4UNQA

Mtb tmk in complex with compound 36
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 72
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unqA00
1H8EA 2XX3A 4M2LA 4CEJA 4RD1A 3L0OA 4LSGA 3Q5DA 2YJTD 2J0VA 2YWFA 1TPZA 2ZU0C 5KDLA 2ODBA 4ILEA 4D4JA 1GOTA 3GD7A 4ZCIA 3SFZA 1I2MA 1NVUQ 3BB4A 2G9NA 1AK2A 2YNMA 4Q4AB 3QEJA 1XEXB 1P61B 1T3SA 2WTUA 3G0HA 5FTNA 3OHMA 1VG9B 4CEIA 2P67A 1XFAA 1YZTA 4KSCA 4OL0A 1IN6A 3THXB 1N0WA 4Y0VA 5A4JA 4QGGA 2F55A 2ZREA 2R65A 1EFRD 3SHWA 1IBRA 2AFIE 2O8BA 2CNWA 2ONKA 2ZI9A 3RS2A 1DARA 4F4JA 1XMIA 4PPQA 2IYSA 2Q9BA 3U7GA 5AJVB 4PC7A 2GBLA 3QBTA 1OF1A 1II0A 2CE2X 1L2TA 1LFDB 2F6RA 4PSKA 3WNDA 1WA5A 1M6NA 4M9QA 1EK0A 3K53A 5FTLA 3U6KA 4DLXA 1JNYA 3AKDA 2ORWA 2GCNA 1EG7A 4P31A 5JI2E 1W0JA 2WVJA 4Q1BA 2C5LA 4L4UA 2WZQA 3JVVA 1W7AA 1GM5A 1KK2A 5J4LA 1P9NA 1U9IC 2C78A 2ZIAA 2X2FA 5FL7D 3SU8A 3E2IA 3KUCA 2JATA 2RGBA 2PLRA 1P2SA 3MWYW 1G16A 1E9CA 1CRPA 1DAKA 3MAAC 1IM2A 1XCGB 2NO7A 3T5GA 3WXMA 4UXJA 4ZDJA 4M1OA 2D4HA 2CLSA 2B92A 1N6OA 3P26A 1N0VC 2C2HA 2NTYC 4TYPA 4DCUA 4IKEA 1YHNA 4JLDA 4JSTA 3SJCA 2ZSAA 3IO3A 4HDCA 1NLYA 4WW0A 3VKHA 3M6AA 2Q9CA 2WAYA 2WPDD 1G8FA 1FUKA 3ZZTA 1E2QA 3ZIAA 4KV9A 1N6NA 4QNRA 2QSZA 3HU1A 2IC5A 1G8PA 3A4NA 3X1DA 3OFND 4Z1MD 2TMKA 4L15A 2CHVA 3LVQE 5DHFA 3LXXA 3AKYA 5JJKA 4DT1B 2DWPA 1KI6A 1G3IA 4LJ9A 3ZS8A 3QKRA 4XIGS 4ZKEA 1TMKA 1HH4A 4HUTA 1UBGA 1P60A 1AA9A 1AIPA 3TVTA 3BE4A 1LNZA 4URUR 2ERYA 3GLIE 2ZRPA 1RIFA 1TX4B 1XZQA 2JJ2D 1UADA 4MUBA 4JYCA 4JS0A 3KXKA 5ANRB 5AUPB 1L4YA 2ZAMA 1FQJA 2ZRBA 2HCJB 4MYHA 2VP9A 1T0HB 4GOKA 4Q19A 3TR0A 5JMTA 1UBFA 1ESNA 1VMAA 4NYMR 4TLEA 3WNBA 4JMPA 1E9SA 1VIYA 1HQCA 1ZW6A 1W4AA 1QHSA 3U44A 1E2LA 2DWOA 2GDJA 3B8HA 2WSSD 4Q66C 1KTVA 2F3RA 3ADCA 3BERA 2GJ8A 5FOXA 3ZLJA 1XTQA 1IY2A 3VX4A 4HB4A 3BGWA 3DOEA 5LB2A 3WRYC 2CEAA 1MT0A 3B1YA 4TYWA 3FB4A 3CPJB 5KSPA 4Q9LA 4URZR 2OESA 4HZUA 4BLRA 1TNDA 4DSOA 1JR3D 4HB0A 2CMKA 1TU4A 4BE7B 2W2XA 4WZAE 3VU9B 1F48A 4GZLA 1GTVA 621PA 3TGPA 5DI3A 4DLRA 2ZRLA 3L0SA 3MD0A 5KSZA 2P2LA 4Q03A 3SHFA 2Z4SA 3UWKA 3WHKA 3AVXA 3BWDD 5BYJA 5CB6A 1KSHA 4B6EA 2C77A 1MH1A 3SJZA 2VP0A 4X8MA 4G1UC 4G0NA 4CDGA 4OBEA 1L7VC 4V03A 1S3SA 2VPPA 3SN6A 1G4AE 3N2IA 2BBSA 1XJQA 3RYTC 4KVAA 2A5FA 3BH6A 4NCKA 3SEAA 4DCSA 4DKXA 4C9BA 3LAWA 4RFSB 1YVDA 1QVAA 4NE2A 3LD9A 1I2DA 4DC9A 3LX5A 4I1VA 2DY1A 2IYLD 3U7HB 3TW8B 1DOAA 5KU1A 3CR8A 4R2IA 4HSEA 1KHTA 4NCHA 2G3YA 3RS7A 2EQBA 3AVQA 4C0LA 4ZO4A 1XWIA 1RJ9B 4FINA 2QPOA 1XU4A 2I3BA 1J70A 1KMHA 4HYYA 4A9AA 1JJ7A 1ZC3A 2F43B 2FN4A 1NLZA 2Z5FA 2O5VA 3B5JA 4AURA 1Z0AA 4IFBA 1G5RA 1MR3F 3W5IA 2FEOA 3K8YA 3X1YA 2PMDA 2XZLA 5KO2A 4LJAA 2WJYA 3B2EA 2FGJA 3GLFA 2EVWX 1ZINA 1NMZA 4K46A 2OLKA 3I5YA 1S9DA 2BM1A 3HPRA 2GA8A 4A8JB 1FOEB 4LUCA 4AWXA 4D80A 3RC8A 1CR1A 1ZNYA 3CIOA 5A5GA 3U4QA 3TE6A 2WKRA 1E9DA 4PQRA 1UF9A 2C8VA 1E2IA 4M53A 5DHAA 3EZFA 3LWNA 2NGRA 3A4LA 5FBWB 1EXMA 3ZGXA 2GCPA 3CZQA 4Q4HB 2DR3A 4PPGA 1KIMA 1M74A 2FG5A 5FL3A 3PJRA 4M9XA 5C1BA 4TMKA 3C15C 1Q1ZA 2IK8A 3AVOA 4PR0A 3EA0A 4FMDF 5CDFE 2Z83A 4V0KA 4RKFA 5AUNB 1DAFA 4TSFD 4TMWA 3FPAA 2KSQA 3CF6R 3OE7A 2CBZA 1COWA 1UDWA 2ANCA 1E9BA 4AYXA 4M0LA 4BFVA 2YKGA 2R6CA 1RRCA 2OFOA 1HYQA 3BXZA 4LHZA 4URWR 1CLUA 3PEUA 3HJNA 2ANBA 4R7ZA 1GKIA 1Z6AA 4IVPA 4Q4AA 3I8XA 2HLDA 4CT5A 4EFLA 4LGMA 1Z08A 2ASEA 4P33A 2UKDA 4JL5A 1XD2A 1U0HC 2YVUA 3W6NA 4C0AC 3TQFA 1CR0A 1MO5A 3CRMA 1JJVA 3NBYC 1YR6A 2UVQA 2G6BA 1P3JA 2VHUA 4E07A 5EJEA 3PUXA 1XJCA 4RFVA 1T91A 4OQNA 1M8PA 1D5CA 5SZHB 1OIVA 2ZAOA 1TL7C 1VDZA 3P1JA 3RLFA 3FOZA 4RZXA 3LH5A 4FW9A 4B3CA 4G5QA 1CP2A 2BHRA 2XOKA 3S1AA 1XPUA 2J7PD 3ETLA 4AKHA 1KY3A 4BEBA 5CJPA 2A9KA 2WWIA 5KSYA 5JJIA 1BKDR 4HB3A 3NEYA 1BO6A 1KMQA 1NL3A 3H86A 1GL9B 4IJMA 4GPTA 3OZXA 4EQ6B 3FMIA 1UFQA 2CK3A 1MRNA 5K8TA 1EGAA 2CVHA 2FU5C 1FNMA 1G291 2BCGY 3DM5A 3X1WA 5C46F 2BEKA 2J1LA 3QXSA 3LV8A 1UAAA 2FZ4A 4I1UA 2WIAA 1LVGA 3M1IA 4MKFA 4OHXA 4MDFA 3UIEA 3AQ4A 3KKNA 2HF8A 3A37A 3CPHA 3AVYA 4A0FA 3DKPA 3MRSA 4AYWA 3CKLA 1SXJB 2QP3A 4MA4A 1DO2A 1S2MA 2D62A 4D4KA 3CX6A 2KJQA 1ONBA 1HTWA 3GLIA 2JJ2A 4CZ2A 4NU0A 1IY0A 4Y0AA 3WBJA 2DPXA 4I1SA 4DBLC 1W47A 5D3MA 3A36A 3NH6A 1GFIA 1LV7A 2IYUA 2VHTA 3C16C 4WXPA 3ZH9B 3TKLA 1Z06A 3IQWA 4TLBA 3KKPA 4RCYA 4KAXA 3K0SA 4LWZA 5FFMA 1D8TA 3EIHA 4PO9A 2OXRA 2W83A 4WXRA 4C3ZA 2HYIC 4MYUA 1WBDA 3SR0A 1J8MF 4IEIA 1OB5A 1G7TA 3THWB 1P9RA 1PUJA 1W46A 1E4YA 1OH7A 1JEEA 1P62B 1AM4D 4YONB 3FMFA 3MG9A 2E9SA 2WHXA 4I99A 4XTCS 1W5TA 3VHXA 1U8YA 4TSFA 5FH9A 1KOFA 1SVMA 3VTKA 4C0JA 5TMPA 1KK3A 1GUAA 1ZUIA 2ZPTX 4M4SA 1HV8A 2V54A 3VR6A 4JL6A 4D81A 1OHHD 1NLFA 1JPJA 3VQTA 1E0KA 1P9WA 2XEXA 3T35A 1EFCA 1N25A 1DAMA 3UG7A 5P21A 2PLFA 1JI0A 1Q1EA 5TV2A 3TIFA 1G21E 4IW3B 5JSZB 1P75A 2XTMA 2OFWA 3QNUA 4FI3C 1VYTA 4CW7A 2G1KA 1SXJA 5CLQA 3KL4A 4G5OA 1E79D 4M1KA 4TQAA 2IWHA 1G19A 3HU3A 4KBGA 2G83A 3NBFA 3ZJYA 2C04A 2BIFA 4UNRA 2VP6A 3B9PA 2ZROA 3SNHA 1CS4C 3BRWD 1JAIA 2VHCA 2ERXA 1ZM4A 2CCGA 5CIQA 2EYQA 1IXSB 5A0FA 1G8YA 1MABA 3THOA 1QHXA 2OAQ1 3RABA 2FE4A 1G5TA 4A8JC 