGA 4B34A 1JXOA 2P6UA 4JLDA 2PCLA 1DADA 2PT5A 3LXRA 2ZU6A 4NCNA 3TMKA 1CULC 4A4DA 2F1IA 4TMXA 1O3YA 3QXJA 4HSEA 3T15A 4F93B 3QKRB 3HR7A 1T6NA 1TUIA 3ZVLA 5AR1A 1OHHA 2GVDC 2QBYB 4HAVA 4AURA 3DKPA 1YRBA 2GZDA 1VYTA 4GI7A 1IONA 1ETUA 3DEFA 2H1LA 2QL6A 1FP6A 4B32A 1U0LA 2GF9A 2ODWA 2J7PA 3RRMA 5LD2C 2I3BA 1JXMA 2QE7D 1P5ZB 3BC1A 3K0CA 4Z8XA 4W9MC 1R5OA 1N6PA 2D74A 4Q19A 3OE7A 2G1KA 2DWQA 2QQEA 4KLZA 3AP3A 4XTCS 4H1UA 3WMEA 1X6VA 1Z07A 1OH7A 3AVQA 2QG6A 1D2MA 1EFUA 1ZM4A 1W0KA 3T1QA 2XX3A 1F60A 3BAFA 5JECA 2IYQA 3LBIA 4ZIRA 2EFDB 4D0GA 3KFXA 2WWFA 5KYKA 3GLIE 1YR6A 4YMTA 2NO7A 1KI6A 4IXNA 1Q22A 4Q7MB 3BD9A 2AFIE 1IHUA 3KKMA 2FOLA 1U90A 4Q9HA 1KK3A 3GLGE 2QI9C 2OLKA 5HKKA 1DAIA 3W34A 3J81k 1IJEA 1II8B 2VRWA 4PC1A 3BE4A 3GEHA 5KU1A 2V1XA 3U60B 2B92A 1OIVA 2XGJA 1VPLA 1FQKA 2QAGC 4BRWA 1PV4A 1F6BA 3A1SA 3VR1A 1X1RA 4PO9A 1D5CA 1M7BA 1SXJD 4B2PA 5FL3A 4A0HA 2X2FA 1G4UR 5CDFE 2QN6A 3KUCA 2GAAA 4RFSB 4FMDF 3UMRA 1KSJA 3IKJA 3CPJB 1HV8A 1H8HD 2KB0A 4WVFA 3OIUA 3WP0A 1RRCA 1ZJ6A 5ANRB 3SE0A 2G1JA 2WWXA 5FI1B 4OJKA 3BB4A 3BFKA 5G3YA 1T3SA 1MABA 2ZVQX 1WA5A 5DLQC 2ATXA 4HZUA 3H0KA 4LZZA 3RWMB 4M9ZA 5JCPA 5HTKA 2QMUA 2OXCA 2R8RA 4HB2A 2D4HA 2ZYVX 1RVDA 2O8BB 3ZQJA 3U5ZB 2VP6A 2QROA
chains in the Genus database with same CATH superfamily
4B87A 2YFHA 3HU3A 2GK6A 3JARA 2PS1A 1JNXX 4NF2A 2CKMA 2E7ZA 2IYAA 2AJLI 2FPKA 4ITRC 5EUQB 5GM2A 5T67A 1UEJA 2WP0A 5AJXA 3O8DA 3T3IA 3H7IA 3FPBA 3OESA 4C04A 2I7XA 2PZFA 2VPXA 3ND9A 4LSWA 1OYVA 3FYTA 2DKNA 3MJHA 4MR8B 1AXRA 3WLEA 1GVHA 5LFAA 3RWBA 5JJIA 2JH8A 3OFSA 2LW7A 3T7DA 2BKLA 121PA 4BZQA 1IPFA 5IXJA 2D2FA 4WZBE 3AR7A 1SCKA 1IN6A 1QLJA 3ZQUA 1JLMA 4UCFA 3L0YA 4C7OB 4WQMA 5IYZA 2AGVA 3OX2A 3TLZA 1ZVJA 2GILA 5ER6A 4Q39A 3TOXA 4XIFA 1O5TA 4MB6A 2XI4A 1QYCA 4DDMA 1M8KA 4R2HA 4BFZA 5BN4A 2NZJA 3FDJA 4LK2A 2WYUA 1BWRA 4BV9A 1K5HA 3JYOA 4OXNA 4RTRA 5JQGA 1I9CA 2ZEJA 2NGRA 3C1UA 5BWOA 4D9HA 1YR2A 2WWTA 5L51A 4A73A 4W5NA 4U7JA 4FR2A 4JC0A 1II9A 3ANNA 4PQFA 4HNHA 4IX1A 1J22A 4HBGA 1V3UA 3UV7A 1LBEA 3QXSA 4YJ3F 3D7NA 5D84A 4C7BA 3VR4A 1KBOA 3I5AA 2Q41A 1ZM9A 4W5QA 3KYDA 4Q24A 2HSWA 2QXYA 2LD4A 2ONZA 4I4TF 5DIFA 1L5GB 5CBPA 1UM8A 4W5OA 3ORHA 3CW8X 5CYFA 4WBNB 4CV2A 3SXPA 5FTLA 2ZIVB 2I71A 1SOWA 3KYIB 2BN4A 3AUJB 3QXGA 3UYLA 3JW8A 4CDRA 4IO0A 1TMGE 5J5VA 4W6QA 2YBDA 4PZYA 4C0XA 1SKYB 1E4OA 3MD0A 2R86A 4F9FA 1E5LA 