4UNNA

Mtb tmk in complex with compound 8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
184
Chain Sequence
VLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 71
structure length 184
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unnA00
3AB3A 1XJCA 2AKYA 2HCJB 2MMCA 4BLPA 1GL7A 5B58C 4LHWA 4B3BA 1PV4A 2GEUA 3TSZA 3DKVA 1A4RA 4BECA 2YOGA 5FPSA 2ZEJA 3CRQA 2BM0A 3ZIAA 2F3TA 4PPGA 4TQUS 2O8DB 1DOAA 3FFBA 4AIIA 1SVOA 4HB3A 4W5JA 1ESNA 5UKDA 3AVPA 4OL0A 4IHQA 2QAGA 3LBHA 1VKJA 1VCIA 4Q7MB 3REGA 4GMXA 3BC1A 1FFHA 1Z47A 3RWMB 4P31A 2WICA 3LBIA 1N25A 1UAAA 2D7CA 1SVWA 3PUYA 2HUPA 1LF0A 3EWAA 4K46A 3QJYA 4A6XA 2PMDA 4JL5A 2JLUA 1XMSA 4QFMA 2QGZA 3FYHA 4CEJB 3P4YA 4S35A 4RFSB 4QBHA 2V6IA 2YOFA 4TLDA 4A6PA 1FQJA 1HQCA 1ZD9A 2CLDX 5KSPA 1Z0KA 3HDTA 3SYLA 5FR1A 1DARA 1ONBA 2HEIA 1PLKA 1W0JD 1GP2A 2ZS9A 1YZNA 2GVZC 1IXRC 3AUXA 4BZXA 2BJWA 4OKSA 2JAQA 1CLUA 2H17A 5KHOC 4B34A 3A1UA 3DMNA 2GAAA 3EG5A 1CRPA 2ZANA 1OH6A 3EIHA 3F8TA 4JKIA 2WWFA 4LK2A 5FOWA 1OFIA 4HZUA 5KDDA 3NXSA 5C4GB 3P20A 4XVRA 3W5JA 4H9GA 1ESMA 1EWQA 4DKXA 3VR3A 4TTRA 2H57A 2CE2X 2IYYA 2ZR0A 4IFEA 2ZR7A 5B2ZA 3GLIB 2AD5A 4EFLA 4Q7KA 1S8FA 1ETUA 1P2SA 1QHIA 3FPAA 4HAVA 4AURA 4Q5IA 3UG7A 1JXOA 5H1YA 3RC3A 1HV8A 1COWD 4PSAA 1M34E 5BYKA 1E99A 1FPMA 2YC4C 1KSGA 3KFVA 4G3XA 3PENA 1AZSC 5DN6A 2VSXA 2LCFA 2YWEA 3AVYA 3IO3A 1KK1A 2QE7D 1ZVQA 1MRNA 1T3LA 1ZM4A 5EE9A 3W90A 4XSGA 3PEYA 3L82B 3OE7D 4LC1A 1T5LA 3IIKA 3ZJYA 1IN8A 3WYAA 2Z4RA 4NCNA 1G18A 1OIWA 1JEEA 2C8VA 2AWNA 1KZGB 1YZLA 3F3YA 4OK6A 1NJGA 2BOVA 1E1RD 3U7EB 1KO7A 1L4YA 4DSTA 1LNZA 1QF9A 2L0XA 1FP7A 1R5NA 4B2IA 4ZIRB 1W49A 4ON9A 4DLUA 3ZDQA 5JS8A 4XIGS 4KFTA 2Q9BA 1YR9A 5IK2D 3ZVNA 1CIPA 2IYWA 2NMVA 2XZLA 3I92A 2PEYA 2CDNA 2QU8A 3BAFA 2CK3D 5F2EA 4DDWA 1KAOA 5LD2B 2QMUA 3TSWA 1KI7A 5L3QB 4Z8XA 5P21A 5BN3A 2I1QA 3TAUA 2ZJZA 2QUZA 2R2AA 1OLOA 2P5SA 5AUOB 2KWIA 3HJNA 3K0EA 4FCVA 4G01B 2VF8A 3CRVA 1L8QA 1VHTA 5CJPA 3TNFA 3X1DA 2MSCB 4Q1DA 1IN4A 4Q4AA 1U2RA 2ZRGA 3THYA 3VKHA 5HR5A 3UKDA 2MSDB 1ZRHA 2JJ1A 1G8HA 2VTKA 3QKTA 3AVWA 5SZIA 5KO2A 4RKFA 4N1AA 1ANKA 3ASZA 3H2YA 5BQ5A 3PUWA 4ZCIA 3SHWA 1F6BA 2IYLD 5CB8A 3ZVRA 3BH0A 2ASEA 3OFNA 4YMTA 3I62A 1EFHA 4MRPA 2ZUBA 1NG1A 1Q1ZA 4LHVA 2QT1A 2A5YB 1TU3A 1Z29A 2R6CA 5TY0A 2JEOA 2P2LA 1NKSA 1FTNA 1G5PA 1GTVA 1UKZA 1RE0A 1EWRA 5FOVA 1PUIA 4LBZA 1ZC4A 2ZTSA 2SHKA 1MO5A 2FH5B 2XX3A 4O0MA 1GNRA 4MDEA 1BMFD 3CWZA 3TW8B 1KO4A 2WJGA 1E9SA 1DELA 1XZPA 2ZJYA 2EFDB 3QIAA 3QXJA 1AKEA 3QPUA 2NTYC 1E0JA 4ZI3A 4M9XA 1Q1BA 2OESA 3W5IA 1FUUA 2NIPA 4O25A 3BFXA 4MKHA 3WP1B 5E7IA 1YQTA 1U0LA 5A0FA 3ADKA 3QPVA 3FMPB 3QBTA 1GFIA 3RAPR 2AD1A 3IIJA 1N6LA 1KMHB 2H92A 1Z0IA 2QP9X 4MGZR 2VSFA 3R9WA 4KITB 3GLHB 1K5DA 2IT1A 2WAYA 4DHEA 4C7OB 3UXMA 4PO1A 3OIYA 4DCVA 4P3YA 1WBDA 3Q8XB 4JL8A 4Q4HA 4MGIR 4CEHA 2XAUA 3D31A 2WMNB 5FOXA 2AKAB 4L9SA 4BFZA 2OCPA 3VR2A 1S0UA 3K09C 1E9CA 3MWLA 4C0SA 1D2EA 2Z6VA 2ZXUA 3RNLA 1VG8A 1TQ6A 3NWJA 2J87A 4MA4A 3OIUA 3FKSD 1W4CA 5GJWC 4R9UC 1BYUA 4FMDB 4PC7A 3EPLA 4ZKDA 3B7GA 1NNEA 5CB6A 1OFTA 3IBGA 3I73A 4IOJA 1WDTA 5FI1B 2CEAA 1WCV1 3ZVLA 5D3MA 4KVGA 1L4UA 2FGKA 1YRAA 2C9YA 3C41J 1RKBA 2ODNA 2BCJQ 3DZ8A 5KTYA 3ADBA 1ZIOA 4M0LA 1KDRA 3LXRA 2H7VA 3W6PA 4LX0A 1KHTA 1DAGA 2NOAA 4GOJA 2OCBA 3RRNA 1OHHA 1W0JA 5JECA 3CLVA 2F1HA 3QKSA 1GUAA 1TMKA 3CH5A 4QM6A 5KNDA 2D06A 2V55B 4M9ZA 3AF2A 4LY6A 2GHIA 3LD9A 4DCNA 4DZZA 1JALA 2KBEA 4BEBA 2FFBA 2FFAA 1JR3A 3Q7PA 1TAGA 4HLDA 5EE1A 3EZ2A 3N70A 5HZHA 1PUJA 1NMYA 3OEEA 4DCUA 3PG5A 4RY2A 2R9VA 2JLRA 1F3OA 4IXMA 4US1R 4DCTA 1ZM9A 1WF3A 1SQ5A 4HAXA 3GJ6A 3M1IA 4JLDA 2PMKA 3CRRA 4D6PA 5BW8A 4KVAA 1A1VA 1F48A 4L4UA 2ZPTX 2FSHA 3L2OB 2IWHA 1A7JA 4FINA 1JR6A 5DN6D 2N1BA 2AFHE 4KHZA 5H70A 3NHAA 1TUEA 4TL7A 3RHFA 4C9BA 1CJKC 2D2FA 3T35A 2GZDA 4A0GA 3Q72A 2EWVA 1U0HC 3OE7A 1NVXQ 1T4GA 2HF9A 4DRZA 4OQLA 1P73A 4IVPA 3V4RA 3BS4A 2IHYA 4Q48A 2YV5A 2WBLC 3ZZ0A 2B21A 1BO6A 2A30A 4DUGA 2IXEA 4HDQB 1E1RA 3AKCA 5TB5A 5FBLB 2CHGA 3BH7A 5DHFA 3MD0A 4PC3A 2WIBA 3LXXA 4TYPA 1NN5A 2IYZA 1EX7A 5HE9A 2HJVA 2PJRA 2XB4A 2AL7A 1Q3HA 5JI3E 2ZU6A 3C5CA 4CYMA 1P9WA 5LPNA 2J0UB 2ZYVX 4JYBA 4JL6A 3U6KA 1Z0JA 4QC2A 5C1BA 1VHLA 3QPWA 1NP6A 2QPAA 2YWGA 4TL9A 1OH5A 2FG5A 4ZDJA 3C14C 2RHMA 1QBKC 1VIAA 2ZYWX 3O8BA 4F92B 2GBLC 1KSJA 1SVIA 4U02A 1E94E 3T06B 4BFVA 3GFOA 5JEEA 3TLXA 2B6HA 2IL1A 3A1TA 5LB2A 1MH1A 1ZCBA 2RHDA 3CR8A 1CXZA 2BMDA 5CM8B 4DIDA 1G64A 1TADA 1CRQA 2Q3HA 3U3KA 2WWHA 3LX5A 5L3QA 5EE3A 4QRHA 4KBGA 1XEWY 4HZUB 4UNNA 1E9FA 2ZAMA 3X1XA 4O2RA 3G0HA 4MYHA 2EYUA 3CB4A 3JVUA 3OFND 5K8IA 3EX7C 4OBEA 3BE4A 3NIBA 4GBMA 1SZPA 1II8B 1XJQA 3CX6A 4P4UA 1EFRA 1KOFA 1ZNYA 2VHCA 1FL9A 4IDOA 2P3SA 3KJEA 1NSFA 4OJQA 4GL2A 3FOZA 5GJCA 4B76A 5JS7A 1OXVA 4YXWD 3AH8A 2IYUA 4G5SA 4LJ4A 2ZI6A 3HU1A 3OZXA 5CLQA 3T61A 1D6JA 1YZKA 4NHOA 2ODBA 4C30A 1KI4A 4D0NA 4CEIA 3QG1A 5L3SA 4LV8B 3CX7A 4LDJA 1FMLA 3B2EA 3DM9B 2OLKA 3DVLA 3ZYCA 4JVSB 5JCPA 2VQSA 2P67A 2GEVA 2IS1A 4X8HA 2HXSA 4EQ6B 1T0JB 4UQOA 3UMSA 3U4QB 2WJVA 4B6EA 4D4KA 3HPQA 3NDPA 3U61B 