4UNQA

Mtb tmk in complex with compound 36
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 72
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unqA00
4L16A 1WP9A 3QF4B 1TQDA 4P4SB 4JS0A 5E7IA 3CKLA 5LBIA 3TVTA 1GL7A 1LFDB 1VHLA 2GA8A 5EP4A 4MYTA 4OHZA 4CEJA 1Z06A 3X1XA 4UJ5A 1UKEA 1BMFD 1W4BA 3CX8A 5TARA 3MLEA 3FE2A 4W5WA 3FKSD 4NYMR 4BFWA 4E03A 1Q12A 2UVQA 1XZQA 2BVNA 3EC2A 3TR5A 1W47A 2XZOA 4HZIA 3PUVA 1ODFA 1W4AA 2ZYVX 4QGFA 3MAAC 3LQRA 3S1AB 4L5BA 4CT5A 1YZNA 1A5TA 2D7DA 3TJZA 4I1SA 3SJBA 4D81A 1XF9A 2ZI3A 3QPUA 2AXPA 3KQNA 3BORA 2ZRMA 4DLTA 5G53C 4TL6A 4LJ7A 1GIAA 3U7EB 1FQJA 4BLSA 3CRQA 1JR3D 2VLIA 2ZE8A 2J0UA 4JMPA 5UKDA 1NMXA 3GEHA 3GPLA 2H57A 3CLVA 5KTYA 2IXEA 3E5HA 3X1WA 1QG2A 1G5PA 3W8RA 5IDVA 5TVKA 5DYGA 4EUNA 1FP7A 4Q7LA 3AVYA 5JMTA 1BH2A 1RIFA 2C9CA 4NH0A 2FSIA 2C78A 4TN1A 3AF1A 4EQ6A 3D8BA 2V9PA 1W2GA 1E1RD 2XJ9A 3L0OA 1FTSA 2QPTA 2XGJA 2GILA 5D3MA 4BFXA 3PEWA 1EXMA 3JZAA 1OXTA 2OILA 3UG7A 4KITB 1Z6TA 3DMDA 4MQBA 3FTQA 3SFVA 2FV8A 1TAGA 4MGKR 4S2EA 2CL6X 1IY0A 3U6KA 2Z4SA 1B0UA 2G1JA 3K8YA 3CH5A 1EFCA 2GZAA 4D26A 3EG5A 4MDEA 1CJVC 2P65A 1DAMA 4FXPA 2ZVQX 1GKUB 1KSJA 4FW9A 4CVNA 4DLSA 5AUOB 4Q4AB 2VYFA 3LWNA 4IJMA 1EFHA 1JQJC 4QC2A 2ZI6A 1LF0A 3N2EA 3NKVA 2EYQA 2X19A 5JRJA 4C0LA 2CLDX 4OJQA 2J0VA 2BEKA 1YJ5A 4V0MA 1EESA 3KKNA 1Q3TA 1IAQA 1N6PA 1YRBA 4HUTA 3IQXA 1OE0A 4P31A 4LJ8A 4U00A 2ZRFA 2HLDD 1AN0A 1ZNWA 3GJ8A 4JL5A 5C4MA 1W1WA 2IYUA 3JVVA 3O8BA 1N2CE 3THXB 2BDTA 3C15C 2FFHA 2NMVA 4JLDA 3CUEF 3PUYA 4R9UC 5JI2E 1Q20A 2GZDA 2HJGA 2FSFA 4L9SA 2A5YB 4NYIR 3K9LA 1U0LA 1XJCA 1KJYA 3T5DA 2PX3A 3H1TA 3PUXA 2QAGA 3RS3A 4R7ZA 1UBFA 3I8SA 4UJ3A 3U3MA 2IS2A 2W2XA 4G1UC 1LY1A 2PT5A 3P1JA 4Q9KA 2F1HA 5KSPA 1P2VA 1GFIA 2XNSA 1OXXK 2OESA 4US1R 1NG9A 1SQ5A 1OF1A 1D2MA 1CXZA 5J4VA 4IDPA 1KDOA 5GJBA 2WKPA 2PZEA 5H68A 5G41A 5TDHA 1AM4D 2J3EA 5FI0B 3K09A 4KO8A 2RHDA 2EWWA 1S1CA 2I1VB 4JZKA 4RD2A 5TY0A 2O8EB 2J1LA 4V0LA 1ZC4A 3T61A 1NLYA 4A92A 5CITA 3SFZA 3GFPA 2J9RA 4NPHA 1T3SA 621PA 4BFZA 4EFMA 4ZIRB 1G41A 3WHLA 1TADA 3CF0A 1N6RA 4PQRA 4HLQB 1ZD1A 4TYWA 3QBTA 4ARZB 3B2EA 4N0EA 2CE7A 3KDSE 4ZV4A 1Z3IX 1MO4A 5GJWC 1IN7A 5HR5A 1MR3F 3PFIA 2G6BA 3T1OA 2GXQA 4QOSA 3EX7C 5TV2A 3LLUA 3RYTC 3VKWA 1II0A 4V03A 1NF3A 1ZMXA 4MYCA 3L8YA 4DEXA 2D74A 4EDHA 1R5NA 3OF5A 3N5CA 2IS4A 1Z6AA 3ZS8A 2ZRDA 5ELXA 4TMZA 4Z1MA 2O8DB 3C5HA 4UKDA 2XZLA 2IWRA 3WYFA 1KO1A 4C0JA 4DDWA 1ZUIA 2Z83A 4FCVA 3N70A 3GFOA 3K9GA 2GAOA 3B7GA 4WBSA 1N5IA 5CJPA 5E4FA 3VU9B 4CEIA 1LW7A 2GCPA 3ADCA 2VHJA 1E2LA 1CRQA 1U2RA 1W2HA 3EZ2A 3OEED 4Y0AA 4XJXA 5FTNA 5EXSA 3U4QA 1XMVA 3PUWA 1DAHA 1NVWQ 2BHRA 1FMLA 3KKPA 4A4DA 4QBGB 2MSDB 2F3TA 2MMGA 2HLDA 4RD4A 1XD9A 2E87A 2OSBA 4XD7A 3TNFA 4M1WA 3REFA 4BZXA 5LPNA 1E2GA 3DL0A 1PLJA 5G3ZA 1E2JA 3AP1A 1ZIOA 1V5WA 2GTPA 4F91B 3FWYA 3DM9B 1XD2B 1SZPA 3RRNA 2BMDA 3THWA 4NYMQ 4XTRA 2GEUA 3W6OA 1Z0IA 2C96A 5FPYA 2QTHA 3QKTA 4PSAA 3QF4A 1G4AE 1SHKA 4YMWA 4KVGA 1AIPA 2HCBA 2IF0A 3I92A 1Z08A 3KJIA 1VDZA 1NBMD 4LBYA 1GL6A 1NIJA 2V4ZA 2ZRNA 3B9PA 3IIJA 3FPAA 3G5UA 1G4UR 2C2HA 3TUIC 2Q6TA 1ANKA 1U8YA 2ANBA 2ZI9A 1KY2A 4WZBE 1E2NA 4G5QA 2FEOA 3MG9A 1OFIA 4Q03A 1U81A 1LVGA 2R2AA 4G01B 4JBYA 1T8UA 2O52A 3GLFB 2OCYC 4GT1A 2QE7A 2QTFA 3VTKA 2ZJ2A 2CL7X 2V55B 3EIQA 4QHYA 2NPFA 4M21A 4YLGA 1NLFA 4L4UA 4ZCIA 3W3AA 2D7CA 1Z07A 1F5NA 3FGNA 4DUGD 2ZRHA 4BUJA 5SZHB 1PUIA 4OHYA 3RS2A 3LA6A 5DYIA 3I3SR 3SQWA 3BGWA 4PSVA 2V7QD 4LZZA 5JFGA 4LC1A 4E22A 3WMGA 1WE2A 1UBEA 2QROA 4ZKDA 5BQ5A 4C0HA 1DE0A 3A8TA 1S9HA 1OV4A 5L8VA 4TT3D 3B1YA 4XSGA 3NHBA 1VYUA 2ZSAA 3TUJC 1NN1A 3GQBA 1QRAA 3OIVA 4JSYA 3PUZA 4BFUA 3GLGE 4D0GA 1OHHD 1VCNA 4JT4A 1XWIA 3NBFA 4OQNA 3M0EA 1G7RA 1YZUA 3DZ8A 4QBHA 2WWIA 1VG9B 2A5GA 4JBXA 2V1XA 1NY5A 2QGNA 3GJ4A 1W0JA 1D9ZA 2ZI7A 4JLJA 3DZDA 4C0SA 1FL9A 4YC7A 2JASA 4I81A 2JLYA 2AD1A 2NTYC 5JWOA 2NG1A 1X6VA 5JHHB 1E1QA 2OE2A 1XCMA 5IK2D 3UKDA 2XAUA 2XEXA 2ZRAA 4KODA 1N5LA 4JKIA 4U5XA 4B76A 2BMEA 1DVRA 3R7WB 2QUZA 1ZC3A 2A3RA 2NOAA 1QHHB 5F98A 3SYNA 1IJEA 1FNNA 3OHMA 4LDJA 3I32A 2J59A 4KSCA 1EWQA 2FWRA 3CRVA 4BRUA 1V43A 2WM9B 2G0NA 3AKCA 2HV8A 1TQ6A 3UMRA 2UZIR 2CK3D 3PV0A 2REXB 2ZI4A 2ZXUA 3LVQE 3GLGA 1SXJA 3PG5A 4AYTA 4N0DA 2XTNA 4JYCA 4Q4HA 3GCGA 1BMFA 1VYTA 4LHZA 3KUCA 4QGHA 3VKHA 3KTAB 4Q9IA 2KI5A 2O8FB 5JECA 4MH0R 1CRPA 821PA 2HCJB 2PJZA 2WSSA 1TF7A 1H8ED 4HZUA 4WVFA 4ZI2A 5FUWA 4C2UA 5AUQA 2VA8A 4HZUB 4MRNA 1PUJA 1G20E 2RMKA 3DHWC 3LV8A 1FW6A 3I8XA 4ARZA 4QNMA 1E2QA 1DAGA 1IOZA 1ZYUA 3C4JA 4A0HA 1TF5A 1N6KA 1QHGA 3IO3A 1E98A 5CYOA 1XPOA 2BKUA 1J2JA 3IKJA 3A36A 1ZNZA 3OESA 4M1MA 5SZKB 1HV8A 2O0KA 4BE7B 3IO5A 4M9QA 5FOXA 4KFUA 3C14C 4JLVA 2DR3A 4HSEA 2NZ8A 3CZPA 5TMPA 4OQFA 3T15A 5AUPB 2KSQA 2CEAA 1E3MA 1W36C 4GPTA 1U98A 1OKKD 1DO0A 5EXXA 4DCNA 1G3MA 3AVXA 2R62A 4DLZA 1K8RA 4V0KA 4TYPA 3AVVA 2NO9A 2FF7A 4LHXA 3WP0A 2GBLA 4RFVA 2JIZD 1II8B 1SVOA 4DBLC 5FR2A 1KK3A 1N6HA 4BEBA 1CIPA 2GF9A 2ZQ5A 4GOJA 3I4LA 4A8JC 1TQ4A 1OYWA 1W48A 1Z8FA 2FZLA 4W5JA 4GRAA 1XTKA 2CMKA 2PX0A 2DBYA 2O5VA 3QY0A 