4UNNA

Mtb tmk in complex with compound 8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
184
Chain Sequence
VLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords THYMIDYLATE KINASE
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 71
structure length 184
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unnA00
4W5HA 3OIYA 2VTKA 1G6OA 2P5TB 4GFDA 1G18A 2ZJ2A 1SHKA 1DAFA 5EXXA 3K53A 4N3NA 1KI6B 3GLIB 3GQBA 2IYWA 3TUIC 4YMWA 4GZMA 1UKZA 5HKKD 1ODFA 1CP2A 3BB3A 1ZAKA 3EWAA 3KX2A 3TUZC 2J0UA 3LA6A 1W5SA 5J47A 1IXSB 4LC0A 4X8LA 3VR4A 2VA8A 3SQWA 4LGMA 5EP2A 4IOLA 3UMFA 2FJUA 3I62A 1II0A 4TL8A 2YC2C 4LJ4A 4QGAA 1TF2A 3HYRA 1VG8A 2J7PA 1ZMXA 3FMPB 4PPFA 2R9VA 3GFPA 2A5YB 3N70A 3R8CA 3ZZ0A 3S1AA 5SZJA 4ZO4A 4K46A 5EZ5A 2HYIC 4PFSA 1F3OA 4R7ZA 1JALA 2FU5C 2WPDD 1OSNA 1KSFX 5CITA 1WB9A 5BQ5A 5KTYA 2BJVA 3IDQA 2I3BA 4BLRA 1GDDA 2NTYC 2C9CA 4LJ9A 1DARA 2ZIAA 2ANBA 1AS3A 2SHKA 1FW6A 1E0JA 3CR7A 1G5TA 4C2TA 2IS6A 1TNDA 1XCGB 2KI5A 1OYWA 4L9WA 2B7CA 4LHWA 4NU0A 3UG7A 1HQYE 4AURA 5DE3A 3SQXA 4QL3A 3RAPR 5EQTA 2JLRA 2WJVA 2J59A 1X8LA 2NO0A 4JLBA 4MKHA 1DAMA 1AM4D 1GNPA 3UKDA 3B1ZA 1Z47A 1O87A 2IXFA 2ZANA 1E4YA 1ZIOA 2J41A 1RYHA 3AH8A 1RZ3A 1BO6A 1NMXA 2W6IA 2XNDA 3SN6A 1NY5A 1FUKA 1Z0KA 2B92A 4D80A 5CJPA 2C78A 1G3RA 1GP2A 2MSDB 1Q57A 3IKJA 1F48A 4AKEA 1E2KA 2IXEA 2ZJAA 3CKLA 2HLDA 4HDCA 1OKKA 5G53C 1YZTA 3DOFA 4LBZA 3QBVA 3J81k 3NH6A 4TT3A 3L0PA 2VO1A 2PCLA 4V0NA 3WMEA 4MUAA 3D7MA 4D4JA 4RVCA 4A8JA 3RHFA 3TE6A 1QHGA 2CLCX 2GK6A 2VPPA 4JBXA 3W34A 5DN6D 5FPKA 4NDZA 3UATA 1Z0IA 4AK9A 3VNVA 3GCGA 5FFMA 3HU3A 4Q9KA 4CEJB 4TQUS 1RRFA 1Q12A 2IYRA 4HDQB 3KKMA 4I1SA 3V9PA 1GRNA 2KE5A 2YOGA 3RSOA 1JAIA 1CLUA 2QGZA 2I1QA 3SR0A 2NPFA 1E2PA 4NYMQ 1Z2CA 2TMKA 3C8UA 3FHCB 3PUXA 3VMFA 4D4LA 4M1TA 1ESNA 4DDVA 2IYSA 2OAP1 2D3WA 4DCVA 1TUEA 3FMFA 3U60B 1IONA 1R0YA 2WIAA 2GXAA 2QI9C 4YONB 1NKSA 3QVVA 1FNNA 2FWRA 2ZI4A 3IBGA 2XX3A 3KFXA 3W9YA 3OEEA 5C46F 1LB1B 4IRUB 3WBJA 2Z83A 1R0XA 3B2EA 1E3MA 2IHBA 1TADA 1DG3A 2PBRA 3K0AB 4ARZA 2D7DA 3E5HA 4QBHA 5FBQB 4OI2A 1X8JA 4F93B 2XXAA 4B74A 2F1HA 2HYDA 3W8RA 2NZJA 2P6UA 4LBVA 3AVQA 2C98A 3CF0A 4BGDA 2Q9BA 3ZQJA 3REGA 5KSOA 2IBMA 3EC1A 3THYB 2CHQA 1KO1A 4P32A 4DLZA 4LCBA 5UKDA 2LCFA 1QBKC 1X1RA 1YZGA 2JLQA 3W3AA 3Q7PA 1E9DA 3BH7A 1P2UA 1NVXQ 2G88A 4JKYA 1ZRHA 3D8BA 4LC1A 4ZPXA 1KO7A 5SZHB 4EUNA 4TL7A 2QNRA 3O8RA 4UXIA 2BEKA 4B3CA 1M34E 3DPUA 5EP4A 2E87A 2CVFA 3KJGA 3C4JA 2HXYA 4BUJA 2W83A 1GM5A 3UMRA 3B85A 2HEIA 4KITB 4RZXA 2EU8A 3A1SA 4C0AC 4K8OA 5CM8B 1AS0A 1AZTA 1ZBDA 5IDVA 3ZVLA 2CCGA 2FSIA 1N5IA 2RB4A 3B1YA 3MUFA 1P61B 2CL0X 2GILA 3CNOA 3KKQA 4KSBA 4B6EA 1KJWA 2WJHA 4M1MA 2XZLA 4JLPA 5C4MA 4NZYA 3ZZTA 1L8QA 1N6NA 3L8YA 2CJWA 1KI1A 1P2SA 2B6HA 4M9SA 2WJYA 5HE9A 3WY9A 2DB3A 1XBTA 1OH8A 3BD9A 1NIPA 3SHFA 2W0SA 1C4OA 3SE0A 5DYGA 2BCJQ 3BBPA 1Z5ZA 2PZGA 4HB2A 5HZHA 2WWFA 4CEHA 3PEYA 2NMVA 4K81B 1E98A 3I5YA 4A4DA 5EXPA 2ZRKA 2QTHA 2GCPA 4KCGA 4B6FA 5JHGB 5JS8A 4AI6A 4C0LA 5HTKA 4IDPA 1NIJA 1W1WA 3RWOA 2QN6A 4XH9B 1NSTA 1OHHD 1YVDA 2J46A 4G1UC 1UBEA 1EWQA 4Q1FA 3PENA 1ELOA 2HT1A 3CONA 3QNUA 2A5FA 5DLQC 3QIAA 1QHIA 2JIZA 3EARA 2YOHA 2G77B 4URYR 1QHHB 4B2PA 4DDUA 1Q1BA 2ZVQX 3TIFA 1I2MA 4LX0A 2PEZA 4G5SA 2GZAA 1UEJA 2V7QA 2V54A 3WMFA 1YU9A 2FNAA 2XITA 1KMHA 3NHBA 3I1FA 1GSIA 3KFVA 1D2NA 2ZJYA 3CX6A 3LV8A 4UNPA 3VR2A 4Q66C 1P60A 2GWHA 3A1UA 3OF5A 3EPLA 4TSFA 3SFVA 4CYMA 1MABB 1E2QA 5DHAA 2JATA 2VYFA 2BMFA 3QXXA 3TJZA 3BXZA 5AJVB 1J99A 4Q1DA 1TQDA 3QF7A 4G01B 1BKDR 1KZGB 3B82A 1YE8A 5KU1A 3TLXA 1VIAA 2RMKA 2IUSA 2AFHE 3UXMA 5H68A 4B44A 3THXB 2HJVA 2DYKA 4Q03A 4LV5B 1M7HA 3U7FB 1T0HB 4ZV4A 3KQKA 3I72A 1R8QA 2W00A 2J7PD 1Z83A 2WKQA 1E2FA 4P4TA 3TBKA 4V0KA 5EP1A 3VKWA 2F1JA 5KO2A 3GJXC 1TEVA 4ACAA 4LYHA 1YZLA 1AK2A 2QGNA 2D4HA 4XJXA 4DLTA 2VH5R 1IXRC 1SZPA 1L4UA 1NN3A 1P7CA 1U9IA 4QBFA 4AWXA 1JQLB 3U7GA 4A1FA 2DHRA 1KSHA 3NG1A 3PXGA 3Q5DA 3CX7A 4QKQA 3RWMB 5GJCA 2Q3MA 3DMNA 2JA1A 5JFGA 3BH0A 1VIYA 2WM9B 4IW3B 4LHXA 4C9BA 1NVVQ 3V00A 2P0EA 4BE7B 3SS8A 2C03A 4C0BA 1DEKA 1Z6YA 3RC8A 1SVWA 2QT1A 4R2HA 2IC5A 4NCNA 1XCPA 2L0XA 1OFIA 2ZR9A 3QBTA 1NN0A 3K0EA 3O8BA 2Q3FA 4OQMA 3RS4A 2A78A 2J87A 4B3FX 2C04A 3QOFA 3BJIC 3LW7A 3QPUA 4MYCA 1GIAA 3NEJA 2QAGC 1PLJA 3EZFA 2XNDD 3QKUA 1FL9A 1KDOA 4UNQA 2WSMA 1HE1C 1D9XA 2XZPA 1TAGA 4GP6A 4Q7MB 2MMGA 2ZAMA 1I4TD 2HLDD 4C3ZA 1VECA 1KO5A 3SI7A 3NBXX 3PUVA 4Q7KA 1HQCA 1HURA 2P67A 4QXAA 4URZR 5AUPB 2ZSBA 1G8FA 5JRJA 2AL7A 4YDHB 2FH5B 3W3ZB 4US1R 1P2TA 4EQ6A 3ICEA 1VCMA 1WF3A 2HJGA 2GESA 3U61B 4XD7D 2CLSA 1P73A 2JAQA 2QRNA 3WRXC 1JEEA 1KGDA 2A30A 4HLUC 3HP1A 4MYTA 5E3HA 1Z2AA 4A0RA 3WHLA 1FP7A 3QPWA 2XTNA 4MRSA 1TF7A 3GJ4A 4I99A 5FTKA 3WBKA 1Z3IX 3FVQA 2BBWA 2VSFA 1KYIA 1HT2E 4LPSA 1DAEA 4WA7A 2H92A 3IPXA 5TV2A 1G7SA 1YJ5A 1J70A 4NKRA 2ZE5A 5HZKA 3BB1A 3KKNA 4XVQA 5BN3A 4HAVA 4V0ME 3PG5A 2IXGA 4M9XA 2WMOB 1NN1A 2YHSA 2JJ2A 3FKQA 3QJYA 3U3OA 1AGPA 4IDQA 2WWXA 4M22A 3CNNA 5CK5A 3OEED 3CWZA 4MDFA 4YDSA 1S0UA 2R2AA 4TQ9A 4W5JA 3TUJC 2P3SA 1E9BA 1KK0A 4I1VA 4YXWA 