5IHPA 1JECA 4Q00A 3K0CC 1VTKA 5DI3A 5FL7D 2ZROA 4UKDA 2CHVA 3CF0A 5HCNA 1RYHA 3PUVA 3WHLA 5CDFA 4C0HA 3LWNA 3KUCA 4BFTA 3AF3A 3RYTC 4PZLA 3VX4A 3U44B 1YRBA 5IRCD 1R5OA 4XJXA 1D2NA 4LOAA 4UNPA 4NCJA 4OK5A 4LV6A 1RJ9B 4XH9B 5CDFE 3ICEA 3GQBA 2IBMA 2ZSBA 4TYQA 4DSUA 3ZQJA 2WV9A 3OAAA 4ARZA 4BLOA 1OSNA 2NG1A 2J0SA 1HA3A 4Q4AB 4I1UA 3THYB 3MSXA 1KKLA 2WWGA 3WRXC 4CEHB 3ZD7A 5KSOA 3EZ9A 1HQYE 3HYTA 1ZM3A 4OQXA 2QSZA 4GSYA 1N5KA 5E7JA 2QTVB 1SHZA 3FFAA 4Q01A 5JWRA 3C15C 3ZLJA 1T8UA 2DFKB 2VP5A 3T1OA 3LRPA 3KJGA 3LW7A 4PQYA 1AS0A 4LRWA 5AJXA 1NSTA 1E0AA 5FTNA 4JLPA 4RFVA 3U3MA 4ASUA 2XITA 4PQRA 3L0SA 2GETA 3AM1A 3CPEA 1RC8A 2IUUA 1E2HA 4JLVA 1D8TA 2BHRA 2GK7A 4C0QC 3MFYA 4BZQA 1G8YA 1P7CA 1SGWA 1SXJB 2HT6A 3SC3A 4YMUA 3GLGA 3ZD6A 3RS7A 3D6TB 1I4LD 3VKGA 1CJTC 3A6PC 1XEWX 2XTNA 3QSYA 4BLRA 4A8JB 2VIIA 2DPXA 3VAAA 1QHSA 2J7KA 3SQXA 1OXUA 2IYTA 5KPJA 1XCPA 4HYYA 2W6JA 5G40A 3OEED 1UM8A 1TEXA 4HDOB 4C0JA 1XD2B 3K53A 1EFUA 1QDEA 5H68A 1GWNA 2A5JA 3THOA 2OCYC 2WKPA 2JASA 3FE2A 3GFPA 1OT3A 4HAZA 4CRWB 1AS2A 2REBA 3X2SA 4Q4LA 2OG2A 5DI9A 4LGMA 2BIFA 4LHXA 4QGFA 4JLMA 3I72A 2NPIA 4KSCA 4AKGA 1GL9B 3BXZA 2OEPA 3I1FA 4BRWA 1VG9B 2IYSA 3CO5A 3VKWA 5J4LA 2ZYUX 4LJ6A 4RFSA 4GDFA 3LBNA 1V5WA 2D74A 2OE2A 5D3QA 1GKYA 3NDBB 2A7QA 1NJFA 1DAMA 1HY3A 3EW9A 1X8JA 4LBWA 2GA8A 4F93B 3N2IA 3QBVA 4QGHA 3EZ7A 5EZ5A 2PT5A 1W2HA 1XTIA 3K0AB 4QGAA 4Y0AA 4XVUA 3TQCA 1Q0UA 3P4XA 2X2FA 1QHNA 3OHMA 4BWYA 2XXAB 2O8CB 1G7TA 1C4OA 1XNJA 2F9LA 5J47A 1UADA 1UEIA 2EFGA 3PITA 5DYIA 3V00A 1G1MA 4XTRA 3ADDA 1XD2A 2QP4A 1PLLA 1TU4A 2DR3A 3LX8A 4TMTA 1WMSA 3KB2A 2ZI9A 5KDLA 3KZ1E 3QY0A 2FN4A 3PIRA 4MH0R 1UDWA 1X6VA 1ZD8A 4QNMA 4LCBA 4QM7A 3CZQA 1T6NA 4RJLA 3DOEA 3SS8A 1NVUQ 3AGPA 5H8WA 1CR2A 1Q20A 2FZLA 2XB2A 2FZ4A 1N6HA 1E98A 2QEQA 4KFUA 4V02A 5BWMA 4D25A 2YYZA 3IPXA 4Q7JB 5FTKA 1RVDA 3UMFA 3QKSB 4CZ2A 2F1JA 4D2IA 2G0TA 1OJLA 3DKPA 5JJKA 1S3SA 1VDZA 4MQBA 5DIFA 3T34A 3R7WB 3B6EA 1G21E 5TVKA 5M04A 4M4SA 3BK7A 2UVQA 2WOJA 3FMIA 3I4LA 2WKRA 3QKRB 3KB1A 4MYTA 4OHWA 4WZBE 3K70D 2XOKD 5JMTA 1PLJA 1JR3E 2WWIA 4N0EA 3NKVA 2ZITA 1E4VA 3E5HA 4NYIQ 4P0TA 4RVCA 3W8NA 2YINC 4O2LA 1E9BA 2AXPA 4W5WA 1VPLA 3U7GA 2YVUA 3B9PA 2AK2A 3K8YA 3RSOA 1TQ4A 4CF7A 5GVSA 3ZH9B 3JZMA 2QT0A 3K0FA 1TTTA 4MRVA 1W36D 3WY9A 1NVWQ 3LV8A 4YXWA 5EJEA 1HT2E 1KI9A 3AGQA 4MKGA 1G7RA 5JBQA 4LWZA 4AYTA 4KAXA 4BFUA 1YZGA 2N42A 2J7PD 1Q12A 3V4FA 1P3JA 4A2QA 4MUBA 2FPMA 4YMWA 4Q1BA 3B1VA 1KDTA 4RD0A 4B75A 2ZREA 3EASA 2W0SA 4E5UA 1GRNA 2G1JA 3CIOA 4ZCMA 1E9RA 1XPOA 4Q66C 1JPJA 2F43A 2DY1A 5C18A 1U99A 1Z0AA 1DAHA 4R2HA 4JZKA 4LPSA 2OT3B 2WWXA 1ZNWA 1NG9A 1H8EA 3VU9B 2V7QA 4EQ6A 2CNWA 3BB3A 3FKQA 4Q9HA 3RVBA 1US8A 1IY1A 3BRWD 4PHGA 1ZD1A 3BOSA 1T91A 4CIDA 2QRZA 5J5CA 5DLQC 4CT4B 2GCOB 5FL3A 1IN7A 4DVGA 4DDUA 8OHMA 3WNCA 2UZIR 3M0EA 1QHHB 1GILA 5EQTA 1E2DA 2ATVA 4M1OA 3OAAD 2QN6A 5FTMA 4B3FX 2QRNA 1N0WA 3B1YA 3RDPA 4F91B 2YHSA 2GDJA 2ZSDA 1IY0A 2W2XA 2KE5A 4Q19A 1S9HA 4U7DA 4BE7B 3TRFA 4YQFA 3B82A 4M1YA 1N6OA 1YR8A 3W6OA 4FWTA 2ZJOA 2ATXA 3LQQA 2JATA 1KDPA 1RRFA 3B8HA 1KK3A 1AJEA 1MR3F 1KJYA 5KYKA 1G7SA 1AN0A 4Q9IA 2ERXA 3BB4A 1R6BX 3Q3JB 5DH9A 2J5XA 4ESHA 4G5OA 3ZS9A 2ZSFA 3THWB 4RKEA 5CYOA 2FA9A 4EJSB 4M1TA 1XTSA 1ZJ6A 1IXSB 1E2IA 1US8B 3BJIC 4JVMA 4NCIA 4AG5A 2EQBA 4WIAA 4MITA 1G8PA 3QXSA 5KDOA 2G77B 1A5TA 4CGZA 1ELOA 2A3RA 3LW8A 1LV7A 4PO8A 2XNSA 4AK9A 4RZUA 3NC0C 1W36C 2HF8A 1KMQA 2FJUA 2XEXA 2J9RA 3KKNA 3U4QA 1SXJA 1J90A 3GLGB 1K5GA 1XCMA 2R6DA 1J2JA 1SXJE 3FGNA 3KQHA 5DI3B 6Q21A 3QXXA 5FOUA 2GZAA 1DS6A 4IKEA 5JWOA 2OBLA 4IFBA 5CITA 1TPZA 2PLRA 3H0KA 5B64A 4Z1MD 1N2CE 2CJWA 1D9XA 2X1VA 4NKRA 3AP1A 2NO6A 3MAAC 2R6FA 4A0RA 1DAKA 2YC2C 4J0QA 4L16A 4GPTA 2DYKA 2ZJ2A 4C0KA 3KX2A 1Z08A 3P32A 4Q9KA 2OSBA 1LTQA 1E2KA 4TMKA 3SYKA 3CPJB 1CBUA 4EJSA 1W36B 1G5TA 4RSGA 4UJ5A 1ZINA 4JSTA 3T15A 4B48A 4E09A 4BUJA 1TQDA 3CRW1 4ACBA 1W4RA 3FB4A 4KCGA 2EU8A 2FFQA 1E9AA 1E79D 2P6UA 3TMKA 1O87A 4U00A 4FN5A 2XZPA 3HYRA 4HLUA 3A1SA 2W00A 3OEHA 3Q85A 3FDIA 3PXGA 4QNRA 1KI6A 4PPFA 4URUR 3ADCA 4M1SA 3U60B 3AKYA 2ZI4A 2OFXA 2ZE6A 4M9QA 4QHYA 3IQXA 1DG3A 2F3RA 4TTPA 2VEDA 1XB2A 4QBFA 2OILA 3CKLA 1SULA 4NYJQ 4KO8A 2WZQA 1JB1A 2RKOA 3BFKA 3CF2A 3KTAA 2J3EA 4OQFA 1R8QA 2PH1A 2RCNA 2H16A 3RRMA 4DDTA 4JBYA 1R0XA 2WKQA 4OQMA 3DL0A 2O8DA 2G0NA 3VHLB 1W5SA 2H1LA 2ZUDA 2BJVA 3IEUA 4PANA 721PA 4FIDA 4YONB 4GT1A 2XOKA 3NHBA 3NBYC 4Q18A 4BFSA 1OF1A 2JLQA 2JIZA 3M4YA 3PUXA 1KO5A 4KYUA 3WYGA 4BFYA 5HKKD 2ZRPA 4M1MA 1JEDA 5EP4A 5JHHB 2GAOA 3UG6A 3REFA 2MMGA 2PJZA 5G53C 1D9ZA 4IDNA 1G41A 2E1RA 2ZR9A 4C3ZA 4TN1A 3HU3A 1WP9A 4CDGA 1KI6B 3QG5A 1T3SA 4NP6A 5LDDC 4Q9JA 1BMFA 2FX3A 4ZO4A 3OESA 4IOKA 1CJMA 3RS3A 3RLFA 4B71A 1KJZA 2GILA 3TKLA 1T3HA 4K8OA 3AKEA 4WZAE 1KYIA 4IJMA 1IXZA 2WJYA 3EZFA 4AD8A 4PHFA 3U3JA 3NC1C 4DLSA 2F9MA 3G5UA 3HR8A 1XMIA 5CJ2A 1OB2A 1MRSA 1XEXA 2Q3FA 3ND8A 5K8UA 4C0BA 1N5LA 1CKEA 4LSGA 2Z4SA 4B3DA 3IHLA 2WMOB 3KQUA 2GXAA 2P6RA 3K09A 2ZRLA 2J46A 2OLJA 4OI4A 2FEOA 4DT1B 1FUKA 2ZRJA 2VRWA 4F7WA 1UEJA 4NCKA 4RD2A 