3B82A 1IN5A 2BJVA 3RAPR 5DGXA 3GLIE 1YZTA 5FBQB 3B1XA 4Q02A 3KFVA 1YRAA 3IDQA 4Q1FA 2L0XA 3ZVMA 5KDOA 2K5UA 1Z83A 4FMDB 3ZIAD 3C8UA 3H4MA 5BN4A 2JLRA 1E1QD 4LV6A 1X8KA 1U99A 4V0ME 1RPZA 1ETUA 4XTCS 3QKRB 1ESMA 5JS7A 1JPNA 2NPIA 4OK5A 3TQCA 4R71A 3BH0A 1JQLB 4PXAA 3Q3JB 1JAIA 3T5GA 1ZCAA 3CM0A 1ZBDA 1XTSA 2R6GA 1AZTA 4HLCA 3M1IA 3U60B 1GUAA 2ZYTX 2VH5R 1UM8A 2CCGA 2ZAMA 3X2SA 4OI2A 2IHBA 1RVDA 2W2TA 1P60A 4JVSB 1SULA 1JNYA 3DEFA 1XXHB 1WBBA 3E2IA 2OO7A 5GADl 1ZM2A 5FOUA 2W6IA 1YKSA 2D06A 3EPHA 4BZPA 2LCFA 1KO7A 1P9WA 1WBDA 1XMSA 3QQ5A 2R6CA 4YDSA 1H65A 3DDCA 2QMUA 2QP3A 1HQYE 1RYHA 3U3KA 2H1LA 1CU1A 1VG0B 4YONB 2WJVA 2G9NA 4TTRA 4AYWA 2KBFA 1P6XA 4NE2A 3AKDA 1P62B 3AH8A 2OXCA 4PQYA 3AF4A 1BKDR 1W4CA 1ZVQA 3IHWA 4MGYR 2ZR0A 4RKEA 2BM0A 3BXZA 1E2HA 3KL4A 4Q9LA 5CIQA 1ZD9A 4DCVA 1YZGA 5HZHA 3NIBA 3U2QA 1LNZA 3C16C 4ZDJA 4LHVA 2AKAB 2YOGA 4NMMA 4QM7A 3A1WA 4KXFB 3GJ5A 2WAXA 3NTUA 4LV5B 4RFSB 4LYAA 4LJ6A 3AQ4A 3RDPA 4V0NA 3GFTA 3KKMA 1PLKA 2ATVA 2XSZD 3BH6A 1TQ2A 2FE4A 1XEWX 4PTLA 4E5UA 4JYBA 2WWFA 2W6JD 1QZXA 1F48A 1DTSA 5IRCD 2VEDA 2GNOA 3NBYC 1Z6YA 2FA9A 1KSGA 3RVBA 4MKIA 3ICQB 1TPZA 4D4KA 1Z2AA 3IPXA 2WV9A 3EC1A 3OAAA 4R2IA 1BYIA 1CBUA 1EFRD 5BN5A 1R0YA 2BMFA 2YVUA 3HWSA 1R5BA 3K0CC 3O47A 4NP6A 4B48A 4TMKA 4Z54A 2FJUA 2HYIC 4CF7A 4Q47A 3QVVA 2FN4A 1HE1C 4QRHA 1FMJA 2YWGA 4TT3A 3NC1C 2F1IA 2HF9A 3QI2A 121PA 1ZRHA 4C0QC 2WIBA 2FPKA 2QBYB 1NG1A 2GCOB 1IM2A 1CJMA 3BFKA 4Z8XA 3OE7D 1X8LA 4P32A 2ZROA 1A82A 3FB4A 4EPTA 1J8MF 2WWXA 3GLFE 4NCJA 1F2UB 2WMNB 2J5XA 4B47A 1HEIA 4LV8B 4MKGA 1XEXA 1DAFA 3SNHA 2PJRA 3LVRE 2PMDA 1W46A 2AFHE 3W6NA 4PHGA 3TIFA 3IEVA 1N6IA 4Q66C 4A36A 4RD0A 2AKYA 4OHXA 1F6BA 1Z22A 4LHWA 2CVHA 3WYGA 1CJUC 4B73A 3TVDA 1KI9A 3SBEA 3U5ZB 1NIPA 4C4PA 4OK3A 1D5CA 4NCNA 3CB4A 1OXSC 3QEJA 4NONA 1XCPA 2IUSA 3CR7A 3SYLA 2V3CC 4AG6A 3NHAA 4MITA 3CPJB 3CX6A 4MDFA 3K1JA 5DO9A 2W2VA 5CLQA 2BBSA 4BQSA 4AKHA 4WXRA 4HAUA 1Q1BA 4M9ZA 1PZNA 3RSLA 3SR0A 2VP6A 4RZ2A 2JCSA 4IVRA 3AKYA 4TZ6A 4GFDA 4M0LA 3WRYC 4HEJA 4PZZA 1R4AA 3L82B 3VU9A 1XEXB 3WHKA 4A2WA 4HB0A 4ZDWA 1OFTA 4D4JA 3RABA 3U3JA 2FU5C 1U94A 1NVVQ 4EPVA 2LKCA 4FMBB 2XITA 4TLBA 1WRBA 1G3RA 2FNAA 1ZU4A 3T34A 1GDDA 2OCPA 2QBYA 2G0TA 1G16A 5EE9A 4IRUB 1VIAA 2ZRBA 4JT2A 2EWVA 2GRJA 2B21A 2R44A 4UNPA 4YXWA 3W90A 3WYAA 5JEEA 4RJLA 1W0KD 1XTJA 2HF8A 3GJ0A 3HDTA 2JLZA 4DDTA 3SEAA 3S1AA 1N0VC 2VHTA 4GOXA 2J7PD 1S3SA 2O0JA 4LK2A 2QSYA 1XRJA 4N1AA 2QMEA 1OIVA 4KV9A 4U02A 2H92A 2JLQA 2OCBA 1IQPA 1DEKA 3NDBB 1US8B 2JAQA 1S96A 1S8FA 2F43B 1E0AA 3AVPA 4PQFA 2JDIA 2GXUA 4B3XA 2BEJA 2RGNA 4JVNA 4X8LA 2QI9C 4DZZA 4A82A 1OYYA 5DHFA 2WVJA 3PENA 3BE4A 2ZE7A 5JSZA 3UXMA 4HLUC 1G8FA 3GJXC 5EE0A 3NWJA 3BH7A 1FNMA 1Q57A 2IW3A 4NL4H 3LW8A 4PC6A 1ZJ6A 1FQKA 1KNQA 2IXGA 5F9HA 2PLFA 1XCGB 3RC8A 5KSOA 4KLZA 4IXMA 2FX3A 3MUFA 1HH4A 5EXTA 4QBIA 2GKSA 2IYYA 4IEIA 3GD7A 1GTVA 2BCGY 3LXXA 2AL7A 3RSOA 1NN5A 4BLOA 1YVDA 4HLUA 4C7OA 4TMVA 3WY9A 4WAUA 3V00A 2J46A 3KJHA 5C18A 1P2UA 2RGEA 4TSFA 4PR0A 4C9BA 5M04A 3QXSA 1KAOA 2WJGA 2X2EA 3IBGA 4R2HA 5J47A 3QNUA 4XH9B 1GKIA 1XU4A 1ZNXA 4URVR 3ETLA 2HJVA 3CH4B 3THYA 3Q7QA 5KYKA 2EFEB 2B6HA 4DCSA 1E79D 2ZUDA 1GNQA 5P21A 1N6OA 3WNDA 3DVLA 3P20A 1B23P 2QT1A 1P4SA 1KI6A 1U9IA 2C8VA 2FMXA 1J7KA 2QP9X 2NO7A 3PCRB 4M8NE 4XWAA 3ASYA 3BFXA 3PEUA 2WJYA 4M9XA 3CRMA 4QJ5A 2DY1A 1NN0A 4X8MA 1EGAA 2YYZA 2Z5FA 5GJCA 1JAHA 1FUKA 3CNOA 3CF6R 4OQMA 4FN5A 2X1VA 4NKRA 4URZR 5H1YA 1KMHA 2QTVB 2ZRPA 5AJZA 5KPDA 1P9RA 2OUKA 2VP4A 3JZMA 4P4TA 5BN3A 3D3QA 2OAQ1 2GDJA 2ZI5A 2ZPTX 4HAXA 5KDLA 3FKQA 2R6FA 4WZAE 3VX4A 2DFKB 4MA4A 3O8RA 1OPXA 3PJRA 1ZM4A 4FI3C 1JR3A 2WAYA 1J8YF 3QXCA 5E7MA 5FUYA 1Q44A 4I99A 4ZO4A 5E3HA 2FG5A 1RJ9B 3NDPA 3QSYA 3KQKA 1YZKA 4ZDIA 5ANRB 2AHOA 4DT1B 2F9LA 4TQUS 1GNPA 3RHFA 3F0TA 2P2LA 4IDHA 1UBCA 4Q7JB 4C2TA 4B3GA 4O25A 4PO8A 2OM2A 1MABA 3A4LA 1N5JA 5H70A 4TYYA 2A78A 2VO1A 1G6OA 3ADKA 3U4QB 2GXAA 1BO6A 5C46F 2GCOA 2QE7D 1G17A 3OAAD 1A2BA 3HU2A 4BWYA 4US2R 1HQCA 2RGBA 2ZJAA 1E2MA 5GJVC 4EJSB 2ZE6A 2IYTA 2WIAA 4EQ6B 1MKYA 4TZ0A 2ERXA 3GLIA 1OHHA 2MSEB 4AIIA 3VMFA 1E94E 2QP4A 4B43A 3FMPB 2FZ4A 5LB4A 2GK6A 4DLXA 1HT2E 5K8UA 1WQ1R 3QOFA 2IS6A 2YZ2A 3DOEA 3I5YA 3EIEA 2ZE5A 2XB4A 3PIRA 5E7JA 2LKDA 5AJWA 4DCTA 1KI8A 1Z0AA 3ZS9A 2RGXA 1HT1E 2GBLC 1T91A 2PZFA 3IIKA 3F5FA 1WDTA 4BLQA 1YE8A 4RD6A 4O0MA 1SKYB 1XMIA 4UNNA 1G3UA 3VKGA 2ZJOA 2R8RA 4FMDF 3QXHA 3EASA 3B1VA 4JLAA 2O8FA 1IJFA 1ZM3A 4URXR 4AC9A 3R7WA 1W7AA 3HP1A 2G77B 2GJ9A 4P4SA 4NCIA 2JJ8A 4FWIB 3BB3A 2J0SA 1E9SA 3AVTA 1S4QA 1OB2A 1GSIA 3R9IA 4BLTA 4K8OA 3RRYA 1BYUA 4HYYA 4PO1A 3TSOA 1Z63A 4KBFA 1ZU5A 5FBWB 2N1BA 4DIDA 5K8LA 4OL0A 1R10A 5FBRB 3NEYA 4B3DA 4LYFA 3W34A 1NNEA 2XJ4A 1XXHE 4GZMA 3BD9A 2NQ2C 2GZHA 3FMOB 1QF9A 2AK3A 1QVAA 2LWIA 4C0KA 1N6NA 2WSSD 1ESNA 2BM1A 2XNDD 1E4YA 3U6BA 1XP8A 1NP6A 4S35A 4B6FA 4TLEA 3F8TA 5B64A 1E2IA 4M1SA 4FINA 3K9HA 1T5IA 3M4YA 1DG1G 3KJEA 1QHSA 2QNRA 2RGCA 4D0NA 1G7TA 3UMFA 3AF2A 3B5JA 4DLWA 5CK4A 4HDQB 1JALA 3AF3A 1ZD8A 1ONBA 1T9HA 2XZPA 5JJLA 