2R4UA 4PCVA 4KLCA 4MW7A 3CX6A 3JD4A 1OLXB 2JFQA 2C59A 4V0LA 2VXOA 2AKEA 1M6NA 4BKMA 1DXYA 3L07A 4F5DA 1EDZA 4IEFB 1JMKC 3U7RA 1SXJE 1DJQA 3IQWA 3KWFA 3IBGA 3ZJUA 5JZBA 4UM7A 2FQ1A 2B8NA 3SIRA 4EPVA 3W8NA 3U1TA 2G0TA 3KJNA 4MAMA 1OA1A 2CMFA 2P65A 4PHGA 1RABA 4YJDA 4F1JA 1J5XA 5AVQA 3R3VA 2P9QA 1MAHA 1OGIA 3RHFA 1V1JA 2OGZA 1U8CB 5TQ2B 1QAOA 4WKBA 1S3IA 1XZHA 3O0TA 4JP1A 1JBKA 3U3XA 1TEHA 4M49A 3M6XA 5AFSA 4R9VA 1E32A 2ZAYA 3SJBA 2VPWA 2XGMA 1IULA 1QOZA 2VPPA 1R18A 4B3GA 4K6FA 4LXTA 4X8LA 3WADA 4C20A 1FUYB 1XU7A 3R5TA 1SBCA 3FNEA 1K98A 2Z09A 2C5BA 1LF0A 4MV6A 4BNMA 4E2ZA 1VTKA 3Q2IA 4TRJA 1XJWA 1KI1A 1QVWA 3UPTA 2QUIA 3ICPA 5BYBA 4GI5A 4LHXA 1U2GA 4G8CA 4IDCA 3E8XA 5IJZA 2ZE8A 3H9BA 1HXHA 3NUGA 4GMXA 3UT6A 2DEUA 2GB4A 3QJ5A 3BH6A 2BKEA 2F62A 1JKFA 4Z6KA 2QN2A 2F3PA 3NC0C 3ZTWA 1KPHA 4YDSA 3T7IA 5CNKA 2ZRMA 1X1SA 1G17A 4LFBB 4EMSA 1ICEA 3GDFA 4DREA 2C95A 3H2YA 2PZKA 2C8KA 5K8CA 1GNRA 3HMKA 3X43A 1NE2A 4JLOA 1F9AA 5EEGA 5DEOA 1P9WA 3SHVA 3NS7A 1FDRA 3OP4A 1FFBA 4MVJA 1W85B 3CNHA 2XKJE 4JI3B 1Q1ZA 3GLUA 1SUAA 5CA1A 3JQBA 3QVSA 1FLVA 2VQFB 1L7RA 3HY3A 3WL8A 1NM5C 1V6CA 4ZEWA 5KAMA 1L7QA 5EKDA 5LYYA 3PXUA 3H1FA 1O94D 2IYZA 4L08A 1LLCA 3GRCA 3IKLA 1Z15A 3TDNA 3AF3A 4OQLA 1P8JA 5HUQA 1K88A 2Q50A 3RR2A 4YIHA 5E4YA 1QH9A 1FMCA 1XWFA 1YB5A 2ATVA 2NSYA 2IVFA 3E9DA 4J2HA 2ORIA 4TXNA 2RGBA 5CVJA 2OXTA 2C07A 5HQTA 2D8MA 3Q6NA 3ABRB 5GM1A 3V9PA 3K9NA 3LGSA 1Y4DE 3KEMA 3FKSD 3MHPA 5HXAA 3FMOB 4YTEA 2LCQA 1L4NA 1ZN9A 2OPHA 3BF8A 2ZRQA 3O8RA 4DKJA 4RH3A 2PVPA 4XYBA 2FJPA 4XPIB 5AHOA 1N8NA 3B9BA 2EP5A 4BFYA 5B2EA 4B3HA 1H9CA 3G9ZA 3MJSA 3S2UA 3VKWA 4W9RA 1XVVA 4FGKA 1I1QB 1A5SB 3AIKA 1LA2A 4GE0A 3P0FA 1T26A 2PRIA 5EZ5A 3PGMA 1CLUA 2HGZA 1P80A 2VF2A 2X42A 4I9NA 4V03A 4X7PA 3NHRA 4HYYA 1WU8A 4A6EA 4AZTA 1X13A 1H6AA 4I50F 5FBWB 4I7EA 3M8KA 1S5PA 3OZUA 4MYRA 2EQ5A 2NTVA 1MIHA 4CM8A 4CDMA 3RYCB 1N0HA 2QTNA 3TLGA 4PIPA 5EZYF 4DR3B 4O2AB 3G2LA 5F2EA 2YC2C 3K32A 2KLBA 3TEMA 5IT9A 1Z7BA 2O1EA 2RAUA 1DIAA 4GZLA 4DR4B 3I92A 2PX4A 3IMEA 3L4BA 4DQUA 1NPTO 3TW8B 1FX1A 1UJ4A 5EHZA 2K7ZA 1YVPA 2B8JA 3QKSA 2D7DA 4TUYF 3SQLA 2VTBA 1JP7A 3B1YA 4JQOA 3UJ9A 1XZGA 5DXAA 1WPGA 1KZ1A 2WP8J 2DJIA 4CQMB 2GBPA 1M2HA 3QX8A 4D2IA 4EF5A 5FR2A 3P4XA 1S3FA 1Z6TA 1Q21A 3HN2A 3K8QA 1H8ED 2ISCA 5HUHA 1LS6A 1TMKA 3DMHA 2QZSA 4Q7EA 2OAQ1 3W4JA 2MINB 3MTQA 4LYYA 4I9GA 5E2BA 