4UNSA

Mtb tmk in complex with compound 40
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
209
structure length
186
Chain Sequence
MLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAEDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure Guided Lead Generation for M. Tuberculosis Thymidylate Kinase (Mtb Tmk): Discovery of 3-Cyanopyridone and 1,6-Naphthyridin-2-One as Potent Inhibitors.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
molecule keywords THYMIDYLATE KINASE
total genus 71
structure length 186
sequence length 209
chains with identical sequence B
ec nomenclature ec 2.7.4.9: dTMP kinase.
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02223 Thymidylate_kin Thymidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4unsA00
4DSTA 721PA 2ZSEA 2QRZA 3KXKA 2ZSDA 2R65A 2RB4A 1R0YA 2ZU6A 1CR1A 1RYFA 4Q9LA 2XGJA 3PITA 2R8RA 2OXCA 4C0JA 4RD4A 2KJQA 2ZIAA 2QORA 3X1DA 3QSYA 3WRXC 2IA5A 1WCV1 2ZJBA 3KL4A 5ELXA 3EZ7A 2JIZD 3SHFA 1IN5A 4I81A 3H0KA 2OESA 3QY0A 2OLJA 4MYCA 3H2YA 4BFTA 4CDGA 3ADDA 4L9WA 4KAXA 4TLBA 3BH6A 3U3MA 3F3YA 4CYMA 2UKDA 4X8MA 1SVWA 2BVNA 2NPIA 5TY0A 1P61B 3SOPA 3H84A 5GVSA 1OB5A 3A4MA 1MH1A 1SVIA 3B1WA 4YONB 2OFXA 2VP6A 4GL2A 1P2UA 1QVRA 1E2MA 1KO4A 2BHRA 2GXSA 4LJAA 2QNRA 4B3DA 4AYWA 3R9WA 3HJNA 2XJ9A 1F2UB 4PC2A 1W4RA 2IS6A 1P72A 2IYUA 3CNNA 4I99A 1NG9A 1WA5A 3LVQE 3OE7A 3OZXA 4EKDA 3W34A 5KSZA 1G4AE 3CRVA 2F9MA 3EIQA 4JKIA 2EFGA 4AI6A 3GMTA 1NMZA 2D4HA 4G0NA 3SJBA 2QZ4A 4JBYA 3B85A 4LCBA 1GTVA 4B2IA 4GP7A 3SU8A 3TE6A 4O3MA 2NG1A 3MLEA 4MYTA 4EFLA 1B0UA 1NN5A 2H8KA 2VTKA 1AIPA 1GL7A 3LD9A 2GZDA 1AQYA 1JBKA 1HYQA 4ZI3A 4PPGA 5H1YA 2IS2A 2GEDA 3UPUA 4MGYR 3RS4A 4F93B 3UKDA 4LOAA 1RRPA 4B3GA 2WV9A 4S35A 3PFIA 3QG5A 2OV2A 1QZXA 1KMHB 1IN6A 1E96A 2FNAA 4V0ME 1RE0A 1Z0AA 2FDCA 1E9EA 4R71A 4V0KA 4BQSA 1N6IA 2ODWA 3I4LA 1WF3A 2IF0A 5F2EA 3K9LA 1LY1A 4HB2A 2Q6TA 4YMUA 3BAFA 1TPZA 3FPAA 2AR7A 2WJYA 4AG6A 3QBTA 1RIFA 5G3YA 3I5XA 3EPJA 1HH4A 3K0FB 2HYDA 2NO7A 5FPHA 1G16A 4US2R 2ODNA 1MO4A 4PHFA 4A2QA 3IBYA 3RS7A 4V03A 3FHCB 4LJYA 1HV8A 2OCAA 3W3AA 1KJZA 3UXMA 1QBKC 1TTTA 2KB0A 2XTMA 1D5CA 2AX4A 3S1AB 1RFLA 3I1FA 4NCKA 5EE3A 1H8HA 2YINC 1KI9A 1Q20A 4LJ6A 2QTHA 3IILA 1OF1A 4Y0AA 1QRAA 2G0TA 3FGNA 2DWOA 1UM8A 2F3RA 2GZHA 3IQWA 5FH9A 4EJSB 2JJ2D 3LRPA 1T8UA 2IS4A 1J7KA 4NYJQ 3O8CA 2IUTA 3QXHA 4Q47A 5JMTA 1DAGA 5G3ZA 3NVAA 5HTKA 5FOVA 1FX0A 2JLYA 5DO9A 3ASYA 1XXHE 1E6CA 2PT5A 3JVVA 1TF7A 4TTPA 3U2QA 5CDFE 4URVR 2ZXUA 1PJRA 1UBCA 3CF2A 5EP1A 2J0UB 2P5SA 4BFZA 2WJHA 3BRWD 4JJKA 2PZGA 3PUYA 2HDNB 4J0QA 4XVUA 4FI3C 2GCPA 2F6RA 3THOA 1P6XA 1G8YA 4M1WA 1EFHA 5LB4A 1T3LA 1KO1A 2O8EB 1W48A 1IJFA 1CJKC 1S4QA 1Z28A 3K0SA 1E2HA 2IYWA 3BERA 3TAHA 3D8BA 3ZIAA 2PL3A 821PA 3UATA 1Z0IA 3B8HA 1MOZA 5L3SB 4KBFA 4XD7D 1L8QA 2QE7A 4C3ZA 1E0JA 421PA 2FX3A 2A78A 2QU8A 4E07A 2AD1A 3UWOA 1WBBA 1XEWY 1S1MA 2ZJ2A 4QOSA 3WP0A 5JJLA 1ZNZA 3K0CA 4PC6A 4OI1A 4PZLA 2O0KA 2V1UA 2HXSA 2BCGY 3RC8A 2GVZC 2ZVQX 4FW9A 4A4DA 2A5JA 4N3NA 3KFXA 4KO8A 4B75A 5DYIA 3CRQA 4TMKA 5EXPA 2LWIA 3RS5A 5AUQA 4YLGA 1KYIA 1TF2A 3VR6A 4LPSA 4QBFA 5DH9A 1C9KA 5UKDA 5FI0B 3FE2A 1KNXA 1T9HA 1J2JA 1JQJC 3CWZA 3QNUA 4MGIR 3KB2A 1DO0A 1LF5A 5GVRA 2DFTA 4OI0A 4CEJA 5JWOA 4UJ5A 1UAAA 1GKUB 5B2ZA 4PANA 4CF7A 4F4IA 1E2FA 4NYMQ 2ZJ5A 5DN6A 