1DBSA 4KU4A 1M7BA 2X2FA 4RCZA 2C98A 4U7DA 4HB2A 4ASUD 4MGZR 1TU3A 1M2OB 3JVUA 2XXAA 1M7HA 1TUIA 2IUUA 1PV4A 1EWRA 1KSHA 2X8AA 3I5XA 2BKEA 1E9CA 1HTWA 4IDQA 2JGNA 3VHXA 4LOAA 5CK5A 1E99A 1F2TA 5DH9A 3A1UA 1D8TA 2ZRLA 3CW2A 1SVIA 4Q1AA 5HCNA 2CNWD 5A4JA 2F6RA 1S0UA 2QRNA 4BASA 2QL6A 2A9KA 4PC1A 1W36D 3WBJA 4M4SA 3OEHA 1GILA 3I72A 2ZU0C 1XNJA 2MSCB 2V8OA 3NEJA 2OZEA 3KZ1E 3HPQA 3LBIA 1SXJB 1CR4A 1E9BA 4KCGA 1TL7C 4M1YA 5BYKA 1NKSA 3SJCA 2YC4C 1E32A 4NYIQ 4A6PA 4GP6A 3MWJA 3QBVA 2CJWB 1N0WA 3NH9A 1AS3A 4QBFA 2D62A 1YR8A 5JWHA 5KSZA 1OT3A 4D25A 3ZZ0A 1IXZA 2Q3FA 3U3OA 4E07A 5IHPA 4NBSA 4URWR 1G8YA 1I4LD 3KTAA 2FFAA 5LD2B 1G7CA 3DO6A 3MGCA 5A5GA 2PL3A 3B1ZA 1NSTA 1E1RA 4B2PA 4Q4LA 1DPFA 3H86A 2OV2A 1IBRA 4OQLA 5KUTA 2RB4A 3QG5A 4EPYA 4KYUA 3LBHA 1QBKC 1UDXA 2P6NA 3BS4A 4XD7D 1Q3HA 4TL8A 2F43A 1UBGA 2RGAA 3A4NA 4IDOA 4FWTA 1ZM7A 3MJHA 2PEZA 1G19A 2OXRA 2P6UA 5HTKA 5HCIA 2CHQA 2ZIAA 2AWNA 3L43A 4LJ4A 2RH5A 2QQEA 4MKHA 4JBWA 4BZQA 4Q00A 3T1VA 2VP2A 3TSZA 4BEJA 1TTTA 2AN9A 2WKRA 4DJTA 4EPWA 2ERYA 3GJ7A 1XTIA 1Z0KA 4G0NA 3WP1B 1UKZA 4JLOA 4IDNA 1QDEA 4FIDA 4CT4B 1JPJA 2G3YA 4HUQB 2IYSA 2ZSDA 2ZITA 1N5KA 1P9NA 3ONWA 4M1KA 3TSWA 1SVLA 2UKDA 4DCUA 1JEDA 5FI1B 2JJ1D 5AUNB 3VAAA 3B85A 2WPDA 3RWMB 4B33A 4BFYA 2J7PA 1T3HA 2QEQA 4PX9A 4DDUA 5EE1A 2NGRA 5DN6D 1J90A 1VTKA 3AEZA 1COWA 1UADA 1CR2A 1TMKA 1RRFA 5J4KA 4MRSA 1MO6A 2WMOB 1CKEA 2O0HA 4HB3A 2JDID 1UPTA 2PBRA 2W0MA 5D3QA 2EYUA 2Q9CA 2IBMA 4LI0A 1S2MA 3K0SA 5JCPA 4ZCMA 2JATA 1CF4A 1GL9B 1WCV1 2BMJA 2BWJA 4MYUA 4MUBA 4WXPA 1TEXA 2CCKA 4Q4AA 4AWXA 3LAWA 1G5RA 4NYJQ 4GL2A 3QKSA 3MMPA 4FMCB 1P7CA 1HYQA 2PZGA 3BIFA 2ORIA 1SXJE 5EP2A 4OYHA 3E1SA 3L2OB 3BBPA 2A5FA 1KI2A 2E9SA 3RC3A 4YMVA 2ORVA 4QHSA 3G0HA 5JRZA 1RRCA 4Q5IA 4GBMA 2REOA 4PPGA 4ESVA 2BBTA 2CL0X 5FL7D 4IOLA 4O2RA 1M6NA 2R6DA 2QORA 3HR8A 3FMFA 2JJ2D 3U44B 1N25A 1OXUA 1KKMA 2I4IA 2OFXA 3GLFA 4B74A 3RS4A 2ZR9A 5CIWA 3K70C 4TMXA 1BIFA 4M9SA 4TSFD 1IN6A 1DS6A 1GNRA 1GVNB 1VMAA 1KK1A 1A1VA 4KFTA 1F2TB 2RGNC 4OK6A 3FFBA 5CB6A 2CHGA 1AJEA 4IHQA 2IUTA 2P5SA 2GEDA 1JJ7A 5KNBA 2YJTD 4O3MA 3BFVA 3AGQA 3PXGA 2QMOA 5HPYB 4KLNA 1E9DA 3B1WA 4W7SA 3KJGA 2HT6A 1SVKA 3FVQA 4A1FA 1EX6A 1OSNA 1DO2A 1K5GA 4OKSA 1MOZA 4CEHA 4A2PA 3EPKA 1IY1A 1SXJD 1UAAA 5HE8A 1RYFA 2VL7A 3QKSB 1NSFA 2OEPA 4CZ2A 3BOSA 3SQXA 3M6AA 4Q4JB 2WWHA 3OIWA 3TUZC 3EIHA 3EPJA 2OBLA 3L8ZA 2QRZA 1IONA 1NJGA 3ZJYA 2ZM5A 4Q7KA 3K53A 1Z28A 1XEWY 3U61B 2C5LA 3HYRA 2ODWA 3SDZA 3FKSA 4HAWA 1EFTA 4LBWA 2G83A 4NCHA 1XD2A 4ITRC 3V4FA 2YWHA 1WA5A 4BGDA 3E70C 3IHLA 1L4YA 5CDFA 3PEVA 4B71A 221PA 2OLKA 4TWZA 4OI1A 3VR2A 1MRSA 4YMUA 3CWZA 1S9DA 1VPLA 4WA7A 2QSZA 2GJKA 1HA3A 2FFQA 3SS8A 1GWNA 1LTQA 1KO8A 8OHMA 2ONKA 5B30A 1FUUA 1OH6A 2BBWA 3BB1A 1TF2A 2KE5A 1DELA 2QA5A 3B60A 2FSHA 3RLFA 5J4YA 1K6MA 2FOLA 4JLMA 4XIGS 1SVMA 5EXPA 2ZTSA 4M1TA 1Z5ZA 4TMTA 2GF0A 1IXSB 1NLZA 3P32A 4RZXA 3K70D 3Q7PA 4AI6A 3ASZA 1GRQA 1XXHA 1CLUA 1E0KA 1MABB 4Q19A 1H8HD 3FMIA 1TU4A 2HYDA 1BS1A 2QT0A 3WXMA 4D2IA 5JLJA 3IILA 3KXLA 4HAYA 4WZ6A 3U3RA 4WW0A 3QJYA 3LD9A 3AVWA 4DB2A 3HPRA 4US0R 3KX2A 5JJKA 1KZGB 4JVMA 5A0FA 3SU8A 1QG4A 4OHWA 3BK7A 1GM5A 1W49A 2BOVA 1HURA 5FOTA 2O8CB 2VTKA 4F4CA 3PEYA 3W8NA 4PANA 4EPRA 1M74A 5SZJA 4D4LA 2ODBA 2B7BA 4CIDA 4DWJA 1OIWA 2CJWA 3AVQA 3QE0A 4M2LA 3K9NA 2WJIA 3QUSA 3UMSA 3PR1A 1W4RA 1A2KC 1VCOA 2OBNA 2RGGA 3L0PA 4AKGA 1Q0UA 1R8SA 4OBEA 4TYQA 2W58A 4MGIR 2KBEA 4LGMA 2I3BA 3RNLA 1AGRA 3RWOA 4CRWB 4DRZA 2NIPA 1JEEA 1ZNYA 1AK2A 2RGDA 1KDTA 3BAFA 3TAUA 4B3FX 3WRXC 2WJJA 2WOOA 4K81B 3QF7A 2P5TB 1OFUX 3CF2A 1KJZA 3EW9A 2KJQA 2CK3A 5JCZA 3TBKA 1Z47A 1I2MA 4ZDKA 4NDZA 1NI3A 1JB1A 3AP3A 2IK8A 4GNKA 1VKJA 1XBTA 2OG2A 1KI7A 3D31A 4IFEA 4XWKA 1RKBA 5FOWA 1US8A 2PCLA 4HDCA 4Q1EA 2DPXA 2IYXA 3FYHA 3ZZUA 4BFTA 1AKYA 4F4IA 5EQTA 2NO6A 2NO0A 4KFRA 4ZPXA 1P5ZB 2GCNA 3MWKA 3L0SA 3B78A 4MYHA 4QNRA 3Q5DA 4LPSA 3SI7A 2ZJ8A 3VR1A 2Z6VA 4F38A 1OW3B 5KHOC 3EPLA 2V54A 2DFLA 2GJ8A 2YOHA 3B9QA 4I1VA 1O3YA 4L9WA 4B3BA 4OJKA 2GJAA 1K5DA 1KHTA 4QXAA 3N2IA 1H8EA 3DPUA 3VR5A 2A5DA 4YDHB 5DLQC 3UWOA 1OFHA 2N46A 2QPAA 2VSXA 2Z43A 4QHTA 4I4LA 4RFSA 5DN6A 1KNXA 1KI1A 5D3MB 4DC9A 4O2LA 2RKOA 1LV7A 1SKQA 2Q3MA 2V6JA 4NYJR 1EFRA 1XTQA 3LH5A 3ZGXA 2IXFA 4ZI3A 3KQUA 5FPTA 2V1UA 1OJLA 5KOYA 2N42A 1AQUA 1GRNA 1JI0A 2WWWA 1C4OA 3W5JA 3GLHE 1QHHA 3TW4A 5HE9A 2JLUA 1E9FA 1IXRC 2IF2A 2Q0HA 1E69A 2B7CA 2J0UB 4TQ9A 3H84A 3CONA 3AV0B 1XEFA 1LF5A 2Z4RA 2XTZA 1ZAKA 4OI4A 2P3SA 3VNUA 2OFOA 4PC7A 1Z0FA 1SVSA 3AB3A 3BRWD 4DDVA 3RS5A 4DT1A 4Z1MD 3LXRA 1OB5A 3QPWA 2GHIA 3IEUA 3NBXX 4I1UA 2B92A 4XVQA 1M7GA 1E2FA 2J0QA 1E9RA 1U8AA 2FPMA 4RSGA 3UIEA 3U7FB 4X8HA 6Q21A 4LY6A 2IYLD 2GJSA 5BXQC 1CR0A 4FCWA 4IW3B 3W5IA 4MRRA 4D80A 2ZUCA 1ZINA 2A7QA 3MWLA 3AM1A 4PHFA 1VECA 2D3WA 3ADBA 4C3ZA 3HJNA 1G8HA 2FH5B 1G1MA 2BIFA 4RD1A 3GLIB 2EFHB 1X8JA 4Z51A 1G7SA 1UF9A 3THXA 1NVUQ 5FTLA 5E95A 1HE8B 1KMHB 1P72A 1QVRA 3AUYA 3D6TB 3GMTA 2C9YA 4HATA 1IN8A 3DKPA 4I1OA 4GZLA 4B34A 2VP0A 1NVXQ 3ZIAA 4PPNA 3WMFA 4NZYA 3EZ6A 1NY6A 