1R8SA 2RGBA 4GP7A 4JLNA 5KU1A 2P0EA 1H8ED 3PFIA 2O8BB 1EXMA 1YZQA 1NRJB 4DLRA 2BBWA 1OKKA 1N0VC 4HUTA 5EP2A 1IJEA 1W4AA 5CIQA 1XDBA 4JBWA 3VR6A 1QVRA 2ZYTX 3LY5A 3W6NA 3DZDA 4XWKA 2O0KA 1WRBA 3A4MA 2XZOA 3R20A 2R6AA 4QBGB 4XSHA 3EPJA 1KZ7B 2WSSD 1NBMA 1HH4A 1XTKA 2BWJA 4KJZA 4TL8A 4WOPA 1G4AE 3SEAA 2Q21A 3EA5A 1F60A 1FMJA 1NKTA 1UDXA 3TK1A 3B60A 3CH4B 3FTQA 1KTVA 4S2EA 1CR0A 5J40A 4IVRA 5SZJA 2AFIE 2QPOA 4PC2A 3EPHA 1R0ZA 4G5RA 4LBYA 3SFZA 2JLYA 3GJ4A 3SZRA 1GDDA 4BPBA 3LLMA 3M6AA 4A2WA 4IRUB 3MWKA 4M1WA 1SXJC 3BWDD 1P62B 3CW2A 1U9IA 2E9SA 4OHXA 4DT1A 2BDTA 1N6NA 4DBLC 4FCWA 2P5TB 1UBCA 1EG7A 2HYIC 3CR7A 3NG1A 4TYNA 3KKPA 2OM2A 5AUNB 4L15A 2ZRNA 1F2TA 3CM0A 4EPYA 1JXMA 3IBYA 5FBVB 1NN1A 2P65A 3R8FA 2IUTA 1P61B 3UPUA 1JI0A 1Z2AA 1I4DD 2WSMA 3BERA 4GOXA 1JR3D 3UMRA 4DLZA 4Q1CA 2C9CA 4NPHA 2WIAA 2G88A 1CTQA 4QJ3A 4EAQA 4TMVA 4GI7A 2WTUA 3CWQA 1G8GA 4URXR 4TLBA 2PZEA 2FGJA 1SXJD 2ZI3A 2RMKA 3NVAA 2J59A 1G19A 1N6PA 3PVSA 4E03A 2GNOA 2B8TA 2BV3A 4OHVA 1JAHA 3K9LA 5JRJA 4I1SA 1TUIA 2ZI7A 1XRJA 1II8A 1I4TD 3QI2A 4TTQA 5C4MA 3TE6A 2CVHA 3WYFA 1C1YA 1ZCAA 1RRPA 1N3BA 2IHBA 4HAYA 5AUQA 4YMVA 4ZCLA 3K0CA 4BRUA 4WA7A 4AC9A 4HLCA 1U90A 5KNBA 4MGYR 2XJ9A 1G7CA 2ZE5A 1DPFA 3EAQA 4DIEA 2YNMA 1MV5A 2Q0HA 1KAGA 1M8PA 2QAJA 1DAFA 1M7GA 1UKEA 1BS1A 4QHTA 2DFLA 2R6GA 1SKYE 4UJ3A 4URWR 4BLQA 2GCOA 2QZ4A 3EXAA 4DUGD 4E07A 3NBFA 4R7ZA 2NO9A 3I61A 4BZPA 3CNLA 5ANRB 1KO1A 1TEVA 4EDHA 3IPYA 2CJWB 5LBIA 3NBZC 2V9PA 5FBRB 3Q5EA 4PZYA 3QE0A 4NTZA 4Z8YA 1AIPA 1TF7A 3OEHD 2IYVA 5FUVA 2C96A 4Q4JB 1FW6A 4GZLA 2KBFA 3W9YA 1YHNA 3MMPA 5DYGA 4Q1AA 2F6RA 1GL6A 4LHYA 3U2QA 3N5CA 2ZJ5A 5JJIA 1TF2A 2C04A 2CL7X 2W58A 3AP2A 3AF0A 2CHQA 2RAPA 2AN9A 2QTFA 5DISB 4TQAA 3BGWA 2FDCA 1P2VA 4B74A 1TNDA 1V43A 2VP4A 4RD4A 4TQ9A 1W4BA 4QXAA 2OBMA 1J7KA 1NN3A 1Z6XA 4W9MC 1W48A 4DEYA 5JSZB 1OPXA 1SHKA 3E2IA 4ARZB 1U94A 1KK2A 4TT3D 4B2PA 2YWHA 4HSEA 1F2UA 4JYCA 3O8DA 4D26A 2JIZD 3L0IB 5HE8A 5TMPA 4DB2A 3J81k 4TSFD 2QM8A 5DO9A 3TAHA 1MO3A 5FI0B 1OH8A 4DLYA 5KNCA 2EYQA 3BB1A 1E9DA 1H8HA 5FBQB 3EIEA 5D3MB 3U3OA 4HDCA 3KJIA 421PA 1G16A 2F55A 2G3YA 2ZE7A 1XPRA 3LQRA 1Z0DA 2OZEA 4BEJA 1CJVC 2DWQA 2QM7A 3KXLA 1VCNA 2BEJA 5FOSA 4MKFA 2F1RA 5FFMA 1P5ZB 4GNKA 2FMXA 4L5BA 3QF7A 2B7BA 1UBGA 2D7DA 1XZQA 1FX0B 1G17A 2GWHA 2JDIA 2AXNA 3AP3A 3QXHA 5FR2A 3O8RA 4HI0E 1AK2A 3LH5A 4JT2A 3TIFA 2AK3A 3I32A 4JVLA 1B23P 2JJ8A 3SOPA 4EPXA 4KFRA 2D3WA 3B85A 4URYR 3GLHA 5EZ6B 1NIJA 4CVNA 3GLIE 2LKDA 4KV9A 2IF0A 4TMXA 5FL7A 4JLJA 4KFSA 2G9NA 4C0LA 5JCZA 4A36A 4WVFA 4JBXA 2CL6X 4H1UA 1OXTA 3UWOA 4QBIA 2WWYA 3PEWA 5G41A 2C77A 4PHHA 4NBSA 2F1IA 2VF7A 4US0R 4A82A 1P9NA 4DDVA 2QPTA 4QL3A 2DBYA 2GEDA 2OAQ1 3GCGA 4L9WA 4LBVA 2P6NA 3MWJA 5K8LA 1X1SA 3QKRA 1JQLB 2ZJBA 4BFWA 4WZ6A 3UATA 2Z43A 1U9IC 3IILA 4M2LA 3TVDA 2LKCA 3VTKA 4V0ME 5FUXA 4FI3C 4PR0A 5TXGA 3GLFE 3GJ5A 4RD1A 3X1YA 3SFVA 4LJ9A 4UNSA 4B3XA 3W8RA 2ZVPX 4D0LB 2VPPA 4R71A 3I5YA 3LO5A 3WBJA 3MUFA 1WQ1R 4NYMQ 3TSOA 2C5LA 4UNQA 1VYTA 3U6BA 4V0MA 4AKIA 1IBRA 3B78A 4KYIB 1OFHA 4RZ3A 3FVQA 5B30A 4AKEA 3QXCA 3RS0A 1FX0A 3F5FA 1S1MA 3AKDA 2NO0A 4TMZA 1XBTA 3U3RA 1IN6A 3H4MA 2JJ2D 4RZ2A 3DM5A 3KL4A 2X77A 1VCOA 3W3ZB 3C16C 1LVGA 1E2QA 2XXAA 1GITA 1XU4A 2ZAOA 3ZZTA 4MRSA 2C98A 2FSFA 5SZHB 1IM2A 1XTJA 4F4JA 4LYHA 2BMJA 2IUSA 3AVTA 2EFHB 4AWXA 2GBLA 3EARA 4W5HA 4WXRA 4M9SA 4FMDF 1E3MA 1RIFA 4PPQA 1A82A 3VNUA 1M7HA 2CMKA 3I3SR 3CZPA 1G5RA 3HR7A 4OHYA 1GNQA 3QVUA 2XNDA 1VECA 2JA1A 5E3HA 2HLDD 1CS4C 5EXPA 5EP1A 1G3QA 4HZIA 4PX9A 2ZRCA 2ORWA 5BYJA 1ZU5A 2GTPA 4IDQA 4EFMA 1DE0A 1N6KA 2EW1A 4MUAA 3KKOA 3K0AA 1U98A 2VHJA 5K8TA 3X1ZA 1EESA 1AM4D 1AGRA 1MT0A 4ILEA 3RSLA 4N3NA 4ZIRA 2AHOA 2ZSAA 4DXAA 5AK0A 3PQCA 2PBRA 2A2ZA 3SU8A 1U8YA 1YKSA 2VP0A 5C2JB 4O3MA 1WA5A 3TBKA 4V0KA 1TF5A 1QG2A 1II0A 1NMXA 4Z54A 2YJTD 2FOLA 3AVVA 3RC8A 3FHCB 4PTLA 3RS2A 1VCMA 5EE0A 5SZKB 3WNBA 1GOTA 3BD9A 3TH5A 4D0GA 3QOFA 1U81A 2QMEA 2IF2A 4BGDA 4Y0VA 2ZVQX 4AYXA 3DMDA 5FUYA 4HB0A 2FPLA 4QOSA 3R7WA 1NLZA 4PXAA 4ZDIA 4D4LA 1AQUA 3GLHE 3GLIA 4QHSA 1A2KC 3H1TA 4I81A 2WOOA 3GJ8A 4XWOA 2WPDD 3NH9A 5ELXA 4C0AC 3U7HB 1WE2A 2R62A 1J99A 1I2MA 2GJAA 3ECCA 4DWJA 3THXB 2EFCB 5E95A 1JBKA 3B1ZA 1JJ7A 2F43B 3LNCA 4KLZA 2RB4A 1C9KA 4IW3B 1DO2A 5E4FA 4HAWA 2C95A 4DEXA 4Q02A 4OJKA 4OQNA 2OFWA 1G3MA 1X8LA 4TYYA 4PPNA 4OYHA 4Q9LA 3SJCA 4PQFA 5DHAA 5TARA 3EZ6A 1KNXA 4X8MA 2W6IA 5AJYA 1J8MF 2RGDA 3LFUA 3U44A 1CR4A 4CW7A 2UKDA 3C5HA 3H86A 3I5XA 1VG0B 2ANCA 5DE3A 1OH7A 2EWWA 5FOTA 3NEYA 1RRGA 3MLEA 4PO9A 1JPNA 3PEVA 2CVFA 1S3GA 3SI7A 4OHZA 1TQ2A 4EJSC 4EPWA 3VNVA 3AVOA 4JJKA 3A58B 5EXSA 2RGGA 4XTCS 2IYXA 4PSVA 3D7MA 1DADA 4HB2A 2YZ2A 1LF5A 2QTHA 4TSFA 1W5TA 2H8KA 1YU9A 2K5UA 1Q1EA 1P9RA 1HTWA 4EPRA 3THXA 2V6JA 3QF4B 1X86B 3AVQA 2BKEA 3ICQB 1Z6YA 1E9EA 1P6XA 5LD2C 3T1TA 3EPKA 1UFQA 1UPTA 4C7OA 2OUKA 5KUTA 2NPFA 4OI0A 2XSZA 1GSIA 3E1SA 1L2TA 1G8FA 1ZYUA 2B8WA 1QHHA 2VHQA 4TL6A 2W83A 4P4SA 3UWKA 3ZIAD 4B3CA 2O8EB 4AI6A 4ZV4A 2X19A 2J7PA 3NBXX 4BLTA 1Z5ZA 4Q47A 4NZYA 2JDID 3U7FB 2FWRA 2BEKA 1II9A 