1E9AA 2IYLD 1XTSA 2WZQA 4KXFB 1DE0A 4GBMA 3U3RA 1IJEA 1P60A 3KX2A 5A4JA 3TSWA 4LV8B 1Z0DA 1E9FA 1Z47A 2Y8EA 3O47A 3GLIE 1G17A 3L43A 2VH5R 3HU3A 1FNMA 5CLQA 3RRYA 1IBRA 3QVVA 4IJMA 1G4UR 1ZNXA 1TF5A 5KSYA 5A5GA 3E2IA 1T5IA 3SN6A 4Z1MD 5TB5A 1OB2A 5IK2A 3CH5A 2FOLA 3B78A 4QM7A 1LS6A 1L4UA 4NL4H 4UNNA 3SYKA 1JQLB 5H68A 1Z8FA 4Q4HA 3I5YA 2E9SA 4KVAA 5B30A 3KXIA 5E7JA 3VHXA 3DKVA 4V0LA 1HEIA 4NP6A 1YZNA 3U44B 2G1KA 2ZJZA 3IEUA 4EDHA 4HLQB 1IXZA 5FUXA 3T1QA 1SKQA 2HCJB 3MCAA 2CMKA 3CRW1 2QTFA 3P20A 4LHXA 4V0NA 1PUIA 1OE0A 3K0EA 1ONBA 4M1OA 4A0FA 2FFAA 1M74A 2QP9X 1Z63A 4L4UA 3EIHA 2YOHA 2YOGA 3HU2A 1JJVA 4GOJA 3CPHA 4A0HA 3Q5DA 5GJVC 1XTQA 5SZKB 4C0LA 1UF9A 3U3JA 3NKVA 1G6HA 1TMKA 3KTAA 4HATA 4HEJA 1KKLA 5JJKA 3A4NA 5CB6A 3EPLA 2NO0A 4KODA 2PH1A 3PUZA 1HTWA 2WWGA 1DPFA 4M1KA 5DIFA 1S3SA 5BWMA 3OIUA 4WVFA 2HYIC 1OT3A 4OJKA 3X1XA 2X2EA 3RRMA 1OXSC 1XPUA 2AWOA 5AJVB 3NBXX 3CPJB 4WXPA 4B35A 1D2EA 2WAYA 3C8UA 3AEZA 1GKIA 4TL7A 4EPVA 1A7JA 1FUKA 3PEYA 2RGNA 4DDWA 4DJTA 5DN6D 1QHHA 1DAMA 2F7SA 2X77A 1GNPA 4KFSA 4L9SA 4P32A 4D4JA 4Q21A 2GEVA 3PEWA 4TLDA 2Q3FA 4EPRA 3ADCA 1ZD8A 1SZPA 4QRHA 3FMFA 2AD5A 4JLNA 4PO8A 2GVDC 5CK5A 1F2TA 2QAGA 2QY9A 4EPTA 4MKHA 2XOKD 1Z6TA 4Z8XA 2AXNA 1RRCA 2ZRKA 1U2RA 1XX6A 2YYZA 2GXAA 1YZKA 2H17A 4BRWA 3V4RA 1KI8A 4DDUA 4O2RA 4QGGA 5LD2B 2CLDX 3WY9A 1FW6A 1P4SA 3PV0A 4BEJA 4Q1FA 4LBWA 2OXRA 3QKRB 1N6RA 3VHLB 2FZ4A 1Z0KA 1CEEA 3W6OA 1N6LA 4XWAA 2A2ZA 4Q1EA 3O8DA 5C4MA 2XZLA 1QDEA 5P21A 1ZCAA 2LKDA 2YWEA 3AQ4A 3QQ5A 3BORA 2HEIA 4A9AA 1ZIOA 5E3HA 4R9UC 2V6JA 3CIOA 3VR5A 4B74A 1GOTA 3OIWA 4HAXA 4B44A 2FMXA 4M1MA 2XB4A 2V55B 1FMJA 621PA 2ZYWX 4M21A 1N5LA 1NJFA 2X8AA 2RGBA 2ZRAA 5SZJA 4C0SA 4Z8YA 1GUAA 2HLDD 4KI0A 1R6BX 4GZLA 4KFUA 2JLVA 4BLTA 2PX0A 4U7DA 4ESHA 2ZM5A 3AVTA 2OCYC 4TQUS 4BLRA 5C18A 1WB9A 2EFDB 1X8LA 4IEIA 1UPTA 3ZS9A 4DIEA 1XXHB 1W2GA 1Q1QA 4MRRA 4DLWA 2VPPA 4JJZA 1UDWA 3Q72A 2VF7A 4AKEA 1FTSA 1YZGA 3FKSD 1A2BA 1TAGA 2AHOA 1M7GA 1FX0B 2R44A 4MDFA 4D25A 1D8TA 4ZV4A 5LD2C 3CH4B 2IHYA 5KPDA 5KUTA 2LCFA 5DSZA 1IONA 1ZNYA 4C7OA 3SJCA 2D2EA 2ANCA 4BZXA 4I1VA 2BEJA 2OAQ1 2RCNA 2WBLC 4E22A 2ZRPA 3B1VA 5J5CA 1ZU4A 3RSLA 3SR0A 4B43A 3I8SA 4LV5B 3BD9A 2FFQA 4AKGA 1R7RA 4RSGA 4XVRA 2R6CA 4UXHA 3AB3A 4QBGB 1NVVR 5FPKA 1SKYE 1P9NA 3FMIA 2F1IA 4KFTA 2O0JA 4HDQB 2REBA 2XNDD 2W6JD 2IYYA 5KSPA 3UMRA 3PUVA 2IYTA 4URYR 2ANBA 3GJ3A 5CJ2A 4LI0A 3CW2A 1Z2AA 3AKDA 2BKUA 1ZUIA 1CRPA 1Z6XA 1K6MA 1KGDA 5DI9A 4BASA 2JDIA 5EXTA 3HDTA 3CKLA 2P2LA 5J4LA 2QROA 1UBGA 1WXQA 4M9XA 4AIIA 2OAP1 4IVRA 1FUUA 1MRSA 3T12A 2W2XA 4JLOA 4A2WA 3U61B 1EFRD 1V43A 4G5RA 4PC3A 4GMDA 4ACBA 4KITB 4JKYA 5G40A 4TL8A 4A8JA 2OLKA 4DLTA 5JEDA 4DCTA 2QQEA 4AC9A 1AQUA 3FHOA 4M1TA 1VG1A 4EJSC 3AF1A 3QPVA 4RVCA 4BE7B 4B6EA 2IEYA 1EK0A 3ADKA 4IFBA 2GDJA 2ZRDA 3M0EA 1NJGA 1YR6A 3TR5A 1E9RA 4M1YA 1Y63A 2O8FA 1ETUA 2QM8A 2NGRA 2EFHB 3NC0C 2QP4A 2FE4A 4Q4JB 4KSBA 1WBDA 4Z51A 4DLVA 1Z06A 3OF5A 1UKVY 5J47A 3WP1B 4FIDA 1VYTA 3IPXA 5AUNB 1EXMA 4FMBB 1CBUA 2VRWA 1C1YA 2JLZA 2W0SA 2OSBA 5IF9A 4HUQA 3RLFA 1QHHB 2ZE7A 1Z6GA 1XRJA 5FOXA 4JVLA 1XTKA 3DO6A 3N5CA 1WE2A 4HLUC 2G3YA 3FFAA 3TSOA 4B76A 4YMSA 1XPRA 2G77B 4PZZA 5EQTA 4P4SA 5HZKA 2IXFA 1GL6A 1OIWA 2EWVA 4M2LA 5CIWA 5L3SA 1G3RA 1KDTA 3LLUA 4NHOA 1G9XA 4WIAA 2O8CA 5FBRB 3U7GA 4B71A 4Q4AA 1W4BA 