3EZ9A 3W34A 2WOOA 4QBGB 4D26A 3CF0A 1R2QA 2JLRA 3O8DA 4ZV4A 2F43A 1CJKC 3NVAA 3D3QA 4UJ5A 3F0TA 1K5GA 1CIPA 3L0PA 2IYZA 1UDXA 4GP6A 5JFGA 3AKCA 5J40A 3EC2A 1YR7A 4NL4H 2FH5B 4HLQB 3LVRE 1NRJB 4BFXA 1KJYA 3LX8A 1BIFA 2GWHA 2ZRDA 4V0NA 4B3FX 4ZPXA 4DUGA 3KQNA 4KO8A 1IONA 3L0IB 1GWNA 2IUSA 4RZUA 4FIDA 1SULA 4LBYA 4DLTA 5L3QA 3RDPA 3GLHB 5FOWA 2QEQA 2IWRA 1VHLA 4ESVA 4WIAA 4TL8A 4ZCLA 1RPZA 1GG2A 2JLYA 2ZE5A 3EPHA 2CNWD 3KXLA 5JWHA 2XB4A 3KJEA 1W0KA 1W1WA 5L3SB 2MSDB 2IL1A 2QG6A 3T1QA 2LKCA 5IT5A 3QPWA 3GJXC 5FI0B 1XEWX 5EZ6B 4GBMA 1Q20A 5SZIA 4IFEA 1YZKA 3QVVA 3AGPA 3QF7A 3Q85A 2ODNA 1NBMA 4GOXA 2QTFA 1XD9A 2VSOA 5FPHA 3HPQA 4G5SA 4O3MA 4URVR 3ECCA 4B73A 1B0UA 1TEVA 5C4GB 2DCUA 2QAGC 1WCV1 4OQFA 4HAVA 1J2JA 4TMTA 4FCVA 4MDEA 2P6NA 3O47A 4PTLA 3R9WA 4QHTA 2QT1A 4X8OA 4NCIA 1OKKA 2IBMA 4HUQB 4QGFA 3VR3A 1RFLA 1VCNA 1QZXA 5L3VA 3MSXA 1R10A 1YRAA 2F3TA 2O8FA 1NBME 3PEVA 4AG6A 4KFTA 1MOZA 3LBHA 1DEKA 1ZNZA 4FCTA 1X3SA 4QJ5A 4NYMQ 2QT0A 1NVVR 3W6OA 1E0SA 2R62A 2VA8A 4DEYA 1Q57A 3K0CA 2R2AA 1SZPA 3OEHD 1R6BX 3IDQA 3KJIA 2OBMA 3WMFA 2ATVA 5GJWC 4KI0A 2DBYA 3RS0A 2BMDA 2HXYA 4NCNA 1GRRA 4MYCA 3TVDA 5M04A 5EUMA 3RNLA 1N6PA 1IQPA 2A5GA 4AY2A 4PPFA 3MJHA 3KQLA 3GMTA 2J7PA 3ZIAD 4FMBB 1WB9A 5DN6D 2A5DA 1C4OA 1AKYA 4HDQB 1BMFD 3NBXX 2R6FA 4XVRA 2H1LA 2DB3A 2J0UA 3WP0A 2O8FB 1XZPA 2V9PA 5EQTA 1WBBA 4DSUA 3SQWA 4R2HA 1P2TA 5CJ2A 2ZYUX 3K0FB 1CEEA 1ZBDA 3DDCA 4NYIR 3QUSA 3I4LA 1X86B 2G0TA 4AC9A 1G8HA 1ZNXA 1IN8A 2IHBA 2IS6A 2JGNA 1Y63A 3R8FA 1KJZA 4PZZA 2K5UA 2OXCA 1ZMXA 1J8YF 2EFCB 4DCVA 1U81A 3IGFA 5KPDA 4U7DA 5JWOA 1BYUA 3P32A 1KK1A 1KAOA 2JCSA 1KDTA 3IEUA 3P4YA 1D2NA 4DLYA 4ABYA 2BBOA 3C4JA 1X8KA 1AZSC 1ZIPA 1R0YA 821PA 4PHGA 1CJMA 2GHIA 3QXXA 4JLOA 4ZDKA 3W6PA 4R71A 4YMTA 3SBDA 5AUQA 3TUJC 3F8TA 3BORA 2BJWA 1R4AA 4C0BA 4D4MA 1E0AA 3QKUA 4FXPA 1FTSA 2QAGA 3T34A 3A6PC 2QU8A 1KZ7B 1Z28A 5AJXA 4KBFA 3U61B 4Q1EA 1NG9A 1H8HA 4GDFA 2QY9A 1NVWQ 2F1IA 1U90A 5IHPA 1IN7A 1QBKC 1W5SA 3GLGA 4LC0A 2DHRA 1QHHA 4DDVA 3NDBB 3BFVA 1ANKA 2C9OA 4AI6A 3ZVNA 1LB1B 3HYTA 2QTVB 3IPXA 5GJBA 5IDVA 1OFUX 3RRYA 4XWKA 2FA9A 2C98A 1Q3TA 3NHBA 2WWFA 3KQKA 4OHYA 4DIDA 3KQHA 1SKQA 2O0JA 1E9AA 1N0UA 2QENA 4M22A 5EE1A 4ACAA 1OFTA 4Q4JB 1DAIA 1R8SA 2ZRMA 1CR4A 1KO4A 3KTAB 2RGGA 3G82C 3K09A 3RVBA 1ZCAA 4Z8YA 5KDDA 1MRSA 3LO5A 1HT1E 2IYYA 2C95A 1KDRA 1AZTA 4N0DA 1R5BA 1SVWA 4LJ7A 5LB4A 2UZ3A 4B3DA 1ZM2A 3MWLA 3N2EA 3I32A 3CNOA 5L8VA 4ERNA 1QHGA 2ZRAA 5FTJA 3BH7A 4EKDA 2ZRNA 2OAP1 4V0ME 1UJ2A 2CCKA 3L43A 3QPUA 3B78A 4BFUA 4ACBA 2W2TA 4XSHA 2QUZA 2V7QD 3G5UA 4PHFA 3KUDA 3U3RA 2FDCA 4BLOA 3QENA 1LS6A 4KCGA 5B64A 2RCNA 1N6LA 4WVFA 2ORVA 3NH9A 1GKUB 2A30A 2GJSA 2RGXA 4M1WA 2IXEA 1XTSA 2JIZA 3L82B 3SJAA 2ODWA 2HLDD 1AGRA 1S1CA 2OEPA 1E1QD 3DEFA 4LJ8A 3RS4A 4DB2A 4V0MA 5KNDA 1KO5A 3IPYA 1LTQA 5B30A 1G7RA 4HUQA 2V1UA 1XCMA 3FFBA 3OFNA 4KXFB 5BXQC 3P4XA 1G64A 4V0OA 2GXAA 4LY6A 4FWIB 1ELOA 3EX7C 3K9GA 1KKLA 1OT3A 2HJGA 2XNSA 1SVOA 4NP6A 5H8WA 3BB3A 1RYHA 1SXJE 2AX4A 2BC9A 2FSHA 3TH5A 5JI3E 1IY1A 3GJ3A 5C18A 3NTUA 3W9YA 1DAEA 2WWGA 1KO7A 3W3AA 2O8DB 2Q3MA 4D25A 3K70C 4J0QA 3ZZ0A 6Q21A 2WWXA 2OT3B 4UKDA 5IK2A 1VPLA 2ZS9A 4A2PA 5EZ5A 4IDOA 1FQKA 2P0EA 4B75A 1PJRA 3BJIC 1KI2A 4L9WA 2XTZA 4P4SB 4DCTA 4AIIA 1F6BA 1T0JB 5AJZA 1XDBA 3UANA 2AK2A 3W90A 4QBHA 5HKKD 1QHIA 3AUYA 2GKSA 3GJ0A 1E2FA 5KYKA 4EPTA 2FFAA 5DNYB 2YYZA 1LW7A 1XP8A 3A1UA 5KTYA 2CDNA 2NO6A 4I81A 4L8GA 4LHWA 4LHYA 1OXUA 1X6VA 1MO3A 4OJKA 4EQ6A 5L3SA 3FKQA 4JLPA 2PJRA 4F7WA 2WWYA 5CDFA 2H8KA 3DZDA 3R7WB 2AD1A 2QRNA 5EP1A 4PPNA 2NQ2C 2QORA 4TZ6A 3CH4B 2D7DA 4CT4B 2J0SA 4BWYA 2BMJA 4KITB 1OE0A 2FSFA 2YINC 3D31A 3EASA 4TMXA 4II7A 2F1HA 1IJFA 2IW3A 3HYRA 4C0QC 4KLZA 4JVMA 3IIKA 3TSZA 3CUEF 3I61A 2KE5A 3KJGA 3ONWA 3L2OB 3QOFA 4Z8XA 4A0GA 4Q9HA 1GRNA 3QKSB 3H4MA 3PUWA 4UNQA 3K70B 2ZRKA 1E1RA 2RGAA 2WMOB 2JA1A 3QPVA 4PZYA 2XOKD 4LV8B 3FKSD 1NN1A 1W4RA 4LJ6A 3R20A 2B7BA 2AHOA 3Q8XB 1FMLA 3PEYA 4IXMA 2AFHE 2O8CA 3K09C 4BZXA 4C7OB 1G41A 1A82A 1HE8B 4TT3D 2W6IA 4US1R 3ADBA 2IXFA 1LY1A 1I4TD 3KKOA 4XWOA 3SQXA 4UNSA 5BWMA 5FOUA 1KI7A 1G8GA 1U8AA 1YRBA 4MKIA 5DLQC 4A15A 1MV5A 3REGA 2ZI4A 4Q48A 5CITA 3GLHE 1HT2E 4Q9KA 1N6HA 3PCRB 3QBVA 1NF3A 3JZAA 4LC1A 3GLFE 2IYRA 4MKGA 4D0GA 3GLFB 3LW7A 3MFYA 4TTRA 4EUNA 1OPXA 3RWMB 4B74A 4YMSA 1KY2A 3PXGA 4HAYA 4LV6A 4DJTA 5JEEA 5HCNA 3C14C 2ZRHA 1JALA 1G3UA 2J9RA 2OCBA 5UKDA 2QTHA 4ZI2A 4URYR 4FN5A 3TAUA 2MMCA 1GILA 1G3MA 2GCOA 3D8BA 3CF2A 3THYA 3PQCA 3RRMA 4MRVA 2ZXUA 1XB2A 4F38A 2BMEA 1XF9A 2V4ZA 3BAFA 1FL9A 3EWAA 5FR1A 5KOYA 3HU2A 2BMFA 2B6HA 2RHDA 2EWVA 4BPBA 2CCJA 4PC1A 3EPKA 2A7QA 4G5RA 4N1AA 4YDSA 1NIPA 5F3WB 2RGNA 3Q9LA 4QHYA 1SXJC 5EE0A 3X2SA 4PQYA 1SVLA 3AP1A 3IQXA 3DPUA 2JJ1D 1FW6A 1X1RA 5G3YA 3B7GA 5KDOA 2DFKB 1Z0DA 3AF2A 2JJ1A 4W5WA 1QHYA 1S3GA 3ZD6A 1U94A 1DPFA 1Z6XA 1W36D 5HZKA 4GZMA 3D6TB 2XGJA 3UWOA 1OV4A 4DSTA 4P4SA 4PC3A 1A1VA 3D7MA 3TNFA 1OFIA 2MMGA 2IYWA 3A1VA 4MRNA 4DLSA 2FSGA 4QHSA 2QMOA 2YC2C 1N3BA 4MKHA 1DVRA 1E32A 1OH6A 1AJEA 5E7JA 3X1XA 