3A37A 3SBEA 4KSBA 2Z0MA 1SVKA 2N46A 121PA 1L7VC 1FOEB 4B47A 2ZU0C 3KUDA 1X1RA 3CNOA 1WXQA 4DCSA 4C2TA 2RGNC 4MRRA 3K70C 1GIAA 2VA8A 2IXGA 3KTAB 4OK3A 4ZKEA 4TWZA 1N5JA 2WAXA 1YZUA 4IDHA 1DAEA 4I1OA 2CCGA 1IONA 4QG7A 2DFNA 2ONJA 3Q7QA 4RZXA 1E4YA 2IC5A 2V7QD 1HE1C 1VMAA 4I99A 2Z5FA 2RGCA 2GESA 3AUYA 3WMEA 2CNWD 3THWA 1AGPA 2KJQA 2O0HA 2JLZA 1U8AA 1UBEA 2VL7A 4JMPA 4M8NE 2O52A 3I8XA 1QVAA 5EE5B 4NE2A 2J41A 1H65A 4MKIA 4B44A 4JKYA 1LS1A 5LB4A 3IDQA 4V0NA 1Z83A 2BBOA 3GEIA 1ZC3A 2J0VA 1Q3TA 5L3RA 2FPKA 1G3UA 2WVJA 1E1QA 4FXPA 5FPTA 4AG6A 3WBKA 2D4HA 1K8RA 5JSZA 3SE0A 4Q1FA 2QORA 1NF3A 1YE8A 4D4JA 1OFUX 3DEFA 3IIMA 3SDZA 3GLGE 4C4PA 4KBFA 3KQNA 1CEEA 5JI2E 3FMFA 1Z6GA 2W2TA 4PSKA 4PFSA 3A1WA 1MO4A 2MSEB 2FEMA 3T12A 5EUMA 3S1AA 4IDPA 1M1YE 2B7CA 4EUNA 3AQ4A 3VMFA 5IT5A 1ZNZA 2IS2A 2ZETA 2G6BA 3VFDA 5GJBA 1DAIA 1MOZA 3H84A 2XNDD 4HUQA 3CPHA 2HLDA 5JZVA 4A8JA 3TVTA 1XD9A 4JLKA 3B5JA 1DG1G 2OCAA 1HE8B 1PVOA 2VHUA 4B43A 2AX4A 3B9QA 4TLEA 4DLXA 1OW3B 1ZW6A 3JZAA 2AWOA 5BN4A 2V4ZA 4HB4A 2IEYA 1IHUA 3O47A 2WJHA 4RD6A 2O8FA 4LPKA 1PZNA 3P1JA 2GKSA 3K70B 4CEJA 4UXHA 1MABB 2VYFA 1DBSA 4FMCF 1R0YA 4EPTA 3ASYA 1HYQA 1QRAA 1ZNXA 3L8ZA 821PA 1ZM7A 3MWYW 3FHTA 4Z1MA 1XXHA 3L8YA 4IVQA 4PAQA 1OYWA 1LB1B 2V1UA 1XMJA 4IOMA 4DSOA 1VYVA 3C8UA 4EFNA 2GF9A 3EA0A 3K9NA 1S96A 2CE7A 4DJTA 2GVDC 2DCUA 1ZU4A 4UXJA 5J4VA 3SR0A 5EP3A 2D62A 3CUEF 3Q9LA 2A9KA 4YDHB 3T1VA 4B35A 1KDOA 1QHXA 2V1XA 3OF5A 3MRSA 1RYFA 4POAA 3B13B 2WPDA 4HUQB 4RCYA 4DLTA 2REOA 3RRYA 2QMOA 1E79A 1KI2A 1KI8A 2GK6A 3L0PA 2G1KA 2NZJA 3KXIA 1BKDR 4JSYA 4DLVA 1FP6A 4NCHA 1E2NA 4G0NA 1W2GA 1R2QA 1Q22A 2FSGA 4GP6A 2WWWA 1M6NA 3CBQA 5FTJA 4QJ5A 5GADl 2QG6A 1DEKA 1HEIA 2XJ4A 3LDAA 2GCNA 3SJBA 1OIXA 2BC9A 2CXXA 4NDZA 5CIWA 3WHKA 5AUPB 4P33A 1YZTA 2UZ3A 3MCAA 4E22A 3D3QA 2QMHA 2XTZA 1K6MA 4MGKR 5EUQB 5CK4A 2A78A 4Z51A 3AVXA 1IN5A 4B73A 4ESVA 2ZRFA 4PAOA 4ERNA 3GEEA 3VR5A 2QY9A 4NONA 1LY1A 4A9AA 4ITRC 1KI3A 2ZRIA 1KKMA 1ZIPA 1T5IA 3EC1A 221PA 2DWOA 1Z07A 3TUJC 5HKKA 1N5IA 5J4HA 2PEZA 5AWFC 3ZQ6A 1Q57A 1QZXA 3TW4A 3WXMA 1BH2A 3IEVA 5AJZA 1YVDA 4LHZA 2QSYA 4EKDA 4JLBA 1Q21A 2DHRA 4Q03A 2HJGA 4B33A 4EIWA 5F98A 1QHYA 1NN0A 4YC7A 1E0SA 4WXPA 3TUZC 4R98A 2VHTA 1T8TA 2GCPA 1EGAA 3QUSA 1J70A 1UJ2A 3K1JA 1TX4B 2J1LA 3SYNA 4A15A 2C99A 2LWIA 2XSZD 3W3AA 2FV8A 2NO1A 2OO7A 2IW3A 1GKUB 4WW0A 3SNHA 1CULC 2IA5A 4V03A 4JVNA 1R4AA 4A4DA 3UIEA 2W0MA 3GPLA 2Q9AA 1P2UA 4ZI2A 3QEJA 4D4MA 3FKSA 4N0DA 2PLFA 4Q7LA 4X8OA 4DLWA 2BMEA 1Z22A 4PAMA 4A2PA 2QA5A 2VO1A 1GG2A 4NYJR 2IX3A 1UKVY 2VP9A 1XFAA 1UBFA 3IKJA 2IS6A 2H18A 3OIWA 3U5ZB 5AR1A 1FQKA 3MG9A 1JNYA 1SVMA 1XX6A 1BOFA 1OYYA 2Q9CA 2V8OA 1MKYA 1E69A 4P4SB 1Z6TA 4GZMA 3R8CA 1YR6A 2ERYA 2GJ8A 4M21A 3RS4A 1YR7A 1EFCA 5A5GA 1SKQA 4JLAA 4US2R 2OAP1 1LW7A 2XTMA 3JVVA 3X1WA 2BVNA 3IHWA 4PZZA 5B57C 4EPVA 1F2UB 1OKKD 4NL4H 2X8AA 3GEHA 621PA 1ODFA 3CONA 4OI2A 2IS4A 4CEIB 1OHHD 3HU2A 4HATA 2JCSA 4D81A 5L3SB 1HURA 5KSZA 2XGJA 3T5GA 3PEUA 5C46F 3DO6A 5FPKA 2QGNA 2QL6A 1KY3A 4M22A 5FUWA 3TQFA 2C9OA 4JJZA 4URZR 5DGXA 4FCTA 2WSSA 1NBMD 1U8ZA 2NGRA 1W0KA 2VBCA 3C4JA 3VX3A 1E2EA 3GJ0A 3SN6A 5IDVA 2C78A 1E1QD 2J45A 3GLFA 1S4QA 1U0JA 5JLJA 2HV8A 1HT1E 3EC2A 2E87A 2PX0A 3B1XA 3KJHA 4NMMA 5G3ZA 5JEDA 3PJRA 3AEZA 4K81B 1NLFA 2W2VA 1Z2CA 1OIVA 4X8LA 5IF9A 4BASA 1GZSA 4XD7A 3RABA 2ONKA 1XD8A 2V54A 3MJHA 2B92A 2QQ0A 3KQKA 2ZJAA 1TL7C 3WRYC 1F5NA 1E2JA 1S9DA 1J8YF 3HPRA 5TV2A 2ZRMA 2CCKA 1E96A 1E6CA 3IQWA 4IEIA 2VP6A 4C2UA 4KI0A 2A5GA 4B2LA 4NU0A 5JJLA 1W47A 4LJ8A 4FW9A 1AS3A 1KSHA 1VG1A 3PCRB 2OFOA 2YWFA 2YKGA 4W7SA 1KNQA 4AY2A 4II7A 1ZBDA 4MYUA 5CYPA 5L8VA 1QG4A 1OE0A 1G6OA 3VR4A 1DO0A 2FE4A 4L8GA 4KU4A 4BLSA 4RCZA 4IOLA 1LS6A 1Q1QA 3CF6R 3K9GA 3S1AB 4KLNA 2ODWA 1QHGA 1UF9A 3GJ7A 4PHTA 4UXIA 2GXQA 2ZRKA 1R0WA 4Q4JA 3PUZA 4A1FA 2ZIAA 1R7RA 2IYRA 1XWIA 4Q1EA 2GXSA 2BBTA 2JGNA 3SJZA 2G83A 2QAGC 2ZS7A 1KI1A 1Q44A 4I1VA 2QI9C 4FMCB 4ZDWA 3BBPA 4A92A 2O8CA 2HYDA 2IWRA 3BIFA 3HWSA 1W1WA 1WB9A 2AR7A 3AF4A 3N2EA 1NI3A 3IO5A 4B32A 3CNNA 2IEZA 2WHXA 3SQWA 3TGPA 1GKIA 3ZVMA 4ACAA 2PCJA 4LI0A 2ODEA 5JRZA 2QROA 4QJ4A 1O3YA 4V0OA 4A0HA 5F3WB 3TJZA 4Q4HB 1YJ5A 2FU5C 3AV0B 1W44A 2VH5R 4AYWA 2X2EA 5FBWB 2IYQA 2DFTA 3KFXA 4HEJA 2CBZA 3UK6A 3EWSA 1KGDA 4GOKA 4LJ5A 4URVR 2HT1A 2Y8EA 4XWAA 2ZM5A 1N6RA 5L3VA 3QENA 3ZGXA 2ZRAA 3GMTA 1EFRD 1NL3A 2OV2A 4JLOA 1P60A 2ZQ5A 4G5GA 2J0QA 3TUIC 1G3IA 2RGAA 1WBBA 1KK0A 4FD2A 1E2MA 5FTLA 2REXB 3PV0A 1XP8A 2BCGY 3MJRA 1BIFA 1RFLA 1OB5A 3VHXA 2RGXA 1KSFX 4KODA 5FPYA 2O8BA 2FF7A 2YOHA 3WP0A 2TMKA 5KOYA 1P4SA 4R2IA 4A0FA 4HAUA 2O0JA 4LJAA 5HPYB 1DVRA 4LYJA 3ZZUA 5CK5A 1OV4A 1G6HA 1R5BA 4LC0A 4TT3A 4G1UC 2KB0A 1Z0FA 4GRAA 1Z06A 4MYCA 5A4JA 2QQEA 2CLCX 3BORA 1GAJA 1M74A 4OI1A 3FHOA 1M2OB 3DPUA 1RW4A 5DSZA 3SHFA 3LLUA 3LAWA 1P75A 1T9HA 4YDSA 2GJSA 1MO6A 1XF9A 2R65A 4KXFB 3CRMA 1NIPA 4TZ0A 2NQ2C 2QBYB 1H8HD 2ORVA 1M7BA 5F9FA 2QAGB 2J0UA 1PJRA 1MABA 1CR1A 3DOFA 1E2FA 5F9HA 1P72A 3LVRE 1N0UA 1GM5A 1AKYA 4TMWA 3FWYA 1GNPA 2Q6TA 1W7AA 1HUQA 4MDFA 2C2HA 