4L4UA 1F6BA 1CS4C 1VG1A 2Z0MA 3P4YA 1ZCAA 2B21A 3RS0A 2ZRIA 3AKYA 4RD4A 1DVRA 4OBEA 3BFKA 1Z0DA 1JR3A 2BKUA 1K5DA 1UBFA 4I1UA 4LJYA 1L7VC 4IOKA 2ZROA 2LWIA 2N46A 1XXHA 4TYWA 3MRSA 1AKEA 3EW9A 4MRVA 4QM7A 2W2VA 4NTZA 4FCVA 4EDHA 1YQTA 2X8AA 2F55A 4WOPA 4EFNA 3ADKA 1B23P 3F0TA 1CIPA 4O25A 4YMUA 3A8TA 2XOKA 3K70D 4RD6A 3GMTA 3CX8A 1XD2B 2ASEA 1AGRA 3OE7A 4QHTA 3TKLA 5C1BA 2GAAA 3DVLA 4C7OA 4LYAA 5CYOA 1ZJ6A 1SXJA 1W46A 4CRWB 1BYIA 1NMZA 1U90A 3RVBA 3ICQB 3B1WA 5L3RA 1QHSA 3P4XA 2QORA 3P20A 1LF0A 3CRQA 4D4KA 2XSZD 2FFBA 4RZ2A 5JECA 3R9IA 3T1VA 4CVNA 2ZREA 1SULA 2DR3A 5FOXA 1WDTA 1B0UA 5H8WA 1A2BA 2PMKA 5TXGA 3GD7A 1VKJA 4PTLA 1T3LA 4KSCA 3HDTA 5D3MA 2QUZA 1QRAA 1IN8A 1N25A 5KUTA 1XEXB 3W6NA 3W5JA 4PAQA 3A1WA 1H8ED 1SKYE 2ORIA 1ZM9A 2ZJZA 1G3IA 1ZUNB 2IWHA 3FFAA 4NCKA 3W5IA 3QSYA 4W5WA 3K09C 2Q6TA 2RGEA 3P32A 1GZSA 4A6PA 1XX6A 1YR7A 4CW7A 5J4LA 3ADBA 2VHJA 3NC0C 5KNDA 2ZSDA 2ATXA 2PH1A 2WAXA 1NVVR 4UNRA 4MKFA 1VHLA 1EFHA 2EFCB 2OLKA 3E2IA 1UADA 5HE8A 3WNDA 4F7WA 3M0EA 2OV2A 1KIMA 5AWFC 1E1RA 3TQFA 3B8HA 2GBLC 2WTUA 2RGNC 4WXPA 4C4PA 4F4IA 4XWKA 2AKYA 2E9SA 4P0TA 5DI3B 3WYFA 1SXJE 2JIZD 4AD8A 1WBBA 4DB2A 3OAAA 3FDIA 2X1VA 3T5GA 2Q3HA 3IHWA 3EIQA 2A5DA 1LF5A 1G5RA 2V7QD 4JLKA 3KB1A 3GLGE 2HT6A 5H1YA 3LDAA 1LS1A 4QRHA 3SHWA 3TQCA 4P4SA 3K9GA 3VR5A 4BFZA 4FMCF 1R5NA 4DLXA 2GEUA 2DFNA 2YJTD 4BZPA 3U6BA 5FOTA 4GP7A 3UMSA 2PX0A 3FKSA 1Z0FA 3K9NA 1EFTA 1ZW6A 3R9WA 2ODBA 1U0LA 5C18A 4U5XA 3C16C 3EPKA 4F91B 1VCNA 1HT1E 4Q48A 1G9XA 2PZFA 5FUYA 2ONKA 2VL7A 1N6PA 3TSWA 3B78A 1ZNYA 1US8A 2ODNA 4FI3C 3L2OB 2JEOA 2C8VA 1VYVA 4ZKDA 4BZQA 3THWA 4A2WA 2CL7X 4DCNA 1PZNA 4R9UC 2ZSAA 3PR1A 1N5JA 3GLHE 5FR2A 3KQLA 5IF9A 1CJKC 1P9RA 4LYFA 4BZXA 3GJ3A 4A0HA 5GJBA 4JBWA 4FCWA 2WOJA 4YQFA 5HCIA 1N3BA 1P9NA 1A82A 3T1QA 3VKHA 2MSEB 5CDFA 1AN0A 2DFTA 2EFEB 3ASZA 1L4YA 4TLCA 1KK3A 1G20E 4FXPA 2BHRA 4S2EA 4QGGA 1E2LA 1JR6A 3CF6R 4PO8A 1UJ2A 3QUSA 2QBYB 3FWYA 2XJ9A 3QENA 4NCHA 1KJZA 1COWD 2JLWA 1G3QA 1OB5A 1VG0B 1P72A 3AF3A 2IK8A 3TAHA 3VR3A 3GJ6A 2DFLA 4OK3A 2E1RA 1YZUA 1HV8A 2BBTA 2JDIA 4RCZA 1EK0A 3BS4A 4L8GA 4LYJA 5DNYB 1GKYA 2O8FB 5B64A 4ZIRA 1AQUA 1R7RA 5FPYA 5BXQC 5HPYB 5JSZB 3PEVA 4F4CA 1CF4A 4MUBA 5FUXA 3RDPA 2GRJA 3LH5A 4YMVA 3ZVMA 4CGZA 1BS1A 1RYFA 2QAGB 4CF7A 1IM2A 2FFAA 1ZUHA 5KPJA 3R7WB 2IS2A 4B3GA 1S4QA 5FI0B 4B3XA 4DWJA 4ERNA 4D26A 2N1BA 1KI8A 4QNMA 4YMSA 4TMZA 5E7IA 2OEPA 3JZMA 4ON9A 2J45A 2CCJA 2CE7A 2FSHA 4TN1A 1N5LA 2PX3A 4XWAA 4GRAA 5AJWA 2ZQ5A 4DIDA 3TNFA 1NJGA 2ZRNA 2P6NA 3N2EA 3VNUA 5CDFE 4E22A 3AF2A 3WNBA 2IS1A 2P6RA 1O3YA 1YRBA 1J8YF 4MGZR 4DLVA 4GDFA 4Q1CA 1TUIA 3NBFA 3BRWD 3AVOA 4PC2A 4ESHA 1FZQA 4Q02A 1AKYA 1EGAA 2WOOA 3BB4A 4YMTA 3EAQA 3GLFA 4PHGA 2GTPA 4ILEA 3PVSA 3G82C 5CLQA 3U44B 4A36A 1JJ7A 5J40A 1H8HA 4M0LA 2GA8A 2QPAA 3PJRA 2G83A 3GEIA 3OFND 4DCUA 1XMSA 1ZIPA 2JLZA 4IOMA 2PEYA 2ZRCA 4LV8B 2CVHA 3B1XA 3LW8A 5EE1A 4A9AA 4XSGA 2JLYA 3FYHA 4FMDF 2C77A 4TLAA 4UXHA 1DADA 1HY3A 3K70B 4AKHA 3UK6A 2X2FA 3RABA 2KBFA 1OYYA 1XEWY 1AZSC 5LPNA 4CDGA 4RFSB 2HV8A 3LD9A 2V6IA 4OYHA 1RRCA 1PJRA 1JAHA 3VHLB 2P65A 3H4MA 1U0JA 3C7KA 1FP6A 3MD0A 4D0LB 1EFRA 2IEZA 1YR6A 1AQYA 5AJXA 4TZ0A 3PUYA 4CZ2A 2J5XA 3KJEA 4YXWD 3IEVA 3SZRA 2O8EB 3DZDA 2IYLD 4KLZA 5GJWC 4D4MA 1JXMA 4KI0A 4EAQA 3CNLA 2F9MA 4Q1AA 1KI7A 2D62A 2ATVA 2W58A 4O3MA 1K6MA 1XTQA 2C99A 4MGIR 3C15C 1FMLA 1QHNA 2I4IA 5LDDC 3WP0A 1J7KA 3DZ8A 1T9HA 1DS6A 4M9QA 4NL4H 1E6CA 1U8ZA 3KTAB 1QHYA 2W0MA 5A0FA 1A5TA 2FN4A 5KSPA 1P75A 3LAWA 4Q4JB 3QKRB 4LBWA 2EYUA 4ACBA 1C9KA 1SVSA 2OILA 4LUCA 4DCSA 3DMDA 2QSYA 5KNBA 3QXCA 2XJ4A 3DM9B 3BERA 1XTSA 3AVTA 3ND9A 3OE7D 2EWWA 1T3HA 2VBCA 3PCRB 1E0SA 1SXJD 5K8UA 3AP3A 4DSTA 4RD0A 5CIWA 4B32A 1SVMA 1ZU5A 3UANA 4QHYA 5L3SB 1R2QA 1RW4A 2P2LA 5AUNB 5BN4A 2PCJA 3L0OA 4DIEA 1JB1A 1IN7A 2DCUA 1GNQA 1XRJA 2C2HA 3MWYW 4LOAA 4G5RA 1FTSA 4G5GA 1G19A 4Q9LA 4DLRA 2D2FA 4JVMA 1RFLA 3L43A 5EE9A 1XTIA 3WYGA 4R71A 3I5XA 2OCBA 1JEDA 5KSZA 5AJZA 1II9A 1Z8FA 2REBA 5JMTA 5JWOA 4E5UA 2H1LA 4Q1BA 1W0KD 4B73A 3EWSA 4IFEA 4JMPA 1KKLA 1FPMA 4B71A 3CRVA 1G7RA 4Q4AB 1ZU4A 2A7QA 4XTCS 3LFUA 1ZM3A 2IF2A 3MCAA 1YRAA 3U4QA 3QVUA 4AC9A 3GEEA 2WWIA 3HYTA 1KNXA 2WWYA 1GKUB 1E1RD 1QZXA 2R6CA 1ZUIA 1ZVQA 3D31A 2AXNA 1D2MA 1DPFA 2AX4A 3A58B 4BEBA 1SGWA 3OAAD 4JS0A 4OJQA 2REXB 3EZ7A 2GCOA 4O2RA 3K0CC 2R62A 3VX3A 1IY1A 1E2EA 4KFRA 1IBRA 1CRQA 3K0FB 2V1UA 1S3GA 2KBEA 3Q3JB 4GOKA 1I4DD 2WBLC 5AR1A 2O8DA 3IHLA 1KK2A 4BFUA 1ZM7A 1DOAA 3LNCA 3A37A 2V55B 1XJQA 1RJ9A 3QF4B 4JT2A 4LRWA 2ZUCA 2CL6X 4UXJA 1NNEA 2CHGA 1FOEB 4BFTA 4KVAA 3TW8B 4WIAA 1RE0A 3NHAA 3OIUA 1ANKA 4TMXA 1S1MA 3U3KA 2QENA 4KBGA 1YHNA 1XTRA 4QGFA 1LTQA 4RY2A 1KI9A 1KI6A 2B8WA 1U94A 3KL4A 3GLIA 1RPZA 1D5CA 1ZD8A 1GUAA 4RD1A 4X8MA 2VSOA 4U00A 2DWOA 1EX6A 3D3QA 3QG1A 2ZPTX 1G7CA 3ZD7A 5A5GA 1CJTC 5KOYA 2ZI7A 2FOLA 4GMDA 4JIMA 1KI4A 4MQBA 2FSFA 5J4KA 2W6JD 2Z6VA 1UM8A 2J0QA 3T61A 4ITRC 5TB5A 1UKVY 3VHXA 5P21A 3B9QA 1W44A 2FPKA 4TZ6A 1U98A 3E70C 2Z43A 3G0HA 1OPXA 2F3RA 2OZEA 1NL3A 3VFDA 4MRRA 2XB2A 5JWHA 2ZRGA 3CBQA 