4B71A 3QEOA 4KJZA 2WWHA 2FJUA 1M2OB 4W7SA 2Z6VA 3M0EA 2KBEA 1NVXQ 2ZJ8A 4MH0R 4LBZA 4W9MC 3GP8A 2VSFA 4Q1AA 1NI3A 1RJ9A 5KNCA 3ICEA 2I1VB 1PZNA 2D2FA 1UM8A 1P2UA 3QQ5A 1PUIA 4EIWA 2JLXA 2ODEA 1CKEA 3WRXC 4CEIB 1NMYA 3RRNA 1FP6A 2XNDD 3KKQA 3QVUA 1G5PA 4IOMA 1XEFA 2FFBA 3CH5A 3C8UA 2ORIA 3C7KA 2KB0A 5HTKA 3JZMA 4ZDIA 3CONA 2AN9A 1HY3A 2SHKA 4TN1A 2AD5A 2H5EA 2QQEA 4YXWA 2LCFA 1W2GA 3I8SA 5CIWA 1JXMA 2CXXA 1BYIA 3BK7A 5B58C 2KI5A 1OH5A 2GRJA 3PUYA 2VHJA 2OBNA 2QMUA 5FPSA 2WJIA 4YDHB 3RAPR 4QJ4A 2J7KA 1KI3A 2H17A 3AH8A 4Q9JA 5JEDA 1M34E 4M8NE 2QSYA 2VP5A 2V55B 4V0LA 3HR7A 4YLGA 2ZE7A 2EFGA 3TAHA 3ADDA 2AWNA 2R44A 4XVQA 2Z43A 1UEJA 3L8ZA 3F3YA 2FFHA 1Q22A 3KJHA 4MRPA 1DS6A 1ZM3A 1RC8A 4AD8A 1Z0FA 1JECA 4N3NA 1JBKA 2NMVA 1E2PA 1UEIA 3A8TA 3HDTA 1Z6YA 5DYGA 2VQSA 2YOHA 1ZC4A 1P6XA 3T12A 2JDIA 4HZIA 1U2RA 1IOZA 1Z29A 2RGNC 3B13B 3BFKA 3MCAA 2W6ID 3FTQA 3EPLA 1CULC 1DO0A 5F98A 4BFZA 3LXRA 1XTIA 2PCJA 1F2UB 1VG1A 5KUTA 2GXUA 1KNQA 1XXHE 4FMDB 1FTNA 3EAQA 4O25A 4LK2A 4DEXA 3ZVMA 1G1MA 1ZNWA 4QNMA 2NO1A 1VYVA 1E69A 4Q7JB 2O8BB 4UNNA 4A92A 5IF9A 4TYNA 2W0MA 3CO5A 2P6RA 4B3XA 3NC0C 3TMKA 2WAXA 3PENA 1E99A 4CEJB 4PC2A 1GKYA 2E1RA 2FX3A 4DZZA 1YQTA 3Q5EA 3T5DA 4AYTA 4A82A 4PXAA 3WYAA 5GVRA 1RKBA 1RW4A 1XX6A 2GJ9A 3U5ZB 1XNJA 4HB2A 3QKRB 3SYNA 5FPTA 3QE0A 1KO1A 3S1AB 5J4KA 2O52A 2AL7A 4XVUA 1UKVY 5JZVA 2IEZA 3OEED 4WA7A 4B33A 2WSMA 1M7GA 1HA3A 2OCYC 1V5WA 3TQCA 1GVNB 4CVNA 2HT6A 1OXSC 2GK6A 4LDJA 2W6JD 4JT4A 3VKGA 4HAWA 1C1YA 3WMEA 3PVSA 1KSJA 3U7EB 3CNLA 4W5JA 1E2NA 2J87A 3EARA 3T15A 4LX0A 1L8QA 1MABB 4BFTA 4DVGA 1OH8A 1F3OA 5EXXA 3LRPA 3GJ8A 2AK3A 4LYHA 3KQUA 3OIUA 3P27A 4DXAA 4ZCMA 2ZITA 3BOSA 3B1XA 4JJZA 4LYFA 3NWJA 4QBFA 1BMFA 2OSBA 3PV0A 2PBRA 2IUTA 1RVDA 4FCWA 5TXGA 1R8QA 4QOSA 2XJ4A 4GNKA 2HYDA 5G41A 2IS2A 2FPLA 4X8LA 4Z1MA 4DWJA 2VL7A 3KDSE 4KFUA 2BCJQ 2AXPA 4TYQA 2QGNA 4OHZA 2LKDA 3ASZA 1SKYB 4DB4A 2D7CA 4H1VA 3RC3A 4JLJA 1XPRA 1ZU4A 2ZJOA 4S35A 3AVWA 4NDZA 1TQ6A 1K5DA 3WBKA 4AKIA 3CRQA 3NHAA 2FV8A 1T3HA 3X1ZA 4B43A 3GPLA 4OKSA 3R8CA 3KX2A 1KI1A 2GEVA 1GL6A 2JJ8A 5EP2A 5KSOA 5EE5B 2AWOA 1IJEA 4PAOA 3U7FB 2QE7D 3O8BA 2D2EA 5CK4A 1U98A 1ZCBA 4I4LA 4A4DA 2R9VA 1N5LA 4QC2A 4R98A 1HE1C 1W36B 1ZJ6A 2GESA 1Z6TA 5AR1A 1G6HA 4C0SA 1VECA 1FX0A 4KHZA 4NBSA 2N42A 4XWAA 4C4PA 4JLAA 4IDPA 2CL0X 1R5OA 4HATA 5E3HA 2V1XA 3THYB 1AQYA 1TU3A 1US8B 2BBTA 1R7RA 1D2MA 3OIVA 1E94E 3THXA 4U02A 4CYMA 4NTZA 4RSGA 1TUEA 2GZAA 5SZKB 5K8UA 1S9HA 1CXZA 3NDPA 2QP4A 3MWKA 2N1BA 1NIJA 4A0HA 3GEHA 5E4FA 4IOJA 4TQ9A 2VBCA 2PH1A 1II8A 4DLUA 3ASYA 4U00A 1Q1BA 2BKEA 4P3YA 3TK1A 4B2LA 4QL3A 1AGPA 1AKEA 1R0XA 5FOTA 3LLMA 4ZIRA 3FKSA 2JEOA 1XD2B 1XXHA 2IT1A 4KYIB 4ARZB 2NZ8A 3WY9A 2JAQA 2NPIA 2PL3A 4ON9A 4OQXA 2PMKA 4IOKA 4QXAA 1W0KD 3CRRA 2QNRA 1D6JA 3K0FA 2WV9A 3H0KA 2J0QA 1II8B 3QF4B 4ASUD 3AM1A 2QE7A 4HZUB 5FOVA 1XTJA 2GJKA 3MWJA 3AKEA 3Q7QA 4IOLA 2FMXA 4B76A 4E09A 4TLAA 1E2DA 2JLZA 4OQMA 2VRWA 1PLKA 3LBNA 1BOFA 2J46A 2RGCA 5JSZA 4US2R 4OI1A 5F9HA 2ZYTX 2ZVPX 1GNQA 2RGDA 4B2PA 5FUXA 4B6FA 4PANA 1XEXA 4Q9IA 3WYFA 1E4VA 3BC1A 4EJSC 1LF5A 2RHMA 4BZQA 4RVCA 1YZLA 4KU4A 3V4FA 1ZM7A 4D0LB 4PSVA 2RH5A 2WICA 1KO8A 2IYVA 5LPNA 5DIFA 1I4LD 1P5ZB 2KBFA 4EFMA 2QM8A 1YR8A 2G1JA 2YOGA 3K9HA 4Q1FA 2XSZD 2VTKA 3W8NA 4F4IA 5IK2D 4M21A 3PIRA 2QAGB 5KPJA 2IEYA 4A2WA 5J5CA 2WOJA 3AVUA 4NKRA 2EFHB 2GZDA 3VKWA 5DO9A 2OCAA 4LRWA 1TQ4A 3LDAA 5HKKA 4NYJQ 3PUVA 1G20E 1YU9A 4D6PA 1IAQA 5KNBA 2XZOA 4TL9A 2C99A 1R5NA 3B1ZA 3HP1A 4G01B 3AV0B 1MKYA 1Z07A 2PT5A 4Q7MB 1NP6A 2W6JA 3RRZA 3UG6A 2EFEB 4LPKA 5TY0A 1A7JA 1ZIOA 4B2IA 1U99A 1W49A 2GNOA 1GIAA 1YZNA 1XBTA 5FPKA 3GFOA 2YC4C 2FPKA 4HLUA 1KNXA 3AF4A 2ZJBA 3SFVA 1N6IA 3U3OA 3VX3A 1C9KA 3B6EA 1U8ZA 4BLSA 2NOAA 1TEXA 4WBSA 4QFMA 3BD9A 4PZLA 2B8TA 1P4SA 1SVIA 2XXAB 3UMSA 1RE0A 3FGNA 4UJ3A 1EFUA 1F2TB 2ZYWX 4D2IA 2OM2A 3SYLA 1GDDA 4K8OA 1E1QA 4BLTA 5F9FA 3RWOA 1F5NA 5JBQA 2HDNB 2VLIA 4B3GA 4Z54A 1WMSA 2ZI7A 1DG3A 3MJRA 3UATA 3VU9A 2QM7A 2VIIA 4QRHA 2Q3FA 2QGZA 1Z83A 3EZ2A 1SHKA 3IIJA 4G3XA 3TRFA 5HR5A 4JLNA 2VP2A 2GCOB 4KFSA 1M1YE 1H8HD 1VHTA 2CL7X 4KLNA 4B34A 1ODFA 2BM0A 3AEZA 3TJZA 3GFPA 1YZGA 2RGEA 4NHOA 2UZIR 3CX7A 1T8UA 4NZYA 4MGZR 2QPAA 3ZQJA 1JXOA 3B60A 2DYKA 3U2QA 5J4YA 2XZPA 3GJ5A 4A0RA 3VR1A 1D9XA 1US8A 5G40A 3ZVRA 2H57A 2QAJA 3H2YA 4I1OA 4XD7D 1N2CE 3WMGA 3QF4A 4MITA 1A2KC 2ZRCA 4NH0A 1CF4A 2A2ZA 2PZFA 2ZSBA 3TW4A 1F2UA 3RSOA 3WNCA 1E3MA 5HE9A 8OHMA 3SYKA 1ZVQA 2IA5A 5HE8A 5BN3A 5FBRB 1ZM9A 2P5SA 3GLIB 1Z2AA 2F7SA 1IHUA 3K0CC 2CVFA 3K0AB 3TSWA 2QROA 4F92B 3AUXA 2GVZC 4TTQA 2ZUCA 3WHLA 2NZJA 3QIAA 2ZI6A 4DDWA 3REFA 4BQSA 4DCNA 3IILA 1SGWA 4HDOB 3SJBA 1NKTA 2YWGA 1TF7A 1VCMA 3RS3A 4ZI3A 4WOPA 1OSNA 2R8RA 3P20A 4E22A 4LBVA 3OE7D 4BRWA 4H1UA 4JJKA 4S2EA 1S0UA 1Q0UA 3IIMA 4JLMA 2ZSFA 2WSSA 1KDPA 4HAXA 3U4QB 2J41A 3EIQA 5AJYA 3I5XA 1CJTC 3GQBA 1P7CA 3QI2A 4O2RA 4ESHA 1HUQA 5FUWA 2Q9AA 3EIEA 3IEVA 5CM8B 4QJ3A 1M7HA 1ZP6A 3CZPA 2VYFA 4JSYA 3PG5A 3R7WA 5G53C 3OIWA 221PA 3FHTA 2IS1A 2H92A 3Q72A 5FBVB 2VF8A 