2PY6A 1OXTA 5IJAA 4ZCMA 5AW1A 1I94B 4D25A 2D5IA 1TEZA 1J0AA 1XJ0A 4JFAA 5IT5A 3NWOA 1V3VA 5F21A 4NV0A 2MHCA 3LF1A 1L1EA 5IBRA 1RYFA 1H69A 2V6JA 2OC4A 5M3BA 5DU2A 2BUBA 4ECAA 3UY4A 2JA1A 2XMQA 4AO6A 1IEWA 4YACA 3DNMA 5CVEA 1YDGA 4Q3AA 4K9PA 2YV4A 2HYIC 4JVMA 3QJYA 4PSCA 4U2DA 2OORC 5CLQA 3DFZA 5T6BA 1SU6A 1ZSNA 4YGYA 4WBNA 3STYA 5FUYA 5EUBA 3CFYA 1FSGA 1EA5A 2YRFA 2NV6A 4JYPA 5F1YA 1Z0DA 3ZN2A 4DV7B 3H16A 2ZM6B 4O2RA 2QTWB 2BEVA 1AKYA 3QMWA 2VN8A 4Y2QA 2GZHA 3A58B 3QBVA 3N1UA 2IP4A 5AH0A 4QTZA 3MGGA 1KRWA 1EHIA 2X8BA 3B1XA 1L2TA 2AFIA 3CPSA 3I30X 5EUMA 3ZIAA 4BQEA 5KTMA 1DSSG 4A0FA 1M6YA 3EBOA 3ER9A 1HDOA 2VP9A 4F6RA 4Y7CA 3U62A 5F9HA 4JI1B 3QLVA 2P9BA 5FLKA 1OZ0A 2AEEA 2WU8A 2GM9A 2AJTA 4RK7A 3W3ZB 1QE5A 4ZAVA 1EQ2A 1U3UA 3D8BA 4BJ3A 1N5KA 4G5FA 4M55A 2DPLA 1R0ZA 4UEKA 2DXIA 3RRYA 1DAHA 2GA9A 2V5AA 3LHFA 5DYWA 5J40A 4W1RA 2W2KA 4R8KA 5AKEA 4ETNA 1WHTA 4MHSA 2HJVA 1WMDA 3UEOA 3SX0A 2EC5A 2OBYA 4HYTA 1JEEA 3EQ8A 2C3UA 2H9AA 2EJVA 4PLTA 5EIBD 3SYNA 4CIVA 3CX3A 3V34A 1QMPA 5JMTA 4PLFA 5FUMA 1O9BA 4PSVA 5K20A 5KHOC 3WHIA 1SBNE 2GDJA 3C97A 4ZFNA 1NHWA 3W2HA 1EUZA 2HWXA 3L8EA 4BFCA 2I3GA 4HGNA 1LFDB 4HEA6 3VHQA 1DO0A 4QUAA 4MS1B 3WGOA 2LKDA 5FEUA 4NXNB 1TCVA 1ZJZA 2W48A 3A6EA 4D0LB 2Q5EA 3K0AA 1HEUA 1IRIA 1O9HA 4UNIA 2BI7A 3W8DA 1G8GA 1P19A 2QKYA 3PRYA 3W2IA 1V0JA 3DL7A 4P0TA 1OVMA 1JLLA 3M5PA 3KUUA 4NS1A 4CF4A 4Y67A 1N57A 2IUYA 1T5DX 2COKA 3OD5A 2HK7A 3ZCTA 4PY2A 2VDWA 4LZAA 5AKXA 1EI9A 1D03A 1SULA 3DEIA 1E5VA 3F2VA 4Y30A 4R0VA 5LMCA 2HF8A 4XLZA 4DCVA 2CFSA 4F3NA 1IZ9A 2QQGA 1UQTA 1D2GA 3OM0A 3ZCSA 3JWIA 5JBQA 2UUAB 1C7QA 5GV7A 2B83A 3U26A 5AVXA 3LQYA 1XD9A 4NKRA 2IYFA 3KAQA 4L4XA 4Q1FA 4DDTA 3HJCA 2ZPTX 2BMEA 1U7ZA 4JLPA 2PMWB 1CV2A 1GIAA 4E14A 4DCCA 3ABQB 4DSZA 3KR1A 4F4CA 1KYYA 2WYHA 3ACDA 3ZNNA 4JEIA 5ITZB 1R6UA 3HO8A 3OPYA 5LMNB 2D0PB 3AI2A 4Y2VA 4CYMA 5CA1B 2C3OA 3KQOA 1P7ZA 4AQDA 1T1JA 2HRRA 2JGDA 1HWYA 1BEZA 4FFWA 2OD7A 1G66A 1IEVA 3DKIA 3KYDB 4U9IS 3CJRA 2LBPA 3GZJA 3PRHA 2D3TA 1NVVQ 1PTJA 1XPOA 5ULLA 1CUBA 3A7EA 2QL9A 1KOJA 4XVQA 3VV3A 1RS0A 4D9GA 1DVRA 4W5HA 4OHVA 1QRTA 2QMOA 5K1ZA 5GVSA 3PF8A 1CQZA 4B47A 3LHKA 4JB8A 2IH4A 2ZYHA 4ND8A 4P1ZA 4QYWA 4RE6A 4X64B 3PB3A 1VG1A 4WKNA 3JVDA 3H5OA 2M6LA 3AJRA 4IQ0A 4X41A 5HMMA 5KKCA 4FGLA 4P3OA 3GA5A 1HUQA 3OOYA 4WCFC 5CB4B 2A2ZA 3QEBZ 1N0IA 4BC1A 3U39A 1CEYA 1XNGA 2XH8A 1MO3A 