4DBLC 3CO5A 1IN6A 1KDTA 1KOFA 2QMHA 3TR0A 3THOA 1F5NA 2OFWA 3TAUA 1GVNB 4OK5A 3VTKA 4ASUD 1ZNWA 2D2EA 1BYUA 5IT5A 1D6JA 1E1QA 4WW0A 1ZNXA 1A7JA 2IYZA 4NYIQ 3LLMA 2ZAOA 4HYYA 3T15A 2O0KA 5ELXA 2IF0A 1GG2A 1Q3HA 1ZC3A 5EUQB 1F2TB 2FSGA 4Z1MD 4KHZA 1UAAA 1DBSA 1DAKA 4B2IA 3NWJA 5JHHB 1CTQA 1Q20A 2AWOA 2LKCA 4Z8XA 3EZ6A 4F92B 1MH1A 2ZJBA 4PAMA 4XTRA 4NH0A 4IDNA 1H65A 1ZM4A 1A4RA 1W4RA 2O8CB 1XTKA 2ORVA 3LX5A 5AK0A 2P5SA 1UKEA 2ERXA 3AVUA 3D6TB 2LKDA 4M1YA 1OV4A 4XWOA 1G41A 3LQQA 3RANA 3FHTA 3ZVRA 1XWIA 2FE4A 2H18A 1SKYB 1GKIA 3AP2A 4X8HA 4Z8YA 2AN9A 1G6HA 1KY2A 4A15A 4B43A 4PPNA 2QQEA 2WKRA 2H8KA 3LVQE 2J9RA 3VR6A 1H8HD 1UFQA 1TF5A 4GSYA 2CDNA 3Q8XB 1OJLA 4DLSA 3K09A 4JL5A 4PQRA 4XIGS 4CEJA 2N42A 2CMKA 3DL0A 2HUPA 4PQFA 4WBSA 2ANCA 2YYZA 3QQ5A 4FINA 4OHXA 3RRMA 8OHMA 3ECCA 1WMSA 3QPVA 2VP0A 3IQXA 3EPJA 1DG1G 1UKYA 1V43A 4NYMR 2XNSA 4G5QA 1Z6TA 3MGCA 2BJWA 2GBLA 2ZI9A 3KZ1E 4CEIB 2GK7A 2RGNA 1EFRD 3MG9A 1K8RA 3Q7QA 4PX9A 3ADDA 4IXMA 2AR7A 4JSYA 1FNMA 1R5BA 3IQWA 3GLGB 5FL7A 3A1VA 2VHTA 5JEDA 2ZU0C 3DEFA 1Z0AA 4GOJA 4DVGA 5JJKA 1TQ2A 3EC2A 2R6AA 2QAJA 3NEYA 4DXAA 3ZD6A 3AVYA 2UZ3A 3IO5A 5CB8A 1VYTA 2WJGA 3K0AA 1D2EA 3TGPA 3TSZA 3U2QA 2QM7A 3AGPA 4A6XA 4W9MC 1NRJB 2ZRMA 3QKSB 2Q0HA 1CR1A 1GITA 3FMOB 1M74A 4DT1B 1R10A 1XNJA 3C5CA 1G5PA 2WICA 1XP8A 2QT0A 3RYTC 4BFWA 1F60A 3THYA 5B2ZA 4HB3A 3AEZA 4Q19A 4Q9JA 4HEJA 1E79A 4JKIA 1AS2A 2RH5A 3X1ZA 3ONWA 2BKEA 4JLDA 2OBNA 2QMOA 4HLDA 1U8YA 2NOAA 3I61A 2VP5A 1IN5A 1KAOA 1YZNA 3T1TA 3SBDA 3L0SA 1E2IA 3GLHB 5TDHA 2W6ID 5DGXA 4EJSB 2W2TA 3MSXA 2Z5FA 4Q47A 3T5DA 3KB2A 3CF2A 4KLNA 1LVGA 5DSZA 3LXRA 4O0MA 2IHYA 2RHMA 3U7HB 1OKKD 3U3JA 2QE7A 1DAIA 3NXSA 1OFUX 3Q85A 4RD2A 4TT3D 2CK3A 1KI3A 1N0UA 1ZP6A 4JLVA 3OESA 5CYPA 2GJ9A 1JBKA 1N6HA 3CWQA 3PFIA 3IBYA 4E03A 1TU4A 3L82B 3R8FA 5FTJA 1FX0B 3HR7A 5KDOA 4A92A 1XMVA 1ZNZA 1VCOA 1MO3A 1M8PA 2QY9A 1SVLA 2QPTA 4HB0A 3SNHA 4UKDA 2CCKA 1CU1A 1JPNA 4BWYA 4D81A 4ZCMA 2IUUA 2QQ0A 4OHVA 2ZJ5A 5GADl 1N6KA 3DO6A 1N6RA 4QBGB 4TLDA 4NHOA 1Z6XA 2OBMA 3FE2A 4N0EA 4KODA 5J4VA 3VX4A 2ZE6A 4EKDA 2PJZA 3ND8A 5HKKA 1QHXA 4KO8A 1CR2A 5L3QB 4XSHA 4BLOA 2V3CC 2VHQA 4UJ5A 1EWRA 3NVAA 3OEHA 1II8B 5KPDA 5EE3A 1Z0JA 2H17A 2GJKA 5JCZA 2GXSA 2OG2A 4BPBA 5FOSA 2J7KA 3K70C 2AXPA 2NGRA 2FEOA 4Q7LA 3ZQ6A 5EE0A 1UDXA 4OQFA 1E2DA 2EFDB 4IFBA 5F9HA 5E7JA 4V0LA 5BW8A 2YNMA 3CM0A 4Q4LA 3BK7A 1X86B 3R20A 5EE5B 1KI2A 2FA9A 3G5UA 4URXR 1YR9A 2WIBA 3WMGA 4WXRA 2CXXA 4D2IA 4PHFA 2VP4A 3KQHA 5K8LA 1GOTA 1QHHA 3UPUA 5FOVA 3H2YA 4ZCLA 1OF1A 1Q21A 2FG5A 2IL1A 2C96A 2IA5A 3ASYA 2ZU6A 4IJMA 4KFSA 1UPTA 2BVNA 4HATA 3IIMA 3RSLA 3A4LA 3RC3A 4AYXA 2ZRHA 2OHFA 1CBUA 2R8RA 1W36D 4BLPA 1J90A 1HE8B 4DJTA 1UEIA 3MWJA 1IJEA 3ZIAA 3CZPA 4D6PA 4B48A 2J1LA 4BQSA 1U81A 4ZDJA 3PEWA 2GJSA 1OLOA 3SYKA 1MABA 2I1VB 3OZXA 3TSOA 2XTZA 1JECA 4RZUA 1XFAA 3TRFA 4EFLA 1G64A 2EFGA 4TL9A 1E9EA 3P27A 1K5GA 2OFXA 4OHZA 2RGGA 2VF8A 3THXA 4TYQA 3VU9B 4MDEA 4MYHA 4LJ6A 4Q4HB 4QM6A 1MRNA 2QMUA 2WWWA 4GL2A 4Y0AA 3B9PA 5L8VA 1F2UB 1WQ1R 4GI7A 3AP1A 1S3SA 4FD2A 3SBEA 1E69A 4LDJA 1XCMA 1XMJA 4NE2A 2QP3A 1JR3E 4AYTA 3H0KA 4JVSB 5JS7A 2IYVA 1W48A 4OJKA 1QDEA 3RS7A 5SZIA 5BYJA 2ZUBA 3BORA 3IGFA 3H84A 5J5CA 3CB4A 1XXHE 2J0UB 2GNOA 1T3SA 4OI1A 1E2GA 3A4MA 3GJ8A 1E1QD 3Q72A 1EX7A 2AHOA 2H57A 2QTFA 4KYIB 5DN6A 3PITA 4CT4B 4D0GA 4HI0E 2ONJA 1WRBA 2GCNA 3AKDA 1UF9A 5FTMA 3RLFA 1EFCA 4NCIA 4WVFA 1M7BA 4ABYA 4PHHA 2GZHA 2FPLA 2ZJ8A 2QPOA 1P4SA 2BM1A 3BWDD 1A2KC 1G8YA 2NQ2C 1C1YA 4M1WA 4B35A 2HXSA 2VP9A 4PO1A 4R98A 2R6GA 3S1AB 3U3MA 1G291 1CR4A 4R2IA 1RKBA 1KTVA 3LLUA 2JLXA 4LY6A 5G3YA 3T34A 2GZDA 1M6NA 3X1XA 2WZQA 3HJNA 4FW9A 1KHTA 4OKSA 3QXSA 1Z07A 1S9DA 1X3SA 2O0JA 3U3RA 4A0FA 1S2MA 121PA 221PA 3TVDA 4PZZA 1R4AA 2ZS9A 4TSFD 4L15A 1VTKA 5LB4A 3V4RA 1W49A 4A0GA 5BN5A 2FPMA 2NO1A 3I92A 3TK1A 5KYKA 2HCBA 1FUUA 3GJ7A 1S9HA 3B1VA 4KV9A 4Z51A 2FMXA 1BMFA 1TQ6A 4JVNA 4B3BA 1MO5A 4DB4A 3CW2A 1Y63A 3MWLA 2YC4C 2GF0A 2F1IA 3JVUA 2IYQA 3EIEA 1P6XA 3AM1A 1YZKA 4ZDIA 3K1JA 4IVRA 3R9XA 1U8AA 3TMKA 3MMPA 4C0HA 4BEJA 1N6IA 3MLEA 2QA5A 1I2DA 1XMIA 2ZYWX 2ZSFA 4Q9HA 5TMPA 3CH4B 1WCV1 4PHTA 2GJ8A 3IIKA 4RJLA 1W2HA 1T4GA 4DSOA 2YV5A 4IDOA 4WZ6A 4ZI2A 1HEIA 2WHXA 5FL7D 1VPLA 1LW7A 3CRW1 4LWZA 2FZLA 1NLYA 2KSQA 3TW4A 3K0CA 821PA 2ZYTX 3BE4A 3WXMA 1R5OA 1W4CA 3ZGXA 4A8JB 1J2JA 1N6LA 1MOZA 5FI1B 2F6RA 2NPIA 3MJHA 4OQXA 3TVTA 3EG5A 5CB6A 1NVWQ 1Q3TA 3ZLJA 5DIFA 2ODEA 5LD2B 4MRNA 4IXNA 4C0KA 3HU2A 4UQOA 1G8HA 4OHYA 4LJ5A 4N1AA 1QG4A 3NH9A 4TMTA 2YOFA 4Z54A 3VKGA 1KSGA 2QG6A 1E79D 3GFOA 2GEDA 3QEOA 2CHVA 5E7MA 2PJRA 1XF9A 4I1OA 4DLYA 4EPXA 3TH5A 1W0JA 3NBZC 2BEJA 2JGNA 4FWTA 3WHKA 1TMKA 1IAQA 4TYPA 3C14C 4I4LA 2HF8A 1OIVA 3SJBA 4TQAA 4PC6A 5BYKA 3BC1A 1XJCA 2HF9A 1XD2A 5EUMA 3RNLA 5DHFA 2QE7D 4JLJA 3X1YA 4ARZB 4BRWA 4ZCIA 1KDRA 2EYQA 1DO2A 4DDTA 2CK3D 2OSBA 2XXAB 1OXUA 1FTNA 2VRWA 2B7BA 4RCYA 2ZJOA 4CT5A 2C5LA 2OUKA 4WZAE 3N5CA 1NBMA 4IEIA 1XEFA 3SOPA 3DDCA 1EG7A 4G3XA 2FGKA 3U7EB 2XB4A 3PUZA 2C9OA 4FIDA 2ORWA 1CJUC 1E9CA 1ZD1A 2GVZC 3VU9A 5KSYA 1XU4A 