3AVUA 3P26A 4LZZA 1E0KA 3VU9A 4TYWA 2WJIA 1X3SA 4LJYA 4JS0A 3A4NA 4LYAA 4ABYA 5BXQC 2JLVA 3E70C 1SVSA 1JAIA 5EXXA 4D82A 1JQJC 4IEEA 1ZP6A 2PT7A 3WMFA 1Y3AA 1BYIA 3TR5A 1S1CA 3GJXC 4G5QA 1NVVQ 4PC6A 2QP3A 5GVRA 2CLSA 4BQSA 3A8TA 3I8SA 4P4TA 3KDSE 2QENA 3IUYA 2FSIA 3K9HA 4DC9A 3A36A 4D80A 3K0FB 2ZS8A 5JFGA 1N6IA 4DSNA 3O8CA 3GD7A 3A4LA 5DNYB 1GRQA 3MGCA 2JLXA 4LUCA 2I3BA 2GJ9A 2QBYA 4ASUD 2BKUA 2JLWA 4BFXA 1FNMA 3VR1A 3QVVA 2OXRA 2BBSA 2A5FA 3GP8A 1UKYA 3D8BA 2ZSEA 1P2TA 4XOIA 3P27A 1AZTA 5J4KA 3V9PA 2KSQA 1NBME 2I4IA 1E2GA 4GMDA 2ZRDA 2ZJ8A 3ZS8A 4MRNA 4F38A 1RJ9A 1XCGB 2PZGA 1W0KD 5HZKA 5E7MA 1IY2A 1KJWA 2OHFA 4HLUC 4Q21A 3T5DA 1I2DA 2Z83A 1G4UR 1CU1A 1ZMXA 2BMFA 1T0HB 1A2BA 2W6JD 2JJ2A 5GJVC 1EK0A 1Z28A 4GFDA 4XD7D 2R8RA 4I4LA 1ZAKA 2FNAA 1JJVA 2D2EA 2CCJA 4CT5A 3QNUA 1COWA 1XJ0A 2VLIA 3C7KA 1FNNA 2HDNB 4H1VA 4JIMA 2EFEB 2NO7A 1AQYA 3ND9A 2OBNA 1RRCA 3TR0A 3FMOB 1F2TB 1IQPA 2ORIA 1Z8FA 3KKQA 5AJVB 3EIQA 1GVNB 1CF4A 2QE7A 2VSOA 3BFVA 4LYFA 2C03A 2ZRBA 3T1QA 1W46A 2R44A 2A5DA 4JT4A 1XPUA 3IGFA 3R9IA 4FMBB 1EFTA 4NYIR 1SKYB 3GFTA 1XEFA 5JHGB 2F7SA 1KMHA 4QGGA 1KY2A 3VQTA 2CL0X 4IXNA 4LJ7A 3AF1A 2PCLA 1RPZA 1E2LA 3W34A 3LA6A 3SBDA 1Z3IX 3NTUA 3QQ5A 3RS5A 4NYMR 4PC1A 2FFHA 4ZPXA 4U5XA 2KI5A 5IK2A 2GXUA 3KKMA 2IK8A 2EVWX 2CK3A 2OXCA 3A1VA 1LFDB 2RGEA 2QNRA 3QKUA 5HTKA 1NY6A 1G3RA 3LVQE 1XXHE 2DB3A 1Y63A 2RGNA 5FH9A 1D5CA 3L0OA 2IXFA 4WBSA 4TLAA 3WMGA 2WM9B 3HP1A 5BN5A 2V3CC 3DHWC 2Q3MA 3ETLA 4RD3A 1Z6AA 4TLCA 521PA 3G82C 1S2MA 4WAUA 5EXTA 1KO8A 1CJUC 3F0TA 4F4CA 1FTSA 3KQLA 1ZUNB 2NZ8A 1CP2A 2JJ1D 3L43A 1R10A 3UANA 4YMSA 1NMZA 1DTSA 2DWPA 5CLLA 1AA9A 2PL3A 3K0SA 4AKHA 5HCIA 2PZFA 3NH6A 4UNRA 3KXKA 3GLFB 2ECKA 1E32A 3CX8A 3B1WA 3QF4A 2GF0A 1IJFA 2PX3A 1NY5A 3NEJA 2H5EA 5G3YA 4HLQB 3SJAA 3GJ3A 4M53A 5JWHA 1XTQA 4M1KA 5CM9C 1E2PA 1GRRA 2HXYA 1G291 4QKQA 1OXXK 2O8FB 2I1VB 1ZM2A 2O8EA 2W6ID 1XMVA 4P32A 1FZQA 1XTRA 2BM1A 1NVVR 5KPDA 2WJJA 3BH6A 1OXSC 5FPHA 5J4YA 1IAQA 4DB4A 2ZRHA 3RRZA 2JLSA 1RZ3A 1D2MA 2GRJA 3QEOA 1XXHB 1X8KA 5KSYA 1KIMA 2ANBA 1VIYA 3OIVA 4YLGA 3RANA 4ZDKA 4F4IA 3DDCA 4B6FA 1G20E 2RH5A 1XEXB 1SVLA 1ZUHA 2GJKA 2O5VA 4XVQA 1Z63A 2ZUCA 4TZ6A 1EX6A 2ZI5A 3RWOA 1B0UA 3R9XA 3ONWA 1VYUA 4A8JC 4LV5B 1IOZA 5AJWA 4B3GA 2VP2A 3Q5DA 4NH0A 4V0LA 2HCBA 4FWIB 1G9XA 5TDHA 1NLYA 2GZHA 3WNDA 2ZE8A 3PR1A 1ZUIA
chains in the Genus database with same CATH superfamily
1FFAA 2FJ0A 2VWPA 3AB3A 2H51A 3C3CA 2OA0A 1QIKA 4L8FA 3RSGA 1QE5A 2BZSA 1J06A 3DKVA 1DSSG 1SHTX 4L3WA 1Z2PX 2GYWA 4D97A 2BM0A 1T6XA 1IC6A 1Z5OA 3JQQA 4NNOA 3ZIAA 4PPGA 1MOSA 3KSBC 4AS3A 3DHNA 5I3CA 3VPFA 4EHFA 4QYTA 2E21A 1C1HA 2EDAA 1ESNA 5UKDA 3Q3VA 4YUVA 3AVPA 4OL0A 3VVCA 5EHZA 3LBHA 3KEMA 5JFOA 1VCIA 4Q7MB 3REGA 3ZDEA 3ZOKA 1EBBA 3U4AA 3M5DA 1YR2A 3PPIA 4ZVPA 4UPVA 3E05A 5HM8A 1Y1PA 3CUTA 3IE0A 2HUPA 4A6XA 2BGTA 3H83A 1JTEA 2JLUA 1UXJA 1XMSA 2NTEA 1UJNA 4EY3A 3LC1O 2WHYA 5DLDA 4M98A 4QBHA 3AOEC 1P8JA 1JG7A 2GBPA 1VMDA 3QZUA 2JG3A 4ZT4A 3E7PA 4KVZA 3OWXA 1ZD9A 3TZEA 4NXNB 1Z0KA 3ONVA 1DARA 4KRXA 3D8SA 4M1ZA 1GCAA 1CP3A 3WK4A 4EJMA 2HEIA 3WSWA 2ZS9A 3HKCB 2DH6A 3CZ5A 1YBMA 3AUXA 1AKNA 4TV9B 1P74A 3IDAA 3CZ9A 5AW2A 4G0QA 1RYZA 2YXBA 5F1OA 2VTDA 3A1UA 1RDFA 1NR1A 1GYRA 3DMNA 5PGMA 3VDNB 3CTPA 2QRUA 2E55A 2KQUA 3PQDA 3F8TA 1EVIA 1TRHA 1OI4A 3PJFA 5FOWA 1YTLA 1JNXX 1SBYA 1FVHA 2J48A 4W9NC 3U4DA 1VE9A 1MH9A 3CLSD 2JFPA 3D7SA 2Q28A 1NRIA 1ORDA 3GLIB 4IFEA 1OLXB 1ACMA 5HHTA 4EFLA 4GWKA 3S2FA 1S8FA 4BO6A 1MV8A 4BV3A 5T4FA 3UG7A 4BN0A 4DCCA 4P0PB 1HC7A 5F76A 1K8QA 5H1YA 1YC2A 1RP1A 4PYOA 1RI2A 1LU9A 1AZSC 2GVNA 3Q10A 2PYIA 2FWMX 1TYAE 3M1LA 5DPMA 2ZDGA 3KQWA 2I8AA 2PM8A 4ND6A 4QRDA 4XSGA 4D9FA 5CXQA 4UASA 4Y67A 4LC1A 4CL8A 3U80A 2X9VA 1GL3A 5HDBB 1B74A 2GAIA 1KZGB 3KE9A 1QGYA 3F3YA 3OH8A 3SIRA 3B9RA 4Q3DA 3VJRA 4L0MA 3H5WA 1KO7A 1QR2A 1LNZA 2VF2A 1Y80A 1R5NA 2YHIA 1U0SY 4FLMA 4GPD1 4M8LA 3PK0A 4ON9A 4E94A 4LYEA 2XYGA 5JS8A 3FDZB 2JBAA 3N2NA 1Y4DE 1DXYA 2ZATA 1TKBA 1YR9A 3ETCA 2ZZKA 5IK2D 1SCDA 4KLAA 4KO3S 2NMVA 2B61A 3LUAA 1GTRA 5DHUA 2CDNA 3C8ZA 1GR1A 2Z6QA 5F2EA 1ZPDA 4DDWA 5T4EA 3M5CA 5LD2B 4O2AB 1KI7A 1T3GA 4HJRA 4REMA 2KMLA 2ZT6A 4WXYB 5LMNB 3C4VA 1Z4KA 5AKGA 3TAUA 3WE7A 5FWYB 3MN1A 2CF5A 4L8YA 2Y1EA 1OLOA 5DX1A 4WXHA 4EH1A 2P5SA 1HLGA 5AUOB 2KWIA 1N32B 3K0EA 3HH8A 1DDOA 3QE4A 4FCVA 2VJBA 3NRBA 1VHTA 1ODLA 3TNFA 3W6UA 1BHO1 5C7YA 2MSCB 1Z35A 1IN4A 5DN9A 4Q4AA 5AKKA 3VKHA 1ECCA 4KB5A 3OECA 4EG1A 3UKDA 4EQZA 4WK6A 1ZRHA 2C4KA 5CXXA 1NT2A 3AVWA 3QKTA 1XDGA 3NANA 5CA0B 3VDMA 5KO2A 4CTNA 5T6BA 1SBNE 3KPYA 4OJNA 1IG3A 5TNXA 3RROA 3VXKA 3FNBA 1W5EA 3TL2A 1M6HA 1TM1E 3PUWA 1F6BA 2ZIVB 3ZGNA 3AY7A 5BRAA 4K9KA 4N3BA 3SBXA 5GPBA 4YCDA 4KOAA 4H17A 2IEAA 1F8YA 1OBCA 4MRPA 2ZUBA 3G7UA 2Z9DA 2SCUB 3PHLA 4JUCA 4LHVA 3A70A 3IUMA 3SAJA 3BDAA 3P2OA 2GEBA 2BP7B 2CXUA 2P2LA 2P2GA 1DKPA 3WJ2A 5ICCA 1WO8A 2IHVA 1FTNA 3M6UA 5DK4A 3RYCA 3BJZA 1UMDA 5TX7A 3ZI7A 1ZXBA 3SQMA 1H42A 4PZ9A 2ZTSA 4QVGA 3UBMA 4IXDA 4L4ZA 4IHJA 2V65A 4O0MA 7REQA 5CBKA 5BSKA 2WJGA 1KPHA 2I6FA 4RSMA 