1WMSA 3VNVA 4RJLA 4UNRA 4F4CA 2EWWA 2VA8A 2QGZA 1A4RA 1MR3F 4PSAA 2UZ3A 4QJ5A 2WKQA 3GFTA 3OEHD 4PC1A 1XF9A 4RFSB 1DG1G 1SULA 1GRNA 2BIFA 4RD0A 3GPLA 1ZM7A 1KHTA 3HP1A 1J70A 3MWYW 4YXWD 2PMKA 1FFHA 3BH0A 2J7KA 2XJ4A 1VECA 2C5LA 1SKYB 2ZJOA 3C7KA 4P4SB 4C0QC 2Z83A 4ZCMA 4RZ3A 4C2UA 2C95A 2I3BA 5FFMA 1VCMA 5BYJA 3GLFB 3A1WA 4LSGA 4TTRA 3ETLA 2PCLA 1E32A 1II0A 1UKEA 4CEHB 1R0XA 1GL9B 2AKYA 4YMWA 4QBHA 2QAJA 4IEEA 3QXJA 5CJPA 5IT5A 3P1JA 1Y3AA 1OFIA 2O52A 3DEFA 3K09A 1F48A 4XJXA 3D3QA 4PZYA 3WBJA 2QQ0A 1ZUHA 3ZVNA 3QF4B 1NVWQ 1BIFA 5AUOB 4KJZA 2FN4A 3LBIA 4QKQA 4P0TA 3SDZA 1E3MA 3VKGA 2N1BA 3OAAD 4MQBA 4D82A 3QIAA 2D3WA 1P5ZB 4TLEA 1NG1A 3IGFA 3AF4A 1KSHA 1XMJA 4A2PA 4BLQA 2C9OA 4P3YA 5CDFA 1COWD 2DFNA 1ZM4A 4PAQA 1A2KC 1YRBA 1W0KD 3U6KA 2QBYB 4QHSA 4HAYA 3AVXA 1XB2A 1KZGB 2IYZA 4DDVA 2GJKA 4AD8A 2CVFA 4RCYA 4ARZB 5BYKA 1BH2A 2V8OA 1CRQA 4II7A 1M7BA 1UADA 4JIMA 4NKRA 1G291 5JHGB 5HR5A 5JBQA 2QPOA 3LX5A 1JJ7A 2BBSA 3LFUA 2MMCA 4W7SA 4G01B 1JEEA 2VP9A 1P9RA 3AUXA 4Q1AA 2HF9A 4HAVA 5KHOC 1KMHA 1N0WA 3RRNA 1Z6AA 4LWZA 2C77A 4DRZA 2FEOA 3TUIC 2B7CA 1SXJA 3OIVA 4PQYA 1PZNA 3CM0A 4TTQA 3KFVA 4MH0R 3W5IA 5JCZA 5J4YA 4AG5A 1T0JB 3VX4A 2QSZA 2RHMA 2NMVA 5FTMA 1SVKA 3VR3A 3ZDQA 1E2NA 1X3SA 4UXJA 1E9BA 521PA 4LGMA 1EX6A 3WNCA 2Q9AA 2QPAA 1E99A 3FWYA 3IKJA 4E09A 5BW8A 4C0KA 1B23P 4N0EA 4IDHA 1D2NA 4C0BA 1M1YE 1R0WA 1TQ2A 4RKFA 5FUYA 2QMOA 2WKPA 2BJWA 2KWIA 3EWAA 4FINA 2HLDA 4IHQA 2R6GA 4PHHA 4QHTA 4Z54A 2C04A 2CNWA 2H5EA 5FL7D 3WYGA 4TYYA 3ZQ6A 1N5IA 2WMNB 4K8OA 1FOEB 4M1SA 1DVRA 3UG7A 2YV5A 4Q7LA 5JCPA 3BIFA 2ZYUX 2DFKB 1KI2A 3LA6A 3NDBB 4KLZA 3GEEA 5EXSA 2XTNA 1C4OA 4CEJB 2V6IA 1E2GA 1F2TB 2QAGB 4OK5A 4NPHA 1UKYA 2MSDB 4OHVA 4RZUA 1XNJA 3L0OA 1VIAA 2KI5A 3B2EA 3FKSA 1AM4D 5KPJA 5J4VA 1HUQA 3UMFA 4NYJR 4LBZA 4BZQA 4O25A 3ZYCA 2CBZA 4H1VA 2DR3A 3KJEA 2OG2A 4DB4A 1NN0A 2IHBA 2J45A 5KNCA 2ZUDA 3PUWA 1JB1A 2Z4SA 3WNDA 3U3OA 3SJAA 1LTQA 1U8AA 3KB1A 1IAQA 2ZS8A 4Q9IA 1DS6A 4GOXA 3A1TA 2AFHE 1FL9A 3A37A 1E79D 2IWHA 1RZ3A 4LJ4A 2JJ1A 1IHUA 5DLQC 2G9NA 2BM0A 1XPOA 2CHQA 4DVGA 3U7FB 1YHNA 5J40A 4URXR 1KJYA 3DM5A 4YMTA 2EVWX 4MYHA 1MO5A 4AYXA 4OHZA 5JECA 3NBYC 2BMEA 2J41A 1A82A 1W44A 2JLXA 5F3WB 2OCBA 2XB2A 1U0HC 2HV8A 4YDSA 5FBLB 3BH7A 2ZQ5A 2WWWA 4ON9A 1DAFA 3AP2A 3QXCA 2W6ID 3LVRE 4FMCF 3FMPB 1A1VA 2OBLA 1ZP6A 2IUSA 4ZKEA 4ZDWA 4PHGA 1G7CA 3KZ1E 3RAPR 1KAOA 5EE5B 2GK7A 1CJVC 4WW0A 4JLKA 1ZM2A 1PV4A 1S0UA 4IFEA 2F3TA 1YR9A 1W4AA 2FF7A 4HAZA 5KNBA 2W2VA 3SC3A 1ZD9A 1EFRA 1M7HA 1SGWA 2CL0X 3HR7A 1IOZA 3CLVA 4GP6A 4Q9HA 2GJAA 4ABYA 1AS2A 4JVMA 3AV0B 3EZ6A 3GLIB 2Q3MA 1E4YA 2VP4A 3ZIAD 3KXLA 4ZI2A 1E2DA 1NF3A 3VTKA 3L2OB 1XD8A 4OI2A 3T61A 1FQKA 2QE7D 3HR8A 4MYUA 1T4GA 5JWHA 2IW3A 2ONKA 1ELOA 2ZSFA 2FSGA 3CR8A 4BECA 5B57C 2O8DA 2W83A 4A82A 1ZW6A 1I4DD 5KU1A 1G5PA 4X8LA 3PVSA 3QI2A 3MAAC 2REOA 2P6NA 2AK3A 1W0JD 3QBVA 2P6RA 4MRPA 2C99A 2CVHA 1KI3A 4ASUA 2BBWA 4D4LA 1KY2A 3LDAA 3T1TA 1WQ1R 1JEDA 1X86B 5EE9A 3A36A 1OIVA 2ZROA 2FFHA 3ND8A 4GSYA 3KTAB 3VU9A 3KQNA 2CCGA 3ZJYA 2FSIA 2FJUA 2H16A 4RD6A 4A0RA 4LBVA 4LHVA 1YRAA 2CCKA 3L8ZA 4MA4A 2C96A 1AA9A 3TW4A 2DB3A 4MGZR 3GEIA 4JLDA 3R8FA 3ADBA 2A5GA 2AN9A 3KJHA 5HE9A 1QHIA 2ZRFA 2CJWA 2UZIR 4HB0A 1E2EA 2ZI5A 3DHWC 2J1LA 2IL1A 5TMPA 1W5SA 1GFIA 4JL8A 4MKGA 3MUFA 1KI4A 3QKRA 2QL6A 1GNRA 