1JXOA 3SJZA 5TARA 2GXQA 4B2LA 2GETA 2WAYA 4JYBA 4B76A 5JI2E 1P9WA 2QM8A 2OXCA 3EIHA 4JJKA 2DWPA 2F9LA 1GL7A 1S96A 1DTSA 2H5EA 1XEXA 2V6JA 1WBDA 3C5HA 1FQKA 4TYYA 1HH4A 3EZ2A 1T6NA 2JJ2D 2VHCA 3X1WA 5JCPA 1Z08A 5IK2A 4DRZA 1E0AA 4HZUB 3T12A 4DSNA 5JWRA 3VQTA 3A36A 3OEHD 5DI9A 1G21E 4M1KA 1MR3F 2BMEA 2ERYA 4QJ5A 1KKMA 4BRUA 3B5JA 1N0WA 4TTRA 3K0SA 1E2HA 5E4FA 1GWNA 3AGQA 3P1JA 4TTQA 4BFXA 1QG2A 5FL3A 4F38A 2Z4SA 4KXFB 3MAAC 1U99A 1SXJC 1GTVA 1KAGA 1L2TA 1JR3D 4XOIA 5DI3A 4C2UA 3F3YA 4BFYA 1E9SA 1Q1ZA 1NN5A 1RVDA 1I4LD 4PPQA 2G9NA 2QL6A 1Z06A 2CJWB 4NP6A 3NDBB 1NBME 3BIFA 1MO4A 4QBIA 3KUCA 4OK6A 3GLFE 3U6KA 2OE2A 4LK2A 4KFTA 2G6BA 2WJJA 4AKIA 2BBSA 2QP4A 3MWKA 4ZI3A 2VSXA 2AWNA 4CEHB 3DHWC 2DWQA 3ZIAD 2IT1A 2XOKD 3Q9LA 2RGBA 4Q18A 1NSFA 2IYYA 2ZSEA 3B13B 4L16A 4M1SA 5C4GB 2A3RA 3PEUA 5EP3A 4KFUA 4KJZA 3EXAA 2ZR7A 1MT0A 1OIWA 4ZDKA 1G3MA 3O8CA 3WYAA 4GBMA 5IRCD 2JLSA 2NG1A 3AF1A 4NYJQ 2F3TA 1MO6A 5L3VA 2VEDA 2Y8EA 4GMXA 1Y3AA 2F7SA 3CRRA 3ETLA 4Q7JB 4A82A 4EJSC 2XGJA 4MITA 1X8KA 2JLUA 1OIXA 4H1UA 3ZS9A 3AKEA 1SVKA 1KMHB 5H70A 4HB4A 1KO4A 1PV4A 2JLVA 1AIPA 2K5UA 1HTWA 4TYNA 1S1CA 5F98A 4M21A 2NZ8A 5G41A 2FF7A 3EASA 3JVVA 4HLCA 2QBYA 2DPXA 4FMDB 1OFTA 4JJZA 3FPAA 3KDSE 4Y0VA 1G7TA 4D82A 2YWGA 1E9FA 1Q22A 1E0KA 3NDPA 2UKDA 4J0QA 1TL7C 5DH9A 2VLIA 4XD7A 4B47A 4KAXA 4C0QC 2O8FA 5G40A 5CIQA 5JSZA 3SYLA 1E94E 4AG6A 1OB2A 2ZS8A 5FUWA 5B58C 4LJ7A 2PL3A 1LFDB 2QAGA 4BLTA 1JPJA 1DAGA 5FBWB 3R7WA 3EZ9A 4L9SA 1OFHA 4AIIA 1OT3A 5GVRA 3W6OA 5M04A 3L0IB 4RD3A 1GL6A 4IDHA 4ESVA 2OT3B 4I81A 1IHUA 1XB2A 2XAUA 3CPJB 4GT1A 4PQYA 5IHPA 3ZS8A 2W2XA 4LHZA 4PZLA 4Q1EA 3REFA 4PSKA 4Q00A 521PA 4C30A 3AF0A 1U2RA 4DUGA 4NCJA 4DEXA 1EFUA 2VF7A 1NI3A 1RRPA 2JJ8A 3FKSD 3LVRE 4JL8A 2EFHB 3PV0A 4HLUA 4EPRA 4IHQA 2PT5A 2FFQA 5A4JA 4UNNA 3DKVA 4Q01A 4FWIB 3SYNA 3KKOA 4NONA 5JRZA 1BMFD 2BWJA 1AA9A 1SQ5A 4DLUA 1CKEA 1G8GA 1GRRA 2DY1A 3B6EA 4PXAA 4V0OA 4MKIA 3UWKA 3DKPA 4Q9IA 3AQ4A 3U44A 3KQNA 3T06B 1GAJA 1ZYUA 3SDZA 4OQNA 1NLFA 1X6VA 1VDZA 1XTJA 1NG9A 1VMAA 4A2PA 4P31A 4GZLA 3X2SA 2IX3A 2X77A 3I4LA 4NBSA 3QEJA 4KBFA 4DZZA 3EA0A 4DCTA 1VHTA 4EPVA 4RFSA 2WWGA 4HZUA 2YVUA 5EZ6B 1SHZA 1E2MA 1WA5A 2HCJB 2VIIA 2JDID 1CR0A 4EQ6B 1GILA 3KQUA 3UIEA 2BBOA 4GOXA 2NO7A 3KUDA 5EXTA 2GAOA 2XSZA 3P26A 2O8EA 1Q1QA 2FV8A 3W8NA 1D9ZA 2QSZA 2JJ1A 3OIWA 4OI0A 5BWMA 4PZYA 3AVXA 3DM5A 3RRNA 1W2GA 4HSEA 3LBIA 5FPSA 1KDPA 2GXUA 1E4VA 2Q9CA 4JYCA 2ODWA 2JASA 4KU4A 3UG6A 4EIWA 2J0SA 1SVOA 2F1RA 2Z4RA 4URWR 2UZIR 2YINC 4HAXA 3GLIE 3KTAA 1H8EA 1N2CE 1W0JD 4JVLA 2ZI6A 4U7DA 3DOEA 4Q4JA 1E99A 3QKRA 2YWFA 1HA3A 4H1VA 3NC1C 2WSSA 4AG5A 1P62B 1HYQA 2ZEJA 1CULC 3LRPA 4QFMA 2RGXA 3FTQA 3MJRA 4OL0A 4URUR 5B30A 1T8TA 1RIFA 2OO7A 2OCYC 4PC3A 2XZOA 2OLJA 4II7A 4HUTA 3KXIA 5J4YA 4PC7A 1W47A 3LX8A 2FZ4A 1Q44A 2X19A 3LWNA 4PC1A 4PR0A 5C2JB 2ZRFA 3IUYA 1VCIA 5EJEA 3HR8A 4DSUA 4NYJR 2C95A 2G1JA 2PT7A 5L3SA 1NBMD 1E9AA 2WVJA 2ZR0A 1OH5A 1S8FA 3O8DA 2A5GA 2O52A 4LPKA 1BIFA 4B33A 3A6PC 1CRPA 2J3EA 2CE2X 1XXHB 4JLAA 4TMKA 4ZKEA 4BFSA 2GVDC 2PLRA 2FFHA 3BFVA 1LNZA 4GPTA 2OBLA 2A5JA 3SFZA 2RCNA 3CZQA 3KJIA 5KDLA 1MRSA 3AKCA 2FGJA 3LBHA 2EW1A 4PSVA 5TVKA 2IEYA 2ECKA 2D7CA 3LQRA 3GJ5A 4MRPA 3ZH9B 1DAHA 3FHOA 2O8BB 2QEQA 1DE0A 5JI3E 3SJCA 5IK2D 2GDJA 4C7OB 4AY2A 5FPHA 5TY0A 4LJAA 5F3WB 1SXJB 4JBYA 4M1OA 4TL6A 2REOA 3FMIA 1OXVA 2BV3A 4Q4AA 1M2OB 4B75A 1YR8A 4HAZA 4DC9A 5FH9A 2ZE7A 2KWIA 1P5ZB 4US0R 3Q5EA 1N6OA 3QG5A 1W7AA 2GKSA 5CLLA 5CJ2A 2Q9AA 5FR1A 3RRZA 1KMQA 2PMDA 1TTTA 1IY2A 1JI0A 2CLDX 3MFYA 3NIBA 4MGKR 3KXLA 4Q5IA 5F9FA 3RS2A 3FB4A 4JZKA 3VR1A 5D3MB 2CNWA 4PO9A 1NG1A 3FFBA 3FGNA 5LB2A 3IIJA 1KSJA 3GFTA 4A8JC 2R6FA 3K0FA 1COWA 3ZJYA 6Q21A 2ZRJA 3GP8A 2G3YA 1GRQA 3ADCA 1R8SA 4BASA 4C0JA 3QF4A 5LD2C 4QOSA 2YKGA 1P2VA 4C0SA 1OE0A 4RKEA 3NTUA 2EVWX 2G1KA 3BAFA 1E96A 1OW3B 2ZRBA 3BGWA 4OQLA 2UVQA 1ZC4A 4DKXA 1Q0UA 2GEVA 1NY6A 1SVIA 1N0VC 4FCTA 1IN4A 3GEHA 1OXSC 4V0MA 4GNKA 1Z6AA 3HU1A 3BOSA 3CRMA 5DISB 4QJ3A 1E9RA 1QVAA 2X2EA 4E09A 1KY3A 3IEUA 1PLKA 4L5BA 4EPYA 3KXKA 2QMEA 2QZ4A 4QNRA 3EA5A 4B3DA 1PVOA 5HR5A 4P4SB 3V4FA 4EFMA 1V5WA 4IOJA 3AVVA 3K9HA 2WWHA 3K8YA 3FOZA 1AJEA 2ZXUA 2A9KA 1ZINA 4DHEA 5B57C 1UDWA 4ZDWA 2BIFA 2YWEA 3W90A 1G17A 1Z29A 5E95A 1M7GA 2OXRA 4EPWA 1EXMA 1BH2A 2Q21A 1PUJA 2ZI3A 1BOFA 1XPOA 5FBRB 3HPRA 4G5OA 1W5TA 4HDOB 4YC7A 4QHSA 2JCSA 2EWVA 1FQJA 1US8B 1SKQA 3NBYC 4P33A 5DO9A 2WJIA 1DELA 3W6PA 3PIRA 4E07A 721PA 1W36C 1CJMA 1E2NA 3THWB 1G3UA 1KJYA 3LBNA 4RZ3A 2J0VA 5CM9C 4HAYA 4NYIR 2A2ZA 3CPEA 3OFNA 2QTVB 3QE0A 1IJFA 2WV9A 3I73A 1MKYA 1TQ4A 1TPZA 3UWOA 2DFKB 2WMNB 5K8TA 3A4NA 5FTNA 3ZZUA 1F2TA 4HZIA 2OAQ1 2ZETA 4BFVA 1G8PA 2VP2A 3E1SA 3QXJA 3VAAA 1XZQA 3M4YA 4TLEA 1E2JA 3H86A 4MYUA 4CIDA 3I32A 4PSAA 1QF9A 2RKOA 1IXZA 4MKGA 4TMVA 5DYIA 3RS3A 2NO9A 3QY0A 4B34A 2QU8A 4DUGD 4FN5A 3I8SA 2F43B 2WPDA 2O8CA 3TR5A 4ZIRB 2RGAA 1Z63A 1ZM2A 4P4UA 2RGDA 4HUQB 1VYUA 1XPUA 4M9ZA 2KJQA 2AKAB 3OIVA 1TX4B 5K8IA 2BOVA 1NKTA 1G4AE 1CXZA 1DO0A 2QRZA 2AD1A 2FEMA 2ZUDA 1IY0A 3AV0B 4WAUA 5FOWA 