3RBXA 4F8YA 2E6KA 1F0NA 3NAQA 3QIAA 1AKEA 4J0CA 4B4DA 3K9BA 2NTYC 1E0JA 4MJXA 4D3ZA 4GGPA 3W5IA 1VA5A 1XN1A 3OZVA 4MQFA 2NIPA 5F2KA 4PS0A 2YL2A 3FLAA 5E7IA 1YQTA 1TZKA 5IPFA 1RMQA 1VBFA 3IQGX 4B9EA 2AD1A 2GAFA 1ID8A 2NZ2A 5E0KB 3BWEA 4RCVA 4DMRA 4FW8A 4BLUA 1KMHB 2H92A 2QP9X 2Y68A 5CNIA 1T1SA 1SD2A 2ZYGA 3OZDA 1ILEA 5LZ7A 1BXGB 2G9QA 3X43A 1XZIA 4G9EA 4N7BA 3UJDA 4KR9A 2BMWA 2XA2A 2Y9MB 2YWJA 3QLTA 1QH1B 4D6YA 4Y2TA 5BW5A 3HRKA 1T8SA 3UXMA 1OTHA 2D5AA 3O8QB 2JFYA 1H2YA 5EIBC 5H9VA 5ILGA 3UAZA 3W2HA 2G0AA 4FFDA 1AKTA 1Z74A 2C2BA 3KSZO 4CLRB 1J7JA 1CC1S 2XAUA 3D31A 2UYGA 3FETA 3FMVA 3IMKA 3PQ6A 4L9SA 3RUCA 1F2VA 4BFZA 3DDUA 3CV3A 1E9CA 3GMSA 3GLQA 1YOVB 1D2EA 3VR6D 1BDHA 3RNLA 1JEAA 1NZFA 4MCIA 2YRXA 3TLGB 3Q15C 1AURA 2YWXA 4IYRA 1TDJA 1WX1A 3FR8A 3K5HA 4ALIA 2JZOA 2NUPB 5MHTA 3CXUA 3OFKA 4B81A 1CG6A 4O4HA 5LOVF 4XJVA 3L07A 1IIBA 3PJEA 3IBGA 3O73A 3I73A 1DDIA 5H4GA 1MRZA 3QI7A 3Q3HA 1WCV1 3L7IA 2DXIA 4HVCA 3JU3A 1KTIA 5DKFA 1E1MA 1QLHA 4KVGA 5BN4B 1TFUA 1KMMA 3MJFA 3QFHA 3DEKA 3HN7A 4DYVA 5CD9A 2C9YA 4FKMA 1NAIA 2BCJQ 3HDVA 3QUQA 4ZEWA 4U1RA 1GTSA 3DBRA 2CNBA 4PY2A 5LJLA 1ZIOA 4C6HA 3UHJA 3OLQA 3IV9A 3W6PA 4GSKA 1UM9B 4LX0A 5DGDA 2G5TA 3WGJA 2IXDA 3QUBA 4PLWA 2YXEA 3MWGA 1OHHA 3DE7X 1VE6A 5DBIA 1W0JA 1WCIA 1PYGA 2JEYA 3CLVA 4OP2A 2F1HA 3ZE8A 1YQEA 1EFDN 1GUAA 1QYVA 1SY7A 1BQEA 1UJ6A 4WZBB 5C52B 4ZQCB 1L7BA 4J4TA 4M9ZA 1R9MA 3HJUA 4YLYA 1S8AA 2VK8A 3D3KA 5ITVA 3KT3A 1T43A 3A6HA 4P53A 3IPAA 2PZBA 1ZS9A 4B34A 5DM0A 1JQ5A 2KBEA 3I1YA 4ZP1A 2FFAA 4LRQA 3IR7A 4Z2AA 3T7EA 1NJSA 3N70A 1LDEA 3Q2KA 1OGYA 5HZHA 3DE5X 5FFNA 4I1YA 1XMQB 1DWUA 1NVGA 2YXLA 3JVIA 2R9VA 4HXFB 2ZSHA 3F73A 2JLRA 4IXMA 5FNVB 4CWAA 4JXZA 4PWYA 3ZDCA 1O94C 4HAXA 4GYWA 4D6PA 4KVAA 4MZXA 2QD2A 2BISA 4L4UA 2QYOA 2FSHA 2REQB 2C7QA 1E2BA 4J16A 2FEAA 2H11A 1HKUA 3ZLTA 2P7IA 2QN3A 4CMEC 3ILSA 1QAQA 5KNLA 4YUZA 1LDYA 5IEJA 5DTRA 2DLDA 2D0DA 5TRTA 4C9BA 1CJKC 2B36A 3D6NB 2PYZA 4A0GA 3Q72A 3DAFA 2ZPUA 1T1RA 2AJCA 5K0TA 4WCFC 3BXXA 2HF9A 5DGCA 3IXMA 4DRZA 3ANLA 4DG9A 1V9CA 4UUPA 5LWQA 1BWRA 2B4QA 2GGSA 4IVPA 5JAPA 4MWDA 5IAEA 5LXTB 4YHHB 3ZPXA 5HOEA 1B76A 2FN9A 4Q48A 1JXAA 2WBLC 3ZZ0A 1BO6A 2PANA 1CRZA 1R4ZA 2NYRA 1E1RA 1MFZA 1WXGA 2X4GA 1FP1D 3HEAA 3MJSA 5TB5A 1ZFNA 3NVKI 4MPPA 5CEFA 1AUOA 1FLVA 4Y6RA 2C3MA 2X76A 1DLIA 4IRMA 5KNCH 2QHXA 2WIBA 2Y0CA 4YRLA 3LXXA 1T25A 2FETA 2IYZA 3GNTA 4PG4A 4R1MA 1YKFA 4X61A 5HE9A 4KZKA 3JQDA 1AOXA 1S8OA 3S6JA 3ORQA 4J0GA 2BEUA 2R86A 1M0EA 1FXWA 5LPNA 4LZAA 1I9GA 3NP9A 5GGYA 3UUGA 1BXZA 5C1BA 5L9AA 3QPWA 4RV4A 1NP6A 3E03A 2QPAA 4KW7A 5IKMA 3BGSA 5B1DA 4Z4EA 1UP4A 2EKQA 3KJQA 1MZVA 3TI7A 5F5LA 2GBLC 3WBFA 2X41A 3T06B 1Z38A 4EEZA 4QPZA 5JCJD 4L8VA 1Q3KA 6AT1A 3VPCA 4FQ7A 1MH1A 1SK9A 3EHDA 3IUPA 3ZV7A 4L9RA 4ZCPA 2CFTA 1CWUA 1G64A 2V5VA 1WMDA 2YZGA 4B3MB 2Q3HA 3FZEA 3U3KA 2WWHA 1EU1A 2C4TA 2NXNA 3HB1A 4H3HB 2WHPB 3AEUA 5HEKA 1ULBA 1XEWY 2VRNA 3FCOA 5JO0A 4JASB 4UNNA 2DR0A 4ZQGA 3S5JA 3G0HA 1KAQA 2HUNA 4WNAB 3CB4A 5KTOA 3OFND 3RSSA 1T26A 5DW3A 5MN5A 3JAWB 3IRUA 3LQYA 4KQJA 3C1OA 3R40A 5KJ1A 3F6YA 4N0PA 4GBMA 1O7JA 3R0XA 1XJQA 4M7RA 3SLKA 5L95A 2I55A 1FFXA 2YWBA 2VHCA 4IDOA 4P4UA 4RZQA 1FL9A 5H59A 1BRMA 3BPSA 3PC8C 1GUDA 5E9JA 4RMNA 4I6GA 5GJCA 3ZZNA 4B76A 3JYLA 4GQAA 1BRTA 3ET5A 4YXWD 3AH8A 1G60A 3O8NA 1CSEE 5CW1A 2HA0A 1P4GA 2X22A 1C30B 4OGFA 2EFJA 5CLQA 3VTZA 5KYVA 3WLHA 2ODBA 3GV0A 4D0NA 1ZN7A 5LZ5A 4I2VA 1RIIA 1WMEA 3HBLA 3QG1A 4YJ2B 2AFIA 5M5BA 4LDJA 4GH5A 1FMLA 3DM9B 3DVLA 1SR8A 3NYQA 1ML4A 3REQA 4JVSB 4G2TA 2QTAA 3X2EA 3NJ4A 4NPCA 1JFLA 2HXSA 4P9NA 3UHOA 4EQ6B 3RYCB 4UQOA 3EIOA 3R5TA 2WF8A 2PGJA 1W94A 3HXTA 2YZ7A 4D4KA 1JECA 5F35A 1JT9A 2DUJA 1KHHA 2FLKA 1V0JA 2ZULA 4PLYA 2VYVA 1CE8A 4FOSA 1QP7A 3V4OA 2RKBA 4OFWA 2AIRA 1X1BA 2ZBPA 4RK4A 5FLEX 5CG2A 1RYHA 1YS9A 2GPSA 3PUVA 4HG2A 2DQSA 4JBLA 4RQTA 2R8EA 2HDHA 5CDFA 3W5HA 3GGOA 5H80A 5ISMA 2IEIA 4L0CA 2IW1A 1YSCA 1H0HA 3PRHA 4PZLA 4QYWA 1XYGA 5DXAA 3SNKA 3VX4A 2FHSA 3P0FA 1H4QA 1R5OA 2EKLA 5A3SA 3MT9A 1ZBQA 4UNPA 5HRAA 5DGTA 1YTUA 1GQRA 4JEHA 2ETXA 4PXYA 1CUEA 1JSLA 5K6RA 4NCJA 4OK5A 5SY9A 3HUTA 5CDFE 2GO1A 3PXBA 3QEKA 1UOOA 2IBMA 3DOIA 4DSUA 2CLLB 2PJDA 2SKCA 1WL8A 2VDNB 1PG5A 4MEJA 3DZCA 3FUUA 1T4BA 5AOVA 2ZPAA 3AESA 1W29A 4Q4AB 4I1UA 3EMBA 5F73A 3KEGA 4LVNA 3VC1A 3ZXIA 3KRTA 1ZQ1A 3HYTA 1QYCA 5CFPA 1Q95A 3T9AA 1NW8A 2WMDA 3AX6A 5E7JA 2QTVB 2AZTA 1IB0A 2AJBA 5EEGA 4XIIA 1AXRA 1CZUA 3ZLJA 2VJPA 3ZJTA 2EZTA 3QHAA 1KVTA 4IJKA 4YQZA 5DHPA 3T1OA 1T2VA 1X74A 3R3YA 5LZ4A 1SAYA 4PQYA 2Z6AA 3DEYX 2QU7A 3SMQA 5COQA 5CA0F 2M6RA 1GV0A 1FVXA 2MJLA 3ONEA 4QXPA 3U3MA 2B5WA 3H5IA 4JX8A 4MWZA 4ASUA 4PQRA 1KF0A 3AM1A 1E3WB 3VHQA 2H2FA 1M0TA 5F7JA 2GK7A 1SUCA 1XNGA 2VRCD 2J85A 2Z2KA 5K6AA 4BVEA 2GM4A 3ZD6A 1TTQB 1C9YA 4C5BA 5L7WA 1FRNA 3GFSA 3D6TB 3TX6A 3U09A 3ZIUA 2JI8A 3O3OB 1KOGA 3A6PC 2XTNA 1TD1A 4G97A 4A16A 5BR7A 2CFRA 4I14A 4Z9XA 4AJHA 1FZTA 1PAUA 3LPMA 3MBKA 2XCQA 3E7WA 4Q3OA 1LUAA 2VIIA 2DPXA 2O3RA 1Q0QA 2OQVA 2PKXA 1T0BA 5C8YB 1OXUA 2XIJA 2IYTA 4KPYA 1XCPA 5JCOA 