1YS7A 2RIRA 1NVEA 1WAMA 1GPMA 3U4MA 3G5UA 3WL7A 4NQRA 2Q8PA 4P3NA 2R1VB 3RS0A 4OI2A 5A4AA 1S9HA 3AVUA 1GG2A 3SKXA 2H1FA 1R6VA 3BUSA 2WTEA 3COPA 1GSIA 4PHHA 4F71A 5FBKA 2YR0A 3HZOA 3OCCA 3K70C 3QPAA 1ZGHA 1E6CA 5BMVB 3P4UA 1W4LA 1OX5A 3EPLA 3T5PA 1WKVA 1XDWA 3K0AB 5I8WA 4OMFG 1QHXA 4FQ7A 3ANTA 1J97A 1PHRA 2YVQA 2MR6A 3FYUC 4JMPA 5FBQB 1ZPDA 3UUFA 4BQQA 5KPDA 4ND1A 2Q6KA 2EFYA 2XMGA 2ZXEA 4XDHA 3V1LA 2CXNA 2QTCA 1WP4A 4WLNA 4UBKA 1VLJA 5AUQA 4AKTA 2O0JA 4XUCA 1SG6A 4KIGA 1USWA 3SVTA 4ZYXA 2IP1A 2GASA 1Q1EA 1I2DA 4C22A 4F1WA 5TJ9A 3H04A 1XL1A 6AT1A 3WWEA 2RGRA 4IIJB 4IUBS 1YNSA 5TQVA 1R4NA 4UCQA 3TNFA 3IVRA 3U0BA 1JQKA 3GVIA 3BERA 4LQCA 3NATA 4QGGA 1M34B 5CFOA 3CF6R 1KYIA 3CV3A 3E7DA 5JBNA 5DOVA 4ZVRA 4R40A 3UVEA 2JDID 3VR0A 3WMXA 2PS3A 5B7NA 1VKOA 1H1TA 2O4CA 3AHDA 4LY3A 4PYQA 4WFKA 5KAPA 2NYRA 3V6LA 1SQ5A 1YK1A 2GPBA 2RHDA 2C7VA 2QGNA 4TSRA 4CEJB 3I62A 4ZK6A 2HXSA 3ZOZA 4AN1A 5DTRA 5FXMA 4HY3A 2Q1SA 2HIAA 1S4MA 4F4IA 3GC6A 3L43A 5FAXA 1EFRA 3SPXA 1IN1A 2AUTA 1BVYF 4MS4B 3REFA 3EXG2 5CYGA 4FYIA 2EZTA 5BN5A 2RH4A 3BWCA 3UH0A 5AK6A 1A50B 2G4LA 2OK7A 1SVKA 4W99A 2QRHA 3AL2A 1RXEA 4OAOA 2REXB 1JDNA 3WYAA 1WMFA 5CM8B 1P81A 2JLBA 1G5IA 3K2QA 4TWBA 2G1AA 2Q5OA 4E1VA 3RRJA 4M8KA 5JS6A 3KX2A 2VHWA 3EGIA 3KOUA 3KU4A 4NECA 4DT1A 3PPXA 4AU1A 3OIFA 2VFAA 3H1GA 1GNVA 5IMBA 3TW4A 1TYAE 2LXNA 2PXAA 4MQ6A 3QBJA 1M7GA 4ZVUA 3GJ7A 5DO9A 1Q7EA 4CKCB 3BWXA 5I8ZA 4QZVA 2V74B 5C7YA 1ZCZA 1CETA 1SCUB 2W0SA 3RLFA 2Q5FA 1QHHA 3FFBA 3OEHA 5KOJB 5A9SA 2FRXA 1E2BA 4C08A 4INAA 4DV2B 1D9XA 1PZEA 2NO9A 2EZ8A 3NC4A 3QA3E 3ZJ5A 4UAGA 3FG9A 5G3ZA 1F8FA 4IBOA 1ZR2A 2YYYA 4PGGA 1W5SA 2P3LA 1HGXA 3LDAA 3OF2A 3EUFA 2QLMA 1Y9JA 1A3CA 1DIBA 3O8OB 3D7MA 1QFZA 1QE3A 3E23A 2A7XA 3C43A 1UXIA 4N9QA 4GL4A 2AFRA 4PTYA 5LDGA 1U8AA 4P3XA 1E9EA 3RQIA 4BASA 1DBVO 5LB2A 1S89A 3BRCA 4EJ6A 1Z35A 4P7FA 2IHTA 1OKKD 2O8FB 3I0ZA 5BSHA 3DFMA 2BR4A 4QOHA 3P71T 1WMAA 1HE3A 2BJHA 1OB2A 1VI6A 2CE7A 3EG5A 3DT6A 1UBJS 2BFNA 3PDIB 4ARBA 3R4CA 4HLUA 4MVJE 2WUGA 1VMDA 1MOQA 4KFRA 1J09A 1HFJA 1XAJA 3LYAA 4CCAA 1EK6A 2R8XA 5DYGA 2YRWA 3L49A 3KV3O 3EFHA 3C3BA 1KOLA 2EJUA 1ZGBA 2J9XB 4A1FA 2PRSA 1OZFA 4N3NA 1A72A 2EBUA 2BFWA 2PYZA 2WKSA 2YWXA 3QITA 1RADA 4TUYB 5FHQA 1G7RA 1X8XA 4F0JA 1CY8A 3CH5A 1WR8A 3OQ6A 5FA5A 4B85A 1QX4A 2BD0A 3QFRA 5AOCA 5K03A 3V7FA 3UMMA 2DF8A 2J09A 3DEAA 4DJFC 5KTTA 