2BCGY 3A1TA 4PANA 4QGHA 4BLQA 4TTPA 1U0HC 2ZM5A 1LY1A 4TWZA 1ZCBA 3HPQA 2V9PA 1XEWX 2ZYUX 1R0ZA 4BLSA 1N5KA 1LS6A 1NP6A 3BH6A 4MGYR 4JSTA 1ESMA 5HCNA 1EESA 2RAPA 1TU3A 5FUVA 2FDCA 1NMYA 4KVGA 3JZAA 4U02A 1G16A 1W4BA 2DBYA 2IUTA 3ZDQA 1T5IA 1XD8A 2BMDA 2MMCA 2OM2A 4LI0A 3SU8A 2XTMA 2PZEA 3KJHA 2RHDA 4IVQA 1QVRA 3B60A 1G4UR 4HLQB 2ZE8A 3CLVA 4G0NA 4AYWA 3IILA 5KDDA 3RS5A 2O8BA 4DDWA 5G3ZA 4CEIA 4JLNA 1VG9B 4A2QA 5F2EA 2B8TA 1W4AA 3WP1B 3QKTA 3GLGA 2BMJA 4POAA 2AK3A 4LBYA 5LBIA 3GLFB 5JJIA 3AUYA 2IYUA 3PUWA 3PQCA 2AD5A 4UNSA 5ANRB 2JJ1D 3OHMA 1GFIA 1G1MA 1OXTA 1T5LA 4JLOA 2AFIE 1Q1EA 2IWRA 4S35A 2KB0A 4OI4A 4WZBE 4V03A 3GPLA 2D06A 3QKSA 1W0KA 1A1VA 4DT1A 3L8ZA 4HAWA 2GHIA 2VQSA 3RRYA 1M1YE 2ZVPX 2C9YA 3GJ0A 1KZ7B 3LY5A 2H7VA 1ETUA 2WSSD 2ZRLA 4LSGA 4RFVA 2O5VA 5FTLA 5GVSA 4PAOA 1KNQA 3T1OA 4DLWA 1TEXA 1GL9B 5SZKB 2R6DA 4NPHA 1T91A 3GLHA 4M8NE 2QP9X 1JNYA 4RKFA 4EJSA 2YZ2A 3C41J 4QC2A 3T35A 2VHUA 5JEEA 4AKGA 1UBCA 1WP9A 4F4JA 3I3SR 3U5ZB 5JLJA 2ZTSA 1OXXK 2G0NA 4M53A 1YKSA 1U9IC 3SEAA 1KO8A 2MSCB 3QXHA 5KHOC 3EX7C 1P3JA 2CBZA 3CPHA 1X1SA 2RGCA 4N0DA 3WNCA 2GJAA 2EQBA 2ZRDA 1T8UA 4FMBB 3EPHA 2V8OA 4BECA 4P3YA 2V1XA 3NKVA 4TLBA 3HWSA 2V4ZA 4O2LA 5CK4A 1FX0A 2D74A 5GJVC 2ZI5A 4EPTA 2VP6A 4H9GA 2ZRAA 2IYXA 2ZYVX 2BM0A 1R0WA 4D25A 3F5FA 3ZVNA 4JT4A 2IW3A 4UJ3A 5EXSA 5AJYA 1RC8A 3AF4A 1XJ0A 621PA 3F8TA 4DEYA 1E32A 3ZYCA 2OCPA 4RSGA 1NVUQ 1XZPA 4NMMA 1LV7A 4PPGA 1HUQA 1R6BX 3LXXA 5L3QA 1FFHA 2CEAA 2FX3A 3AB3A 3I8XA 1IOZA 1NJFA 3X1DA 421PA 1II8A 3WRYC 1CEEA 1NLZA 3AVWA 2AK2A 2BC9A 3CUEF 2NO6A 4LHYA 2BDTA 4LV6A 3CH5A 4YLGA 1XD9A 3BFXA 5FPTA 2W6JA 2CNWD 4TMWA 2O0HA 1YZQA 1GNRA 1Z22A 2IYTA 1D8TA 2PLFA 1OH7A 3B7GA 2G0TA 4MA4A 4QG7A 5KNCA 2QROA 3IPYA 1XPRA 5JJLA 5FBVB 4JL6A 1IQPA 3AVPA 1XDBA 1CJVC 1JQJC 2F43A 1ZD9A 4HAUA 3U4QB 2IS4A 5JBQA 4HUQA 1ONBA 4US2R 1PUIA 4URVR 3SJAA 2OFOA 3IO3A 3N2IA 4ASUA 3QI2A 2XEXA 5AUOB 2ZRPA 1UBGA 2R65A 3AUXA 3O47A 1OH6A 1MV5A 2WKPA 1Z6GA 3K9LA 4FMCB 2OESA 4M4SA 2NIPA 4XVUA 4IVPA 4KYUA 1OHHA 4Q21A 4V02A 1JJVA 4D0NA 1NF3A 1WXQA 2GCOB 2ZS7A 3CIOA 3SC3A 4Z1MA 5D3QA 4X8OA 2H16A 3H1TA 4QJ4A 1KK1A 3M1IA 2YWHA 3CR8A 4W7SA 1PLLA 4LHVA 5AUQA 2GF9A 2R44A 4OHWA 2O8DB 4IKEA 1RJ9B 4MH0R 1Z28A 2HDNB 4IEEA 4Q4HA 4JLMA 3M6AA 5FBLB 2OCAA 4LJ8A 5JZVA 2ZITA 1J8MF 1F2UA 3LO5A 1W36B 4LZZA 1WE2A 4M2LA 3KKPA 4XVRA 1RRGA 5J4HA 5FOUA 1T0JB 1FMJA
chains in the Genus database with same CATH superfamily
2W7TA 2VTKA 2W93A 1ZMRA 1G18A 5C8VA 1SHKA 1DAFA 3IKLA 3CVYA 1KI6B 1OLSB 1PT7A 3GQBA 3TUIC 1NNLA 5IXYA 1E4OA 4CN8A 4Q3LA 3BB3A 4DV1B 3KPYA 3EWAA 3TUZC 3A9WA 1KMMA 5FJJA 4QUAA 2J0UA 1ZGAA 5AW1A 1PWEA 2Q2OA 1RU3A 4L6CA 4FDMA 4RHEA 1Z38A 5E2IA 4N65A 4NBLA 4B3SB 1DBQA 2VA8A 1L4GA 1IQ0A 1V5IA 4GVPA 5SY9A 1HDIA 4XR4A 4IOLA 3U7RA 1FTGA 3UMFA 3CTMA 3NUQA 3I62A 4NECA 4B6GA 2DUUA 1II0A 1YHYA 3NTXA 4FYXA 2W98A 3AR5A 2QG9A 2BAGA 4FLMA 4QGAA 2VRCA 2GFQA 1NUUA 4JJGA 1GZ4A 5EZYF 3GFPA 1LI7A 2NYRA 3KVOA 3N70A 4MVJE 4NJEA 4I8XA 4HG2A 4R1UA 3LECA 5DM70 1DLIA 2C3PA 4XM0A 3S1AA 4DM4A 2V9ZA 4H4EA 1A7UA 3GH3A 1ZL0A 1K4KA 2IUEA 1QDLB 4JU9A 4XRRA 2FQWA 3T6KA 3WIOA 4D0NA 1OSNA 4JJ7A 3S81A 1AKRA 1KSFX 3S0JA 5ALEA 4DJ5X 5CITA 5KTYA 4FYVA 1DRUA 5KC9A 5JY1A 1NJ2A 3EYAA 4GGMX 4PCUA 2X9LA 3I9JA 1GDDA 1UZLA 2P4SA 1LSOA 1MDBA 2G67A 5DTQA 3OZBA 3SQDA 5LZ7A 2CDCA 1AS3A 2SHKA 2DY0A 1JHVA 1LC0A 1WVIA 1ZGZA 3BMOA 3C4VA 1P7PA 2LUOA 4OA8A 3HJGA 4C2TA 3UFBA 5IBCA 1OYWA 3T3OA 1KYVA 3HGMA 3Q41A 4L9WA 3TD6A 4EABA 5C37A 2AC4A 1J5EB 1HG0A 2O7NA 2BFOA 5KQGA 1U8XX 5AVOA 3I9MA 1QRUA 3ICQB 4YAEA 5DM4A 1HQYE 4C7BA 4AURA 3CWCA 3ANNA 3FNHA 2XCOA 4X7RA 3I83A 3EVTA 4RXMA 3SQXA 5EQTA 1ULTA 1NMEA 2Q6KA 4L07A 2WJVA 4C07A 1ISJA 1GNPA 4ZQFA 2LCQA 3B1ZA 1NXPA 1O87A 4IJWA 1ZIOA 1BQEA 2OHIA 2NXCA 5HOQA 3T95A 3RSCA 1TCAA 3H0CA 1R3UA 4D80A 2MSDB 1GTSA 4Y98A 1Q57A 1A0OA 1F48A 3E5RA 3WK6A 1CIVA 3FRIA 2DHDA 4WLNA 4HDCA 1X8XA 2X3UA 3DOFA 1RC1A 1X13A 1OWOA 1I5OA 3L0PA 3F9IA 4INZA 2VO1A 2PCLA 3FNIA 4V0NA 2QRUA 4WPGA 5HQJA 1R18A 4LKOA 5CA0B 4YDQA 1I33A 4HAOA 4HYTA 3G5TA 3RHFA 5EHZA 5K0EA 2CLCX 3P5BA 2VPPA 2Z58A 1YNOA 4NIMA 4J4HA 4X5OA 1C0EA 2CFTA 4KJXA 5ALQA 3UWMA 2J9FB 3GOHA 5TT0A 3HU3A 4CEJB 4TQUS 1RRFA 2ZZMA 4AUNA 3PNLA 4PYRA 5LXTA 2GKGA 4FQ7A 3DXFA 4X90A 2C5HA 5GMOA 4K9LA 3CLRC 4QD3A 1FFGA 1NVTA 4G0YA 3KSMA 3L1KA 4LEIA 1CLUA 1YTLA 4AQDA 1E2PA 1ES9A 5B6PA 4C6TA 4ZVKA 3M2TA 3FHCB 3M4JA 2DHQA 1ESNA 4GYYA 5B2FA 4QQNA 1UDAA 1V6SA 2ZSIA 3TG8A 1R0YA 3AR6A 3UJCA 4E30A 2QYOA 3ZY4A 2FEKA 4DM7A 4ZHSA 3YASA 1P80A 2OZVA 2ZI4A 3IBGA 2XX3A 4NMXB 4XUDA 2PGNA 5ALTA 3OC6A 4ZT7A 4OGKA 3UMVA 5C46F 2VPIA 3C1TA 1LBSA 3G9XA 4IRUB 4ZC1A 3ELBA 4PGAA 2ZWOA 3B2EA 4E3WA 4N4AA 2JCVA 3JQFA 2R68A 1E3MA 1T5TA 1EXDA 4HPJB 4MWTA 2PBRA 2D7DA 3K0AB 1VKHA 5GOZA 5CX1B 2ONYA 1AKVA 4B2YA 5E6RB 1OFGA 1FQOA 4ND3A 3BXFA 4JIGA 3WIVA 4BNLA 4F93B 1TUBA 1OAOC 1C7QA 2NZJA 3LJKA 4FEGA 1NVMB 3SM3A 3AB8A 3CF0A 1XCOA 3NTQA 3REGA 4ZZ3A 2GM9A 1OBFO 2RI6A 2F17A 2XQKA 5CB4F 1PS9A 1J7JA 2P11A 1G55A 2Z8ZA 4AS1A 1UBRS 1X0VA 1QGUB 2ES4A 3PRYA 