1R5NA 2BMJA 3TIFA 4V0MA 1GVNB 3TMKA 2YOFA 3VX3A 3KJIA 4M0LA 3WMEA 1HA3A 4QBIA 4V02A 1KI7A 2WWYA 3KKMA 3AGQA 4QNRA 5FUVA 3GJ4A 1YKSA 2NZJA 1TX4B 1JR6A 4ZDIA 4Q1BA 2EFCB 2WM9B 2VP0A 3V00A 1G21E 5AJYA 2VIIA 4F91B 2ZI3A 3IEVA 4OYHA 4LV6A 3WRYC 1CR4A 4AWXA 1AKYA 4BGDA 1JPJA 3LXXA 4WAUA 1HY3A 1NLFA 4PFSA 3B1XA 4G3XA 3BFXA 1N0VC 1G18A 3SS8A 2O5VA 3SEAA 1E98A 1NRJB 4FN5A 4JL5A 4DHEA 1FP6A 4DLXA 1GKYA 4AKIA 1TUIA 1S2MA 1TU4A 3MD0A 3NIBA 4LDJA 1Q44A 3L8YA 1VKJA 2P5TB 3EWSA 1Q57A 4F4JA 1W0JA 3KKQA 4GPTA 3U7EB 4W9MC 1NBME 1G7TA 1R8QA 4JLMA 1JXOA 3T1OA 2BOVA 3WHLA 1NY6A 3BOSA 4Q03A 5FL3A 1P62B 2CK3D 4DLYA 1OHHA 4XIGS 1HT2E 2VL7A 4C9BA 3M6AA 2AL7A 2KBFA 3MWKA 3B13B 2VHUA 4KLNA 4QGHA 5FR1A 3DOFA 3Q7QA 1CR0A 3BB3A 2OILA 4MITA 3NBZC 1KI6B 4CW7A 3HU1A 3OE7D 2A3RA 1CKEA 1S9HA 5DE3A 3W8NA 5F9HA 3THXA 2FG5A 2FGKA 3LY5A 4DT1A 4B73A 2R6DA 2OM2A 4M22A 4CEIB 5C46F 1KJWA 3I72A 4B3XA 4MKIA 1G8HA 5L3QB 1YZTA 5DNYB 5HKKD 4NCNA 1G3UA 4MRVA 3NXSA 4R2HA 2NPFA 3PEUA 5CYOA 2FGJA 4JZKA 4ZPXA 1QHNA 3NEYA 2VHQA 2J46A 1Q3TA 3Q85A 2R62A 5FPYA 2J87A 3PEVA 3OFND 1UEIA 4PSVA 2IYQA 3LX8A 2Q9CA 4QFMA 5DHAA 3K0FA 2ERYA 3K09C 2F55A 1NVVQ 1Q3HA 2CLCX 4TMWA 3HPRA 4ACAA 4EPXA 4F38A 1S3GA 4XSHA 1ZYUA 1SQ5A 1AZSC 1Z83A 5EXXA 1R8SA 3VNUA 1JR3D 3T1VA 1TUEA 4FCTA 5JS8A 1OKKA 3KUCA 4MKFA 4WZBE 4DT1B 4PHTA 1BS1A 3NBFA 1E0KA 1G1MA 4N1AA 3GLHE 1W5TA 3SHWA 3K0AA 1YZQA 2O8BB 1G7SA 4TYWA 1GP2A 2GTPA 1XBTA 2WJJA 1D6JA 2WOOA 1AN0A 1NMXA 2WPDA 1VDZA 4O0MA 3FB4A 4GI7A 3RS0A 1YZLA 1PUJA 4K81B 1NY5A 4D0LB 5CM8B 2P65A 4OL0A 1KI1A 3CX6A 4TMZA 1GITA 4PSKA 1VCOA 3PQCA 1P9WA 5EUMA 4DIDA 3QEJA 1IQPA 3J81k 2RKOA 4POAA 3A6PC 2P6UA 3VKHA 2WSSD 1XZQA 4DDTA 2D74A 5JSZA 3G82C 1SXJB 4YDHB 3VQTA 1X1SA 5HE8A 3KKOA 3AF3A 4PTLA 4DCSA 3EX7C 4DUGD 4QJ3A 2G83A 2BMFA 2Z5FA 3LW8A 4D81A 3W3ZB 1DEKA 1V5WA 1TQ4A 5H8WA 3G5UA 2WWXA 2IS1A 1D2MA 4PR0A 1BMFD 3T06B 3E1SA 3ZGXA 2WJVA 4OHWA 4UKDA 5KTYA 1US8B 4ZKDA 4TLCA 4WZ6A 3RWOA 2ZETA 3GJXC 5GADl 2GRJA 3QXXA 5GJWC 3SZRA 1G41A 5G41A 3EZFA 2ZRCA 1XEXA 2B92A 3IO3A 4NMMA 4XD7A 1E69A 2ZANA 1QHXA 3MMPA 4RD3A 2NO9A 4C0HA 4LYFA 3FMOB 2A5FA 1LV7A 1P2VA 2IWRA 1T6NA 3IIMA 1Q1ZA 4ZDJA 2ZJYA 5K8LA 3GD7A 1OXUA 3I92A 1L4YA 1T3HA 2JIZA 1XTRA 4OQLA 3PUXA 3IIJA 3TNFA 4BPBA 1T91A 3C16C 4LY6A 2XX3A 5FTLA 1AGRA 2OFOA 2JA1A 4PPNA 3MJHA 5E7MA 2IXEA 1UBEA 4C7OB 1HURA 4TT3D 4MRNA 1NNEA 1ZIPA 1ZRHA 4HLCA 4ZO4A 5AUPB 3PG5A 5BQ5A 1ESMA 4NCHA 2QPTA 4LZZA 2A9KA 3R9IA 5KDDA 2ZRLA 3Q8XB 1TQ6A 2JCSA 5JS7A 4CGZA 3BFKA 1LNZA 3UG6A 3B1YA 2VYFA 3WBKA 2PX3A 4US1R 3WMFA 5GJCA 3SE0A 1W4CA 3MSXA 5GJBA 3BC1A 3Q3JB 1OH7A 2O8FB 1GNQA 2ERXA 4TYNA 2XXAA 1SVOA 3LBHA 1NBMA 1NL3A 2XEXA 2VHJA 3NC1C 4M4SA 2QAGC 3LW7A 4LYHA 4QGAA 5TVKA 2RGAA 3EC2A 3U4QA 2YWHA 3H86A 4ZCIA 2OBNA 5K8IA 1NLZA 2GF9A 1DO2A 1KZ7B 2GXUA 4GMXA 4F92B 5KSOA 2HJVA 4I1UA 4HDOB 1SXJC 3AKCA 3SQXA 1MO3A 3Q7PA 1DARA 2YVUA 4C4PA 2PBRA 3SI7A 3W9YA 1KIMA 5IDVA 2N46A 1IY0A 1XMIA 2GK6A 3V9PA 3DOEA 3QXSA 3GJ5A 1QHSA 1XJCA 2B21A 1Q0UA 1TL7C 3LV8A 1E79A 3V4FA 2K5UA 1TQDA 2PJZA 3QEOA 1KOFA 3QVUA 4OJQA 3T34A 2XNDA 1YZUA 3C5HA 2HF8A 2GJSA 2CEAA 1I4LD 5HZHA 3GLGA 1T0HB 1VG9B 2JLSA 4B3FX 4KU4A 2IYRA 2FEMA 1U99A 4OQFA 2AFIE 2VSXA 3QENA 4QXAA 4U02A 1JALA 1YJ5A 2QT0A 3GLGE 4RFVA 1ZU5A 3EAQA 4AKHA 5AJWA 2JDID 1OYWA 2W6IA 1W2HA 5L3RA 1OYYA 3P27A 