3UK6A 1OHHA 4V02A 5D3MB 1OW3B 3DMNA 3SC3A 3EG5A 5JHHB 3HWSA 4OJQA 2DFLA 4URXR 5FBLB 1D2EA 3GLHA 2XB2A 1R0WA 3IO5A 3OF5A 1OIWA 2WKPA 2O0HA 1NSTA 1Z22A 5BN5A 4P0TA 1Y3AA 4TMZA 2ECKA 4RZ2A 1ZAKA 2VO1A 1FPMA 3QKTA 3EWSA 4JKIA 3K0AA 1E96A 2F1RA 3TUIC 1EWQA 5EP3A 1KKMA 3FWYA 4RFSA 1NJGA 3QKSA 3IBYA 1EWRA 1UKZA 4Q4JA 1T6NA 3RANA 5FTKA 2GEDA 3J81k 4EFNA 5GVSA 2GBLC 2FGKA 4A8JA 1N5KA 2ZJAA 2H16A 5EE3A 421PA 3KXIA 4Q1CA 2RMKA 1NN5A 1CTQA 3GEEA 1GITA 4RD0A 3ZD7A 2JDID 2ZR0A 2CLCX 2OILA 2PX0A 2W58A 3NXSA 3QG5A 4OK5A 3HR8A 2OV2A 2ZSDA 2FNAA 1E2KA 1J90A 4MGIR 4RD2A 1L4UA 4XD7A 3I92A 3ND8A 5E95A 3SOPA 3TBKA 3R9XA 1W2HA 1CR2A 1GZSA 1NSFA 1QRAA 2XXAA 2JASA 3JVUA 1VG8A 3RHFA 521PA 2IF0A 4M9ZA 3KB1A 4DLVA 2G88A 1Z0IA 3C5HA 1WQ1R 4YC7A 5GADl 1YE8A 1H65A 1HEIA 5FUYA 2A78A 5BQ5A 1JR6A 3M4YA 4PFSA 4M1MA 2AKYA 2ZI5A 2IXGA 1LS1A 1K8RA 1KI9A 4KFRA 3W3ZB 2NO0A 4NCJA 5DGXA 5FOSA 1UPTA 3SDZA 4TT3A 3F5FA 2D06A 3PITA 3TLXA 3NG1A 3PEWA 2IUUA 2Q0HA 1T8TA 1COWD 2ZJ2A 2WIBA 1QG4A 2EWWA 5AUOB 4GOJA 5DI9A 2Q3HA 1K6MA 4FMCB 3IUYA 4RD6A 3U3JA 3FMOB 1W4BA 1E1RD 2YHSA 1WE2A 4DSNA 4TYYA 4LZZA 1NG1A 4IDNA 1KMHB 3AP3A 4ZKDA 3VAAA 2GF0A 1KJWA 1N5IA 4CRWB 721PA 1X8JA 2HXSA 3UMFA 3I1FA 4IRUB 5JECA 1FUUA 5CYOA 1F2TA 4P4TA 3H1TA 1DE0A 3W8RA 4B48A 5C2JB 4GL2A 3U60B 4LCBA 5J4HA 3KZ1E 4GI7A 2XITA 4DUGD 2ZTSA 2ZS8A 3BIFA 3DMDA 1VIAA 3I62A 1S96A 4XH9B 1GRQA 1HQYE 4CEHB 3GLGB 2R6AA 1A2BA 2NG1A 2ZANA 4CF7A 1TF5A 5IRCD 3AVPA 4HAZA 1JR3E 3ZS9A 5BW8A 1CBUA 2YOFA 4PHTA 2QQ0A 1OXVA 4Q4LA 2X2EA 3FDIA 4IVRA 3ZVLA 1RRFA 2JLVA 3GEIA 1UKEA 4D4LA 3CX8A 1JAHA 1E2GA 2YWEA 2GILA 2VEDA 1Z2CA 1PV4A 1NJFA 2GJAA 4Q47A 2BKUA 4L16A 2C03A 2HF9A 1CJUC 4XJXA 2GTPA 4MGKR 2P5TB 3VFDA 5DISB 2IF2A 1IXRC 5FL7A 2OE2A 3OESA 4FMCF 4JL8A 1XMJA 1G3RA 2QA5A 4MRRA 3OEEA 3CPEA 4IVQA 1G17A 3N5CA 1FFHA 2VP4A 1TUIA 3VR2A 3EZ6A 1JQJC 4PQFA 4Q4HA 2QL6A 1OXXK 4OQLA 1ZRHA 1AS3A 1MO6A 1OLOA 1VYUA 2A5JA 2XTNA 1XJ0A 3BS4A 3CR7A 2BOVA 3LFUA 2ZS7A 3K0EA 1NY5A 3QY0A 1OIXA 3CBQA 4OK3A 5TDHA 2QBYB 5SZJA 3U3KA 1VKJA 3E1SA 3GJ7A 1IXZA 3C41J 4YQFA 4G5GA 4KVGA 4ARZA 1NY6A 3CM0A 4CEHA 3AVVA 4ITRC 2XJ9A 2O8DA 4M9SA 4MUAA 4PSAA 4PX9A 5EXSA 1NN3A 5LD2B 4OI4A 1ZUNB 3CB4A 5HZHA 1YZUA 4HLDA 1ZU5A 3LQRA 1EX6A 2J3EA 2CHGA 2DFTA 1Z3IX 2F9MA 1YR9A 4IXNA 4A6PA 3KTAA 1B23P 2G77B 4M1TA 2EFDB 1TF2A 2BVNA 2IYTA 2R6GA 3MMPA 4US0R 1Q21A 4TMVA 4A36A 2PEZA 3C5CA 5G3ZA 4A6XA 2QRZA 4HEJA 5HCIA 1U0LA 4LV5B 1GSIA 1SQ5A 5JHGB 1E2MA 1I4DD 1OXTA 4RY2A 4TQUS 1J99A 3EXAA 3K9LA 1ZD8A 5CLLA 1T9HA 4BASA 1E0JA 1D9ZA 1J7KA 4LYJA 5KHOC 5DH9A 3WYGA 5JS8A 3FE2A 5E7IA 3T1TA 1KI4A 1GL7A 5D3QA 1XTKA 1RRGA 1F60A 2BJVA 2FEMA 3CNNA 5DI3B 4JIMA 4EPVA 2BDTA 3IKJA 4PAQA 5FR2A 2GEUA 5TB5A 3RSLA 5FTMA 3NBZC 1SVKA 1Q3HA 5DN6A 5EP4A 1W36C 3CWZA 1Z0JA 3PUZA 5DE3A 3U3MA 2X8AA 2GAAA 2ZR9A 1S4QA 4FWTA 4AK9A 4Q18A 3K9NA 5H68A 2FOLA 4YXWD 4LOAA 2ZE6A 4JLVA 4POAA 1AN0A 2C9YA 4UXHA 2QMEA 1DTSA 4B44A 4C2TA 1E79A 1O87A 1V43A 2EU8A 4QG7A 4IEEA 3EZ7A 4Q7LA 4JT2A 4PO8A 5EXPA 2ZETA 4UNPA 3CW2A 4X8HA 2QP9X 4AG5A 2WBLC 4UXIA 3I72A 1TAGA 2D74A 2OBLA 3AF0A 3DZ8A 4BLPA 2WJGA 2VSXA 4YMWA 2REBA 1FZQA 2FF7A 3SBEA 2B8WA 2P6UA 3THWA 4K81B 4EAQA 3IHWA 3A1SA 4E03A 1VTKA 2JLWA 1OB2A 1II9A 1BH2A 1XRJA 4WZ6A 3QJYA 5FI1B 2QZ4A 2IX3A 4OI0A 3B1VA 1E9FA 1EFHA 1AS0A 5AK0A 2G0NA 3GJ4A 5DYIA 4OHWA 1E2JA 4N0EA 2B21A 2WWWA 2ZYVX 1YZQA 1IN4A 2YV5A 4BFYA 5JLJA 1CRQA 1ZD9A 4LJ5A 5K8LA 3EW9A 3PR1A 1LF0A 4B47A 4F93B 1TQ2A 4BECA 1S1MA 4BFWA 1N5JA 2IYQA 2Z0MA 3H84A 1SHZA 3VR4A 1DG1G 4GFDA 5JCPA 1FX0B 4QM6A 1WP9A 3SZRA 3NEJA 1OJLA 2XSZA 2DWQA 4E5UA 1ZYUA 1ZUHA 4NONA 3OEHA 1PLJA 2C96A 2HCBA 4MRSA 3B85A 1SVSA 5JCZA 1E6CA 1AS2A 2ZM5A 2FPMA 3B9QA 3I3SR 3OAAA 2PT7A 4Q5IA 5JRZA 4BLQA 1XTRA 2XAUA 3LA6A 4A2QA 3FMPB 1EFRA 2IHYA 2QI9C 1P73A 4D82A 1Z63A 1CU1A 4KSBA 3KB2A 1BS1A 1AQUA 2ZR7A 1DADA 3DVLA 4JVNA 3TUZC 3AF3A 1Q1QA 4C2UA 2BV3A 4XTRA 1Q44A 1VCOA 3CRVA 5GJVC 1XMVA 3NKVA 1ESMA 3LBIA 4DDTA 4CIDA 3VNUA 4RD4A 2VH5R 1QDEA 1KI6B 4TL6A 1KI8A 3ND9A 3Q7PA 1NNEA 2V6IA 3Q3JB 3IHLA 1P72A 4M1YA 3VHLB 2Q6TA 1HURA 2A3RA 2EW1A 3EPJA 2O8CB 2AKAB 3T1VA 2ZRFA 4TLDA 3L8YA 5FPYA 1NMXA 4EJSA 1H8ED 4U5XA 1DAHA 4KYUA 2OG2A 1XCPA 1ETUA 2VF7A 2X1VA 2HT1A 1EESA 4GMDA 1KYIA 2PZGA 4B3BA 1QG2A 1DELA 1UKYA 2BEJA 2QN6A 1NN0A 3DOFA 3EA5A 4Q00A 5JS7A 2HEIA 5AJWA 5CB8A 3K1JA 4LI0A 4RD3A 2ONJA 2NIPA 3QG1A 4AKEA 3FHCB 3KKMA 2HV8A 5CM9C 5HPYB 2WMNB 1OYYA 2Y8EA 2DFNA 3AF1A 3KFVA 5DSZA 3O8RA 3IBGA 1FP7A 3FFAA 1KK0A 4LJYA 2VHQA 4BGDA 4O2LA 3A4MA 4MYTA 2ZI3A 1IN5A 3VNVA 5FBQB 2ZSEA 4P32A 1WDTA 1NKSA 1T5LA 4LHXA 1SXJD 1O3YA 2GVDC 2CJWB 3E5HA 3ZYCA 2AR7A 3AGQA 4C0KA 1A5TA 2ZRIA 2OFXA 1VCIA 1GAJA 2RAPA 3B82A 3ZZUA 5EXTA 3QXCA 2GAOA 5FUVA 4RCZA 2ZJYA 1KSFX 2OCPA 3MUFA 3QXJA 4JLKA 4JZKA 1QF9A 3VR5A 2J59A 3DM9B 2O8EB 1KSGA 3ZDQA 3A58B 1W44A 4H9GA 3V9PA 5JRJA 3AP2A 5L3QB 2ZRJA 2QBYA 4DLWA 1T4GA 2ZUBA 2GXQA 5B57C 1W48A 4GSYA 4EDHA 3LY5A 4BUJA 2W2VA 3GJ6A 2NPFA 5JWRA 2J0UB 1SKYE 3LLUA 4PHHA 2N46A 4QKQA 3AVTA 4PO1A 2J45A 3AB3A 4Q7KA 