2X77A 1G64A 3NXSA 1VCMA 2KB0A 4KYIB 2D2FA 4PAMA 3KUDA 3REGA 2IEZA 1WB9A 2YOFA 3FOZA 1VCIA 1GZSA 1ZUNB 3C5CA 5K8IA 3KQHA 1WF3A 1O87A 3MJRA 1DG3A 1ELOA 1XDBA 2BBOA 2QPOA 3PVSA 3EZ7A 1RC8A 3B6EA 3ZVRA 3R9WA 2XNDA 2W0SA 3ND9A 4TL9A 3F3YA 1Z29A 1R8QA 3ND8A 4A6XA 2MMCA 3KB2A 5FPHA 3R8CA 4NCKA 3K0CA 1P61B 4LJ9A 4B2LA 4AURA 1GP2A 1T5LA 2H16A 1TNDA 4CW7A 5EZ6B 1MV5A 3TK1A 3ZVLA 4EFNA 5HKKD 3DKVA 3GEIA 1I2DA 1Z0JA 3W3ZB 4YQFA 1Q22A 2QG6A 5FOSA 4WOPA 2Q3HA 5KDDA 2D4HA 1DAKA 5TXGA 3OFNA 5C4GB 3EWAA 4JJKA 1T6NA 1I4DD 3AKEA 3CNLA 1EK0A 4BFSA 4JSTA 3AGPA 2H17A 4F4JA 4N3NA 2QGZA 1XMJA 3AVOA 2PLRA 3P27A 3THOA 2RHMA 1X86B 3X1YA 2IYVA 3I1FA 4UNQA 4XVUA 1W36B 1SVWA 1EFUA 1CJKC 2F1JA 3UG6A 1GKYA 5BWMA 1MO5A 2R6AA 1R6BX 1DADA 5CJ2A 3R9XA 1G6HA 2HEIA 5FBLB 421PA 3GJ3A 3VR3A 3QPVA 3QXJA 5AWFC 2OBMA 2WWGA 3TRFA 1GOTA 4KSBA 5DIFA 2O8CA 1YQTA 4DSOA 1R0XA 4II7A 4A8JB 1OH7A 4Q48A 3KFXA 5FL7A 1LS6A 1U8ZA 1XJ0A 2IYQA 2JJ2A 4JL8A 1GG2A 5FUXA 1KSFX 1KI4A 2W83A 3GP8A 1KO5A 4ESHA 2DHRA 3CZQA 3OEHD 3SHWA 4LYHA 5KPJA 1W5SA 4A0GA 4GSYA 4B75A 2VHQA 3K0EA 2V7QA 3V4RA 2V6IA 3B13B 3QVUA 1G3QA 2R65A 2QMHA 2ZUBA 3OIYA 3NG1A 3SYKA 3L0IB 2XOKD 2O8DA 3CPEA 3OZXA 2GVDC 4IOJA 1KJWA 2DFNA 4ILEA 2E1RA 4LHYA 3UANA 5KSYA 2ZJZA 1D6JA 1UDWA 4EPXA 4ERNA 1NVVR 2QU8A 2DWPA 5AJXA 4UXJA 4TTQA 3LO5A 5EUQB 5FR1A 2YKGA 2ZVPX 2P0EA 4BRWA 4NTZA 2P6RA 4EJSA 2R9VA 1ZW6A 2F9MA 3A37A 3DOFA 4LRWA 2OFWA 2QM8A 3TH5A 1MT0A 5JI3E 1T4GA 2HT1A 5EE5B 3EXAA 3GLGB 1Q1ZA 1KO4A 4LJYA 1Z6XA 3EA0A 4PSKA 3TAHA 1YZLA 3SHFA 1XJQA 3KQLA 2VHCA 1G21E 3LX5A 5FTJA 1MH1A 1WXQA 4DLRA 4QKQA 5DISB 5KO2A 2AXNA 3A1SA 2IHYA 4EJSC 1T8TA 5L3SB 2VF8A 4KJZA 1AS2A 2VRWA 3SOPA 4IEEA 1UEIA 4B3CA 4AK9A 1UJ2A 2C99A 1CR1A 3RANA 4OI0A 3A1VA 3T1TA 4TYNA 4HLDA 4TLDA 1R7RA 3U7GA 2H7VA 1CULC 3CBQA 1M1YE 3DMNA 3EZFA 1KK0A 4JIMA 2O8BA 1PJRA 4F92B 5BW8A 2VF7A 1YZQA 4A9AA 4NHOA 5F3WB 3TMKA 2WPDD 2QAGB 2ZSEA 5JBQA 2C04A 1L7VC 1FX0A 4V02A 1F60A 1Y3AA 2I1QA 3LW7A 5J5CA 2QENA 1KI6B 2BJWA 4P33A 4YXWD 2QM7A 4IOKA 1COWD 5F2EA 4ABYA 4JKYA 1OH5A 1KY3A 2BC9A 4G5GA 4FD2A 1XZPA 2IEYA 1G8PA 3NH6A 4HUQA 1N6LA 4F7WA 4EKDA 5AJVB 4QJ3A 2ZS9A 3V9PA 1DARA 1II8A 2JJ1A 1PLLA 2VP5A 3CO5A 4H9GA 5EJEA 2QZ4A 4KAXA 1TUEA 2J45A 3X1DA 3D7MA 5CLLA 1E2PA 1VHTA 3GJ6A 3Q5EA 2UZ3A 4UNSA 2ZRKA 4LC0A 2ODEA 1YHNA 1HUQA 1FFHA 3SZRA 3ADDA 3CRW1 1N3BA 4XOIA 2F1RA 3THWB 4ZKEA 4P3YA 5CDFE 2CHVA 3NC0C 2YWEA 4M22A 1ZUHA 3K09C 3VNVA 3A6PC 1Z6GA 2PH1A 3KKQA 5FTMA 5L3VA 5AJYA 2TMKA 1ZCBA 4PZLA 1KOFA 4AYXA 4M53A 1P73A 1Q21A 1JJVA 3A58B 3ZQJA 3QXXA 4C0AC 4PC2A 4G5SA 2NZJA 1QHYA 1XFAA 4LBVA 4URUR 5FOVA 3I62A 5HZKA 1KMQA 1NJFA 2EFCB 4JLPA 1N0UA 4BECA 5DI9A 2DYKA 4A0FA 5IT5A 5JJIA 3EWSA 2ZAOA 3SE0A 4W9MC 5DE3A 2J41A 2QAGC 4D4MA 2Y8EA 2DB3A 5LDDC 4FMCF 3VHLB 2PMKA 4H1VA 1G5TA 2Z0MA 4QGAA 3UPUA 1JXMA 3O8CA 2EU8A 4B35A 2GVZC 5FFMA 2QQ0A 4DLVA 2YV5A 3GLHB 2J7KA 2KWIA 3P4XA 3IPYA 3PQCA 4Z8YA 1R0ZA 3CX7A 4Q4JA 1CS4C 5AK0A 3QKRA 2F7SA 3VX3A 4EAQA 1Z0DA 1HY3A 1E2EA 2ZETA 3SJZA 1RE0A 3IUYA 2ZU6A 5CYPA 2ZJ5A 2AD5A 2WSMA 4K46A 2HXYA 2VIIA 2J87A 521PA 2ZRGA 2G88A 3CIOA 4CEHB 3HR7A 1DOAA 3MFYA 3UATA 3SBDA 1CEEA 2XXAB 2JLVA 1XPRA 4ASUA 1C9KA 4V0OA 5J4HA 5LD2C 3ZVNA 4PO9A 1ZIPA 4B2IA 1FPMA 1T0HB 1P3JA 3GEEA 4L8GA 4MKFA 2FSGA 5LB2A 1RFLA 2OCAA 2VSOA 4KVAA 3FHCB 2ZS8A 3HU3A 4AY2A 2FFBA 5SZIA 2GXSA 2AX4A 3K0FB 1E6CA 2VSFA 1F3OA 5F9FA 1JR6A 4IXNA 1AS0A 2WZQA 4ZIRA 3U44A 3K0FA 5JS8A 4CGZA 2ANCA 1VIYA 3LDAA 5JHGB 4A15A 4D82A 1A7JA 2ZYUX 2BV3A 3KXIA 1YU9A 721PA 3FHOA 3ZD6A 3IGFA 3CWQA 5L3QA 5DI3A 3Q85A 4BLPA 3K0AA 2ZJYA 2GWHA 1W44A 3SJAA 2CLCX 2FPLA 5EUMA 5IF9A 2O8EA 1UEJA 1KDPA 3B8HA 5FL3A 1KIMA 2OT3B 4OHVA 2JLWA 1TEVA 3K0AB 4DSNA 2H5EA 3H2YA 1KK2A 3LX8A 5J40A 2W6JA 2ECKA 2ZREA 4IVPA 3CNNA 2ZSFA 3ZDQA 2IYZA 4G5OA 1DAIA 2GAAA 2VQSA 1FP6A 2NO1A 2YNMA 2ZEJA 1IHUA 3QG1A 4H1UA 2Q9AA 5GVRA 1KGDA 4B32A 3UK6A 1FZQA 2XB2A 1F2UA 4B44A 2CVFA 3LQQA 5GVSA 1H8HA 1S1MA 2JEOA 2IA5A 4JLBA 1SKYE 4LWZA 1XB2A 3A1TA 3LNCA 1UFQA 3MSXA 4DLUA 2YHSA 1LB1B 3CR8A 3EA5A 3SC3A 4P0TA 4IKEA 3RS0A 5C1BA 1M34E 4CEIB 2CXXA 1YR9A 2XTMA 2ONJA 2SHKA 1RRPA 3H0KA 3GLHA 4JLKA 3LBNA 4ZCLA 5BYJA 4C7OB 3QKUA 5FTKA 1RRGA 1E0JA 1E9AA 1DAEA 4KBGA 4QFMA 1W5TA 4DVGA 2O8BB 4QGGA 3UWKA 1T3LA 4RKFA 3WNBA 1KI3A 2JA1A 1E96A 1D9XA 4A0RA 4LX0A 3EAQA 1RZ3A 1R5OA 2P67A 4A2QA 1TX4B 5B57C 4DSTA 2AK2A 2ASEA 4UXIA 1UKYA 5KNDA 1FTNA 3O8DA 5AR1A 1X1SA 3IIMA 4D0LB 5DSZA 4RD3A 4RZ3A 4YMSA 4KFSA 5HKKA 4OQXA 5EZ5A 4RCYA 1KTVA 2F3RA 2IWHA 1KYIA 2IC5A 1G18A 4FCTA 2CLSA 1XD8A 4KI0A 4HAZA 1R2QA 4UXHA 3T06B 3ZYCA 4CYMA 2FGJA 2QAJA 1OIXA 1JECA 3K70B 4LBZA 1NBMA 3ZH9B 1WMSA 1P2SA 4JL6A 2ZANA 2RCNA 3WNCA 4E09A 4C30A 4AKIA 1AA9A 4PHTA 2GETA 4GDFA 2QY9A 1OLOA 2W6ID 4TL7A 4G5RA 4AD8A 1D2NA 1T0JB 3LLMA 1JBKA 2EW1A 1C1YA 3ZQ6A 2OHFA 4ON9A 3NBZC 2Q9BA 1U9IC 1U0JA 1ZM9A 3I73A 1L4UA 2ZYWX 1E0SA 4X8OA 5FPSA 1PVOA 1KZ7B 1VYVA 4LUCA 4DSUA 4PPQA 4TQAA 2WOJA 2B8WA 3VFDA 1A4RA 4PFSA 2GEVA 1W0KA 3FDIA 3KKOA 2CNWA 1G291 4GMDA 2VBCA 1J99A 4PZYA 1E2KA 