2R5WA 3NBFA 2IU4A 4G01B 3WNZA 4FFOA 4HRVA 4DDWA 3DV0A 4QECA 1E4VA 2A5JA 4S12A 3TTXA 4M21A 5J4VA 3G13A 3TFQA 2V0GA 4ZXFA 3U7QB 3V9AA 1IJKA 3FWYA 5DNCA 2BEWB 4J94A 4TWJA 3DOUA 4PHTA 1N5LA 3LA6A 3FBWA 3F67A 3OX1A 4U5QA 1IRXA 3ELBA 1Z6YA 1PX2A 2H0AA 2QTGA 1AKVA 2HBQA 2QVZX 2VQSA 1TADA 2C4TA 5BT8A 3LFHA 5IABA 4BLOA 5CX1A 2UVDA 1FNSA 4PSKA 5F7ZA 2NO5A 4UU0A 2C58A 1DFHA 1LXCA 2O7NA 3E0XA 3DPSA 2YZ2A 3L8GA 1ZBDA 4C05A 4EECA 3IE1A 3HB9A 4BLRA 4CBVA 4XD2A 2Z4RA 1I7SB 2W42A 2PVCA 4DSUA 2FF7A 5BPHA 1LVHA 2NO6A 3A11A 3FKJA 4NATA 5F12A 4DNXA 1QJ4A 5BUQA 1RYNA 3HTXA 3HY4A 4N39A 2VZ0A 4JV5B 3MWGA 5HZKA 2E49A 1FRZA 2XUFA 1I2CA 2WUFA 2DY0A 2EGHA 2XCOA 4YAWA 4ZQEA 5KDOA 5GGYA 5MGBA 1NN1A 3Q7PA 4OHCA 4TWAA 3R9XA 2YHSA 2XVYA 4RPLA 4B6FA 3GN2A 1Z4OA 1ZRSA 2PT7A 3ZE0B 5I5GA 4B7CA 4D80A 4BNVA 4DPLA 1G5PA 3WL3A 5HRAA 2O8BA 4CM8B 2XA9A 3AM1A 1PSZA 4M1SA 1YJCA 4EARA 2CHFA 1MB9A 3T0GA 2IYLD 3LJKA 1PR9A 5J4LA 4XJVA 2D5CA 4AO8A 3OHPA 1T4GA 4GEGA 1V8FA 1QFJA 2WE7A 4W5JA 2JCXA 1Z13A 4R1OA 5DMXA 4NVRA 2WV9A 4JDUA 5KYWA 1SG9A 4Q7KA 1Q3KA 4JYAB 2XTMA 3V42A 3D64A 3U9SA 4AZSA 1P7CA 2HF7A 3E6AA 3R4VA 2HCJB 3ZE8A 4OAPA 3PFHA 1Z2DA 1EUCA 1QKJA 4CLOB 1V5EA 4TKVB 3T5AA 5A03A 1ZJ5A 4KE8A 4UEQA 1Z2PX 3URKA 5DTQA 2Y6UA 2H0QA 1UFQA 3M33A 3GQBB 3RGWS 1XZKA 5FBRB 4E3WA 2IDKA 1E2IA 1HFWA 1BJRE 1GEEA 3HHEA 3BM5A 1H65A 1R6DA 3K16A 4M1EA 1HYBA 3PQDA 5BUCA 2YQZA 4G5YA 1RXWA 1E6KA 1ZINA 1E1LA 3KHKA 4D0SA 2WWWA 3SEZA 4CZ2A 2WHPB 2VAPA 2QG4A 3D4NA 1J42A 2DTDA 2QTBA 2BRUC 1U0FA 1DCKA 2MMCA 2X3FA 2E5FA 1XP8A 2ECOA 2A9FA 3FLBA 3CMMA 3LG2A 1BDMA 3HBNA 3QI2A 1OYOA 3K0SA 1NIPA 5AP9A 3V48A 1IEQA 1CBUA 1PHPA 3LVFO 1PFGA 5EAIA 1EFVA 3HEBA 2MR5A 3CLSC 4JSTA 1QAQA 2WFAA 2HQSA 2I9PA 3CUEF 4KNWA 4MRSA 3RI3A 4EY3A 4LJ7A 3TDMA 5CTJA 1T9DA 3PQ8A 4YJGA 4JI2B 2P78A 3Q1LA 2DPGA 4KCGA 2DVMA 5A6VA 4EA9A 4LNHA 2BMAA 5EPOA 4KFSA 1KQOA 1XYGA 4UOZA 1RBMA 3VC3A 2P8JA 3IAM1 5ALOA 4BO6A 1RKXA 4HDQB 2GD6A 4OP3A 3AVWA 5FFNA 3TOVA 3Q3VA 2GPWA 3A10A 3WBBA 2CFOA 2YN2A 4GLFA 3KEQA 1GWNA 1MB2A 3HA5A 5EJIA 4LRYA 3C85A 3AVOA 1OTYA 2RARA 1O6FA 1NI5A 3UK1A 3GJ0A 2VNSA 1LDGA 4PGHA 1T36B 1OXUA 3BK1A 2H6EA 4OQNA 3KOMA 4BMPB 3BMOA 5C7LO 5LQSA 3MOIA 3D4OA 2BM1A 1XAHA 1ZR4A 4D26A 4QSMA 4EHIA 2GRJA 5HZGA 5CLFA 4MJ7A 1NLMA 2GFIA 3R7BA 1TPYA 2GJ8A 3DXZA 2PKQP 4KXMA 4NJMA 5TXGA 3RVPA 3SAJA 1YFLA 3IGFA 4QXAA 2GSWA 4AY3A 