2BGLA 4HK4A 1IVSA 2LCFA 2X5KO 3L8DA 5ED0A 1H9BA 1GQQA 1R1DA 2Z57A 3F7MA 3LF1A 3QVGB 1UXIA 1QMPA 3QTTA 5FPQA 3ZJTA 3N6RA 5CBPA 1NVXQ 2P9JA 3TZEA 2GM3A 1EE2A 3RYHB 1C3OB 3E81A 1DC7A 4ZK2A 4HN2A 4UXIA 1JKMA 1YMUA 4MW5A 1JN0A 2GWRA 3D7RA 1M34E 4JAVC 4B9EA 4BO0A 4XJVA 4CF4A 3KU4A 2ZJFA 3MQFA 5EP4A 4E2YA 3DFIA 1EDOA 4RF2A 5LOVA 3KJGA 5JZBA 1T26A 3C4JA 3LX4A 3RFCA 2C2KA 3DBLB 4G0UA 5D3ZA 5DT2A 4CMBA 2JJYA 2N1MA 3GBVA 3UAZA 1G0NA 4DMFA 2UUBB 4UMFA 4CBVA 1D6SA 2DR2A 2ZCVA 2IP1A 1FZTA 1J8FA 3N2NA 5CM8B 1IULA 2SECE 4BRSA 1SC1A 3DQQA 3FUCA 1NHWA 3FNFA 2FSIA 3W1VA 2RB4A 1NJSA 3W8FA 1BC5A 1I2AA 4NU6A 1A8UA 2IDJA 3IQHX 2Z6UA 4YUYA 2CL0X 4YALA 3CNOA 4KSBA 4R68A 3SLGA 4B6QA 4B6EA 2VTDA 5ESRA 3AM5A 2HA6A 1V8PA 1X1CA 2PKEA 1V4VA 4F4FA 5LSAA 1CUAA 3QLUC 5C4MA 5LWQA 1HI9A 3E3AA 1F7VA 4PYJA 1P2DA 2CJWA 2GPTA 1PVVA 4QPZA 4XUEA 1U63A 2JK0A 2VDQB 2B6HA 1RPNA 4NENB 4QDKA 2GJ4A 5HVNA 1RI4A 4BB9A 2FW0A 1OH8A 3UV3A 1NIPA 2E21A 4AMYA 4BP9A 2D0PB 1R6UA 5DYGA 2BCJQ 4ZJUA 1Z5ZA 2PZGA 2VVTA 4IHKA 3WK8A 2V7WA 2V7VA 4K81B 1E7SA 2ZRKA 4RGBA 1H2EA 2O54A 2GCPA 3HY4A 5JHGB 1GV1A 2G36A 3CB2A 1P0IA 4IDGA 5KOHA 4H3SA 3IL2A 4PNEA 1FYXA 4IDPA 4LA4A 2DCMA 5EWJB 4XH9B 1LLCA 4WJLA 1EWQA 2GUWA 3F4BA 4X45A 1C8KA 2VK2A 3G9TA 1K6JA 3FTDA 3PENA 2JH3A 2BFEB 5EN4A 3JAWA 1QO0D 4EYSA 3GRRA 5I9NA 2GFIA 3QIAA 4ZCSA 2AIRA 3EARA 3ZWVA 4ZGWA 3LDUA 2G77B 2XE4A 2Z5VA 2DG2A 4K0RA 5ICFA 4TM8A 1I1OA 1Q1BA 2ZVQX 4EMBA 4LX0A 1L5HA 1IMOA 3F6PA 3FPEA 1BAPA 1YK1A 4G5SA 3KPVA 3IERA 4QU8A 4R1QA 2V54A 4OHOA 5TGTA 1ZGJA 1YU9A 3FNEA 2XITA 3MT9A 3NV9A 3OEWA 1U9JA 2ZOSA 4PV7A 4G36A 4DNXA 3I1FA 1FYFA 2VCYA 3KFVA 4FZVA 1Z75A 5NLLA 4LCEA 1RYDA 2R87A 1UBUS 3EXHA 3N0XA 2ZJYA 2B4QA 4O2AF 5BN1A 4UNPA 9MHTA 2G8NA 2ONCA 1I7PA 1P60A 3RTEA 1CJSA 1KAHA 5LQRA 3BD6A 3EZYA 1PFUA 5IDWA 3H99A 1TMOA 4IDAA 2JATA 2BMFA 1PL0A 5ALJA 1JDPA 3TJZA 3TDMA 3CV3A 5T67A 1L5OA 1T2VA 2NZWA 3DDNA 4DS3A 5GIPE 4P35A 5FULA 2OA0A 1V39A 2JG3A 5EVJA 1YD7A 1AMUA 1BKDR 1LQ2A 4OXQA 4C4OA 5LVAA 3R3ZA 4HFRA 1A69A 1K5HA 2IQIA 5DXJA 2Q4BA 2R7NA 4RELA 4WGGA 5KU1A 3R7SA 3MLBA 2RMKA 3MJTA 2IUSA 3UXMA 3HZOA 5H68A 4CIXA 3B53X 5DTIA 2EF0A 1M7HA 3C6ZA 1H1LB 4NULA 1FNCA 1N0HA 2CEKA 1HZZA 2Q6LA 4JMLA 1E2FA 1DPGA 3TBKA 3VKWA 2QGFA 1W4ZA 5IVIA 3WQQA 2BMWA 1CIJA 4NICA 1NXQA 4EGAA 2JKZA 4LYHA 1Z56C 1VJ1A 5CT6A 3LI2A 4P0PB 5DEIA 4MW9A 4EFDA 1UZAA 1NUTA 4XJXA 2D0OB 1IXRC 2Y05A 2A67A 4GIBA 4MWGA 4R1OA 4YAFA 5AP9A 1U9IA 1VPTA 4M0KA 1KPGA 4BNFA 4G0QA 4QBFA 5LQUA 3F2IA 3BHMA 2WG1A 2L82A 3IP7A 5DP2A 5IJXA 4JI3B 3HLTA 3V7FA 2Q6IA 3A6KA 5FA8A 4EYKA 3U7GA 3FN4A 4ZAXA 1XGKA 3CUSA 3PXGA 2NT3A 1W59A 2GM5A 3DP7A 2ZT8A 4A8TA 5JFGA 3BH0A 5KHLB 2GRUA 3RHTA 4MUNA 4KW7A 4XEUA 1NVVQ 2PE5A 3PT9A 1KEEA 4PZ9A 1MRZA 2P0EA 2RC5A 1JSCA 2F1OA 3EVAA 3L4EA 1Z6YA 2HMSA 2QT1A 4MARA 4R2HA 2IC5A 3JZDA 1WMEA 4HJRA 2ZR9A 1OFIA 3AZPA 1EWTA 3NBUA 4OF4A 1MP0A 2W42A 2HSWA 3KWLA 2FXVA 1T1SA 2B5VA 3FIJA 5SYAA 4K9SA 3GDWA 2A78A 3EUAA 1WCXA 4QXOA 4IHJF 2Z3VA 4TS3A 3TZBA 5LP6B 1OUMA 1PLJA 2G5CA 1GGNA 3EGDB 4WY8A 4KR3A 1QUFA 1JIUA 2BDEA 4OUKX 1HE1C 1QYWA 5A1JA 1AGNA 4MP6A 3HRHA 3O8LA 1TAGA 2BR4A 2H4ZA 3AETB 2VJOA 4V2IA 1BKYA 1CQIA 3GRCA 4GP6A 4QEKA 3KKKA 2MMGA 1QQAA 1I4TD 1Y8AA 2IEBA 4MVJF 4MKXA 4NV3A 4IJ5A 4A0QA 3QFCA 4PLFA 2WD8A 1PYDA 1T36B 5TEVA 1HURA 4JKOA 4QXAA 2JBHA 3RASA 1G8FA 2FH5B 1DB3A 4US1R 1PR5A 5KJEA 1VCMA 3A6JA 3NHMA 4WEOA 4XD7D 4LZPA 4FGKA 2NUPB 4CMKA 1CETA 3I2FA 2JAQA 2QRNA 3GUYA 2Q8PA 4GI5A 3PC6A 3FZYA 2AOXA 4AY6A 5FNZA 1Z2AA 4MV0A 4A0RA 5FV7A 2FK7A 2Q8NA 3JQCA 1SQ0A 3T1NA 3WBKA 1ZCZA 2FWJA 1OU4A 3C3PA 3CNBA 2AJ8A 1IBCA 4LPSA 2DE0X 5DF1A 3ZNOA 1M83A 4KXLA 2PIDA 2ZE5A 3B7WA 1MCZA 3BB1A 3K6KA 4MGHA 5F3DA 5JT1A 4MAFA 3UA3A 4OQ4A 1TYDE 2XNCA 1YDGA 2UVPB 3A2LA 5TPZD 4M9XA 4BO4A 2WMOB 1H42A 2YHSA 2JJ2A 3GLTA 3O1LA 3O3OB 1UC8A 2XUJA 3FKQA 4LGVA 4MW6A 5BWBA 3U3OA 3GGDA 4LTDA 6LDHA 1P1KA 3CNNA 5CK5A 3WGYA 5JJ5A 1JWAB 4MDFA 3DCJA 4D99A 3OECA 3Q3IA 1R15A 2HRCA 2P5YA 1RLMA 1SQFA 2HHLA 2JW5A 2X8JB 5GTDA 1Y6GA 1CS4C 4I4CA 2A9VA 1K5PA 3GWZA 4TTJA 7ADHA 1BWPA 5MDHA 1QONA 1RQRA 4JOCA 2R5NA 4UBOA 1TO2E 5ALPA 3I30X 2Y77A 3ABSB 1DVRA 4DG9A 3FAZA 4H7IA 2GAFA 2XDWA 4TVKA 3BYZA 4WBNA 5J2TB 1V11B 4K28A 1L7VC 3DTVA 3V9AA 2LWIA 4I8IA 3GMDA 1L1RA 2B8EA 3IVAA 3FROA 4QUDA 1QCZA 3IP6A 2GO7A 4LXTA 4OCZA 4EF4A 3LUGA 2AR0A 2X0EA 3T5PA 1BKSB 4FCVA 4R1PA 3RG8A 3V7NA 2X8AA 5KZMB 5EKTA 4WOPA 4EFNA 2C2YA 3F8WA 1B23P 1U0RA 4IWYA 3UUEA 4YO8A 3B3QA 5KJ6A 3W5DA 1QV9A 1XD2B 1PNVA 4RGYA 5KSWB 4QHTA 1IEWA 2C5SA 2GAAA 4RH1A 3DVLA 3O82A 4IEFB 2CVZA 3O4RA 4KRXA 2H48A 4P3KA 4AJ4A 1ZESA 1PGJA 2AEJA 1SXJA 2VHYA 2VWGA 1BYIA 3LUKA 3PJFA 5L3RA 1QHSA 2J3HA 3GU3A 4N5NA 4UAGA 4UE6A 4EI8A 4X7PA 3L0CA 5KCZA 1TZBA 2FFBA 4P98A 1YS6A 2Y6UA 4B9AA 1PGQA 3JWJA 3U80A 1E61A 3FGZA 1NVGA 4LNHA 3R9IA 1KJNA 4K1XA 1EVLA 1WDTA 1BDJA 2ADMA 4IGAA 5KQLA 1B0UA 1TGYA 4JJEA 1EQUA 4Z4QA 1T3LA 3QWIA 5LZ2A 4UTOA 1D4OA 1CQZA 3ZHYA 5JASA 3I12A 4BTEA 5D3MA 1ZOPA 4GX5A 2EBWA 1IN8A 1QRAA 3N53A 2WLSA 5ESDA 1XEXB 3CNEA 3L5OA 3W6NA 5B3LA 3A1WA 1H8ED 