1NRJB 2ODNA 4QL3A 4RZUA 2JLSA 1QHIA 4IFBA 3OIUA 1NL3A 1Q1EA 2VHUA 4WIAA 3VQTA 1D2EA 2IYRA 5G3YA 5J4LA 3TR0A 4URYR 4DUGA 1M8PA 2OAP1 1SGWA 2XSZA 1G8GA 3EARA 3MWYW 1KKLA 3R20A 4XVRA 4DIEA 1AZSC 2G1KA 4PPFA 3J81k 3TLXA 4DLYA 5C2JB 1NKTA 4QG7A 3BERA 1OH8A 4B6EA 4HI0E 3FHTA 4HDOB 4UNRA 3AP2A 3PITA 1FX0B 2A30A 1QHNA 4TMWA 4DEYA 5B2ZA 4W5HA 2ZS7A 2FGKA 2EFDB 3U7HB 3ICEA 5IK2A 3HYTA 4HB4A 2A2ZA 1JR3E 2FDCA 2DWQA 2WKQA 3KB1A 4BFVA 1QHXA 1XTRA 4D6PA 2IYWA 1I4TD 3P26A 2C9OA 3IBYA 5H8WA 3C41J 2WWYA 2ZSBA 1RW4A 1AGPA 4R98A 3VR6A 5EE3A 4POAA 3X1ZA 1AKEA 5JSZB 3OE7A 1CTQA 2GK7A 4GP7A 4JLNA 2W00A 2Q21A 3HU1A 3I61A 1EG7A 4XWOA 4P4UA 5B58C 4DB4A 3QIAA 3A4MA 2H18A 1BOFA 1GAJA 4Y0VA 1IN4A 1FOEB 1NBME 3Q8XB 4LPKA 2HXSA 2HUPA 4EIWA 3RRZA 1YR6A 2C03A 2VPPA 5DHAA 4JVLA 1XPUA 4DXAA 1SHZA 3LY5A 5TB5A 5KU1A 5L3SA 2RAPA 4L15A 3TKLA 1E79A 2C77A 2ZJBA 1NN3A 1L8QA 4IOMA 5G40A 2WTUA 4QJ4A 3T35A 4AG5A 2WICA 3BB4A 2H8KA 3ZD7A 5L3QB 3ZLJA 1G9XA 5EP3A 1IY2A 1CP2A 2IL1A 4A8JA 1Y63A 3C7KA 2ZRIA 4Q7MB 4CDGA 2C95A 3R8FA 2F55A 1UKVY 3KXKA 4ACBA 2JLXA 4DKXA 4GOKA 4Q4HB 1P2TA 5JEDA 2DWOA 2EQBA 4MRPA 5FBVB 5KNCA 2ZR7A 2VP9A 4Q1DA 1NMZA 2YINC 4PHHA 1GITA 4UQOA 3AVUA 2HDNB 4TLCA 2CBZA 3P4YA 4F93B 3OFND 3SN6A 2AFIE 4KHZA 1XX6A 2WBLC 3MD0A 4JJZA 1KDRA 1Z2CA 3EZ9A 1S3GA 4XSHA 2AR7A 5K8TA 2JIZA 3QEOA 3BC1A 1E9EA 1GRRA 4Q1CA 4G3XA 2CE2X 3AF0A 3LFUA 1SXJC 3VR4A 4YMTA 4M1OA 4BPBA 3TW8B 3AUXA 4NU0A 4Q01A 4IVQA 4LYJA 5JWRA 1CJTC 3Q72A 1OKKA 1E2DA 4LCBA 4EFLA 5FPKA 2ZRJA 2REBA 1RJ9A 3IQWA 3CRRA 4TLAA 2WHXA 4Q21A 4AKEA 1NMYA 3QENA 1AQYA 1JXOA 2ZRCA 3DM5A 3BWDD 1U0HC 2PEYA 3T1QA 4MRVA 1VG8A 4RVCA 1U90A 2PT7A 2ORWA 3LRPA 3WMEA 3W9YA 3TE6A 4PAQA 4GMXA 4LJAA 2XOKA 3NVAA 4HAVA 1MRNA 2GESA 2QN6A 1LS1A 1X1RA 4Q1BA 4CEJB 5JZVA 2D2EA 2YWFA 3CPHA 4Q9HA 2FEMA 2WJHA 1J70A 2DCUA 1ZP6A 5CM9C 2XX3A 2PCJA 5L3RA 2EVWX 5FH9A 5EP1A 4ACAA 1G3IA 2IS1A 4J0QA 2IT1A 4MUAA 4GI7A 2CCJA 1OXVA 3W6PA 1Q1QA 3OEEA 3MRSA 5CM8B 4PAOA 1X3SA 1W0JD 4C0BA 2EFGA 4DHEA 1VG1A 4BLRA 1MO3A 4LJ5A 2ATXA 3TQFA 3Q9LA 1R0WA 5DI3B 3ZZTA 2OLJA 2IX3A 4QM6A 4Q9JA 3RRMA 3WBKA 3THYB 2YC2C 5FUVA 1YR7A 4LSGA 4Q18A 1L2TA 1II9A 3MCAA 1E4VA 3FFAA 1EX7A 5CB8A 3BJIC 4RY2A 2DFTA 3G82C 3TGPA 3T12A 2A5JA 1P75A 5DNYB 2B8TA 1KAGA 2BCJQ 2CDNA 4TTPA 3RS7A 3ECCA 4PC3A 2AWOA
chains in the Genus database with same CATH superfamily
2GYYA 3ZXYA 3QF4B 3TFQA 4DEVA 4JS0A 1GL7A 2VCHA 4RTLA 1LFDB 2VZLA 1C81A 1VHLA 2GA8A 4CEJA 2NUPA 5GZ1A 1Z06A 2E18A 2M1ZA 2IPNA 1BMFD 4IIFA 5H7XA 5CFPA 5K8CA 4INOA 4OLAA 3FKSD 1BX3A 2WQ6A 4ZTZB 1X2EA 1BTOA 1WUKS 1C9YA 2VYQA 4S3MA 4Y6PA 5F64A 1WETA 5C35A 4YJGB 4AX4A 4EHHA 3E22B 1SRRA 3HCPA 2ID8A 4HZIA 2HU2A 4KI7A 3JQGA 2V6BA 5EMMA 3PUVA 1ODFA 1OLUA 2AA3A 5K0BA 5BQPA 3ZNPA 4QO8A 5HIAA 3S1AB 2ZWIA 2O50A 1TYBE 2DQSA 3PNBA 1R9MA 3LHDA 3O9ZA 4D81A 5DNEA 1EJBA 1JLHA 3UGQA 3NORA 3Q9UA 1CCWA 1YQUA 3HSKA 5IU6A 2B4YA 3LLVA 3QPUA 4UASA 3VBEA 3FFWA 3BORA 2ZRMA 4K05A 4AZ3B 4YPOA 5I3CA 4AN0A 3F9IA 4CLXA 4QYIB 1X1EA 1FQJA 4G85A 1JR3D 2VPQA 4P93A 4RVUA 1XLTC 2CLMB 5UKDA 3QLEA 3GPLA 3K71B 4KQFA 4AJLA 5KTYA 3E5HA 1EDDA 1QG2A 2BFMA 4H77A 5BO5A 3W8RA 4K9KA 1N0IA 1FRZA 2W2OA 4DANA 3KT6A 3CB2A 4Q7LA 4ZQEA 3RKSA 5JMTA 1JG1A 1BH2A 1G9TA 1UIMA 2ZBQA 4OGWA 3O3MB 4GVXA 4R1MA 2C78A 5AM4A 1F4VA 1JWBB 1CRLA 1MXHA 2P35A 3D3KA 1A9QA 4EQ6A 3D8BA 3T5MA 1E1RD 2G63A 1U28A 4J1QA 4F3RA 3RYCB 1FTSA 1NVTA 3EGXA 4R54A 2XGJA 5D3MA 3OE5A 3FVTA 3JZAA 1WTCA 2P78A 3FTQA 2LR0A 4PGFA 3ZV5A 2HQSA 2RFLA 2CL6X 1O5IA 5CCBA 1DAOA 1OZGA 3K8YA 1B0UA 4FKZA 3M70A 1JLSA 4D26A 4Z0NA 4MDEA 3EWIA 2X5XA 1CJVC 1DAMA 1CY8A 1DBPA 1HDZA 4WBNA 3O8OB 2ZAIA 4S04A 4DLSA 1B1AA 1DWOA 1NX9A 4Q3LA 1D6SA 4I2VA 1PBNA 4D0SA 5MDHA 1UBMS 2PZJA 3CKYA 2FUG1 5HUQA 1Y6FA 5ICGA 3IX7A 3JSXA 4G4IA 4GLBA 1NVEA 1EFHA 2DMRA 1SUIA 4QC2A 2ZI6A 4ECAA 3LT2A 1SIBE 1LF0A 3N2EA 4BNYA 1GDTA 2EDCA 2EYQA 2O6HA 3I9LA 1TZMA 3I2YX 3PQFA 4K26A 1ZKDA 4W4TA 2W6QA 1J0XO 1YJ5A 2J9FB 3KKNA 1L5HA 3PPXA 1M72A 3CVJA 4GRDA 5I8ZA 4P31A 4LJ8A 3W6UA 5B36A 2BH9A 4R31A 5DWVA 2QJTA 2HLDD 4JL5A 3NV7A 1W1WA 2IYUA 3DE2X 3KWLA 4M38A 2C1ZA 2RHLA 3THXB 2REQB 1XNHA 2D8AA 2XVXA 3QUBA 4RPCA 4R9UC 5FUBA 1R27A 3C6QA 3CYFA 3DR5A 1Q20A 4ZQIA 1I5OA 2HJGA 4LXGA 5KTTA 1IOLA 4L9SA 3KRTA 3PTZA 3FWZA 5K6TA 2A5YB 4NYIR 2GN1A 1KJYA 5EGSA 5J9FA 2GNAA 4GPIB 4J3JA 3CCCA 4EW3A 3P94A 4Y2YA 2I2CA 3KPWA 5DHTA 3DPSA 1UJMA 1S6YA 2G5CA 3O73A 5CUQA 3R7AA 1LY1A 2B0CA 5IVIA 5BSWA 1HE3A 4X24A 1P2VA 3VC3A 3N05A 1TA4A 4US1R 5K4GA 4ZGBA 4M0DA 5KNCD 2HQBA 4KQGA 1QFJA 1CXZA 4IDPA 5AKHA 2WKPA 4IJVA 4UTZA 5H68A 4R1TA 2J3EA 4LRQA 2QUHA 1AURA 2RHDA 1TVKB 2SBTA 2ZK7A 2EWWA 1USKA 2ZXEA 3M8KA 2UZ1B 4JLUA 4KQJA 4MV5A 4M89A 4L0MA 4QA9A 4B84A 3NT2A 4DJJA 1W29A 2O8EB 1PQPA 3ONNA 3OMWA 1NLYA 2DLDA 2QZ9A 3MN1A 3L8GA 4KFCA 1E66A 1T26A 1YMQA 3M9LA 4ND8A 5D85A 1QTNA 4UFNA 4BFZA 1FNSA 3B6MA 1I2CA 1GDHA 2BLNA 5TQ2A 1MW9X 3GCZA 2CXQA 3MUEA 1Y9ZA 4PQRA 2W5UA 4NABA 1ZD1A 4TYWA 3QBTA 3B2EA 4UOZA 5C7OO 1Z3IX 2H4WA 2FPOA 2H7XA 4HDKA 5GJWC 4KR9A 3G0IA 3QFCA 4X7PA 