1MC1A 1PQ4A 2ZJ2A 4Q1DA 3PC6A 1SIBE 2X3UA 1MIOB 3G88A 3AT1A 3PV0A 4E5KA 5CIQA 4YUWA 2ZSDA 1G6HA 1T24A 2C5FA 1YRLA 3FYCA 4D6XA 1SBYA 1EHCA 1U1DA 2WDPA 2GJAA 4MS3A 5FLEX 4X93A 1L4FA 4GR5A 2JLVA 1OE0A 2EFCB 1CUHA 1D4FA 2IXAA 2XWBF 3HL0A 3KEOA 4AYTA 5LMZA 1HDXA 1D2EA 1OAOC 2FNAA 4C7KA 4L72A 1R8QA 4CTKA 1OZGA 5LA6F 4JYZA 1WUKS 2VDRB 2GPAA 2P6NA 1OH8A 1COZA 5GJWC 2IU3A 5E9QA 2NXCA 4XJXA 3ZEAA 5AOAA 2Z83A 4HX2A 4ZZ3A 2GAJA 3BMXA 2AN4A 2LGJA 4DHEA 3C4QA 3OTQA 4OHRA 1KFKB 1W5AA 2JZOA 4X1KA 2HMAA 3W77A 1W5TA 5HPYB 1DOAA 4B2YA 4GSYA 4G0XA 3V4RA 4MTCA 1LC3A 4LECA 3AR2A 2QM3A 3PFKA 4JOSA 3FHOA 1IL0A 1NSFA 2M1XA 2JGAA 1CJMA 1WSWA 4TKMA 1H22A 1L5YA 4M7PA 3ROEA 3EVDA 5C34B 1NV8A 1U4SA 4M1TA 4PTLA 3PX3A 3P9XA 1P0QA 1TA0A 3U4QB 1T2UA 4CEHB 1QYDA 1DHRA 2NUAB 2ZB8A 2X7XA 4D3DA 3P2EA 4IFIA 2C9DA 3HMQA 2JCVA 1CKEA 1Q14A 4ND3A 2PJRA 3F3SA 1CU1A 2GJ9A 1RPNA 2PR2A 2EAUA 2OBMA 2VJAA 3EGDB 2OWDA 3HVIA 4E2XA 5ABPA 5HRUA 3PHBE 7ADHA 5E1BA 2AG0A 1EUQA 2C7RA 3V8QA 1KP9A 2VSXA 2ZTVA 3C7DB 4MW4A 3RBVA 5J4HA 3W3AA 3EA0A 5G0SA 4H77A 1JZSA 2C2KA 3AESA 4RDHA 3UAVA 3PX7A 2ECKA 2BCJQ 3QBEA 2H63A 3BRWD 3HO6A 3RJZA 1UMDB 1LEHA 2MSDB 3TLAA 3F9IA 2BDEA 5JRJA 4ZAGA 1E4EB 1CCWA 1G6KA 3HDGA 1M1ZA 1HORA 1FRNA 1UEIA 3K70D 1NW9B 1U81A 5LLDA 3D6AA 1XCGB 1JB9A 4GT1A 1KKMA 2Q3EA 1XMPA 5JS2A 1ECFA 3W7BA 4D4GA 3BK7A 4UUNA 2WOJA 3VR6D 3A1VA 3UIEA 5CD1A 1E59A 3LC1O 3DKRA 1US8B 2WPNA 4LMPA 5G1PA 3TTVA 4DCUA 2QRGA 4OL0A 3ZVMA 1XXHE 1T91A 1MQAA 3ELYA 4CPDA 4YJ3A 5IRCD 1Z2EA 1XCPA 2DKFA 3I73A 4LJ9A 4Y0NA 2XMBA 4E5UA 7ABPA 3LIPA 2XZPA 3E05A 2R6R1 3LE8A 3P9YA 2GXSA 3VC1A 1WW2A 1WM1A 1W1UA 2FFJA 1QKIA 4QDOA 3P0RA 3UJ6A 3KS9A 3IUPA 3KKPA 4HL6A 3DZJA 2ZIXB 2YYZA 3WMGA 3KOZA 5EVCA 4DJJA 1VSTA 4KKVA 4EI7A 2XB2A 1V6AA 2F1OA 3QE4A 1SXGA 4G9GA 2M1ZA 1YUNA 1QTQA 2WHEA 3P2JA 4LMAA 1VKNA 2CVPA 2YWRA 2IW1A 4WLFA 1KDZA 1AGRA 3VPGA 1Z74A 4GLLA 3WAKA 3TI7A 3MSXA 3TGWA 2GRAA 5HZMA 3CPEA 4NZOA 3BG5A 4D82A 3TCNA 5IKPA 2O1XA 1NN5A 2RAVA 3KLBA 3WLMA 5HNKA 2R00C 3NASA 1MR3F 1QO9A 4O02B 4FHEA 3SSOA 4HWGA 2O7QA 1V9CA 1Q0PA 2WPDA 2Z8YM 1H4VB 1YULA 1T6YA 1R0SA 4IH9A 4K7JA 4EVRA 3QU9A 1Q7GA 3EA4A 4MRVA 1E2PA 5CCDA 5BQXA 5DWDA 4YAKA 4MUJA 5IJ9B 1DEAA 2KJQA 1S2MA 4N5IX 2P2GA 5J43A 2DTEA 3ERCA 3NM5A 1AK2A 2PGLA 1IOVA 2BFEA 3RWOA 1OFGA 3OMXA 3Q9LA 3FCXA 4R2IA 3VFDA 3A4VA 4B3FX 4L73A 1MV8A 3BH0A 1UMBB 2WSIA 3BCSA 