3VR1A 2IYSA 5DI3B 2C03A 2B6HA 2Z43A 4XSGA 1E1RA 1M2OB 4KV9A 1FQJA 4HUQB 1EFUA 1QG2A 3F0TA 4L15A 5C1BA 4JLJA 1G6OA 3TQCA 2O8BA 3EASA 2QBYA 1G64A 3JZAA 2GWHA 3ZH9B 3L0IB 3K1JA 221PA 1IM2A 1E1QD 2ZAMA 2CL7X 2FPMA 3GLFA 4CT4B 1JAIA 3GLHB 4IDOA 2G88A 3BK7A 1J99A 2BCJQ 1JR3E 3GFOA 1XD2A 3TVDA 4A6PA 4IDQA 2OBMA 4TL9A 3CNOA 2DWPA 1U9IA 2V7QA 2ATXA 3IIKA 1ZINA 1NVXQ 4Q5IA 1F60A 1W7AA 4EQ6B 2FSHA 2AWNA 1GILA 4A8JC 2V4ZA 2ZE5A 2ZUCA 1KK3A 4IKEA 1ZAKA 3ND9A 3KKNA 4M53A 4D4MA 1S1CA 2GCOA 3DM9B 3PR1A 1DAEA 4CEHA 1N5JA 4JLBA 1E2IA 2QP3A 3M4YA 2ZITA 3CZPA 4US0R 2GNOA 1P75A 3WNBA 3RSOA 2WWFA 1CP2A 2XOKA 3MRSA 4FCVA 4TMVA 4MRSA 2OFWA 5J4HA 3BB1A 1NMYA 3KQLA 2QA5A 2VF8A 1R2QA 3BXZA 4V0OA 1OFTA 4UQOA 4ARZA 1XD9A 4EPYA 1OIXA 1Q12A 2R2AA 3QPUA 5FUWA 2P67A 1Q21A 2DFLA 2FWRA 1W46A 3DMDA 1EESA 1XTIA 2ZJ8A 4DZZA 3TRFA 2A5DA 2DBYA 1OSNA 1SHKA 2JGNA 3IDQA 2RHDA 3OEHA 3OESA 1WP9A 1R5OA 1UFQA 3PENA 1W49A 2N42A 3K9GA 5HCNA 1KMQA 1VPLA 2J0SA 2BEKA 3EG5A 4JS0A 1JAHA 1IXSB 2BDTA 2E1RA 2JLWA 2CE2X 4LUCA 3ICQB 2C9CA 4TMTA 2REXB 4S2EA 3LBNA 3K0CC 3X1ZA 1Z08A 2WHXA 4JT4A 4B6FA 4KFRA 4Z1MA 5BXQC 2OT3B 4EFMA 3A1SA 4XVQA 1S9DA 2ZI9A 1G8GA 4N0DA 4DCUA 3CO5A 3R8CA 4IXNA 5D3MA 1E2KA 2NIPA 2X1VA 5DISB 4PPQA 3LWNA 3QG1A 3P4XA 1PVOA 3ZVRA 1ZMXA 3NWJA 1S8FA 3REFA 5JI3E 3AGPA 3KQUA 3WMGA 2QTVB 4HLUA 5AR1A 1KKMA 4DLUA 3Q9LA 1XWIA 2X2FA 4PC7A 1D9ZA 1LVGA 1N6PA 2ZRBA 2JLRA 3CX8A 5DGXA 3MWJA 2HJGA 1E94E 1GRRA 4OQXA 3H1TA 2J9RA 4EIWA 3TUZC 1F6BA 4IVPA 3N2EA 1U0JA 4HUTA 3X1WA 3GJ7A 4L16A 1NN3A 2F43B 4Q00A 3HPQA 2CHGA 1XFAA 2CLSA 1XCGB 2YWGA 1LF0A 4XH9B 2CK3A 2OUKA 1GWNA 2IYVA 1DAHA 3LLMA 3P4YA 2DWQA 3THXB 4YQFA 3L0PA 2D2FA 4NZYA 1P7CA 5IK2D 3ZD6A 2BBOA 2WICA 2ZAOA 2MSEB 3FYHA 2OCPA 5EZ5A 5JJIA 1G3IA 4EAQA 2AK2A 1VIYA 3CZQA 3TQFA 2ECKA 2VSOA 1KO8A 1GRQA 1VMAA 3RVBA 1P2TA 1MRNA 1T8TA 4X8HA 2VQSA 3RANA 3RWMB 4W5WA 4XWKA 1NVUQ 2PCJA 3SQWA 4JBWA 1XD2B 5FBWB 5TARA 2FU5C 1NIPA 1U94A 3OFNA 2A5YB 3ZQJA 4HB4A 5C4GB 4W5JA 1XCMA 1J8MF 1K5GA 5D3MB 4BZPA 121PA 2RMKA 4JT2A 3SYNA 4FMCB 1JECA 4OBEA 1E0AA 3ZS8A 5JLJA 2ZRHA 3PJRA 1QHYA 2V3CC 2ORIA 3ASZA 4LHWA 1UJ2A 2H18A 2GHIA 3RRZA 2C8VA 1YQTA 4DB2A 4HYYA 4G5QA 2RGEA 2WJGA 1HE8B 4Q4JA 4B47A 5FBVB 3T15A 3AVYA 2J7PA 2J0QA 2FH5B 4LYAA 3THWB 4QJ4A 2HCBA 3OHMA 1NBMD 2FA9A 3K70B 1ZJ6A 2WIAA 4HZUB 1VG0B 3UWKA 2PZFA 2GKSA 4HAUA 1W47A 4LJ8A 3M1IA 4EPWA 1KK2A 3IHLA 3TK1A 4TYPA 3B9PA 1MABA 4NYMR 1Z6YA 4QC2A 2HXYA 1NSFA 2G6BA 4UNPA 2EYUA 1X6VA 3T5GA 4D4KA 3CF6R 2CHVA 1DADA 3I61A 2PZEA 1SVMA 5FPSA 1OW3B 2WWIA 1XEWX 5FOSA 3U6BA 4RD2A 2W00A 5LDDC 3THYB 3FHTA 3QKSA 5FOUA 2BBTA 5F9FA 6Q21A 4RD1A 4URWR 4QNMA 4WZAE 3BFVA 1N2CE 5FI1B 1VCNA 4CZ2A 1M8PA 3WHKA 3D31A 1R0ZA 2DY1A 1MV5A 4A6XA 3AKEA 2ZR7A 4QL3A 4EQ6A 5SZHB 4LX0A 1ZC4A 1CULC 3BGWA 4JSTA 3A4LA 1ZNWA 2H7VA 3VR4A 3RS3A 1DOAA 2D7CA 5KOYA 3KJGA 1ANKA 1DAIA 1J90A 2GBLA 3A1VA 3NH6A 3I8XA 4EFNA 1I4TD 3ECCA 2FPKA 1GIAA 1TEVA 1H65A 1TNDA 3EPKA 2R6AA 5EUQB 2C2HA 3ZZUA 5JRJA 1Z3IX 1U0LA 4B48A 5BN4A 4A36A 4Q7KA 2LKCA 3AVPA 3TVTA 5BN3A 2ZRIA 2IUUA 1KNQA 5A0FA 1TEXA 2ZI6A 1DG3A 3EARA 4NDZA 1JI0A 2VBCA 1G5TA 3PCRB 1E1QA 4ESVA 1EX7A 1NP6A 1P3JA 1VTKA 1Z07A 1ZUNB 3MFYA 1OXXK 2PMDA 3QKSB 4HDCA 3TUJC 1N6NA 4NCJA 5FR2A 4P4UA 4Y0VA 1VCIA 2IC5A 1LW7A 1DTSA 1E2QA 2ZYVX 1FTNA 1ZBDA 2F1HA 1BOFA 4NYIQ 1EFTA 3NHBA 