4PFKA 1UM8A 1TEXA 5A7GA 3HB7A 3ZDDA 4C0JA 3W2IA 4RIHA 3NT4A 1GWNA 4TUYF 5I9SA 3LT1A 3FYUB 2WKPA 3PRKE 3G9TA 3UK2A 1L8LA 4LY9A 4KO2S 5KKNB 3DF7A 3ZHCA 1IZ9A 3B6IA 3GROA 1HZJA 4GYKA 3HGQA 4IV5A 4PGFA 5U4XA 3CGGA 3ZD9A 1XLUA 1QO7A 3ZE2B 4XM0A 3WAKA 4Q4LA 1G21B 2OG2A 3O8QA 3WL8A 5BUSA 1QRSA 3CNBA 4LHXA 4QGFA 1N7IA 4TKZA 5ICEA 4MUXA 3I72A 3P9RA 4M37A 2O5EA 3RODA 1PNQA 4OA8A 2Y77A 5FHQA 4WRRA 4BRWA 2HK8A 4G8DA 2HPAA 2XR1A 4C7KA 4AMZA 5LLSA 1M33A 5IVHA 4JZYA 4QU9A 3LHSA 3NNNA 1WXIA 1V5WA 1A9PA 1WABA 2D74A 2OE2A 4O2BB 1IVSA 3MMNA 3RG2A 1XMOB 1DGQA 4OYLA 2C4UA 4UU0A 1PEKE 5GQSA 2D8MA 4Z0TA 4MS3B 1G2OA 1QFJA 1U2PA 5TLSA 5BUCA 4GS5A 4KQMA 2AE2A 3EW9A 3WDLA 3DA8A 3N2IA 4LSMA 5EZ5A 2PT5A 1XTIA 3BZWA 3OM8A 1VP9A 1Q0UA 1V25A 2X2FA 3L4EA 3P4XA 2O8CB 4QUIA 2X8LA 3GFRA 4M0UA 1UEIA 5HS6A 4Z6KA 5KZMB 1TYCA 1G1MA 1QQTA 3GFVA 4AZ3A 1PLLA 2DR3A 1TU4A 1XTUA 1N3LA 3LX8A 1IWOA 2WKWA 2JBWA 4MVCA 4AECA 1JKIA 9LDTA 4BP9A 1WXFA 1BX3A 1UDWA 1BROA 4HVAA 5K3EA 3KYJB 4OXRA 2QTBA 1ZD8A 4I55B 4LCBA 1JDNA 4EVIA 2G80A 3ZN2A 4BV9A 3AGPA 2FZLA 4IGKA 1N6HA 2QEQA 5BWMA 4ENWA 1EG2A 1WCIB 1T35A 1TIBA 2YYZA 3BCRA 4DMKA 1EWVA 4D3DA 4JC8A 2XCSB 1OJLA 3SOZA 3IE2A 3WWDA 5DIFA 3T34A 2BRUA 1YJBA 3B6EA 3COZA 2H4XA 4P80A 1PTJA 4TLMB 2ABWA 2AVNA 4PM4A 4M4SA 2Q5CA 3GPIA 4GL4A 2WU0A 3U4IA 3IBFA 2JVKA 1Y37A 1JHMA 4KDFA 3FMIA 2PNFA 4MYTA 1X15A 4OHWA 5BSWA 5ADVA 5C7IO 3CGWA 1WY5A 2PRYA 3F2VA 4P0TA 3E5HA 4NYIQ 1XRMA 2IOFA 1E9BA 1E5TA 3AWIA 1K98A 1VPLA 2G9UA 3U7GA 4Y2VA 1RM5A 4IIJB 3UHPA 1RI1A 3IURA 3U9LA 5EEHA 3OO1A 2CMHA 2QTLA 2JFWA 4EL5A 1WULS 1BKYA 2OO3A 2ZWPA 2QRLA 2WUEA 3ESCA 5BRNA 3SEQA 4DJ5X 2P6OA 4MRVA 2A1TR 4UUQA 3WY9A 2Z58A 4C1BA 1D5WA 1EM6A 1ZKDA 1KI9A 3AGQA 5J23A 3D6MA 1LNSA 2FW9A 2OGZA 4CLHA 1BVHA 1P1JA 4BVBA 1QP4A 4RKYA 2H3EA 4S04A 5HJ2A 3NW9A 1V6AA 1Z37A 3RUHA 4GX5A 2H4YA 2PQMA 2ZW9A 4BO9A 2ISQA 2R8OA 4YMWA 2XUQA 5A7HA 3B1VA 3UAGA 2DQYA 4K1XA 9LDBA 5T8KA 2WUWE 3AERB 5KMGA 2W0SA 4E5UA 2R00C 5B2EA 5KTYA 5TEWA 1P33A 1Q0HA 3JATA 1JX6A 1JPJA 2GWRA 2HTEA 3AJ9A 5G1NA 1XT6A 2DM6A 3CS3A 3L7KA 1UJ5A 1FFEA 1DC5A 2FUEA 5FORA 1Z0AA 1LJ8A 4LRXA 2XWBF 5CVUA 2CD9A 3DW3X 3F8SA 1X14A 4FNMA 4XRRA 1HLPA 1M1YB 3T7SA 1EUQA 3QVKA 1RLTA 2C3OA 1PO7A 2DSNA 1H8EA 3QVGA 1CUVA 4NECA 1K63A 3CMMA 4TMFA 4MR8A 3FVVA 4EQ6A 3IP1A 4UU8A 3RYHB 3DOJA 1OQAA 1CV2A 1L7XA 3MXTA 1GPWB 1N2JA 1US8A 3BL8A 2J3HA 1VE3A 3HVUA 4J76A 3PC8A 2OORC 3BOSA 1TK3A 2QRZA 4DVGA 2WTBA 5KS2A 3TOCA 1QHHB 3EW7A 1GILA 3HP4A 4KH1A 1E2DA 5K51A 3KTDA 3OAAD 4NBUA 4UVHA 1ZVJA 2QRNA 5C8ZA 1DIRA 1QK4A 4XPIB 4WLOA 4ECAA 2BFOA 3TAXA 4EHBA 5HIAA 4AO8A 2YHSA 1N5DA 1UWVA 1IY0A 2E4ZA 3R09A 3UOAB 1FMFA 2F9FA 1T8YA 2KE5A 2BSXA 3GXOA 4ZGGA 1TJNA 1OV6A 4TKVB 8AT1A 5G0SA 2PUEA 3HZHA 2VHEA 2WHQA 2IDMA 2PUJA 3MTQA 1SQ0A 1HDRA 4LZNA 3X1MA 4DVJA 4YQFA 4M1YA 4J2TA 1OVGA 2Q3DA 2WWRA 3W6OA 1ORTA 2DRIA 2E2WA 2JATA 1KDPA 4TTSA 4O5AA 3RRJA 3Q9SA 1KJYA 1U2GA 4EENA 4Q4CA 5JSQA 5KYKA 2YY6A 2HBRA 3JS5A 4W9NA 3OSUA 1G7SA 2ZKIA 4EI8A 5IJXA 2I0FA 2YNMC 3BB4A 4RVUA 3PIDA 4IIFA 2J5XA 1VSUA 3NT5A 1Y42X 4G5OA 4YRCA 4GMGA 3HG7A 3ZS9A 3THWB 2XAAA 1FF9A 2ZAIA 2B30A 3UK0A 1HL3A 2QRVB 4IZ6A 3IVXA 1O58A 1Z45A 1N7GA 5FLKA 4UMVA 2VJMB 1ZRMA 1IXSB 4NCIA 3C6BA 4JVMA 2QJFA 2BJHA 4YRAA 3PNPA 1EMDA 1G8PA 2KM1A 2PKWA 3DBHB 3QXSA 3RFTA 2HF2A 2A3RA 2B8JA 2JAWA 1LV7A 1VMIA 3NHLA 3OSZA 4PO8A 5CXSA 1W25A 2O57A 2QRMA 1Y8QB 3AV3A 3ZUPA 5FWXA 5JNLA 1NUQA 3O95A 3HSSA 2YZNA 4HR7A 5BORA 2P9EA 2WV7A 2FJUA 1TMYA 2XEXA 4H35A 1ESZA 4U8GA 3UCEA 5I5EA 4G0UA 5ABPA 1P45A 3ASUA 1GV1A 1QZUA 1T6YA 3OU6A 4K87A 4PGGA 1YBVA 3G8DA 4OMDA 3PFBA 5EESA 3RIEA 1N8KA 1U9CA 2M1ZA 4X85A 5BVHB 4N5LA 1X1EA 1BAPA 2EX1A 3NYIA 3QMWA 1EESA 4YO7A 2GZAA 5CITA 1EGQA 2Q41A 1TPZA 1UL1X 3H0KA 4GPBA 2HLPA 4Z1MD 3T3PB 4ZK2A 1KEPA 4X0EA 1D9XA 2HZBA 1J0CA 2NSHA 3DZBA 3M34A 4FX5A 4X6XA 3QELA 3AP1A 4ZAXA 1A76A 4NULA 2BTQB 1DAKA 3GLVA 1DCKA 2WE8A 3Q1LA 3BSSA 3D6FA 3QVWA 1GRCA 4NATA 4LXUA 1FFSA 1SBIA 2ZTLA 1XN4A 3OJXA 3I52A 4GPTA 4Y8VA 1NUPA 1ZKMA 4KPUB 3UT0A 4L2IB 3DDHA 5GWXA 3ZZTA 5AIAA 2OSBA 3BICA 1E2KA 3QPCA 2R4UA 3RGWS 5I7EA 1CBUA 4KYTA 3UGTA 4UQPA 3HVRA 1PWXA 1PJ4A 3FOFC 4K28A 4QQKA 4UJ5A 1ISMA 5H83A 4UEQA 3TNYA 1UJCA 2NSYA 2GBCA 2RGUA 2LZ0A 1X38A 2PIAA 3JQ6A 3NETA 4KCGA 3MQ4A 1XL0A 2FFQA 1E9AA 2YS7A 4PCUA 3TMKA 5K8JB 3Q40A 2R96A 2XZPA 2ARKA 2VEOA 3A1SA 2VDRB 3R75A 5ADUS 2VF5X 2W00A 3Q85A 3PT9A 3FDIA 4G4IA 3S2YA 4D1YA 5LMZA 5KINB 5AHOA 1RZRD 1VXOA 1KI6A 4YP9A 3F3KA 3OTOB 1NI5A 3VH1A 5KWJA 1IZ0A 3U81A 4BP8A 3T5AA 1O89A 2W90A 2WWTA 4O63O 1WKBA 4BU1A 1QWOA 4IR7A 2RHRA 4QHYA 3LLSA 2EDCA 1B1AA 1VJTA 4XJSA 1P2BA 4LRSB 3SHTA 2OILA 4V39A 4WNIA 2D7JA 1MLDA 4WBSA 1C8LA 2PYDA 2RKOA 2WZQA 3KTAA 4J0FA 1XRPA 3RC9A 3WOVA 4DIMA 1N3YA 4WCFA 4C6TB 4JBYA 1DTWB 1FXSA 2M9MA 3ENQA 3KCQA 4QULA 1R0XA 5E7QA 1PQWA 5BMVF 2VAXA 3DL0A 3ND5A 1W5SA 2H1LA 3ESXA 4KXQA 2HM7A 2ZUDA 3RU9A 5L4NA 3ZDBA 2P5UA 3NOQA 3IEUA 721PA 2CNKA 3ZCRA 3IAEA 1L5LA 2C42A 1T0PA 2WILA 2Q8PA 4PE5B 2ZQZA 1CYEA 2BAGA 4KYUA 2O5RA 3BBLA 4BFYA 2VXBA 3DL2A 2ZRPA 