4NF2A 3AIIA 5HR5A 5E9QA 3TLKA 4CG0A 3T1OA 3WMWA 1RHQA 3K2QA 1SPXA 5HBGA 2A0YA 2QL5A 3R23A 5KYTA 3UJNA 4ZZ3A 5SY4A 4OAQA 4MYCA 4R6XA 3KLOA 2O06A 4B4WA 4EDHA 3FPCA 2HWXA 2IS4A 3DNPA 2X4IA 1QHFA 2H1WA 4Z1MA 3FZQA 3KR9A 2XZLA 3A4IA 2IWRA 1H0KA 2JI6A 3WYFA 2YJGA 3STUA 4B8YA 2UYCA 5EIXA 1ZUIA 1Q83A 2VG8A 3SSOA 2ZLBA 3GFOA 1D1PA 2APJA 1WTAA 3C74A 4QDXA 3RK1A 4WBSA 5CJPA 3H5TA 3M82A 3ONFA 4QXOA 5FLXA 1LDMA 2D59A 2VHJA 1L7MA 3QVGA 3ADCA 1TU0A 3H1EA 4G4SO 1UR5A 4MCHA 4I4TF 3RJZA 4J9VA 4Y0AA 2DE0X 3EUFA 3TIXB 5EXSA 3U4QA 1SFRA 3PNSA 4N54A 4U3JA 2ZSUA 3KKPA 1Z45A 3I83A 2GCGA 1BN7A 2MDTA 3OM0A 3PC6A 4YRSA 1WKVA 2HLDA 4YP6A 4HDRB 1V5IA 2OSBA 2HLHA 3FVRA 4J0FA 3NWBA 4MS1B 1EE2A 3R7BA 3REFA 1E2GA 3NXKA 1PLJA 3I6ZA 3Q87B 5G3ZA 3AP1A 1BXKA 4TXJA 3DLCA 4I1YA 2VOEA 3OIFA 4NBVA 4WY2A 3A6EA 2DHDA 4Y9TA 3VV2A 3I9NA 1R9GA 2R60A 3ENNA 1NC3A 4DC0A 3HDHA 4OSOA 5JMWA 4YV0A 3CPSA 1JLKA 3T0FA 1NPDA 2PQ0A 1T1RA 1VBKA 3UC5A 1U4OA 2Z8XA 1SKBA 1Z08A 2IEGA 2XF8A 3I9FA 1N8KA 3KJIA 2DOKA 5D6OA 1GL6A 2WWYA 3BXEA 2UAGA 5D5PA 4LZPA 2I2BA 3DC7A 1G4UR 3G5UA 5FKJA 3TUIC 3UJAA 2ZT5A 1Q6ZA 1ANKA 3DEIA 4WN9B 1KRHA 3PKIA 1U7HA 4X20B 3ZEAA 1U3WA 1VLJA 4WZBE 3IHTA 2V6GA 1FYFA 4RY9A 1LTHR 3QTLA 1I3KA 1K8XB 1U81A 4QJIA 2B78A 4G01B 4PLFA 1T8UA 2O52A 2P1DA 4H4EA 5T4HA 2DZDA 2QD5A 4KXMA 4XJVA 3GLFB 3RTAA 2UUBB 2NSJA 3HI4A 1I4WA 1ZUNA 4RPHA 2OQ2A 5IJAA 4HDRA 1NLFA 4HKTA 1TTHA 1V95A 1F5NA 1FS5A 1Z07A 3FGNA 2ZRHA 4X85A 4BUJA 2RC5A 3SQWA 1VPWA 3LXUX 3WMRA 4PSVA 2ZKLA 4BP3A 5KMGB 5JFGA 4LC1A 1SB9A 4EW1A 5JAPA 2H1RA 1UFVA 2QROA 3D2BA 1XA0A 1SCKA 2IY8A 4ZKDA 4C0HA 5FEUA 1DE0A 1GTMA 1W581 2CBGA 4L74A 5ALPA 3WMXA 5KMGA 5L8VA 3FDZA 4CF5A 1E7MA 4C4TA 3K5PA 2ZSAA 3KVRA 5AW2A 5IVHA 2X5KO 1NN1A 4EYGA 3GQBA 3P9IA 5ALGA 1T13A 1QE5A 3BBLA 3OIVA 4G1CA 4BNMA 5G0TA 1ZBQA 4JI4B 1Y81A 2FDRA 4OUDA 2G09A 3IA7A 5IDWA 2BI7A 4P92A 3S40A 1ACMA 5HIJA 3AIMA 2UYOA 4JA2A 3WLRA 3MK31 1YB7A 4JT4A 1T5SA 2PNFA 2X42A 3NBFA 4JX9A 3OE4A 4HDMB 5BN5B 2A92A 2GAIA 3COVA 1G7RA 2QRPA 4GYWA 3HY6A 2A5GA 2YMMA 3RAFC 1QF6A 5I8WA 1QFYA 1W0JA 1D9ZA 4FC6A 2F9FA 1RQ2A 4JEIA 1DRUA 3UT6A 4B82A 1LPMA 1QZTA 1YS1X 2PRKA 3DWGA 3OOWA 1N4DA 2HRZA 5ES3A 4I46A 4WOCA 3LT1A 1BWPA 4YJHB 2OE2A 3MWGA 4UVIA 3ZBUA 3WRVA 1U2EA 4KODA 4JKIA 4U5XA 1F7VA 3QBEA 2PSHA 2EZ8A 4X6UA 3ZU3A 3SYNA 2WIJA 4R41A 1IJEA 3H2JA 2C7PA 1HFKA 2J59A 3B7PA 2IZ1A 1HMPA 1TYZA 4QXPA 4BRUA 3G8BA 3ADPA 3CLTD 4KDFA 4J7AA 4QUBA 2O5RA 1C7QA 2HV8A 5KC8A 1ILWA 2AJ8A 2QY6A 1VP9A 5DMHA 1GUDA 4G09A 1VPDA 1IUPA 3PFWO 1GPUA 2X9LA 1ISHA 2FUCA 3PV0A 4HRYA 4O08A 4E46A 2ZXUA 3K9WA 3R6GA 1SXJA 1WDWB 3G59A 4N0DA 1X1TA 2QTLA 2JCXA 2WE8A 2O1SA 4R7TA 2IYAA 2PUWA 3SSAA 1BMFA 1VYTA 1ZW1A 2HSZA 4YRGA 1FFBA 4PX3A 2ECQA 3KUCA 4GXTA 4QGHA 4BC1A 4QPPA 3KTAB 4TS4A 3FA2A 4YRLA 4LF4B 4WLOA 2NU9A 3ZI0A 2PJZA 4H0FA 4HZUA 1IHYA 4ZI2A 2E4VA 3CRNA 5AUQA 4DNPA 3TI7A 5I7OA 2Z5LA 3KAQA 4W5QA 1R6XA 1N7IA 3AFOA 3LV8A 2HJSA 2O2JA 1W34A 1RYZA 1U02A 4UFPA 5IDQA 2R68A 1KY5A 2J6HA 2NZWA 1UC8A 1WNFA 1E2QA 3TB4A 4HO1X 5HFJA 3O31A 2P5UA 3TD6A 5LL6P 1IIBA 1MOQA 2WA1A 4A0HA 2Q50A 1M2VA 1PFVA 3GFSA 3L7KA 2FMFA 3K2EA 4PNEA 5I9BA 3IO3A 3TTVA 2Y1OA 4B5KA 1JT2A 3L1HA 1VE5A 2XIQA 4KIGA 2X8JA 3GBPA 3IKJA 1J2JA 3O1JC 5IJWA 3A36A 3WZ2A 3OESA 4ND2A 5DNWA 3OJFA 1HV8A 1O08A 4BE7B 4ZQBA 1KEKA 2CSUA 4OTZA 1M6EX 3UMCA 3BEOA 3C14C 1XQYA 1ZUD1 3L4KA 1PUXA 1QOQB 3GDFA 1JFTA 1YQ9A 1KE2A 8LDHA 5HKLA 5A3VA 2KSQA 4YDQA 1O6BA 2GN0A 4TLLB 3EA4A 4Q34A 4GPTA 2R8OA 4ZVVA 3ZWQA 1DO0A 4F21A 4Q4CA 4DLZA 2OMKA 4V0KA 3RU3A 2R97A 1X7YB 1TGVA 2GZMA 4CMIA 4ND7A 3WP0A 4RFVA 5ENVA 2R47A 3DEZA 5EZYB 4E5PA 4MTCA 3VSBA 4LZJA 3FXAA 5EI5A 4X94A 4GOJA 1TO6A 3BQ9A 3K9QO 2XRFA 3WGNA 3ZKAA 2PSSA 2XNHA 2G17A 3EFEA 2C2XA 4QU5A 4RHEA 5EAIA 3NVDA 1A5BB 1YDFA 3HR4A 1OQAA 3WYNA 1GHTA 1I0LA 1JE1A 4MR7A 3I4FA 3LT5A 2DBYA 3QY0A 4F45A 2V03A 5DGXA 5EPOA 1VA5A 3OUTA 5HKOA 5TNXA 1YZTA 1FA9A 2C8JA 4C43A 2XUGA 4BY9E 2VZ9A 4J7CA 4IV0A 4M0EA 4EKGA 1M1NA 1YRAA 3H16A 1IM8A 3WK8A 1HOXA 1O97D 2L0XA 4HP8A 3LIIA 3DNMA 4XOUA 2O1XA 2K5UA 1Z83A 3QPDA 1DQYA 1NC1A 4FMDB 5EFZA 1W6RA 1QVWA 3NHMA 3O9VA 4ZODA 4F8EA 1V6SA 3IPRA 3OZSA 1I3NA 1DCMA 2ETVA 1RPZA 2Q4BA 4WXEA 4LE2A 4PM4A 3QKRB 1ESMA 5DBIA 4ZZ1A 2X0KA 2OYRA 2ACWA 1JPNA 3PNKA 2JGJA 3QX7A 4OK5A 1RZRA 3MJTA 3AESB 3Q6MA 3TQCA 1IBLB 4G0OA 5JSHA 1KQOA 1O0SA 2YN4A 4FHDA 4BVKA 2YWBA 3R0XA 5DOVA 5CPFA 4OH1A 3DE1X 1XTSA 4ZICA 4BNUA 1JPVA 5H81A 2NXWA 3KQOA 3D8TA 3E7DA 3C3KA 1E1MA 3KSDO 3NQ41 3U16A 4RTSA 3O4IA 2ZZMA 1VGVA 2IHBA 3IDOA 4UTNA 3ZDYB 4Z49A 2W2TA 4JVSB 1DOZA 1KRXA 1VL2A 1WM1A 3HACA 2OO7A 2XB9A 1L4MA 3MTJA 3A3PA 1QRDA 3HB4X 2IE8A 1AHHA 4TV9F 2VJDA 2PGLA 3PZRA 1CNFA 2CXPA 2D06A 3V33A 4DFDA 4V0SA 3D64A 1PP4A 4BZPA 2LCFA 2JFPA 1AK1A 2FRVA 3MTDA 2JFFA 2PJUA 5M7EA 1P9WA 1QVZA 1XU7A 2X1MA 1I7SB 2NU9B 2R6CA 5AW5A 4YDSA 3CXUA 3IODA 1H65A 3DDCA 4HWPA 2QMUA 4REQA 5AKGA 3AY0A 4HF7A 4M3NA 1RYMA 4F5EA 1VG0B 2PUHA 2XWQA 4YONB 2WJVA 3WAKA 5ADVA 3H5WA 4TTRA 1IH8A 2J6BA 3AH8A 3D3WB 3IHWA 1BKDR 4BV3A 1JDVA 1JQEA 