2VT2A 4FOOA 1SKYE 1IHPA 1KEVA 1RXIA 1SQGA 1SUIA 1YQDA 2EFJA 2ORIA 3IVGA 4GXRA 3NWEA 5D5PA 2PD3A 2LPMA 4NCKA 3ITEA 1MAAA 2Q6TA 4W5WA 4YX9A 5BR7A 4A6PA 1XX6A 3GRKA 2WB4A 3UK2A 4RZQA 2J5QA 2X1LA 2YFHA 4RLQA 4YCLA 3P9IA 3Q1KA 1F8GA 2EZUA 4W7IA 1YBVA 1QOQB 1RYEA 3AINA 3R41A 4BU1A 2QT9A 3E9CA 1VHLA 4FHFA 4HZGA 4L72A 1H2ZA 1EB9A 2DPLA 4N0PA 3A6FA 5A4KA 3VPXA 3PZRA 4A91A 1KMIY 4F7WA 3M0EA 4BBAA 3ABQB 2BUCA 5AWFC 4M1QA 4HDSB 5IU6A 2RGNC 4L08A 4LJRA 3L07A 1R74A 2E9SA 5DI3B 3JD1A 4BB6A 2IDMA 5KOJB 3UMMA 5IH3A 1BW9B 2HF2A 1L5KA 3FBGA 2A5DA 2ZB4A 1J39A 1G5RA 3D2CA 1K8QA 1TRHA 2DF8A 3E0QA 4TUYB 1WL8A 1Y9AA 2P9TA 3FOAA 5H1YA 4BKRA 4MWBA 1U28C 1LS1A 1UPUA 4K9PA 1Y4DE 4OP3A 1UMKA 3GRZA 2QY6A 4CCYA 2HW8A 3ULKA 3NONA 4OEHA 1B00A 1EUCB 4P54A 3AJDA 3NP7A 4BZPA 1RYBA 3LC0A 5FOTA 4EJFA 4OHFA 1IU9A 5C7LO 1AUPA 1LVUA 1ZW6A 2B9EA 2ODBA 2OENG 2W37A 3IT2A 4GZ6A 4AUKA 5C18A 1DV1A 1SCAA 1G66A 2QMZA 3WIBA 2PKWA 1DJPA 1HT1E 2PZFA 4G09A 3PICA 1T5DX 3WGOA 1N6PA 3TSWA 4B5KA 3ZIUA 3B78A 2DR0A 3ED5A 4D9IA 2ODNA 5HKOA 4D41A 5TPWA 3UUGA 5K6AC 2C2ZA 3EVZA 2JEOA 2C8VA 4U7TB 4D3FA 3OJWA 5TQJA 2XVMA 1IY8A 3PR1A 3OU6A 1N5JA 4J0EA 5HIIA 1THGA 5TVGA 4O4IB 2EX1A 3KQLA 4GBGA 3FCYA 2Q1UA 1ORTA 2FJPA 2WOJA 2B4AA 3AY7A 3P94A 3ROEA 4YQFA 2J0EA 1A82A 4BJ1A 2MSEB 2EDAA 5H3LA 2B6NA 2UYQA 2GPAA 4D7AA 3DQZA 5KQSA 3HN6A 2F9FA 5L3SA 1JR6A 2AUNA 2BRUA 1O9GA 3CF6R 4PO8A 3ZWYA 4YUWA 4LK3A 3FWYA 4G1EB 2VI5A 3TI7A 4UU0A 3UTCA 1COWD 3O3NB 3WLMA 1OAOA 4EK9A 1WKBA 2CLOB 2P27A 3EQZA 1VG0B 1OB5A 5F1OA 3GJ6A 4OK3A 5C35A 4X66B 3D43A 1RXUA 3RODA 4JEUA 2QNBA 3BS4A 1NWCA 2O3RA 3QX7A 3ANXA 3GT3A 1BFUA 1BE1A 2FP4B 2GN0A 5TGZA 5BXQC 1R7RA 5FPYA 3ZK9A 2BEVA 2JGKA 4YRQA 3V8BA 1MOQA 4MUGA 3RIEA 4DOMA 4HDKB 4OLBA 2GRJA 1ZFNA 4LE0A 4QECA 1Y4AE 5LN1A 2FFAA 4FFBA 2A1TR 4ZVOA 4M88A 3D5TA 3V80A 5JPCA 3OJCA 3GNTA 1XK7A 3HDGA 4TS1A 4DWJA 2F64A 4L2IA 4D26A 4I66A 5DLPA 3G7UA 4YMSA 1E8MA 1I3OA 3E15A 3QEMB 4OTZA 3V55A 3ZY3A 4AF8A 4TMZA 5E7IA 2OEPA 1G21A 1JG6A 4J0JA 1OGIA 1EVEA 3LZCA 4GOOD 3AUSA 4R1LA 1BZYA 1K9VF 3OM0A 1Y8ZA 1BVRA 2CCJA 1IK6A 2IOFK 3CLUD 2FSHA 8ADHA 2AFVA 3MUOA 4MS4A 4WCVA 1N5LA 1UJBA 2J6IA 3DHVA 1ZD2P 5AJWA 1UKAA 5KX5A 1TCUA 3TNFA 4TM7A 1P0PA 2ZRNA 4F97A 1GV0A 2P6NA 4KB5A 5D84A 2P69A 3SMVA 5HS4A 5IVHA 4KXQA 4LZLA 5CDFE 5K0BA 3AF2A 2J3MA 3U31A 1TUGA 3A6HA 3E05A 3VKFA 5CH5A 1Y5NA 4F6CA 4EG5A 1W1UA 5A3RA 1P19A 4KUEA 3UB3A 4BJ6A 1EGAA 1OX4B 1PFVA 2WOOA 3QLUA 3WKDA 3WZLA 1N2CB 4YMTA 1ZGGA 4E94A 3TX6A 2GTPA 3D8NA 4F2WA 2HQ1A 3M9XA 1JJ7A 2CL5A 1PK8A 4YAJA 3TL3A 4BNMA 1VKOA 5AO9A 3OFND 4DMRA 1XMSA 4N49A 4RDCA 3M6IA 4LV8B 2JZOA 2JFWA 5EE1A 5B3JC 4DV0B 1E6EA 1E7RA 4XSGA 4ZVRA 3C98A 2YV3A 3QVKA 4FMDF 2C77A 3R7DA 1DADA 1HY3A 3K70B 1P4JA 4IXWA 5SICE 4AKHA 2QLBA 4EG8A 5DK4A 1ZIDA 2TECE 3HBJA 4XR9A 1AZSC 3AV3A 3P5SA 4Z99A 4CDGA 5LPNA 3O4IA 1HF3A 3WLFA 2YDXA 1W52X 4KVZA 4R6WA 1RRCA 1PJRA 2CXTA 1AXEA 5SV2A 1QZZA 1WCIB 1U0JA 2D0DA 3C7KA 3MD0A 3ZCUA 1CQJB 1EFRA 4KXMA 3L18A 4LRUA 5CVTA 2E4AA 2ZUFA 1T25A 4QVGA 3MJVA 4HL6A 1MPXA 4D44A 2YQ4A 3KJEA 2A3NA 2G7ZA 4YXWD 2C0CA 1V16B 3SZRA 4OX9Y 2PU5A 1TYZA 1J0EA 2JHFA 2RGUA 4UCFA 3I6ZA 4KLZA 4QO8A 2JRCA 1P9OA 1JXMA 3SS9X 4EAQA 3GJYA 1XRPA 1ZUWA 5L7YA 1XTQA 2B8JA 3K6RA 3V1NA 3Q9SA 1VQ1A 2HXGA 4W6ZA 1VFNA 5JBIA 2VDWA 1VXOA 3OPMA 1VP9A 4FT4A 4HGZA 3HO1A 5CDTA 2FZWA 2AUMA 2I55A 1E6CA 4JYZA 5GWXA 1AZLA 1KJJA 1QHYA 2W0MA 2I2FA 3HO8A 3FDZA 3KP1A 5E6UA 2FN4A 3IURA 5KSPA 2VKTA 3RQSA 4AZ0B 4HT3B 3EA4A 3DMGA 4RNDB 1C9KA 1XZDA 3FOFC 2GLTA 4IDCA 1SVSA 4V39A 2QS9A 3FCUB 2P35A 3H4TA 2C7RA 2CFIA 3BHJA 3DM9B 2YIMA 3H1EA 1QBGA 3KHUA 3C8HA 3OE7D 4FW8A 5ABPA 1T3HA 4NNJA 1GU0A 3ZIDA 1DMRA 1NJ8A 3QWFA 4UMVA 3ZX4A 4NJOA 3THRA 1E0SA 2VPWA 3FOWA 4E5NA 1DC6A 1I13A 3JAKB 3PC8A 1PNRA 2O8NA 4DSTA 5CIWA 3WRVA 3PBKA 4XOUA 4RF5A 1Y6JA 1CS0B 5ITSA 2ZBDA 5KVCA 1MJ5A 5CTJA 5L3SB 2W6ZA 4YT2A 4FDVA 3LIIA 5BN4A 1N2XA 1NTOA 1JB1A 3AXTA 3ENQA 1RS0A 1IN7A 2DCUA 3ETCA 3IQGX 1M1NA 1P2BA 3MWYW 4G5RA 1FTSA 4Q9LA 3O1HB 1KQOA 5EE9A 3L43A 4FK8A 3PQFA 1M1XB 5KCMA 2OV4A 1QCDA 2PA3A 3HA7A 3ZBTA 5KSZA 4C78A 1II9A 1Z8FA 4YCJA 2IELA 1EWVA 1YO6A 1R0LA 1P81A 2FW9A 4PQGA 4MWZA 2BGUA 4XLTA 2WT4A 3WIUA 1TK9A 3SHOA 3L8CA 3WQHA 1YS9A 4BE4A 1QDUA 2H65A 4JMPA 1YL7A 3DWGA 4EKEA 4N8EA 5FWYA 3BA1A 1NYTA 1NE7A 1F38A 1R37A 2H2GA 3KVNA 5CU7A 5E3IA 2VRNA 2Z95A 4QYIB 1KE2A 4W1QA 1OX5A 1F17A 1SCJA 1P1RA 4Q4AB 2GN2A 2PZLA 1BQ4A 3ZE0B 4ENVA 1OD6A 2W6OA 1ZM3A 2COUA 1YRAA 3U4QA 1Z7WA 4ALLA 5LUBA 2JBAA 4UHBA 4UUNA 1Q14A 1Z6QA 4KO2S 4CCWA 3WL8A 1QH1B 1B0PA 2WVGA 4GSKA 3STYA 4JX9A 3G2MA 1VGRA 2WWYA 2O1WA 1E1RD 1QZXA 4ZI7A 3P9RA 3R1IA 1ZAYA 2R6CA 1ZUIA 2VYVD 4DV4B 3HYSA 3ZNQA 1KVQA 3D31A 3ZYZA 2C1XA 3K73O 4JLWA 4MPDA 4D3XA 1C3EA 2AX4A 1OLUB 4H7DA 2I6XA 5DDIP 4BEBA 2HRZA 4NEHB 4O02B 2SKEA 4JS0A 2QX8A 4BUZA 4OJQA 3FFTA 4DKJA 3G1TA 1HLPA 2IUFA 4O2RA 1X2BA 1ETHA 4FMPA 4MV4A 5IFLA 4N39A 5LL6P 5EJ6A 4RTPA 1UQUA 3GF4A 3KJZA 1U7XA 4PGGA 3K0FB 3ZGVA 4ZFNA 3F90A 3KEGA 3H2HA 1AKNA 2F00A 2O06A 2Q5LA 2W8ZA 5ADVA 1F7UA 4KQHA 2O8DA 3K9WA 1KK2A 3CF4A 