4MP3A 1Z75A 4OX9Y 4OSPA 3GLSA 4LDPA 5EP4A 3EZYA 3UG6A 1QO9A 2UV8A 2MMGA 1J21A 1JTVA 2IP1A 4CMCA 4FYVA 2H9IA 3IYLW 2ZR9A 2NACA 2O05A 4N8SA 4RABA 1U6IA 2NU9B 3HU3A 4DE5A 2WYOA 4BBZA 1F06A 1ISGA 2X1LA 4N76A 3VU0A 5LDDC 4H7IA 3L1VA 1BMFA 2CJPA 2FX3A 4Q9JA 4Z99A 5LBTA 1YIAA 2XVXA 4IOKA 3RS3A 4JJ8A 3UMBA 4YAJA 3LKZA 4K8OA 4OHUA 5L4LA 5I7HA 4AD8A 2ODPA 3CJQA 2NNWB 1B00A 4PHFA 4Y2PA 3U3JA 2IY9A 1YS4A 4G63A 3GRVA 4UUNA 1XMIA 1MRSA 2WTXA 3KOOA 1XEXA 1MC5A 2XBUA 5L3ZA 3N07A 3JQEA 4GOMD 2GZ2A 1H22A 2W6NA 1WZNA 2DUMA 1I1QB 3K09A 2GXAA 2J46A 2W9XA 4LQDA 2FEOA 3RPEA 2HK7A 1QRRA 1QS0B 2YVQA 1FU8A 1KVRA 4OB8A 1FUKA 2B1JA 5DRYA 3WLQA 3CCFA 2FEPA 5CR9A 4EJ2A 4IS3A 2OYRA 4ZT6A 1D4FA 1HG0A 2HU5A 1R8SA 2AF4C 4JLNA 1JZTA 2R48A 3EYWA 4RD2A 5KU1A 2JI6A 3ZD8A 5M7EA 3ITNA 4M38A 3HB9A 3KYDB 4V0QA 3SP1A 2VN8A 4DLRA 4Q6BA 3PC4A 3ANTA 4XIFA 2D2IA 2PPVA 4DOMA 5CIQA 5FI5A 3PNQA 3ZE7A 1AMNA 2ADMA 4LF9B 1IFXA 1OX4A 3W6NA 1B0PA 2H54A 2WU8A 4MICA 1EVLA 2PQ2A 2O0KA 3A4MA 2XZOA 4QBGB 1XRQA 4MEAA 3QE9Y 4P6VF 3MZ0A 3WWPA 4KE9A 4ZYTA 3EPJA 2GHTA 4KJZA 3DHEA 4WOPA 2HAEA 2P3QA 2WC1A 3SEAA 1VHWA 2BFBB 1QXSA 2Q21A 1FMJA 1UDXA 4G0MA 5J59A 4BJ6A 4C0WA 2ASVA 4R2WA 3TK1A 4ZEVA 2PJUA 4CM5A 1CR0A 1E7MA 4IVRA 1H2XA 2ZCJA 4F2WA 3AR9A 3BF7A 2PL5A 3EPHA 2JD1A 4ZGWA 3PGLA 3JX9A 4G5RA 2WF9A 2V7XA 4KE6A 3GJ4A 3SZRA 3LLMA 3M6AA 3WK8A 3ED5A 3HSKA 5K3CA 3TFQA 1MQSA 1LVUA 4X1YB 5K2OA 1SXJC 3U4MA 3WYDA 1P62B 5DM2A 3HNOA 5EKXA 3KOYA 3HKCA 4OHXA 1T13A 3HR4A 1MCZA 3LECA 2B25A 3ORFA 1ZVMA 3BHMA 3EWIA 4K7JA 3KKPA 1U7HA 5KX5F 3TG8A 1KZ1A 2JIMA 3CM0A 5FBVB 3JQAB 3DZHA 4R2LA 2O2EA 3F97A 3KQTA 5DP2A 1OU4A 3UPUA 1S3FA 2H5IA 4M89A 3BERA 5E6RA 4GOXA 1I5RA 4M6WB 4DA0A 2I66A 1NQTA 2Z1DA 3RARA 3V7NA 2C9CA 2P62A 4NPHA 5HIIA 1Q0LA 2Q29A 2G88A 3EF0A 1CTQA 5CYGA 5FAKA 2AOVA 1WDKA 3LHDA 4KWCA 4GI7A 5AP9A 4N7MA 1G8GA 4JH0A 1T2NA 2FGJA 2RJ3A 4M1QA 4GBJA 3ANSA 2QRVA 4HZGA 4RDHA 2G8NA 4YMGA 2J6HA 2AQIA 3DFFA 3K9LA 2GBGA 2RG7A 3KELA 5CT9A 5ERYA 4OHOA 1XRJA 1II8A 2EJCA 3DBHA 3QI2A 4TTQA 1TTHA 5TE9A 3I2FA 2JAOA 3RFUA 1SZCA 4EB6B 5KHLB 3LTNC 1ZCAA 5JNWA 1P4HA 1J0BA 1FP4A 1Z6QA 2IHBA 3D1VA 4YCAA 5AUQA 4ZCLA 2NU8A 5FWXB 4FHEA 5JAMA 2RKWA 3AXTA 3BIJA 1B14A 1PR4A 4MGYR 4UBIA 1G7CA 3V1TC 1DPFA 2AOWA 2UZ0A 2YNMA 1KIFA 1CVLA 2NP6A 1UMDB 4V3CA 1I6LA 4QHTA 1T24A 1FB5A 1UKEA 1K0UA 3I45A 2C07A 4DRXB 2I87A 1KZ9A 3UMGA 4J94A 4EVQA 5EIEA 2FSVA 4TTTS 2WFLB 3NBFA 3N8IA 4R7ZA 2NO9A 2B4AA 4BZPA 4JI7B 5ANRB 1KO1A 1TEVA 2R6ZA 4EDHA 3IPYA 4XPIA 5C5CA 1CFZA 1PZFA 1JUDA 4N5IX 5LBIA 3OX4A 2V9PA 3WKCA 5EIBD 2GM9A 1GQ2A 1NOKA 1JDUA 3IULA 3OEHD 3DONA 3OT5A 5LKAA 1K8ZB 3H9GA 1U3VA 2FPOA 2D5IA 3EQ7A 4GZLA 4IZOA 4V0RA 1FW6A 3BMQB 1O6ZA 1NFFA 3C6MA 5DYGA 4HWPA 1BXGA 3QV2A 1QH8B 1GL6A 2F6RA 4IWYA 3V2UA 3WMRA 4BZZA 3N6RA 2XCIA 4ZALA 5JJIA 2G71A 1TF2A 4RS3A 2ZYAA 3AFGA 1YASA 4B09A 1NW4A 4B9AA 1AXGA 2QTFA 2HCRA 3EH2A 3N0VA 3RJ5A 1THZA 1GU0A 1JDVA 4RETA 5IM4A 1R50A 2DH5A 4ABTA 2KX7A 2AW3A 1XZMA 2X0NA 4TMYA 5HBGA 1ESDA 1AO0A 4QXAA 5TSDA 3CVJA 3LWDA 3OOYA 3ROTA 3TRIA 3WGKA 4OLAA 3A6FA 5A9RA 2F8SA 2SKEA 4TT3D 2PH3A 6GPBA 2YWHA 3L8MA 1F2UA 3K6KA 4XUGB 3C3DA 2QYHA 4UAGA 4AP5A 2JIZD 3L0IB 4HXYA 5AVJA 1J6UA 4DB2A 4HYTA 5BN1A 4DR5B 3VSEA 3J81k 4EHNA 2AJLI 2QM8A 3GFFA 1JDSA 1OH8A 3TOZA 3O3CA 2QMYA 3OQPA 3X3HA 2EYQA 5KNCA 2HRDA 1H8HA 3I9JA 1FFYA 5IBPA 3KJIA 3H3FA 4L5CA 2G3YA 1EAMA 2ZE7A 1O95D 1QGAA 3K4PA 3MMSA 1BJRE 4FEEA 5K05A 5EFZA 3RU7A 4XB1A 2OZEA 3KV3O 1LRJA 2BM8A 2QZZA 2X6RA 3PVZA 2W4QA 4KKVA 4R1UA 4Z9YA 2OXTA 1XCOA 5IAAA 3SLGA 1QCYA 3D2LA 5FFMA 3IPRA 4AY5A 3LC2O 5FWDA 4GNKA 2JZNA 3CVOA 2Z9CA 5I9BA 4PYQA 2D7DA 3GELA 1PSWA 3QXHA 2JRLA 4XWTA 4H6XA 5FUQA 2I2AA 3VNQA 4MZDA 2UYYA 2V96A 3EXHB 3DMYA 2Q1TA 1YIOA 4JT2A 3TIFA 3TXXA 1JILA 3I32A 3BT7A 2B82A 1NYTA 1LRKA 3GJZA 2JJ8A 3SOPA 5CX1A 2D3WA 1XRLA 3OHSX 4URYR 2ZDQA 1NIJA 2XMPA 4KQIA 1VGQA 4KMRA 5DEIA 4ZJUA 1M6WA 3LA8A 1RJFA 4TMXA 5IAJA 1U5CA 1I1HA 4DLNA 5JCZA 4PYLA 2WG0A 5IN5A 4WVFA 5GIOE 2CL5A 4JBXA 1W4LA 4ILKA 5CXUA 4Z7QB 5LM3A 5JSKA 1HFEL 3QOXA 4DDVA 2LIPA 2Q5FA 4N7RA 2A9QA 2DBYA 3BDIA 2EIXA 3PDJA 2L19A 1VI6A 3S8YA 2ZIUB 1QVZA 1XPUA 4N6GA 1JQLB 2B4TO 3TLGA 5FA5A 2PS3A 2Z43A 4H1TA 3RO7A 3LWZA 1D0SA 4M2LA 3TVDA 4ROTA 4IL5A 4AF7A 3PLNA 3REOA 3UJPA 1IIRA 2XMSA 4FI3C 1PGJA 2QLJA 4P3OA 1RACA 2Z6UA 2PS0A 4M54A 4B3XA 1JJAA 2ZVPX 4D0LB 1Q50A 4UTZA 1KZYC 1T8PA 1WQ1R 2AR0A 3MIZA 2C5LA 2H0AA 4V0MA 1DTWA 4AKIA 1CY6A 1FRZA 1OFHA 4XQ0A 3DO8A 2QXYA 3EMDA 3CU5A 4AKEA 4ARCA 3K9QO 3F5FA 5H3CA 3HFRA 3AKDA 3PYXA 4LZWA 1U7UA 3EUAA 1XBTA 4IDDA 1LBEA 3S7ZA 1WOYA 3TDKA 4RZ2A 4G0WA 4M0CA 3W3ZB 1Q6YA 3OM1A 2X5XA 3C16C 2FFRA 1FC0A 1PUXA 4MRSA 1C3VA 1E6LA 3ESRA 3GCXA 3G2KA 3ND7A 4GX2A 4F4JA 2CNNA 5A06A 4ZWNA 4LYHA 4BP3A 1KMCA 2LGJA 4MULA 1B6RA 1E6UA 2ZDHA 1V2HE 3PYMA 4FMDF 4ZU6X 3A05A 1EEHA 3ZJUA 2CMKA 3WHPA 5D00A 3DZKA 3CZPA 2VAMA 3FLEA 1YA8A 5ER9A 5REQB 2VHWA 2FEKA 2Q3LA 3HR7A 4MB0A 4RXMA 3QVUA 1O94D 1CQIB 1P29A 3GJQA 3NBMA 1LBQA 2EF1A 5EXPA 3LOQA 5FWAA 4PX9A 2O7NA 3IIIA 4YUYA 2FZWA 2PZ8A 2FMFA 5BYJA