3C3YA 2B3TA 2J3KA 3M49A 4AKTA 3RIYA 3ZUPA 1L6IA 2HX1A 3NCTA 1ZD9A 3F9RA 5AYVA 4WK2B 1GG5A 5HZHA 3QVMA 2FVYA 5ICSA 1E3EA 2W6OA 4LHVA 2AKAB 4WKBA 5MN6A 2GSWA 1P8JA 3A1WA 2QOEA 3CLSC 3GJ5A 2V45A 3PPWA 3FTCA 5JUWA 2FZ5A 4R69A 3AQ4A 3MEQA 3MOSA 3RDPA 3TNJA 3VPSA 1SCBA 1XPOA 2Y1CA 4WNAA 3HJFA 2AG6A 3DZHA 3I37X 4XR4A 2X40A 1UZUA 4YJHA 1PRYA 3V1NA 4KLCA 4KK3A 1WD7A 5A3JA 2W6JD 2OBXA 3BF8A 4LMBA 2ZBUA 1WEKA 2RONA 1O0BA 2VYVD 2YW2A 3G5LA 2FA9A 4G1MB 1IBMB 4MKIA 1B2RA 1CETA 1TPZA 2OBFA 1Z2AA 3DZJA 3EAGA 4MYSA 4D97A 1FSFA 2VDRB 2AF4C 5IANA 1NYLA 4UM7A 1EFRD 1G0NA 2E55A 4C4YA 4X95A 5BN5A 3K0CC 1XZEA 2X1LA 3O47A 4NP6A 4B48A 1P4AA 4Z54A 3R9XB 1YMUA 1PT8A 4RJKA 5C1OA 5B53A 3LC1O 5TVGA 1AUXA 3DD1A 4NI5A 3HG7A 4QRHA 5ALSA 1FMJA 2BEWA 4TT3A 4CI9A 3NC1C 1U0FA 1NX6A 3OQMA 3PSAA 121PA 3AWDA 3UJ9A 3ELDA 5BN3B 1MH9A 3RU7A 2ZTMA 5JH7A 4BQPA 2WB4A 1RXCA 2XKJE 2FMUA 4FP9A 4NBRA 1LZLA 4GI1A 1NG1A 2CZQA 1NOJA 1YS4A 2GCOB 2H5IA 1VIDA 1OFGA 1E3JA 2P9BA 2VDPB 4G0YA 4MX8A 1PGOA 4MGHA 1XLWA 4L95C 4QG3A 4P32A 4EQZA 2YMQA 3NUQA 4FBLA 1RXUA 3LXMA 3OY7A 4X9XA 4JB2A 4L5CA 2A9QA 2J3JA 3KU1A 2O2GA 1MJGA 4MKGA 1VGRA 2VZ8A 3LVRE 2AFHE 3TIFA 4BKMA 4RY8A 4A36A 4L8VA 2AKYA 4NBTA 2Q6KA 5TQ0A 2CVHA 2OC9A 3BK2A 4OHKA 3HXTA 3FTPA 4OVKA 3SBEA 3ZN2A 5AVUA 3OKAA 4ZQCB 4N5LA 5LQAA 4L0QA 1ADYA 1TM2A 4XWWA 1NBEA 3HM2A 4EUKA 4BTVA 2AN1A 1XC7A 1VJ5A 2FW1A 3TZHA 5IJ0B 3K0KA 3IAAA 2GBFA 3R7LA 4KPYA 3DKKA 4XQGA 5JH7F 4YUYA 4HEA6 3SBXA 4B0OA 1PYGA 2NU8B 3CPJB 4QPNA 2C5AA 3CX6A 5A7GA 1CUBA 2YBDA 3A3YA 3PPYA 5FA6A 2W2VA 3BL5A 2FLWA 3MQ2A 2NP7A 2A9RA 4AKHA 3CZMA 2HPAA 2AMJA 4QU9A 3RRFA 2AW5A 5LQMA 4PZ0A 3SR0A 3S81A 2VP6A 1EWVA 2OV3A 5TE9A 3DP9A 4IVRA 3AKYA 4TZ6A 2OD2A 3RADC 4YIHA 2ZR8A 5L4NA 3WRYC 1Z12A 1DIGA 3DTVA 1XRMA 4QQRA 4WNIA 4QTTB 1VKNA 4PZZA 1XNRB 1EP2B 2BKLA 2PGNA 4U0KA 3VU9A 4AZ0A 4BE9A 4EGCB 1NPTO 4Z0HO 1KDZA 1T4CA 2HBYA 4ZDWA 4D4JA 4RK1A 4KN8A 1KERA 3VC1A 4RETA 1PJCA 3A3OA 4TLBA 3BHNA 1BROA 5FB3A 2IELA 4FHEA 2E49A 3TBHA 3ETJA 3VR2D 3CKMA 4FJ0A 2H2WA 2B5VA 2WF7A 2YDYA 3KTOA 3NNSA 1X74A 2QBYA 3ZWDA 4LC9A 5EIBD 1H05A 1U7TA 1YFKA 4JT2A 3W90A 4F7DA 8ADHA 4PCLA 3F90A 4KUGA 1QQ6A 3W8EA 2IZ0A 3GJ0A 1H69A 3HDTA 5JEEA 4RV9A 3RF6A 5ECYA 3GGCA 5EHGA 4Z9FA 2QXUA 2VHTA 1QC5A 5TX7A 2BTOA 1O6ZA 4AP9A 3JQCA 2QSYA 1W25A 1PR2A 4NDAA 1XRJA 3N9IA 4N1AA 1QYVA 5CGQB 5ADHA 2H92A 4R1NA 5C37A 1LZKA 1GZDA 3I2FA 3G2HA 1GYRA 1US8B 1S96A 1OWPA 4NPAA 1S8FA 1SC4A 5T67A 5BR4A 1E0AA 4REOA 3P2MA 1VKOA 4R0VA 3NJRA 4PNZA 2BEJA 3TYXA 3VR3D 3ZWMA 1Z88A 1EDOA 4O63O 4ZI5A 4X8LA 2QI9C 4P35A 4A82A 1V4VA 2BCEA 2DP4E 3RRXA 3EUAA 3PENA 2P11A 4ZO8A 2ZE7A 2D1TA 5ALIA 3RWBA 3UT5B 5JSZA 2OWEA 3JQBA 4DSZA 4I66A 3EW7A 1TPYA 3BH7A 4OGLA 3H8JA 5JV5A 4C29A 4NEQA 2IW3A 3RROA 1J0CA 5G4LA 3AM4A 4W8OA 3B3GA 5HKAA 3IULA 1QB8A 3IT2A 3KS9A 4IXMA 4EM6A 3MUFA 4RYLA 1HH4A 5L7YA 2FDXA 2M1XA 3WL8A 2W8ZA 5BWOA 1Z62A 2VWGA 1GTVA 1YD7A 2JFWA 3QNWA 2RGUA 5A2QA 4BLOA 3G7UA 4MW1A 1G21A 4RCVA 3HHPA 4L8LA 2AOUA 2OK7A 4TMVA 4LXXA 1FDWA 5ALRA 1O96A 2J46A 5F7XA 3CR3C 2V8BA 1NNI1 1UC5B 2J3DA 3SDBA 4TSFA 5IG2A 4YX9A 3MD9A 4NU8X 2IZ6A 3UJDA 1CY4A 1UM9B 1PU2A 4D9IA 2GM4A 2NXCA 3QNUA 3E2PA 1W59A 1L5SA 4P7BA 1ZNXA 1M9NA 2CUKA 5T6MA 4ZCSA 4EKIA 3COWA 4EJ2A 2WQ7A 5HMLA 3V8PA 2BSAA 2HJVA 3DOCA 2G5PA 4DGSA 5FIUA 1NUAA 2EFEB 2B6HA 3SICE 1I6LA 2C1EA 3OTQA 4LN1A 1H2YA 4S24A 4ZQGA 5AKJA 3VR0A 1X1BA 2PG3A 1DDGA 4FBGA 4QGBA 3KTFA 2AJTA 4NMXB 2IPMA 1NATA 3OFKA 4B3RB 4AICA 1YRWA 2Q2VA 2P4SA 2C8VA 2LBPA 4NV3A 3TQQA 3ZWBA 2NO7A 3PXXA 2J85A 4XWAA 3LY9A 3BFXA 3RLIA 2VAMA 4BBZA 4WUVA 5CJJA 1MP0A 1FW6A 1G21B 2R5WA 2YYZA 1K9SA 3U17A 1GSAA 2ZSIA 1QIMA 2DSTA 3A26A 3CNOA 3IAFA 3QVWA 4FHZA 4FN5A 2X1VA 1NP3A 3KV3O 4J07A 2FRDA 4M60A 3U56A 4DJDC 1E7WA 1Z5VA 1R3UA 3MT9A 4F1KA 1WMDA 4QD3A 3D3QA 2OAQ1 2YZ7A 3CU5A 2ZPTX 1UXIA 3OU7A 4YCLA 1JW9B 3UCXA 4WX2B 5LMZA 1DCTA 3IESA 1QORA 3OWOA 2V59A 1ODSA 5BOSB 3W2HA 4CV3A 4ZAGA 4K6FA 3UMYA 1QS0A 2R25B 2R87A 2XB8A 3MBKA 3ZWCA 4COKA 2R1TB 4E6PA 5KS2A 2A0WA 2G67A 1PSWA 3VOBA 4DMRA 5FO1A 1YVUA 2NVUA 4KGZA 2ISCA 2PKEA 4DAOA 1H1DA 1MU0A 1J8YF 2P8JA 3T5BA 3UAGA 4ZJPA 1AQ6A 5E3HA 4ZO4A 1HR0B 1WP4A 3DFMA 3QSYA 1UMCA 4ZDIA 5BUSA 3TTTA 2FG7C 3E8XA 3LCRA 3CJTA 1GNPA 1P18A 1NBWB 3ENZA 4BS9A 3F0TA 4DT1B 4NNJA 2A35A 3H0EA 3HFJA 4BCDA 3LSYA 1SXHA 2FEXA 1MABA 2OM2A 3A4LA 3HJCA 2OQRA 2L69A 1A50B 3K6JA 5CP8A 1UDAA 2G40A 1N5DA 4LGYA 1J56A 4XJTA 1BQ3A 4MJXA 3HU2A 4EATA 5CFOA 3MHPA 2V7WA 4A5OA 4I4NA 1QYCA 2P2DA 3DO8A 1J20A 2ZE6A 3F1KA 2PKCA 2DFVA 3KP1A 5JSUA 4U7FA 4E7OA 2WIAA 4RKYA 5ER9A 4EQ6B 3GNQA 3OX1A 4TZ0A 4FLEA 3D4OA 4MIYA 4DA0A 5L6LB 2MSEB 1GAXA 1E94E 3L3BA 4B43A 2B61A 3VYTB 1OBCA 5ESWA 3NX4A 3R5JA 3QOFA 2ACKA 1HM5A 1RRMA 3DOEA 4CMHA 1Y5NA 2YCBA 3I5YA 4PYRA 1M2HA 2F1OA 1DXQA 1WHSA 1KI8A 1Z0AA 2HWWA 5AJWA 5T3UA 3LIPA 3GNTA 2O2ZA 3B5EA 3FKJA 5FEMA 5ETJA 3T3OA 1CZUA 1SU7A 4Z99A 5TLSA 1VSUA 2IJGX 1WDTA 1JWAB 1UFRA 1DRWA 3PQ2A 3VKGA 4PFQA 2R8RA 1FFYA 1FRFS 1NFFA 3H9GA 4JBIA 1ZD2P 4BWFB 4W5RA 3H7IA 2LRHA 2FQXA 2O8FA 2YWRA 