5CMLA 5TSDA 5A3SA 2JJ1A 4GBJA 3FCSB 3D6FA 3ZLVA 3PYXA 4FCCA 3OIGA 5FWXA 5K3AA 3KQHA 2BEUA 1U3FA 2VCEA 3FVWA 4RANA 5KNDA 3NVKI 4EG0A 2XB4A 3JALB 3TGPA 4PFSA 4EG7A 4MMYB 4BFWA 2JLRA 1QGYA 3LK7A 4HEA1 2PANA 5T4BA 2WOOA 3GH3A 4PNHA 3MQ4A 4EB3A 3A1UA 4O4LF 4XFDA 5IYZB 4E03A 1OXMA 5L95A 4O5OA 3CZ9A 3L93A 4YK7A 3KZVA 1Y3HA 4OMDA 2CV1A 4FKZA 4FMBB 1NN3A 2JIRA 3G1TA 2IRWA 1FP4A 4DA0A 4HNUA 1APBA 3WAGA 2ZP1A 3U9LA 3ZQ6A 3GRPA 1PIWA 3FZGA 1XZJA 1XZPA 3OHSX 2BVNA 3IR7A 3GUCA 1SJ9A 3OECA 2GFQA 1Z68A 3HCEA 2PZBA 4GLOA 3GRUA 4DHWA 2V7WA 4RPJA 1EFTA 5LCXA 4POOA 1DAGA 3EDYA 4Y6LA 4C03A 1UBOS 2YVLA 4XYLA 1VRWA 1SELA 3HADA 1H4SA 2C77A 2FDRA 2W4QA 1M2OA 2MT9A 4UJ3A 3WO1A 2A1UB 5FLYA 4R9RA 2H31A 4UMVA 4CTJA 3H1BA 3SDZA 3WWDA 4PE5B 1D07A 2P9GA 3OJXA 5AJZA 4ZQFA 1IB6A 1T5OA 1SVNA 3PUYA 4JD5A 2OFFA 2P41A 3R75A 1W87A 1YKFA 3KG2A 6CHYA 1BCSA 3IVGA 3PUIA 2ZULA 5KJCA 4WVLA 2GLTA 4NFLA 5DSZA 2J9GA 2C3MA 3IBSA 4JJKA 1KSHA 4QJ3A 5CBKA 3K53A 3LY5A 2ZBUA 3P9CA 2H48A 5FQOA 5JD3A 3M89A 2A0XA 4LOHA 3TNDA 1ODKA 3MELA 2V9ZA 3I8OA 4G1FA 1Y7IA 2XZTA 4PICA 1QHNA 3WDMA 721PA 3TTWA 1GTRA 1IZ7A 3DMPA 4WHMA 3WYDA 2BFPA 3C1TA 1ZG3A 4AUMA 4IDAA 2D7CA 2NTEA 4JUIA 3E9ZA 4X8OA 3UAYA 3AF6A 4LXHA 4M1QA 4PONA 3RGGA 5CUQA 4ZU1X 3VH4A 1O5IA 4BIMA 4ECEA 5B1YA 4S0XA 1QDEA 2VDPB 4EW2A 2OHVA 3BB3A 5LXTA 5ALHA 4J0DA 1NJ5A 4P93A 4R71A 2Y9PB 4ID9A 3O3NB 1DG9A 1OHHD 2G0AA 2XWSA 4YV2A 4H4DA 5AKLA 4XM2A 1CY2A 1V48A 3SBEA 3ZPXA 3QLJA 4GWKA 2ECPA 4KR7A 2B4KA 4U0JA 2BJWA 4A82A 2AG6A 2HD4A 2VTKA 3D6VA 4MMXB 3GYBA 1HDYA 5F5NA 3WK8A 3KUDA 1K06A 2YVKA 3O93A 1YTLA 2QAGA 1RRMA 5ALPA 1JECA 3SQXA 2K4MA 1H2EA 4GAEA 4GM1A 4MUBA 4F85A 3KKEA 1MEEA 1I1HA 1L7BA 1LJ8A 1TW2A 3RH0A 4B32A 3D81A 2HRZA 4WI1A 2WJAA 3G2OA 3FDZB 2FLVA 3ITKA 1DG3A 4L3OA 4LXGA 4MQ4A 4XQ0A 3GFVA 2O8EB 2J48A 2R1ZA 3IVCA 1CP3A 4MVJF 1E9BA 5JCXA 2QJRA 2XDQA 5FPQA 4MUGA 1IN7A 2GZMA 1XMSA 4M9QA 2EKBA 2VUHB 2P2LA 3AHJA 3CF4G 3HVJA 1SOMA 2YXNA 1JA9A 3GROA 1EJBA 1IDOA 1XZDA 3RFUA 3BMOB 2JVKA 3E7FA 3QVGA 3HZZA 2YWHA 2J3HA 4F4DA 1BW9B 1H8EA 3IX7A 5EJ4A 4AG6A 3RVSA 1YA4A 5F1PA 3TQOA 4X90A 2FZVA 3FHTA 1VGRA 2YMQA 4FDVA 5AVUA 4K2HA 1JAIA 1AURA 2V59A 3CU5A 1H2RS 1FXUA 4YAGA 1G18A 1T9AA 2BCGY 1DOZA 4LC1A 2WZDA 2E4ZA 4UMEA 4XD7A 5DIZA 1PDOA 3T7SA 1X77A 2C2OA 4JB3A 2AW3A 5H82A 2B99A 3ESCA 1GGJA 3VPSA 4KSBA 4RF2A 3CUWA 2FA9A 5GTDA 1AVTA 1G64A 