3I62A 1S96A 3MG9A 4LBYA 2F1RA 3T35A 1BO6A 3LO5A 4B33A 4TWZA 3AVUA 2TMKA 1XEXB 1DELA 3MGCA 1XCPA 1MO6A 3SFZA 1WDTA 4LHYA 3ICEA 3MJRA 2WMOB 1IN7A 1YE8A 3B5JA 3PIRA 1CXZA 4LRWA 1QVAA 2AKAB 3QUSA 1OFUX 1ZM3A 1FMLA 4RY2A 1W0KA 1GG2A 1M6NA 2QENA 4G5OA 4DEXA 3RNLA 2XSZD 3GEHA 1E9SA 1T3SA 3B6EA 1HT1E 2J0UA 4LJ9A 2J59A 3W6PA 4D80A 2RGCA 4DKXA 1UKZA 3GFPA 1Q22A 2XTZA 3K9HA 5CM9C 4Q9JA 2JJ2A 4CT5A 4HB3A 4Q1DA 3EXAA 2H57A 3FVQA 1DBSA 2RGDA 4KYUA 3A8TA 3Q5EA 2W6JA 2GCOB 1PLJA 5JSZB 3VFDA 2CE7A 1MT0A 4ZIRA 5M04A 4HLDA 4KHZA 4BWYA 3R9XA 2GEUA 5LBIA 4U00A 1G5RA 2WIBA 1CJMA 1UDXA 2WJIA 3EC1A 2CL6X 4HAWA 2V9PA 4K46A 4TMXA 2GAAA 2ORVA 4GNKA 3CR7A 4UXIA 4TQ9A 2XXAB 2GETA 3X1YA 3L82B 2Q0HA 3CBQA 1W36C 2ATVA 3P32A 2IF2A 2E87A 4TSFA 2PEZA 2WTUA 2EQBA 1K5DA 3GLHA 4TL6A 4B2LA 5KNDA 2G0NA 3C14C 1AJEA 4ZDKA 2YC4C 2YHSA 1G3MA 3NHAA 2G1JA 4TLAA 3KQKA 1QF9A 3BBPA 1RYHA 1T5LA 2YKGA 1NKSA 1OPXA 2ZRMA 2PT7A 3EZ2A 4EJSA 4A8JB 1R4AA 4C30A 4UNSA 4A1FA 4GFDA 3I32A 4URUR 2ZSAA 5TDHA 1OKKD 5JFGA 4U5XA 5KYKA 4IW3B 1BYIA 4YC7A 2ZJAA 3BE4A 2GJ8A 1UEJA 4LC1A 2QGNA 1R5BA 4IXMA 4Q19A 2JASA 3IPYA 3CONA 4LK2A 1I2MA 5FBQB 3GLFE 4TYQA 1KO5A 2JLUA 4IRUB 1NLYA 4TQAA 4A92A 5JZVA 2R9VA 2F9LA 4AY2A 4OI4A 3AF0A 2IK8A 5JI2E 2YJTD 3CB4A 3K70C 3AVOA 3CX7A 2D7DA 2IX3A 3DZDA 1R10A 5EJEA 2D06A 1GSIA 4QM6A 2EFEB 3E5HA 2GF0A 3ZLJA 4IOMA 4XTRA 1RW4A 3KDSE 4NU0A 4B3CA 1IY2A 2W58A 1BYUA 1OH6A 1PLLA 1ZVQA 2V7QD 1FZQA 2XAUA 5K8TA 1N25A 3N2IA 4Q7MB 1XEFA 4DLRA 3CUEF 1YVDA 1Z29A 3G0HA 3EW9A 3U5ZB 1ESNA 4JSYA 1SXJE 2WVJA 3OAAA 3SYLA 2Z6VA 2JAQA 3GQBA 3SFVA 3UIEA 4AURA 4FWTA 2QT1A 1WRBA 1RJ9B 2JJ1D 2P3SA 4I1OA 4B32A 4TZ0A 3O8BA 3SNHA 3F5FA 4BLPA 3OEEA 1XU4A 1KK1A 4Q4HB 1N6HA 3AF2A 3OIYA 2B7BA 3R20A 3REGA 2Q9BA 4HZUA 4IOLA 4LYJA 4L8GA 4ERNA 4TZ6A 3U60B 1K8RA 3U3KA 2I4IA 1XJQA 4TSFD 3CRMA 3SBEA 3ZVLA 1EWQA 2IBMA 4ILEA 1BMFA 3AVQA 1U8YA 2QM7A 2WAXA 1OJLA 5HCIA 2NOAA 4D6PA 2A30A 3VR2A 2C98A 3DPUA 3QJYA 1VHLA 2F1JA 1FNNA 3TKLA 1JR3A 1KDRA 2V54A 4O2LA 5KO2A 1AK2A 1SVSA 5JEEA 4Q9KA 5G53C 1LFDB 5AJXA 1VYVA 4PQFA 2L0XA 2DHRA 4NYIR 1NN1A 1QG4A 2ZRGA 2QUZA 5L8VA 2KBEA 4URZR 4KVGA 1KDPA 2VO1A 3FDIA 2ZREA 2GZAA 3IQXA 4JVNA 4WA7A 4R2IA 1A5TA 4DWJA 1GAJA 4HI0E 2XZPA 1CF4A 3C41J 3S1AA 3AH8A 2VEDA 2D62A 5KDLA 1FPMA 4F7WA 2HT6A 4HZIA 1XMSA 2NO6A 2EU8A 4ASUD 2BKEA 5EP2A 4IDPA 3DDCA 1L7VC 5KDOA 4RFSA 1RKBA 2QN6A 4A0GA 1ODFA 3B9QA 3D6TB 3RHFA 4LC0A 4G5SA 5CLLA 3QPWA 3BB4A 5AJZA 5CITA 1X8JA 3THYA 2H1LA 2PJRA 2O8CB 2WWHA 2BMDA 1Q1EA 3AVVA 5LB2A 2Q3HA 4MUAA 4DLSA 4PX9A 4JLPA 3EPHA 2ZRNA 2B8WA 4PAOA 2J3EA 1N6OA 3F8TA 2GJ9A 2QMUA 4JVSB 1IN4A 2F43A 1EWRA 1SXJD 3DL0A 5EP4A 4DXAA 1CIPA 1AS3A 3E70C 3P26A 3AP1A 4JMPA 1P2SA 2QMHA 3U4QB 3H4MA 3ZVMA 5E4FA 1CU1A 1HQYE 1KO7A 3WXMA 1AZTA 2RH5A 1YU9A 3FKQA 4XTCS 1CJTC 3JZMA 4PAMA 5DI3A 3B60A 2AXPA 3VMFA 1I2DA 5HPYB 5FTJA 1AGPA 1XDBA 1E2LA 1E2JA 2VLIA 1KK0A 4D2IA 4OHXA 4MDEA 3C5CA 1N3BA 2EYQA 1M34E 2J5XA 5H70A 3IHWA 3VKWA 1XP8A 3RABA 3WYAA 3EIEA 2ZS7A 5CIQA 3ZZTA 5FL7A 2QG6A 3LQQA 2WOJA 2VSFA 3SBDA 2QRNA 1EFCA 3FTQA 4Q48A 2ZE8A 3EA0A 2QI9C 2NQ2C 3HYRA 4FMDF 5SZIA 2ZI4A 3DVLA 4QG7A 1XJ0A 4OQNA 1CS4C 3B7GA 4KCGA 1W1WA 3A1UA 4LJ7A 4YXWA 2YWFA 2NZ8A 3EA5A 3GJ6A 1RC8A 2ZYTX 4ITRC 1E1RD 4P4TA 1RVDA 2ASEA 4NCIA 1KSJA 2CCJA 4Q1CA 2H92A 3I73A 1GDDA 1Z0JA 5ANRB 1E9DA 