3BKXA 4C3OB 4AC9A 4JC4A 4URXR 1W7AA 4OATA 2H3EA 3OPYB 2GJ9A 3OT4A 4YIKA 2MINB 4NCIA 3K6SB 1J07A 2Q3DA 4LF5B 3BX1A 5U4QA 3BB3A 2JFZA 4UUPA 4AY5A 3CZ5A 5FNVB 1E9SA 1Z7BA 1O7JA 2XKBA 2H51A 1JAZA 4LA4A 1S4QA 5KKNB 1GSIA 1GJRA 4JU9A 3R9IA 4K8OA 5CBPB 1BYUA 1FEZA 1U2PA 4HYYA 5DK4A 1O2DA 2CXTA 1WV1A 2I87A 3CUWA 4CU2A 2Z9DA 4MP8A 1ULUA 1R10A 5AW4A 4FDAA 2O2XA 3IAHA 3NEYA 4HJXA 3SE7A 4NESA 2VQFB 3KYIB 3QI7A 3QPAA 3P9ZA 3H9CA 3EIWA 4OU4A 3BDAA 4Y6SA 3N2NA 2QKYA 3FMOB 1QF9A 2GBGA 2CL5A 3K1AB 5MN5A 1VPTA 2I66A 4EYEA 1MEEA 2VDMB 4YCMA 3RD5A 3U6BA 4MPTA 3TIGA 5B64A 1B43A 2O7RA 1HGXA 1QH8A 1CUHA 1T5IA 2QJRA 2OL4A 3KJEA 4FINA 3AF2A 3B5JA 4UDOA 4KGVA 2FUKA 1NGSA 2RDMA 3AF3A 1Z18A 2J48A 2I7XA 1E7QA 2HXGA 2C9DA 3SZ3A 3WJ2A 3QQPA 1EEXB 3EGDA 5CT4A 4E5SA 4RACA 1GPJA 3D6HA 4QUHA 4BJHB 4F9FA 3QPCA 1QNLA 4YWHA 4PVCA 5KQMA 2VXYA 5DGDA 3O0DA 4ASUD 4MW9A 3OQ1A 3VMMA 4E3WA 1WSBA 1B8OA 3EZYA 4WGGA 4YJKA 5FI5A 1OROA 1M7HA 1M6WA 4N0MA 1PV4A 1ID8A 5C7LO 3QTBA 1KSHA 1UQTA 2ASVA 5AFSA 4IDQA 2JGNA 3HKCA 4LOAA 3R7DA 4D9GA 4KAAA 4FHCA 1FK8A 1F2TA 4ZRNA 2RHRA 4NENA 2Y0DA 1D8TA 1Z38A 1SVIA 1JH8A 4IIJF 4XIIA 2AZXA 4KMSA 3HE3A 4NENB 3M33A 4HH3C 1I7LA 5A4JA 1SG6A 5TPWB 3C39A 1IZZA 3BE8A 4ZOLB 3WK5A 1HDGO 3N53A 1SBTA 4MUGA 2G5GX 2Y4OA 1HQKA 1GXSA 4M4SA 4FGWA 4EGSA 5B1EA 2ZPUA 1X70A 2V8OA 1YZ3A 3IRUA 1PNRA 1T9CA 3QU5A 3AUKA 5AM1A 4DV4B 2VPXA 2AEFA 4JOQA 1WPRA 5YASA 4OUKX 4OJYA 1H0SA 2HOQA 3BDIA 1QV6A 1YOBA 5F78A 3B3AA 1V47A 2M6KA 3TECE 2YC4C 3FPFA 1GZ7A 1E32A 1FXWA 3DMGA 4ZI7A 4D6YA 2YJZA 1OTXA 2D4AA 3IYLW 4YY3B 1M0TA 1UP7A 2I91A 2XYRA 2AW3A 4P5EA 1YR8A 3KPJA 5CLIA 5KSZA 3PZBA 2OCDA 2ISSD 2GEJA 1PJLA 4NBSA 5CFQA 5LYJF 2FFAA 1G7CA 5A5GA 1ZA1A 4X1IA 1NSTA 2DPGA 3FPJA 5CNIA 3T7IA 1IBCA 4Y18A 4Q4LA 3KZMA 4LGVA 3S8MA 3WLSA 1DCFA 2Z9BA 1MC8A 2A4KA 4DV5B 2RB4A 2VA9A 3R3JA 5IYZF 3LBHA 1QBKC 1BJTA 2P6NA 1V96A 3A9UA 1NQTA 1Z4QA 1UBGA 1OBOA 2BFEA 2PUTA 3QFSA 2WT9A 4IDOA 2X7XA 4LCJA 1ZM7A 3D1LA 2Q0QA 3BRQA 2AE1A 4M0MA 4ND3A 2PEZA 3CSSA 4DCGA 1G19A 1LGYA 3BG5A 2VNIA 4EJ6A 3W5BA 2IZ5A 4EKNB 2EW2A 2AEJA 4FE4A 5MF6A 3SBOA 3I30X 1VJDA 1XIVA 2JANA 1PFYA 3L43A 4LJ4A 4C5BA 4G8BA 4O2BB 4UHJA 3KQMA 4JBWA 3NYQA 4Q00A 3R3WA 3TSZA 4BEJA 3CLRD 5K3SA 1TTTA 1HOTA 3GJ7A 3ZDRA 1EB8A 5F51A 1GNVA 2GZ3A 4LNUA 2NSHA 2XVYA 3QOXA 2D54A 3DXZA 4PLWA 4OQEA 1RVV1 4UBLA 5H02A 1WXFA 1JPJA 4EGFA 1YOVA 2CFRA 2ZGVA 4H6PA 4M0UA 5TEVA 1AMUA 2ZSDA 3FNGA 3RUHA 1SVLA 2HDOA 2UKDA 4X63A 8ATCA 3P2EA 3PGA1 4DCUA 5FI1B 1Y6ZA 4H35A 5DTEA 5KYYA 1ZY2A 5AUNB 4YJFB 2F00A 1ZISA 2AQHA 4RMNA 2WPDA 3RWMB 3B2QA 3KB8A 4UMFA 4BFYA 1R8JA 1T3HA 5G0UA 4FWBA 4DDUA 5EE1A 4R2MA 1HLDA 3RUIA 4DQ0A 3AEZA 3QJGA 1F0YA 2Y1WA 3K4PA 3SAJA 4ITVA 1CR2A 5IEJA 2DBRA 4MRSA 1L7PA 1RMQA 3CUUA 5F76A 3MCUA 4KDCA 3TR6A 4HB3A 1EUYA 1REQB 3I12A 1UPTA 4HFJA 4F6RB 5D3QA 3LUCA 3RG8A 4ZOQI 1S2MA 3VJLA 2BAGA 2PZMA 4BO7A 4ZCMA 2O59A 1CF4A 4L85A 2O57A 5D3ZA 2BMJA 1MB9A 2QVXX 3PI7A 2LW7A 4GIBA 3AXTA 5FFNA 4DBVO 1GADO 4IGEA 3JQEA 2RHWA 3EYWA 3LQKA 2D5BA 4AWXA 2XE8A 2HFJA 3GUUA 2FN9A 5E8JA 1HYQA 3B3FA 3BIFA 3N74A 1SXJE 4DV1B 1ZIXA 2IPXA 1QCCA 2VQ6A 3A11A 2E9SA 2IXTA 4QHSA 2ENWA 4LRTB 2JBWA 4Q5IA 1RRCA 3RVPA 4GBMA 2REOA 2CJFA 4ESVA 5A0TA 4RLHA 2AC7A 1CZOA 1U8UA 4IOLA 4GGPA 2QORA 4O2RA 3AMVA 3IBSA 5ISMA 5ABPA 2XZTA 5AK6A 2I4IA 1Y4DE 2X41A 3ZDXB 1GQOA 1LBTA 1L3IA 4EY6A 4B74A 3PWTA 4NULA 4PLYA 2G08A 4I3GA 3LTNC 1UWCA 3VXKA 3WLQA 4TSFD 5DLYA 1A1VA 1GNRA 2JD2A 2VLBA 4G4JA 5DPMA 1YBFA 2DFDA 2OKGA 4MKZA 1ZMBA 2DJ5A 1WJGA 2RGNC 1XP5A 2CHGA 1R4NB 4OK6A 2IYNA 5AP9A 4I5FA 1JJ7A 4O3MA 1PDOA 2HM7A 3AGQA 3UO8B 5HPYB 1KZYC 1SUPA 2XMCA 1W88B 2R84A 1DX9A 1DBIA 5JATA 5E0KB 4A1FA 1F38A 4XARA 2Z1DA 3CX4A 1OSNA 4E1AA 2WD8A 1TD1A 5BW4A 4Q4DA 1MOZA 2QRQA 3HUTA 4C7MA 3UCFA 4RMJA 2JGMA 3T3IA 5HE8A 1RYFA 1OVMA 3HKEB 1H5QA 3QKSB 4K86A 4TWRA 4WK0B 3BSSA 4R1LA 2OEPA 3M89A 4Q4JB 4N3CA 4BQOA 2K7ZA 1ADCA 2I9KA 1I3OA 4ZYXA 4YA6A 1PNOA 1XK7A 2JNWA 4IINA 4M8KA 3L8ZA 4ZAXA 2QRZA 4JWKA 2B83A 4MI1A 3ZJYA 3Q8LA 3ZCTA 3K53A 1Z28A 3EDRA 2RCYA 4WDRA 4IGIA 4WQMA 4DNFA 1A2OA 3RYCA 3H18A 1LK7A 3FKSA 2JCGA 2G83A 4C4OA 3HVUA 3V4FA 1BE8A 3E70C 4MUIA 1QE0A 2EJUA 3E9YA 5KTRA 3IHLA 4E31A 1D2AA 3WNQA 3HN7A 3O92A 1EINA 1GYQA 2XYQA 4B7CA 1KOLA 4K88A 4QNNA 1GRVA 3WWOA 1WULS 1HSOA 3ZHQA 3I2JA 3GW8A 3TG8A 3T1NA 1ZVVA 4RGQA 4W5TA 3WVNA 1OREA 2NU7A 2GJKA 1N2EA 3P5SA 4YRMA 1EVIA 4ZEWA 1FQWA 2B2XA 3SS8A 3SXUB 1LTQA 3UMBA 1ECJA 1KO8A 3MB5A 1DIRA 5F52A 4I08A 5C7YA 1CJCA 5A62A 3VYRB 1NUPA 1KAMA 1DELA 2FR8C 3RLFA 4MYRA 4PTZA 4CQJA 4P34A 4XIGS 4IBOA 1ND5A 3D6UA 3IEKA 3A2MA 5KOJB 4ZD6A 1Z5ZA 4TMTA 2BTQB 3P32A 5JXGA 4AI6A 3UOWA 2YYAA 1T25A 4HGOA 4B3TB 3AHDA 4BKOA 1M5TA 4YRNA 2WZBA 4Q19A 4CNQA 2QSJA 3IT0A 3JY6A 4D2IA 1BS1A 5JLJA 2HK7A 2XADA 4RHTA 1XUOA 5J2TF 1FFAA 4M9UA 4FZ5A 4MKRA 4Z1OA 1V8BA 3VZRA 3EGEA 3AVWA 2ATEA 5BVGA 2QMQA 3RI3A 3VR5H 3ZHRA 1Z7WA 2G5TA 4P81A 3HXOA 1ESZA 3COPA 3LZCA 1JQAA 2VHVA 4WOBA 3UAZA 2W42A 1M67A 1BVYF 1XO1A 4U4AA 3N58A 3TVYA 4RA9B 4B1FA 1UK9A 1L1EA 1Y8QA 1HURA 3CW9A