3EIFA 1ZM7A 3QF4B 3KR1A 1QU3A 2V55B 1XJQA 4CF3A 1ML3A 1RXCA 2ZUCA 3EAGA 4UXJA 2ZSHA 3GO4A 2WTEA 4KVAA 3OIUA 4QOHA 2Z3ZA 4WZZA 1O03A 4G65A 3U3KA 2LRHA 3IQDB 3U9TA 3WGZA 4UZSA 5AI8A 3U4GA 3W2EA 3JCZA 1W34A 3C3BA 1RXEA 2MDTA 3FPHA 2QRJA 4N6NA 5GIOE 5EIWA 3BTOA 3DLTA 4RY2A 1T5HX 3KL4A 5ILQA 2Z2XA 2HQBA 1ZN9A 2XW6A 3PP8A 4EVSA 3I1JA 2JLAA 2VSOA 3U7IA 1DJOA 4IIGA 3M5DA 4HVAA 3DT9A 1Y8QB 3VOSA 4MPTA 1P5HA 5TMDA 1ZLYA 2XPCA 3C3AA 1NV9A 4FZJA 3LHIA 5D86A 3P0IA 3ZD7A 2I65A 3RVPA 5A5GA 1Q74A 1NXTA 1W9HA 1EAMA 2MTBA 3AJRA 1EVYA 4XGKA 1I9CA 4MQBA 1SEPA 2Q5FA 3RUEA 3GPBA 4KNVA 1XZEA 5BYBA 2GI4A 3VRHA 3QUBA 1DSSG 1EEHA 4V0RA 1P7ZA 2VUUA 4R8SA 1BU8A 2W2OA 1LTKA 3KVYA 4FFNA 3TZQA 3E0XA 1OPXA 3PK0A 4MV8A 4N0QA 1U3WA 2PUTA 4IL5A 1NL3A 4PG4A 4Y2UA 4EVRA 2EIXA 4MV5A 3VFDA 3VR3D 2YIDA 4HX5A 4MRRA 4G67A 1XRSB 2WW8A 2V3VA 1EUDB 4QOJA 4CMAA 2ZRGA 1T8YA 3CBQA 3ISTA 3JWGA 1IN6A 2X7HA 2QMHA 4Y9RA 3W5SA 3NUZA 4YP6A 1UK7A 1YJBA 4JOQA 2AMFA 5YASA 4F8JA 5A04A 4MQFB 1YB7A 1N8NA 3C3JA 1GVNB 4OK5A 4G0VA 2PWPA 2NO5A 1ENYA 1YB4A 4BJ3A 5IT5A 1E63A 1D6JA 4QTTB 4WW0A 4ZVNA 3OTQA 4ZMSA 1XLUA 3ADDA 3LLMA 4FDTA 4YREA 5EA2A 2YJ4A 4CKCB 4ZCTA 1T4DA 5ELXA 5DM2A 4MRMA 1LLQA 1ZC3A 2GBIA 1F2TB 4YCCA 2FSGA 4DNFA 1UAAA 1WZEA 2P9CA 2QJOA 2QLLA 3NWJA 2X5NA 3Q5GA 4B2IA 3MGKA 4WN3A 1BXGA 1CTQA 3VC3A 3SKXA 4WFJA 4N3CA 1MH1A 3HC7A 3ZW8A 2GPSA 3WZ2A 4NAUA 1SRRA 4EG0A 1ZM4A 2WSIA 3D81A 1HG1A 5AW7A 2O8CB 4HX2A 2WSBA 3LX5A 4UULA 1IXKA 1F2DA 5AK0A 5JSKA 1RT9A 5CT5A 4A1OA 4ZEVA 4PNZA 3G8AA 3MUEA 4IZOA 1JT2A 4M1YA 1OV4A 2DWCA 2XT9A 3G1UA 3UJ9A 1YK0A 1T34A 2I80A 1PJ4A 3KDAA 2EFYA 1ZHOA 3V8PA 3ZVRA 3ENWA 2AF4C 1M8KA 4UDYX 1GKIA 1L7EA 2VWQA 3AP2A 4KBYA 4JK3A 4DJDC 4E33A 1CSEE 3RADC 3KSDO 3HRKA 5F51A 2WKRA 4RPKA 2A9OA 3VYRB 1MUUA 1UFQA 2AOTA 2G5GX 2RI0A 2CMHA 2FPIA 3AU9A 3WGQA 1NURA 1X7YB 1MEEA 1W5FA 2WNSA 5BV1A 1W75A 2YW2A 5FHQA 2Q2WA 1H69A 2N42A 5F64A 4BKPA 4IH1A 2EHDA 2ANCA 3IMCA 1S2GA 1SAYA 4N54A 3RC9A 2BI7A 5T4HA 2O0MA 2OMEA 2WT9A 1T8WA 4CODB 8OHMA 3PNYA 4LYDA 4JBHA 1AA6A 4PGFA 1UKYA 5BUCA 3EPJA 2AN3A 4KGXA 4DJJA 4OJTA 1FSPA 1RPTA 4J07A 4LTNA 3NHUA 2GSDA 2YHBA 2ZI9A 4LMRA 2OBBA 1LPPA 2RGNA 1Y6ZA 1P6QA 3HKDB 2CVOA 4PX9A 4M99A 5IN5A 4JSYA 2R7AA 4BMOB 1R5BA 1JQEA 4FHCA 3UK1A 4BMPB 4F3CA 4R1NA 5CYGA 1IDN1 3PXBA 1KOGA 3A1VA 3AHDA 1EZ1A 2ZU0C 3DEFA 4GOJA 1GD1O 3PDJA 1CDDA 4UATA 1L7QA 2WD7B 1BXKA 3EC2A 4HC4A 4R84A 3U1TA 4AT1A 2BH2A 5THKA 4KWCA 3FZQA 3ZD6A 1XA4A 3HYNA 4RK4A 5E4TA 1U28A 3C7AA 3R3VA 1GRVA 3VDQA 1VYTA 3ZDRA 1L5QA 1RXSA 5JADA 3TSZA 2IXBA 3AGPA 4A6XA 3GT0A 3TNLA 3H9EO 4AY4A 2MSWA 3CPSA 1EJ6A 1OI7A 1XNJA 3C5CA 4ID3A 1G5PA 4BFWA 5BW4A 4LF8B 4XZ3A 4E4RA 3ILSA 1G8AA 3PUKA 4IDBA 4S0XA 5KU7A 1I36A 1AS2A 5JQGA 2FUG6 2RH5A 4JLDA 2R1VA 4R2LA 2AC2A 3K2QA 5JH7B 1U8YA 5KNBD 3KPJA 5AKJA 4BRZA 1IN5A 1I8TA 1UH5A 4Y6GB 3MOGA 2EATA 5A6SB 3NHLA 3OZFA 2QX7A 5D1HA 3GLHB 5K6AA 1NYRA 5JY6A 2HMVA 4FYYA 1Y8RB 3KUXA 1QS0B 3KB2A 2O19A 4O08A 1UZNA 3VYVA 3PRHA 4HNVA 1I6KA 4PWYA 5KTMA 1F5SA 1ESCA 1JLHA 2IHYA 3C5EA 4BFLA 4QT4A 3M4NA 2ERCA 3EVCA 4WXEA 1BMQA 3IAHA 3TFQA 1N3IA 1Q1AA 3KBOA 1SPBS 4H3KB 1ZIXA 3Q85A 5G4LA 5A3VA 4QLOA 4INPA 2ZUSA 1RWVA 2Q5QA 5AHKA 5C7YA 1GU1A 3AR7A 3OESA 1M6YA 2FN9A 3TZHA 3SY8A 3DP9A 1N6HA 4I4IA 1D5WA 3IBYA 4IGFA 5CW1A 4G37A 1JEYA 1TU4A 3L82B 3P2KA 1Z68A 1EPUA 1FX0B 3NHKA 4QFCA 5AKLA 5KDOA 1N2HA 2FN7A 3NPMA 1ZNZA 5KYWA 1VCOA 2M32A 4QBKA 2R4QA 2UUAB 2CLLB 3FCAA 4X1IB 1M8PA 3DKRA 4CI0B 2AVDA 1Y5IA 3K5WA 4LHEA 3ROXA 5BRJA 4UKDA 4DSNA 2HMUA 4RU1A 2Z08A 1N9GB 3UPTA 1R9JA 3CN9A 2FSSA 4CL3A 4XFJA 2ZBUA 2IUUA 5LU9A 3B70A 3K4PA 1IMJA 1D2AA 4OHVA 3ZG6A 2PGXA 1RKQA 1PR2A 1Q7CA 3QVXA 1DTWA 2XBMA 3IP3A 1JX6A 4G85A 4EJ0A 2OBMA 3N0RA 5J4VA 2FR1A 5GAJA 2ZE6A 4EKDA 4R2JA 3K8ZA 4XLZA 4B4WA 5L3QB 3EWNA 3K4HA 1W6UA 2PV7A 5CCXA 4PZEA 3DE4X 5I8WA 2ABWA 1ZXXA 1JS1X 1LWNA 1X7WB 2CVQA 1YS2X 2VHQA 5AHXA 3R77A 3OQJA 3KU1A 5KPDA 1ECLA 1Z0JA 4BPBA 4UBLA 2IITA 4B0OA 2AXPA 2NGRA 4RC9A 5EE0A 5BSMA 3R75A 1CDEA 4OQFA 1E6WA 3MT7A 3MWDB 2QK4A 5BVGA 2NXJA 1YFJA 3CX4A 3UXYA 3CM0A 4Q4LA 4YQYA 1F8UA 1IZ7A 1KI2A 1RI1A 1YR9A 2PYIA 4WXMA 5K0TA 4WKGA 2DQSA 1N4AA 4OHPA 4C1BA 5E1OA 2GNAA 3LCVB 3OPXA 3V5NA 5CEEA 1QHHA 5FOVA 3QVWA 1H0RA 4H3HB 4MVJH 2NZ2A 2IA5A 2QN9A 4QPNA 3ZCXA 1GKKA 4IJMA 4NZZA 2FMHA 2BVNA 2UV8A 3RSLA 4JGIA 3W04A 4WKPA 5TQVA 1JWBB 4L85A 3RC3A 3NBKA 5FORA 4KWTA 3RGGA 4B6PA 2AFIA 3TQRA 4BLPA 1Q77A 1RJFA 1J90A 2JI6A 3L8MA 1YA4A 3EEIA 3A3PA 1UEIA 2OO5A 3UOGA 3H97A 3CLKA 3VDXA 3ZIAA 3L4SO 2H4XA 2HSGA 3PA8A 5B3JA 4FILA 2AG0A 2HDOA 2DAPA 3DT8A 4OXYA 4DIMA 3PEWA 2Q4TA 3SYKA 3ZWQA 5I45A 4JBGA 1ZDMA 3LUHA 5FHRA 2XTZA 1RI3A 4RZUA 3KK0A 3CZMA 4E4TA 1G64A 1VE7A 3G17A 2EFGA 1PEKE 3RPEA 1UJ5A 1YUBA 1K5GA 4RYLA 3PGA1 1Q0HA 4N7MA 1L8XA 4X6YA 3EMDA 2VF8A 2PUDA 2D6FA 4Q24A 3O7MA 4YJ2B 5EL0A 5FWXB 4MDEA 1GPAA 4D74A 1KVUA 1NQXA 2CW5A 3JZIA 1O89A 1TYBE 4CLRB 1V1MA 3B9PA 1WQ1R 5L8VA 2CV1A 2NP6A 2X4GA 3DOHA 8ABPA 5EHQA 1CE8A 4J8PA 3SBEA 5REQB 1E69A 2HM7A 4G25A 4WESB 5EFOA 1FFAA 4HGPA 2C92A 1PHRA 3MWGA 1BGWA 1C30A