3W5JA 4BZPA 5ELXA 4OHVA 2FFQA 5EE9A 1GP2A 2H7VA 2WJHA 1A4RA 1XXHB 2ZEJA 2E87A 4LPSA 1RYFA 1PVOA 1FMJA 4DIEA 1N6RA 4LJ4A 3VMFA 2ZU6A 3SI7A 2ZUDA 4RJLA 2WPDA 1JB1A 3GCGA 1OKKD 4Q02A 1R0ZA 3NIBA 2JIZD 5TARA 4L5BA 1U0JA 4D0NA 1E2EA 4JYBA 5BN4A 4HLCA 4A1FA 4QM7A 4M1SA 2V6JA 5J47A 4QGAA 2GXSA 2V8OA 5JJLA 4LHVA 4IDQA 5LDDC 1UBEA 2MSEB 4KODA 1CJVC 3UMRA 5LBIA 4L9SA 2W0SA 3NC1C 2V7QA 2JLQA 4GT1A 3V4RA 1DAGA 2ZVQX 2OHFA 4DDUA 3OAAD 5F2EA 2WJVA 3CRW1 5CYPA 1G7SA 4O0MA 1Q12A 4EJSB 2NO9A 1QHHB 3ICQB 1WF3A 3A1TA 2ATXA 1WRBA 3O8CA 2CK3D 4DT1A 1XPOA 1YKSA 4EPYA 4NMMA 1DBSA 4GMXA 4EPRA 4PC6A 2OUKA 2YWHA 5H70A 2FWRA 4F91B 1JQLB 3K70D 4JVSB 2J5XA 4BFSA 1XEWY 2CHQA 2QPTA 2X77A 4WAUA 1G6OA 5BYKA 3GLGE 1Z0KA 2PJZA 3BB1A 3RS5A 1EX7A 4HLUC 1N6KA 3TR5A 3SE0A 3T61A 2JLSA 3DHWC 3QXHA 1VG0B 4FD2A 2REXB 2BBWA 1MO4A 4JKYA 1JPNA 2F9LA 2I4IA 3MGCA 4MGYR 1X8LA 1EFTA 4MQBA 1G3QA 3U6BA 1OYWA 2QMHA 1GNPA 1JR3A 2F1JA 3DKVA 2EYUA 4JBYA 5L3RA 1GNRA 5K8IA 3UXMA 4TZ0A 1E9EA 2CLDX 2CJWA 2CE7A 4BRUA 1KDOA 4B32A 4BEJA 2ZJ5A 1E9RA 2MSCB 4TWZA 2H18A 5CK5A 5C4MA 3BH0A 2D3WA 2I1QA 2HUPA 4P4UA 1Z47A 1XD8A 2KWIA 3GFTA 1T3LA 2CL6X 2XNDA 4Z51A 3I73A 2O8EA 4JBWA 1QHNA 4C30A 2AXNA 1RRPA 2IYXA 3LNCA 4XSGA 1TQDA 2PZEA 3BBPA 2WKQA 4R9UC 4ZDWA 5B2ZA 1M7BA 4JVLA 4JLBA 3T06B 3FVQA 4C7OA 3CWQA 1U9IA 1W4CA 4EPXA 4YMVA 4OK6A 1NVVQ 3TSOA 2RB4A 1XMSA 4PAMA 3T1OA 2Q21A 1G7CA 2B7CA 3FHOA 4DHEA 2Z4RA 2L0XA 1TTTA 3QSYA 2OZEA 4OI2A 1YJ5A 2X19A 1T5IA 2FZLA 2PCLA 4JBXA 2P65A 4NYJR 4TTPA 3SS8A 3UKDA 5LD2C 2FSIA 3E70C 2JLUA 3A1WA 5GJCA 2YZ2A 4Q01A 2V3CC 121PA 5H1YA 1OFHA 1E2HA 2O0KA 3N70A 1QVRA 4AKGA 1KGDA 2R6DA 3ZQ6A 4CGZA 4NPHA 1JEDA 4QGHA 4YMUA 4B35A 2PEYA 1Z8FA 3DO6A 1KAGA 4C0HA 1KZGB 1X1SA 4DLZA 1G9XA 2REOA 2WM9B 1ZD1A 1P2VA 3WP1B 5TVKA 2W00A 3V00A 1Z6GA 3DL0A 3ADKA 2WJJA 1FNNA 1Z5ZA 4TLCA 1G18A 2GZHA 3OIYA 5EUQB 2C9CA 2GK7A 3MLEA 2PX3A 1RZ3A 4RKEA 2IS4A 4TL7A 4LBWA 4WZBE 2ZQ5A 2GF9A 4GRAA 3CLVA 4LYAA 5J4VA 4RZ3A 1WXQA 2P3SA 3LQQA 2ZJZA 4W5HA 2A5YB 2ZE8A 2GETA 2OLJA 3R9IA 4UQOA 4XOIA 3B1WA 4ASUA 1UBCA 4QBIA 4DRZA 2ZRGA 1NBMD 1PLLA 2RKOA 3U44B 3LW8A 4GP7A 4HAUA 1E98A 2LWIA 1S8FA 4OYHA 4NYIQ 5E7MA 4ZIRB 3UPUA 4F4CA 4EPWA 4IDHA 3BFXA 2OO7A 3EC1A 1W0JD 1TADA 3PFIA 4HI0E 3KFXA 4Q1DA 5AWFC 2BWJA 1G4UR 2HJVA 4IHQA 3FYHA 4Q21A
chains in the Genus database with same CATH superfamily
2D5LA 2XX3A 3NALA 1ISRA 1PQUA 1P1FA 1M3SA 1WS6A 3DXXA 4RD1A 4LSGA 3SWWA 5KYYB 1GT6A 3WGQA 3K5HA 1TA4A 5G0TA 2EBWA 3IRUA 1RMTA 5BSVA 1JKJB 1P17A 3PA8A 2NQTA 3MOIA 2AT1A 4ARCA 1TPZA 13PKA 1Y1TA 2B2NA 2H4YA 3GUCA 2CV0A 1YHYA 3NUZA 3H11B 4AXBA 4Y98A 2VYNA 2C2MA 2C7VA 4NFHA 1U3GA 5C3UA 3CLRC 1L5RA 2WU0A 3VPDA 4D9NA 2D6FA 5DGDA 3ZK8A 1WSAA 1O5OA 2FX2A 2I6UA 3QEJA 1T43A 1WXXA 1P61B 2Y0EA 4GM1A 2WTUA 2V6GA 3G0HA 2E4XA 2YCLA 3S2SA 3THXB 2DM6A 1I4OA 3GX1A 1CFJA 4K3UA 5IZCC 1N0WA 3JQEA 4BP8A 1XTBA 4QEKA 2X0FA 5B6IA 1IBRA 2O8BA 4WOJA 3DV0B 2ONKA 4PINA 3DTNA 3RS2A 2EJWA 4MVWA 2QDXA 2D1YA 1QRUA 1IIRA 3EEBA 4FIZA 4D9GA 4GOMD 4INPA 3H87A 4KAAA 4E4RA 1T4DA 1QAQA 2F3UA 2ZAIA 4PIMA 1L2TA 2F6RA 2ON6A 1ZICA 4WLVA 3GEGA 1T26A 4C4YA 3P9KA 1MAAA 4DPLA 2OD2A 4R83A 1E5LA 1NUSA 1GPJA 3UOAB 5FTLA 4FDUA 2JFPA 3OQOA 1V7PC 4DLXA 5MN4A 3ONVA 1JNYA 1XCJA 2F90A 2HHJA 1GXSB 1ST3A 2OZPA 4GPAA 5JI2E 1KYYA 3B3QA 1L9XA 1OXMA 2NXNA 2WZCA 4PAWA 3HKEA 2C5LA 4X85A 5F1OA 3VU3A 1DKUA 5KQMA 1MDFA 1ZA1A 3HY4A 1P9NA 1U9IC 2ZIAA 3HABA 2X2FA 1L5OA 2PXCA 4O4HA 5DCWA 3SCZA 3VU0A 2CZGA 3SU8A 3E2IA 3VO2A 3X2EA 4YPOA 1QRTA 1VPWA 2M6KA 5C34B 3MMXA 4EBFA 2LR0A 5ADHA 1QO7A 1ZHHA 1N7GA 1E9CA 1M34B 2MR5A 3KKLA 1HFEL 4K6FA 1IM2A 1QTNA 2ZIXB 4LXIA 1HPLA 3D2AA 2PSHA 2Y4NA 1DKQA 3T5GA 4RVUA 3ZX5A 4BX0A 1RZRD 1TYCA 4A3SA 1EWVA 1MVNA 1O5IA 1D2AA 4M46A 1N0VC 4DIFA 3A6GA 4PZAA 5T4FA 4IKEA 3E48A 2VJKA 5F1PA 3VJKA 3BWMA 5B1SA 4B81A 4KR0A 4HN4B 3I9OA 2WPDD 2WAYA 1JXAA 3QH4A 3OZDA 3I6QA 2PWPA 1BQ3A 1CRZA 4J1QA 4P08A 2XZTA 5GM1A 1NHGA 4RU1A 2WM3A 3L5OA 4KV9A 5B1DA 3OLYA 1AKNA 1N6NA 3KAJA 3DVQX 4XWYA 3TDMA 3PYLA 5FRDA 4DR4B 1TJNA 2AOXA 4ZO8A 4NENA 2RONA 1F8GA 1VHWA 4Z1MD 1NV8A 1RPAA 3NKFA 1BG6A 5KOHA 1TCAA 1SUIA 3UBMA 2GO1A 4RGYA 5E8JA 5B1HA 4PZDA 1QO0A 1KI6A 4U9HS 3O2NA 1TMKA 4RMIA 4X3OA 1UBGA 1UMKA 2X5KO 1MJFA 3DO8A 4QPCA 1AIPA 2XW6A 4ND8B 4URUR 3GLIE 4DMUB 4MHOA 3WAGA 4M1EA 1XZQA 4MUBA 4JYCA 4JS0A 1O95C 2Q99A 2XQIA 1ORWA 3PU6A 1BX1A 3W5CA 1R9MA 3E6AA 1L4YA 4OG2A 5AUPB 3QFFA 1L4NA 2QN1A 4Q19A 5CRIA 5C31A 2QYHA 4MS1A 4DDKA 2IKQA 4R9RA 5K6TA 1UBFA 1VMAA 4B6OA 1MW8X 4N40A 1FMFA 2P4QA 1W4AA 4B79A 1QHSA 4G8JA 3DB2A 4J07A 4CM1A 1PGNA 1Q7EA 3OZUA 1E2LA 2DWOA 4JJ7A 4JNCA 1PFGA 2WSSD 1BVUA 2E48A 2F3RA 3COYA 4HWTA 2WNSA 4RETA 4WEQA 4AY5A 3ADCA 1X0VA 2PY6A 4TXNA 2VF4X 3BGIA 4MW1A 1XTQA 1P0IA 1MP0A 2XF8A 4HB4A 4KO4S 3ZKAA 4BNVA 1V39A 3B9BA 5LB2A 5MN6A 4C6SA 2QYSA 5HNKA 3B1YA 3WYEA 4TYWA 1S2DA 5KSPA 2CF6A 4BLRA 1N8TA 5LU8A 2R1VB 2CMKA 3TTWA 1QBGA 4YRZA 4YRQA 2Y0CA 2W2XA 4FFOA 2BH9A 4KKVA 1ZGJA 4I6EA 1KH1A 2CFSA 2PKEA 3BE5A 3EXFA 1ORTA 4RPLA 1ONOA 3OQIA 2CLHB 3BMNA 