3KUDA 3GCGA 2RGNC 1OHHD 1XTJA 4DBLC 5LPNA 2C78A 4AYTA 4YMVA 2ODEA 3FOZA 3KKPA 1O3YA 2OHFA 4MUBA 4I1SA 4JLAA 1Z22A 4M9QA 2X19A 2XSZA 3NTUA 4Q4AB 4OQMA 1SHZA 1G20E 2MSCB 2J7PD 4TN1A 1MKYA 1Z2CA 3I3SR 1QHGA 2ZS9A 1KY3A 3TLXA 1KAGA 3PXGA 2Z4RA 3CNLA 5C2JB 4FWIB 4OK3A 5CB8A 2GBLC 2I1VB 3TAUA 4LPKA 5JRZA 1II8B 2ZSBA 1D9XA 4CEIA 4DSOA 2FPLA 2XITA 3L0SA 2PLRA 4PO1A 1YR8A 2GESA 1COWA 1G3QA 2RAPA 3K0AB 4R7ZA 1G8FA 3RC3A 3TSZA 4DEYA 4MGKR 2ORWA 1E4VA 5EP3A 3UMSA 1U81A 2VHTA 3LAWA 1KTVA 3X2SA 1W36D 5CK4A 1F2UA 4QHYA 3VAAA 2I1QA 4NBSA 2W2TA 2P0EA 1XXHA 1LB1B 1KSFX 8OHMA 3B82A 1Q1BA 3K8YA 5DHFA 3QE0A 1ZCBA 4D26A 2EW1A 1L2TA 1CTQA 2NO1A 3RDPA 3T5DA 2OZEA 2GA8A 1IXRC 3B1ZA 3ONWA 3NH9A 1TADA 4C0AC 4XWOA 4ZIRB 3AM1A 3EZ9A 3GP8A 4Q66C 1IY1A 3O8RA 4CVNA 4IOJA 1G19A 4WXRA 1OXVA 3LQRA 2RGXA 4DLZA 1G8PA 2OE2A 4M8NE 3WYFA 4G5GA 4PQRA 1KDOA 2OEPA 1EGAA 3HYTA 2CXXA 4H9GA 1XZPA 3ZD7A 4GDFA 1GZSA 4BRUA 2WPDD 2DCUA 4D0GA 3W90A 4X8OA 3GJ8A 1II9A 3AKYA 4KYIB 2O0HA 2WSMA 3QF7A 5DYGA 4CRWB 3U44A 3DMNA 1DAKA 2HUPA 3DZ8A 3RS2A 1MABB 4NONA 1KI6A 5BN5A 4WOPA 4Q4LA 2GAOA 3LH5A 1N0UA 3BJIC 1E9CA 2XZOA 1P73A 2ZVPX 2CNWD 4IVQA 3SJZA 4JL6A 3VU9B 3ZZ0A 2JATA 3CF0A 3NEJA 4DUGA 1F5NA 4DC9A 3N70A 4H1UA 4C2TA 5J4KA 2W0MA 1AS0A 3QKTA 4Q18A 5E95A 5B64A 1BKDR 3NDPA 4OHYA 4RCZA 2YC2C 4Q7JB 3GJ0A 1RRFA 1VYUA 3BWDD 4R98A 3RYTC 4XOIA 1N5KA 3UK6A 2JEOA 4FXPA 1H8HD 1E2PA 2ZPTX 2BC9A 2ZE6A 4G1UC 4IDNA 4A15A 4Q02A 4RZXA 1H8ED 1YR7A 4BFVA 1U90A 5AWFC 2O8EA 3CWQA 1J8YF 3CPEA 3R7WB 4P33A 4E03A 4FMDB 4B2PA 2PLFA 1JNYA 2FSFA 2DPXA 5IRCD 1NKTA 2CDNA 1NIJA 2YZ2A 1ZD1A 2ONJA 1OH5A 5E7IA 5IHPA 1OXTA 4BUJA 1NI3A 1HE1C 3UANA 2B8TA 1IN8A 1OV4A 3MWLA 2ZEJA 5F98A 3K9NA 4UJ3A 4NH0A 5AK0A 1VG8A 1TU3A 4JLVA 4DSNA 3K70D 2FZLA 3AP3A 3U7HB 4KSCA 4I4LA 4JYCA 3TH5A 4PXAA 2FV8A 2O8DB 1CJUC 3GLGB 2GXQA 4M9SA 5EZ6B 2VP5A 2IYXA 2KE5A 4RZ2A 1KSGA 4TT3A 2UVQA 4BFSA 4KBGA 2WKRA 3R7WA 4CIDA 1ZC3A 1U9IC 3W6NA 1US8A 4HSEA 2A7QA 1U98A 2ZR9A 4LJ5A 5D3QA 1LS1A 1CR2A 4NE2A 2Q21A 4WBSA 1SVLA 1VHTA 2JLQA 3TW8B 2J0VA 3JVUA 5FOWA 4B34A 4E5UA 1GM5A 4AK9A 2CJWB 3A58B 1UBFA 2IEZA 1II8A 1X8KA 2ZTSA 4GT1A 4P31A 4DCVA 3TR0A 2ZRJA 2GCNA 2ZR0A 2RGGA 4ZCLA 3W8RA 5L3QA 2DYKA 2IT1A 4FD2A 4IOKA 4RKEA 2JJ8A 5JWRA 1RRGA 4JBXA 3AVWA 1PLKA 2HT1A 2BWJA 5JHHB 1OFHA 5B58C 4BEBA 1EG7A 1NSTA 3NG1A 2R6FA 3LXRA 1XMVA 3HWSA 5CYPA 4FCWA 4Q01A 1U8ZA 5FOTA 1W36B 4DSUA 4PO9A 2BM1A 2ZI7A 3IUYA 1F3OA 5K8UA 4M9ZA 2QMEA 3TJZA 2BJVA 2OO7A 4BFXA 1CLUA 1HQCA 4BFYA 2KSQA 5FTNA 3AUYA 2FFBA 2SHKA 2VP2A 5HKKA 5FTKA 3THWA 4BLOA 2MMGA 1G7RA 5L3VA 4JYBA 3QOFA 1X1RA 4W5HA 1O87A 4B3BA 5TV2A 4BLSA 1Z0FA 5TXGA 4UNQA 1E0SA 1H8EA 3DKPA 3IBGA 3D7MA 4EUNA 1OH8A 3KQHA 4L5BA 4PPFA 1ZM9A 3BS4A 3C4JA 4BFWA 2QEQA 2WSSA 1FP7A 3K53A 2VHCA 4OK6A 4D0NA 1RPZA 2NTYC 5EE0A 4QGFA 4LHZA 3IO5A 2IXGA 2Z0MA 4BFUA 1JXMA 4GRAA 3TGPA 4NTZA 1Z5ZA 2V1XA 3OEED 4DCNA 4OKSA 4GOKA 2XNSA 2YNMA 4GZMA 3TBKA 1JPNA 1N6KA 2C9YA 3QF4A 3W5JA 2QSYA 5FPTA 2GILA 3QKUA 3FFBA 2BV3A 2PEYA 2ODBA 2ZU0C 1OLOA 2ZUBA 3C15C 1AKEA 3GLIA 1RJ9A 3LNCA 3CRRA 5EE1A
chains in the Genus database with same CATH superfamily