2G5TA 3AM5A 4ALIA 4OKSA 5TX7A 3IVMA 1JFVA 3KKQA 5KMGB 1LCIA 2VHUA 1DBRA 4ZICA 3ZDEA 3R5KA 1MCZA 1QB7A 1VHDA 2FPXA 4J0FA 4FBMA 4PS1A 4ETMA 2WF6A 1GPNA 1JDJA 2GF2A 3KT0A 4BWFB 4F8JA 3DAYA 1H42A 2AC2A 2W6MA 2AN5A 3K1ZA 1EFVB 2VXCA 4D9KA 1G8SA 3OX4A 5L45A 1QC5B 2QRPA 1XXLA 3M9WA 4QM6A 5EC8A 3CVVA 3MTIA 4D02A 4IPTA 1Y9ZA 1CUJA 2EZ4A 3DZIA 4EW6A 4EY5A 3X0DA 1V95A 1XRNA 3AP1A 3OMWA 4LHYA 4WLUA 5JWRA 4NP6A 1KFCB 5I7RA 2A9RA 5CYPA 3RTBA 1RBQA 3H8WA 4Y9DA 3I9NA 3OZAA 2IZ7A 4URVR 5D85A 4E5VA 3FCCA 1GKLA 5C37A 1CT9A 4LVUA 1YBFA 2YJTD 1QIIA 3QEKA 1WS6A 1PT8A 2ISSD 1ZUIA 2XE7A 4MW6A 5HQ3A 1KDVA 3T5BA 3TSWA 4DCTA 5KQLA 1T9GS 5K0NA 1WB9A 2D1QA 1QGED 5ALDA 1ULSA 1TT5A 4J6EA 2XXJA 4GI1A 4BY9E 4CUZA 2Z3VA 5J9FA 4CL2A 1AKWA 4YLEA 4BO1A 1Z4KA 1Q44A 1YQ9A 5K45A 3VDXA 4YPVA 2JLUA 2X0NA 4YJ2A 1L5FA 1ESZA 3ZWCA 1G59A 5D51S 2JI6A 3WLKX 1UJMA 2SCUA 1UM9A 3IS3A 1C4WA 1K8RA 1T9ZA 2AL7A 1XAIA 4YRAA 3EXFB 5A06A 1E94E 4PAOA 1CWUA 2PJDA 3IAM6 3GD5A 1N9GB 5H59A 3W0LB 1J70A 4CNBA 1BKYA 3H65A 2Q1WA 4WDQA 1KMIY 1RYEA 1Z25A 2J5XA 3GFFA 1W4CA 2A9JA 3CVJA 3LWZA 4L4SA 4UTNA 4AICA 1B3RA 4BLUA 1YQDA 4MA4A 2W6ZA 3QVVA 4HZIA 2QK4A 1PG5A 4AUEA 4RY8A 3UA3A 2G07A 1REQB 1N75A 2FP3A 4KZPA 3HVRA 4HC4A 1ZESA 4NDNE 3ZVRA 1LVUA 1OUMA 1MG0A 4JODA 5JISA 5LQCA 2HT1A 1M2KA 2WJHA 1U2PA 4QSHA 1XPUA 1WBBA 1YGYA 3AR3A 4KYUA 4DBZA 4N48A 1LK5A 1X19A 4PZAA 2PSHA 1WW8A 2XKBA 3RABA 2YY7A 1RXIA 1NVXQ 2QIPA 2A1UA 1UZNA 1RTTA 4EI9A 4HD8A 3RK0A 4YJ3B 4B74A 1D0IA 2GEKA 1QX3A 2E5LB 3V46A 4LHSA 2MSWA 2OHXA 2VQ6A 2YMPA 1ZGZA 3AFNA 5H81A 3FNGA 1EB9A 4M99A 5EERA 3W9YA 1BRTA 2L19A 1GG5A 1MFPA 2MSNA 1GJRA 3R76A 2DR2A 1A7AA 3KC2A 4KR2A 2GN9A 3EK2A 1E6MA 1MABB 4QUHA 5AJTA 3ROMA 2YNMA 4A36A 2Y1CA 1Q84A 3VR5A 5JAHA 4FOTA 2PUAA 3NANA 2VWQA 3FUCA 3AVTA 3TIGA 1V37A 1QSGA 4Z86A 1AMNA 4FZVA 1CJKC 1QZXA 3V1KA 1DXQA 1XLWA 2EYQA 1FZTA 2Y66A 1QGOA 4I55B 5H3HA 1OF1A 5J47A 4FONA 4H1WA 1E6WA 5FWNA 3OPYI 2IPNA 4DLXA 3PYLA 2QRKA 3THWA 3EISA 2EXXA 1PWZA 1ZQ9A 2PGDA 4KYIB 1I6KA 3HYLA 3RU3A 3Q40A 2BTQA 1E1CB 4BWGA 1KWGA 1N5JA 5J23A 1BMQA 3A6FA 2J33A 3T99A 3GRRA 3I6ZA 1AHIA 5E1OA 2VWGA 3E8MA 3BFVA 3OO1A 3OJ0A 1EWYA 3A1CA 2I33A 4HMOA 3DE4X 3VMFA 3A06A 3GLHA 4BV3A 3TVTA 4B75A 1V25A 2GNPA 2NU9A 5DTIA 3T12A 4FBGA 1USKA 3U3DA 4GGPA 4P92A 5DGIA 3S40A 1T43A 4U7GA 1CF9A 1YKSA 1BNCA 2NSLA 2VJDA 2WWGA 4JLVA 1RZRA 3M5WA 1THGA 1YL7A