4DLRA 1JL3A 3SHFA 2Z4SA 1ONPA 2J5RA 3UWKA 3TRKA 1S2OA 3WHKA 4AJ4A 1BE1A 1DV1A 1KSHA 4HH1A 1YXMA 3LG2A 4OPMA 1Z5OA 2Q49A 4X1KA 4OP3A 3ESYA 2K7FA 4IP0A 1XNQB 4OBEA 1PFUA 4FYVA 4B3JA 4V03A 1XZBA 4P4GA 1R8YA 1C3OB 1FQOA 3BH6A 3NM4A 4DKXA 3AIKA 3AFGA 3LAWA 4IXDA 2H5JA 3IRVA 3PK0A 2CNKA 1YVDA 3Q3IA 3PEFA 5J63A 4ZVTA 1XZKA 3LD9A 4F6LA 4DC9A 1OBOA 3LX5A 4I1VA 8GPBA 2ZYHA 2FZKA 3EJ6A 3RRXA 1I3CA 3JVDA 3H6KA 1OU0A 3CR8A 3H1FA 5H7XA 2A0YA 3CU5A 5BN3B 1LRLA 1KHTA 3P9CA 1ZSVA 1PQPA 2EQBA 4MVCA 4ZO4A 1JMVA 1XWIA 1NVDA 4F9FA 2UXDB 2X3YA 2I3BA 1X7YB 3LT5A 1XN4A 3FKJA 4RXTA 3QWFA 4LKRA 4AJ9A 3J7AC 1SBIA 2BI4A 2Z5FA 2Q6VA 3B5JA 3VGPA 1MJHA 4IFBA 1OWLA 4H15A 4LAFA 4OCZA 2ECPA 4MWSA 2XZDA 4JQCA 5F12A 5ED4A 3K8YA 1IZZA 3LYAA 2XCLA 4ZT4A 1XKTA 2WJYA 2FGJA 4CIBA 1UZMA 4MKZA 3IV7A 2A1TR 1AK9A 1YRWA 1H2XA 2BM1A 1VSUA 3IVGA 2NNWB 2OYCA 3KYIB 3DVAA 4AWXA 4BZWA 4RYDA 1CR1A 1NBIA 2FHPA 2E6KA 5FUMA 2AN4A 1E9DA 2VDJA 4JV5B 2XR1A 5DHAA 1Q50A 2Q0QA 4UCXA 3NQ41 4XR4A 1NJ5A 2GEBA 5LP6B 1WXFA 3B38A 1RP1A 1ZZGA 2FAXA 2WU4A 3MBIA 2ZWOA 1YASA 4HMQA 3GVXA 4KQEA 4LYEA 4ZEOA 2OCXA 3D4BA 2ZBRA 2R5WA 5EIHA 3KVYA 3TZQA 1FVOA 1PQ4A 3NYIA 1YJQA 1A8HA 4OSOA 3AVOA 3AHGA 4FBMA 4ZVNA 3ZE6A 2UXCB 1HKHA 2Z83A 4RKFA 1L6RA 3ILSA 5KAPA 3FPAA 1RHMA 5FNVB 4BO4A 4CU5A 4Y6QA 3GW8A 3KL2A 1MB9A 2AEEA 4RQAA 1COWA 2ANCA 2C8JA 5BQPA 3SIRA 2YKGA 2XUFA 5FWAA 1K98A 4X6XA 1T6BY 2C4WA 3UW3A 3T1NA 4MQEB 5EJGA 4V3BA 3V8EA 4WBNA 4H59A 2QT9A 2ANBA 4GU5A 2C0QA 1KFEB 4EDFA 1Z2EA 3HQ4O 3EYWA 4LGMA 4OGGA 3LCUA 3L7DA 3H17A 1Y7HA 2UKDA 2CBXA 2ZAYA 1U0HC 5J9FA 3WWEA 3Q0IA 4BGEA 2CYAA 2PGOA 4QUGA 5BR4A 2QYOA 3F5DA 4PYMA 1GO2A 1CR0A 4NQRA 1XJ5A 1KP3A 3AL3A 4MUNA 2DXIA 2I4MA 2Y67A 2A5LA 1P3JA 3TTSA 1RQRA 4DNFA 4OQ4A 2UUPA 1RXIA 2XYPA 3AR5A 4RFVA 2QNBA 1FYVA 2ZOSA 4OQNA 3I2GA 1W76A 2SKCA 3A70A 5CBKA 1LPOA 4FGLA 1ZUWA 2IPXA 5AW9A 2XNCA 1DBWA 3RLFA 3JALA 1J49A 4CKWB 1JT9A 3G5AA 4GBJA 2VVTA 2W43A 4G5QA 2P9GA 4JD5A 3NAGA 4OQYA 4F4UA 4MKRA 1LK0A 2FPWA 2JFWA 4MUGA 2J7PD 7YASA 4L51A 1AUQA 4B3TB 1XVTA 1ZUD1 1T6XA 5KKAA 3RHSA 1KY3A 3WGKA 3R9XB 2PZ8A 1ZVMA 3TQQA 1P9OA 3HFJA 4FT2A 2D0IA 2FW1A 2VQDA 2C2GA 3OZXA 3RVLA 3F2IA 3FMIA 1UFQA 2CK3A 4M6WA 4R6XA 4DADA 5ECWA 2IZ0A 4YA6A 3DGFC 3GPBA 1FNMA 3DM5A 1LRJA 3X1WA 4KFCA 4E5MA 3T95A 1XZEA 3O95A 1OLXB 3MC1A 2HO5A 3QXSA 4I2VA 5H3LA 3H11A 1IU9A 3C5VA 2WIAA 3ITKA 3M1IA 4QU8A 1R4MB 1Y98A 4FGJA 5D6OA 3AQ4A 3FYUA 2XUGA 2P9QA 2P78A 3Q4GA 4V38A 3UIEA 4ZTUB 1JF8A 1GZ4A 3AVYA 4GKAA 1EGVB 5EHQA 3L0ZA 2Y6VA 4AYWA 2B4KA 3IX7A 1O03A 2YNMC 1H6BA 1BXRB 1A9TA 3ZU6A 1MJNA 1V26A 2TYSB 4KZPA 4AQDA 4LXYA 2KJQA 1KS9A 2JANA 3DEHA 4RDCA 2G71A 5CA1F 3U56A 5TJHA 2JJ2A 3EDMA 3H2JA 4YLEA 4CZ2A 4J7UA 4ZMBA 4Y0AA 3WBJA 1BX0A 2DPXA 3AETA 3GWGA 3HDYA 5D3MA 3KB6A 4DBLC 1SXPA 3A36A 4N5NA 5TQ2B 3Q8KA 1VHDA 1DX4A 4WXPA 1LV7A 2E0IA 3KEGA 5EZYB 5HG0A 4R9VA 3TKLA 2Q9UA 3ZW7A 4N12A 4JT9A 1XL1A 2NN3C 4U2FA 3PWTA 4EY5A 3KKPA 4R84A 1B6TA 3UMJA 2YHBA 4LWZA 1D8TA 1T1RA 2NSHA 3AR2A 4EKEA 2HCTA 3IFSA 2P2DA 3RREA 3QNWA 4DANA 3SR0A 1G7TA 3THWB 1P9RA 1W46A 3UICA 3C24A 1P62B 2Y93A 3GUVA 3RJTA 3ZDFA 4D9FA 5JADA 1EXVA 3TECE 1KOGA 4G8BA 1Z34A 2PZAA 3N6XA 3WL3A 4TSFA 3IBTA 3QLEA 3SZMA 5FH9A 2BGUA 4AROA 1KOFA 1SVMA 2NZUG 1H9AA 1KK3A 1KS2A 4LFAB 2G5GX 3PFKA 4EKYA 1PGPA 4Z0HO 1DTWA 4X6YA 4ES6A 5A6SA 2WUGA 2V54A 2OTCA 3R40A 2EEPA 3DMRA 2QXUA 3PGKA 1SUDA 2J5BA 2HCFA 8MHTA 2YICA 2FFJA 4D81A 1OHHD 5HVNA 3PE4A 2BZSA 2EWMA 3VQTA 1NRXA 4LRQA 3GLTA 1P9WA 3T35A 4Q4CA 3PA6A 2UYHA 3CJRA 4UTNA 1A3CA 2PLFA 4IFTA 1NW4A 3AOEA 4Q34A 4IW3B 3QYFA 3OT1B 2J8ZA 4HO1X 3QNUA 5JS2A 7REQB 2WVGA 3FFTA 3GEBA 4FI3C 4BVAA 3NATA 3B20A 2G1KA 5EWJA 5TGDA 1M75A 2A9FA 3H2BA 5CLQA 1HM5A 1UXOA 4G5OA 3TTVA 1X13A 4HQ0A 4M1KA 1FTYA 4YJKA 4CUKA 1G19A 2BFPA 2LCIA 4A7PA 3V8MA 1G60A 4TTVA 1Z74A 2ZAGA 4KBGA 1H6CA 3D3WA 4KQ2A 1A9RA 1YC5A 2C04A 5E1DA 4UNRA 3B9PA 3AUKA 1ZD3A 1E5TA 2FMIA 1CS4C 5FWDA 3BRWD 2YHIA 4GVLA 4OB6A 4EJ6A 5LP6F 1U4OA 2CCGA 3LRTA 4ZOLA 4LZOA 1G8YA 2QM3A 1MABA 3THOA 2GPSA 3M6MD 5IM4F 1NZJA 3QFRA 2FB9A 4FZRA 4Y9SA 4A8JC 3UHPA 1K8YB 2WOOA 4N7JA 4QBGB 5IAJA 4C89A 2O7QA 3CF0A 3O8DA 5DN9A 4ZV4A 2CLIB 3OFKA 2F43A 1ZPDA 5AYVA 2B69A 3RVSA 1OLSB 4UJ5A 2YUIA 4NJEA 1SB9A 3HC7A 5AMXA 4I46A 4YREA 1E3QA 2F3SA 3BMCA 3QTTA 1BMQA 5DLDA 3MILA 1CK4A 4QYSA 5FBHA 5J40A 1OX6A 3GWZA 4DM4A 2ZUUA 4HLQB 3GT3A 4LDRA 4L78A 4G0ZA 4HRVA 4QFDA 3PGVA 1JU4A 2AUNA 2C4UA 2I2CA 4CLXA 2E5LB 3C7AA 1BRMA 3RUPA 2PH7A 1GG5A 3L0IB 3UAGA 1TQHA 3V8PA 2DQSA 4RZUA 3WGZA 1FFSA 1QKJA 4DLTA 1G8SA 4QU5A 3RDPA 5L3QA 2G07A 2F3QA 3GLHB 5FOWA 1V16B 2IWRA 3C3PA 1VHLA 2DKFA 1C8BA 2PXAA 3FVRA 1ACMA 4TWJA 2HV9A 2IE8A 5K3SA 3KJEA 4WBNF 5C1IA 3IT0A 4HQOA 4FHFA 3T1QA 3ZGLA 1NVMB 3UJ8A 2HK8A 5ALVA 4MJ7A 5ECGC 4JDPA 1QKIA 5EZ6B 1Q20A 3S5UA 3IUSA 3NNSA 4IZ6A 2O8BB 2HK7A 2IZZA 2IIVA 3H5WA 4WN9B 4RGBA 4ARBA 2QTFA 3O4RA 2VSOA 5FPHA 3HPQA 4JB0A 1S8AA 4AO8A 1DC8A 1PJ4A 3T8YA 3U16A 5BSKA 4O3MA 3NO4A 4X44A 4I55B 5KWEA 3ZQKA 2XT6A 3BRCA 4B73A 4BP9A 1WCV1 3M5DA 4OQFA 4QUHA 4EHIA 4FCVA 2HPZA 3AU8A 3O47A 2YX1A 3GY0A 4PTLA 2AQ8A 3AR3A 3LGXA 5EJ7A 1TC2A 3PFHA 3GR6A 1IEWA 5EMKA 3VR6H 5IH3A 5BWOA 1OKKA 1ZBQA 3C43A 3D2LA 1IPFA 4XQCA 3SS7X 3VR3A 3RD5A 2WYWA 1I5OA 3ISTA 2PSSA 4KL8S 1LXCA 1XDUA 1DEKA 3NHUA 1X3SA 4GE3A 4BKOA 1J42A 2QT0A 3MTIA 3W6OA 4X62B 1YB7A 1Q57A 2I7TA 1K4KA 3EVZA 4KDRA 2X0JA 2CYCA 5KOHB 2GM4A 4IAOA 5L45A 3KQVA 4BQRA 3F73A 1LKZA 3O91A 1RVV1 2BMDA 2N1MA 4N0PA 2XVMA 2RIPA 4MARA 4Z9YA 1UBOS 5M04A 1RLMA 5B12A 2GN8A 4RYLA 5IT4A 1YQWA 3KQLA 3ZDEA 1D04A 3ZIAD 3ACBA 5SYMA 3WL7A 3A0UA 4HDQB 5K3AA 1ZKMA 1ZOSA 2BGRA 2EIXA 2H1LA 2DB3A 1O94C 4RPGA 4MW7A 3OUTA 2V7GA 2CFTA 4QYTA 3SQWA 2I4OA 4RA6A 5CJ2A 1NOJA 4ZJUA 2YVAA 1UBTS 1MHPA 3VHXB 3PI7A 1JXQA 3VJMA 1L4BA 4MIKA 1CEEA 3DDCA 5H83A 1CUUA 2G0TA 3OOEA 4AC9A 1ODSA 2G9VA 2HWUA 4P6VF 5K03A 3PTAA 4WLFA 2HPAA 3G9QA 1KTIA 2K5UA 2XH8A 2Z2IA 2JGDB 1ZMXA 4Q3DA 2EFCB 3MSCA 4TKVB 2NUPB 4Y2HA 2F62A 4KXXA 2UZ1B 5JNRA 3V7YA 5JWOA 1Y9JA 5LKAA 3TMYA 5LQAA 1BYUA 3JQ9C 4ITUA 1KAOA 2JCSA 3IEUA 3DEJA 3IXMA 1CY4A 1D2NA 3P4YA 1PR1A 4GHWA 2D13A 3DBHB 4H4DA 4PXYA 4F3TA 2RGWA 1YL5A 1C3LA 4BFCA 5F2OA 3PT9A 1D1SA 1R0YA 4GXTA 4LX8A 5ADUS 1KFJB 1OV6A 4NZ9A 4JLOA 5CH8A 1F8YA 4MV8A 2HHCA 3W6PA 1VMDA 1XDZA 4IIJB 3KQYA 3OC6A 3DZIA 3N2KB 5A4MS 4Z3DA 4TKVA 2QAGA 3V8BA 1HORA 3SAJA 5FJJA 1GQSA 3OLCX 2GRUA 1QRSA 3W8DA 2CLFB 1KZ7B 2EJVA 2SECE 3F78A 1G1AA 1MX5A 3EG9A 2O2ZA 3QA3E 5AJXA 4TGLA 2HMSA 4JHXA 5EPOA 5AM3A 2PSFA 5FDFA 1NG9A 1LPAB 1NVWQ 5KWVA 2DWUA 4XGIA 1U90A 4PFKA 4QUAA 4S1PA 2ZR8A 4PG6A 3OICA 5CPBA 5CVEA 3ZY5A 4CI9A 4D8YA 3GLGA 3OMLA 5ICFA 3RJZA 3CUVA 5DW3A 2C9OA 2ICAA 1QG6A 1K0UA 4HH0A 5DK6A 5FBZA 3AR6A 3I04M 3HYTA 1Z2PX 4FYIA 2C54A 2QTVB 4B8YA 2C2KA 1KC3A 3DCNA 5GJBA 3IPCA 3E53A 5ER6A 2O2CA 4LFBB 4XPIB 2VPQA 2ZK7A 4XWKA 3JAWA 4KKXB 3F3SA 1ULAA 4OSPA 4RA9B 1GKKA 5DYNA 4D8WA 1DQRA 3B52X 4OHYA 1SKQA 4HXYA 2CDCA 1SG6A 1P0MA 2QENA 1T1GA 3DA8A 5A71A 3LK7A 4Q4JB 4Y7DA 1VSBA 4WL0A 3C3YA 2Y0PA 5GONB 1Y6JA 3AFHA 5D51S 2RGGA 5CD1A 1EK2A 3IMFA 1M8GA 4W63A 4ALMA 1YRQA 3OQVA 1E1KA 1JH8A 1HT1E 1NVAA 4MCHA 4X91A 1G21A 4N76A 1NQTA 3AU9A 1AZTA 4IV0A 1EE1A 1WHTB 2OV6A 1OLUA 1QIFA 2G72A 4LJ7A 4N0DA 3FSJX 1V5EA 1MNQA 4PG7A 4UE3S 5CX1B 4Q3KA 3N2EA 5JNUA 1V7QA 3I32A 1QH1A 4PLTA 3CNOA 2G0AA 5FTJA 1LEHA 1AHIA 3U7GA 4IKPA 4ZMSA 1UJ2A 3F71A 2OCGA 4ACBA 5LQUA 1GCGA 3PGA1 4F12A 1OC4A 1SC4A 1ZD2P 3M82A 4K9RA 4GOLD 4X95A 4HFRA 1UK8A 1LS6A 2EDCA 2JFZA 2ZQYA 1CF9A 1S3FA 3QENA 5D7BA 2F8SA 3JTEA 3LHKA 4XB1A 5B64A 1XXLA 1KKUA 2EKLA 2RCNA 4MQ5A 4WVFA 3H5TA 3UHFA 1QQ6A 3CRNA 4IQFA 1EX9A 3BXHA 4YUYA 2IXEA 4GD3Q 3L82B 1K3FA 3DJYA 3H42B 4V2IA 2P9CA 2OEPA 4AULA 1BTOA 3WWYA 1NXOA 3LP5A 1E1QD 3I45A 2FSVA 3AX6A 4HKTA 4TTAA 3E27A 4HTFB 2I7CA 1WMEA 2NUAB 1KO5A 1I13A 2SNIE 5KNDA 5HRAA 1Z68A 3RTGA 1NDUA 4F8JA 2I67A 3G0BA 3OFNA 3T5MA 5EPEA 4EYOA 2OXEA 4EF6A 1H2YA 4FWIB 1ELOA 2MJLA 4LY6A 3EX7C 3DMTA 5DCYA 1KKLA 1OT3A 1SVOA 2IHTA 3MINB 3Q9UA 5T57A 5H8WA 1RYHA 2FSHA 3PGLA 3KVOA 1TE2A 4NZZA 2PYDA 3T99A 2BF4A 1IY1A 3HRHA 3W2EA 2TRSB 3GDOA 1SPBS 5C18A 1FFXA 1TKBA 3RFXA 4RMGA 2KHZA 3UHOA 3VVBA 4DG5A 2JI9A 2NQ8A 5K1ZA 1X74A 1BN6A 5CDHA 4D25A 4WZZA 1NQAO 4UVGA 2XB9A 3BTUA 2UUBB 3OO1A 2WEKA 1VPLA 2YXLA 4A2PA 4C78A 3U4QB 3S99A 4ZOCA 1ZI9A 3OTHA 4OHCA 1KI2A 4P4SB 2XTZA 3GYGA 1T13A 3GA5A 4Z4EA 5I51A 1F6BA 1T0JB 3K72B 1XDBA 1S6YA 3FOEC 2QZPA 2B83A 4K9NA 1GPNA 4W1PA 5IAGA 5HKKD 1QHIA 3GJ0A 2UVPB 3KIPA 5DNYB 3GGGA 5CXXA 1WOMA 5THQA 3RTEA 3WRYA 2PRJA 1LW7A 4EYQA 1FS6A 1XVVA 3N1UA 4GEKA 5CVVA 3ZNQA 4GX1A 2NO6A 4I81A 2AMLA 4IX1A 4LHWA 5HKLA 4KRFA 1NBWB 1CUZA 1NDQA 3BE8A 4KQIA 3RAEC 4J9UE 4ZEVA 1MO3A 4OJKA 4DFDA 3MT8A 2CVPA 1JMYA 2JGRA 2XRYA 1KZ9A 5M29A 4YGYA 4MAAA 4I9NA 1J97A 2CHUA 2H8KA 3DZDA 4JVOA 5CDFA 2QRNA 4CODB 1I10A 3CURA 4FZ5A 3K9CA 4OL9A 4UU1A 5EP1A 2HO4A 4I3GA 4PPNA 2QV7A 1NHWA 2HLNA 2GPBA 4MWEA 5BVGA 3W1WA 3UJ6A 3CH4B 2J0SA 4HNTA 4BWYA 1OXKB 2BMJA 4NDAA 1KYWA 3AZPA 4A6DA 1WMDA 5DP2A 3DUFA 4LNAA 3DTVB 3GUZA 3OM8A 1EQ2A 2ZPUA 4II7A 4M9UA 1ECCA 3F6CA 2QKYA 1RQXA 2IW3A 2LUOA 2VC2B 4DJDC 1OLSA 2VZEA 4KLZA 3UEOA 2AS0A 4JX9A 4JVMA 3DFFA 3UH0A 4C4TA 1I6MA 1TVEA 1JSXA 2FZEA 5FIUA 3R9XA 1SZJG 2NTEA 3DO5A 1VBNA 2X86A 5B1EA 4Q9HA 1R12A 3PFBA 4UNQA 6ADHA 1ADBA 3JZIA 3LCMA 5K05A 4NFSA 3A7EA 4AW9A 1MIOB 4M1QA 1U0TA 1XA4A 2PO5A 4LV8B 4C6TA 1NN1A 1TI7A 4E94A 1ISSA 1DB3A 3R20A 1M8KA 3LCJA 2YFYA 4RVFA 4GR9A 2VPXA 5A0VA 4XASA 5JS6A 1J7JA 2VDWB 5B6JA 2O2EA 2RDMA 3E03A 3KR1A 1A82A 2D5CA 3E7DA 3RQSA 2IE0A 4TT3D 4JOBA 2Q3EA 1WZEA 3BMQA 4YJFB 2QMZA 1LY1A 3G79A 4D74A 1Y5LA 1MIOA 3DOJA 3KKOA 5BWMA 1GTRA 1CUFA 4DRXB 3OQJA 3UA4A 1KI7A 1YB1A 5A4DA 1G8GA 5DHQA 3LUAA 4NS4A 5DLQC 5CFPA 1T2AA 4NQZA 4TTSA 2R8OA 1X1DA 4Q48A 2PDAA 1UL1X 4WGFA 6NULA 1YKGA 4UUOA 3JW8A 3F2VA 4AO6A 2V5VA 4HMOA 5J2UB 4JKOA 2XPCA 4Q9KA 3LUDA 3WDSA 1AMUA 1N6HA 1RE1A 1NF3A 2AR9A 2XMSA 3ND5A 1X92A 3B1JA 3IEKA 4MKGA 4D0GA 3GLFE 1B0ZA 3GLFB 1ENPA 2VDQB 5I7EA 5BNWA 4M0KA 3BIOA 4B74A 5LMZA 4FU0A 1IXYA 4YMSA 2FPSA 2MINB 3PXGA 3DYIA 4LV6A 4Q0MA 2XVZA 3K8ZA 2RJNA 4BO8A 3C14C 3MGKA 3RRBA 1ZGGA 4Q93A 1GPDG 2J9RA 2OAGA 3ICVA 3NGXA 2OCBA 3K16A 3T3EA 2GZMA 3ZPXA 4CTKA 4EEKA 1RLOA 1EHYA 3TAUA 4ZGWA 3Q8LA 1CB0A 1G3MA 2GCOA 4IJUA 1UUFA 1T8SA 3ONEA 4L7VA 4DV0B 1HDOA 3THYA 4DBVO 3ASUA 4JJ8A 3HKEB 2ZXUA 1EDOA 4F38A 1FL9A 3RFTA 5KOYA 1DU4A 1OZGA 1PGQA 3HU2A 3KKZA 3QV2A 2XE4A 1DL5A 1PYOA 3TZLA 2GOYA 1QP4A 5CLIA 3IXQA 5JDCC 3ZV7A 1AV7A 4FYPA 3SVLA 4QREA 4JQZA 2D2IA 4N1AA 3AI3A 3H5VA 1O6BA 3Q9LA 1SXJC 3X2SA 1DCFA 2JJ1D 3QVOA 1OX5A 5GGYA 3OD5A 1CNFA 1QR2A 1AB5A 5BNFA 5L51A 1PUXA 3AF2A 3LQYA 3VDNB 2X9GA 3TLYA 1U94A 2XGJA 1T9CA 4DSTA 5DM1A 2JGDA 4B8ZA 4DN6A 1TJ5A 2C83A 3OHPA 4IDAA 1A1VA 1ND5A 3ANMA 4IS2A 5D3KA 3O3MB 3OX4A 5L53A 4MRNA 5JAZA 2Y1LA 1QK3A 2IQIA 2YC2C 1Z39A 1VPEA 4HR7A 2QUAA 4ND6A 4ZVKA 4D79A 2AZXA 1GRVA 2AFIB 4HNAA 3GHYA 2II6A 4IF6A 4GI3A 2QXTA 4MDHA 3UC9A 3UJAA 3WKEA 1W88A 3TRIA 1Y81A 3O4VA 2PUJA 2X6RA 2FMFA 3HVRA 4W9MC 1WLSA 4YCNA 3PFFA 4MV4A 1J0AA 1NI3A 5AKLA 2JI6A 3I2IA 3ICEA 1A98A 3ZEIA 2D2FA 1UM8A 1EJ2A 5BUZA 1LCIA 1EP9A 4TS1A 1B7GO 3OQNA 4RMNA 3BQMB 4CEIB 2FW9A 3PNKA 5JPCA 1NMYA 1UOQA 3RRNA 1Y4SA 5FWYA 1YK1A 1WMBA 2FFBA 1N5OX 3C8UA 2ORIA 3V32A 3KVRA 3EFEA 4R7GA 2NUTA 3U9LA 4DQDA 4TN1A 2H5EA 4RTMA 2QQEA 2XLBA 4AS3A 1GN8A 4QAQA 4E7PA 2Z2XA 2KI5A 3SM9A 4DTCA 4LMBA 5K3EA 1CQXA 1JKIA 2GK4A 3IALA 3PUYA 1PYDA 4G25A 2OBNA 1C81A 2QMUA 2ZWMA 2VT2A 2DSTA 4QJ4A 3O83A 2J7KA 3HL0A 2IX9A 3JARA 4M89A 1JA0A 2ACKA 1M34E 2XWSA 2QSYA 4M8NE 4Q9JA 4RM2A 5JEDA 2DECA 2NT4A 2ZE7A 2AA3A 4X1KB 3L8FA 1MXHA 3L8ZA 1H2WA 2HLPA 4Y6GB 3KJHA 3H6HA 3ZE2B 1DS6A 2YV1A 4Z4HA 2IH5A 1RC8A 1X3LA 1JECA 2L69A 4KGVA 1AVTA 2W8ZA 1JBKA 2JZNA 4FFMA 4YVFA 5JD6A 3H2KA 3DDZX 2VQSA 4BNIA 3IQFA 2Z6UA 1A4XA 4PTYA 3KS9A 4YV1A 4IYRA 1P2GA 4RDHA 1SXIA 1D7AA 1Z29A 3KJXA 3E8XA 3B13B 3HHPA 3D1VA 3MCAA 4C1BA 3RYHB 2ET6A 4BFZA 2BEUB 4XIJA 5IS2A 2MSNA 4RAOA 4RPJA 1DLIA 1XTIA 2QW1A 3SC2B 1X9HA 4BQQA 5KUTA 1JP7A 1LA2A 5DVZA 3ESZA 4R41A 1QIGA 3EAQA 4FMDB 4DEXA 3EH2A 5LMCA 3RIYA 1TAUA 1XR3A 2PFSA 4EB6A 4LCJA 2W98A 3G2JA 1P2DA 1ODTC 1VYVA 3G9XA 2QRKA 1E69A 3C8MA 4Q7JB 4UBOA 5LA6A 1HOTA 3TZEA 3WX0A 1XELA 1B0PA 5JCXA 4KLRA 1KDYA 2JFQA 3JYOA 3VR2D 4G0UA 4ROSA 3L6CA 3CZMA 2BGGA 2P6RA 2X7JA 2QQFA 4G37A 3TF5A 4LFCB 3O4HA 4EGAA 1GTG1 2WAXA 4GLLA 1JG4A 5C9ZA 1PTKA 2I7XA 3QI7A 3KPYA 3RU7A 1CERA 1WPGA 1YQTA 3EJWA 3Q5EA 4TLMB 1ZR4A 3NANA 3IUNA 3EVAA 3UPTA 5GVRA 4YCSA 1MLDA 2XMGA 3LFTA 3MELA 5H9VA 4EB6B 3ROZA 1ULHA 1LPMA 2CDRA 5F1KA 4IIHA 2G17A 5FPTA 4GX2A 4ECAA 3DF9A 5J4KA 1FRVA 5CNIA 1OUMA 1HYGA 2WPNA 3ND7A 5JZVA 3DE1X 4ZYYA 1R4ZA 2WSMA 1M7GA 3JU3A 4ERXA 4C4RA 1T5BA 3GD5A 2HQBA 3AUAA 3MCUA 4JASB 5C37A 4EEXA 5K6AA 3NZEA 3DONA 1OXSC 3LCRA 3TI7A 4CIVA 2NYUA 4JT4A 3HUTA 4OQEA 1C1YA 2DRIA 2OMEA 4RKWA 3B48A 3TNDA 5KQLA 2WVHA 2FSSA 3WBFA 4JP2A 1TTPB 2J87A 3A32A 1FRFS 3EARA 3IKTA 2Q5HA 4CBVA 4M8SA 3NTVA 2JFOA 1PG2A 3EBLA 4BFTA 3GRYA 1OH8A 5CG1A 1Y89A 4Q9AA 3N59A 5TEVA 2WHYA 4MVYA 3SMQA 2D8AA 4G63A 3HFRA 3W2TA 4BLVA 1L7NA 2ZITA 3KEFA 4WADA 3EOBI 1SCUB 2X0EA 5I7VA 1BMFA 5IXSA 1ADGA 3EF0A 5JVDF 3WAJA 2C7OA 5HFNA 1EFPB 1WB6A 3T7RA 4FCWA 5TXGA 3QELB 3IEPA 1KARA 1RLJA 1N5RA 1GXSA 4LOKA 2P1DA 3S4YA 5G41A 2HYDA 1JHAA 1RRMA 4D41A 1E1LA 4PBSA 3UB4A 2C8KA 1LDMA 1ISJA 1X7WB 1VA4A 2VL7A 3PQFA 1DEXA 2E6UX 4OHFA 4EUEA 5FOQA 3M1AA 2QLMA 1DBPA 2J3HA 2QGNA 4O2AA 4TYQA 3ASZA 4ZU1X 4DB4A 2D7CA 2F17A 4CMIA 2JBWA 1AH2A 4EG4A 1C7FA 2KX7A 3I64A 5BOSB 1CZHA 2AJCA 5A0TA 1PTJC 5G0UA 1K4YA 5AM2A 2GPAA 5H5JA 4I8DA 4L6CA 1BWPA 3MCVA 3PWKA 4MZXA 5IHXA 3LUHA 3NYWA 3GPLA 1FNBA 3R8CA 1EGQA 3KR9A 1CEQA 4W1SA 3O8NA 4D9MA 1KI1A 2GEVA 1JIVA 1GL6A 1X7XA 3CE9A 4IO0A 5CHEA 5EP2A 5KSOA 1B43A 4UBIA 4E14A 2PJDA 1DKNA 1IJEA 3NDJA 3AUJB 4HNHA 4XYMA 2VA9A 3FG9A 5AW1A 2N3ZA 2AJ8A 1YVUA 4GVPA 3TO5A 4A4DA 2R9VA 4KOEC 3TL2A 3HN2A 1W36B 2EFYA 1TM7E 1Z6TA 3F7MA 4JAVC 4RK4A 4U2EA 3RIXA 3SHOA 2I8CA 4MWOA 5G1OA 4C0SA 4NABA 1DKMA 4KHZA 5IM5A 4PR3A 1X8XA 5EIFA 5CDUA 2WD7A 4CIYA 2PZLA 1UIRA 2WJZB 2XMBA 5T41A 4U9UA 4XX0A 4MWCA 3F46A 1CB7A 4JLAA 4IDPA 5ITWA 2VTBA 1R5OA 4UARA 1AQYA 1R8XA 4WN3A 4D8TA 1R7RA 5F4BA 1ZFNA 3OIVA 1E94E 1CZUA 4CFSA 5ICMA 1N2HA 3LOUA 2R5FA 1KRXA 1HT0A 1PL7A 2ATEA 3IPAA 4K6CA 3S2FA 4J7CA 2HJSA 1M72A 1TZMA 1IUNA 2QP4A 3HCCA 2A7XA 3GEHA 4KQWA 5E4FA 4TQ9A 2VBCA 4OAQA 2E4YA 4Q39A 1II8A 1UZUA 3E8MA 1ZKDA 2ZBGA 3HN7A 4DLUA 3E3AA 3K20A 4U00A 2HA5A 2BKEA 1Y33E 3RVMA 3TK1A 4D5GA 5JFOA 1MA0A 2GN4A 4S05A 3OP4A 1AKEA 1R0XA 2FZVA 5I9LA 2PR7A 4UAVA 5CNKA 3KZCA 2ZJ0A 1XD2B 1XXHA 2PKWA 3ONDA 4L85A 4PRZA 3WY9A 2JAQA 4U2GA 3L07A 3O7MA 5JH7B 4M55A 3KAQA 4OQXA 2OWDA 3NWBA 1DI0A 1LUAA 1ULUA 1Z8HA 3BJEA 3L7MA 4FSDA 4QXAA 5DSXA 2QNRA 5IH7A 1C9YA 4EI7A 1JSCA 2W70A 1OBVA 2I33A 3K0FA 3C98A 5TIIA 3NM6B 4XUCA 4ASUD 1K06A 1R9NA 1SIOA 5FOVA 1O95A 4L27A 2VJAA 3Q7QA 2FMXA 1VLMA 2JLZA 4CR7A 3SKXA 2VRWA 1PLKA 2X42A 3HKCA 1BOFA 1QM5A 3DWFA 3CZ5A 2J46A 3OKAA 4X66B 1WUJS 1Y8ZA 2J6BA 4R81A 3REOA 3SC4A 2RH8A 2P2NA 4BMVA 4MUIA 1HBJA 3ZY6A 2NP6A 4MPJA 3EMKA 1J20A 1QRDA 4Q9IA 3ZK7A 2WI8A 2GD6A 2D2VA