721PA 2ZSEA 2QRZA 2P0YA 1O94C 3UUFA 2RB4A 1UDRA 4H59A 5BNZA 2BONA 3I2GA 1TKBA 2ZIAA 4DA6A 1OU4A 2ZJBA 2B69A 3KDPA 9ATCA 3WLHA 3SS9X 5IABA 3PDWA 2I3AA 4MVJE 5IJ0A 3GGCA 2O06A 4QFBA 3EBPA 2TMGA 3QY0A 4KDCA 3UO8B 4BFTA 4L6CA 2YICA 4JA2A 5K3AA 4XASA 2OORC 2GN2A 4B0PA 4KWCA 2BZSA 2Q49A 5ALWA 1U7DA 3C97A 1CUUA 3N6VA 4ZC8A 1PT6A 3A4MA 1HKHA 1MH1A 3IJRA 5LQMA 4B7AA 4HNAB 1SVIA 2J31A 1GAQA 1FDVA 3AL0C 4GL2A 2VNIA 2RAUA 1E2MA 1KO4A 2OWDA 3O91A 4OB6A 5TPWA 2GXSA 4AX4A 4CLHA 2X0EA 4B3DA 1JLLB 5CHYA 3JQFA 3R9WA 3EUEA 1PKXA 1QQ6A 3C24A 3KK0A 1ZVVA 1F2UB 1KC1A 2OMKA 2QMQA 4EUEA 2HRDA 4PC2A 1P72A 3VSAA 3KLPX 1FDIA 3FI9A 3TFQA 1ODTC 3OE7A 1OWPA 2DXIA 1MB0A 3ZJTA 3AY7A 3HFGA 1H2YA 1SCNE 2YH2A 1G4AE 1XTUA 1MC5A 4RXTA 4ZT4A 5BYBA 3RV3A 1JWAB 1M2OA 1FJXA 3GMTA 3C6BA 1ISGA 1NMZA 3LUDA 4I8XA 1RQRA 1NLMA 2QF7A 3SJBA 1WUYA 2V74B 3JXEA 4RLFA 5DM60 1M6WA 1L7BA 1GTVA 3ZK8A 3TINA 2AOUB 1JG3A 2QV7A 2B82A 2W70A 2I4RA 5JAPA 2YWBA 3K2BA 4FQ8A 5LA6A 3OZDA 5DM70 2IH5A 3MLEA 4RETA 1POXA 3SPXA 5EUCA 4EFLA 1B0UA 3PPWA 3I6ZA 3ZI7A 2IJGX 3BVPA 4QUHA 5JVDF 4ZGWA 4H77A 3TRJA 1AIPA 3LD9A 4IHJA 1Y1QA 4O1HA 4DUZB 2GZDA 3VMMA 3PGMA 1AQYA 1JBKA 1RKXA 4C76A 4EABA 2IS2A 2GEDA 3UPUA 3RS4A 3NEPX 2C5GA 5B1SA 4WJZA 4EFDA 5LOVB 3MLAA 2BRUA 1YZ3A 1RRPA 1BW9B 4S35A 4N5DA 1CC1S 3LG2A 3RYCA 2J3MA 4DV2B 4ZZ2A 1NBHA 1C50A 3BEOA 2JFFA 4V0ME 3R7FA 5KWJA 4AXXA 3C39A 3ZY3A 1ZOLA 3DZBA 1V9LA 1PEDA 1JIKA 1U7PA 5L4NA 4R71A 1WDKA 1F7UA 1FS6A 3NLLA 4IV5A 3ZCRA 4RVOA 1GU0A 3NZEA 5LSAA 2AEEA 4F84A 1CWUA 3FZQA 1YR1A 2WM3A 2EBUA 1J4AA 1B2RA 1HGXA 4CKCB 2Q6TA 3TTYA 5ITVA 3S1LA 3KZNA 3FPAA 3EPJA 4BB9A 1IUNA 1HH4A 3FRHA 4YEDA 5BO5A 4F2GA 4EHBA 2O2HA 1FUEA 1ADJA 1KJ8A 4YAWA 2ODNA 2PTHA 3BXHA 3GPCA 2QD2A 4QYMA 1MO4A 4A2QA 1Z9BA 3IBYA 2H1WA 3HVKA 4HGOA 4V03A 3SK0A 4GPIB 1UT5A 2FR0A 4B8WA 3HDJA 1L8AA 4YRDA 3I12A 1EP3B 1KJZA 2EDCA 1TTTA 1QK5A 2FWIA 3V1KA 7ADHA 5DIZA 4D3DA 3KJQA 4NBWA 3BSSA 4BRSA 1H8HA 2YINC 5EXEA 3EUFA 2QX8A 1OF1A 5FLEX 4D9FA 1YGYA 4ARUA 2F3RA 2OZLB 3H7IA 3O26A 2GZHA 1MO2A 3KV1A 4N12A 4W9RA 2EKPA 1VSQA 4EJSB 1DGQA 3LRPA 1T8UA 3Q0TA 1HZJA 1GG5A 3E18A 4B6RA 4O4LA 1MX3A 5B4VA 1D5WA 2A1IA 3DF9A 3N3AC 4Q47A 3U7QA 4MV3A 1K5HA 1TJ4A 4YCDA 4G85A 4MKRA 4LVNA 4Y2UA 5IVKA 4Y67A 1OA0A 1FVHA 1GGMA 1XXHE 3BPSA 4RX1A 4G6ZA 4ZOLF 1CZLA 4LISA 3D6UA 1WMDA 1X1AA 1TF7A 4ZT7A 4FEGA 5K99A 4ZEXA 4MAMA 4LXXA 4DL9A 4JODA 2GD0A 2H07A 3V8RA 2XCLA 4URVR 3UPTA 1M72A 3Q98A 2GBFA 5AVTA 4JJKA 2H0RA 4MR8A 3PUYA 2V6MA 4J0QA 3UWDA 3GDOA 3VZQA 3EAGA 5JFOA 4L8LA 1P6XA 2BHSA 4Q3OA 1YVPA 2C5FA 1ZQ1A 3D7NA 2QLLA 3DE1X 4PZPA 4QECA 3WL8A 2O8EB 1S4QA 2UUCB 4ZO7A 2CBXA 1EGMB 2H7XA 1RNLA 5BN5B 2A1TR 3BERA 1DIOB 2PKQO 3LECA 3D8BA 4IG9A 1REQB 2PL3A 1BX3A 3HWWA 3E84A 3MMNA 4RS3A 5CBKA 3L4BA 1XELA 1I5RA 1TMYA 2NZXA 4G4SO 5CEJA 2QMZA 4ZCRA 4ZT6A 2FPPB 1WBBA 1S1MA 2ZJ2A 2DKOA 3OCXA 2VT6A 2J30A 1G0OA 2I9PA 5AKYA 1M2NA 5E4JA 3K0CA 2BFCB 4DIMA 4ZRNA 5LN1A 1M2GA 1U3FA 3TTVA 3K4QA 4GM1A 2IXDA 1IHYA 2XVXA 4QUKA 4XJVA 3FDFA 3EY4A 3LC7O 1LUAA 4QRDA 2A5JA 3N8GA 4ZTUB 4KH0A 3KFXA 4XKJA 1RZVA 4K9NA 2OC4A 5B6IA 1UBHS 4JROA 5AUQA 1TF2A 3ESDA 1TE2A 4O4IF 2LIPA 1C9KA 4TKUA 1OILA 3K8OE 5L7TA 4BXOB 4GMHA 4AY4A 4B9EA 3IEXA 2XF8A 1JSRA 3TCKA 3FE2A 2FW9A 1T9HA 3R3SA 1JQJC 1U0TA 4MZXA 3CWZA 3F6SA 4NZMA 3EVZA 4I14A 4ZVTA 2C20A 2DJIA 3G6WA 5CX4A 5JE8A 4OI0A 5ULLA 3UA4A 3QE9Y 3VVMA 4K5QA 4C4RA 4QICA 2JGJA 4L5IA 4RDXA 1YR2A 1FFXB 2GZ3A 3BL6A 3Q6MA 1LPNA 2L69A 5GONB 1Z16A 4CF7A 4F4IA 2J32A 5AXDA 1E2FA 1WCWA 4JI0B 2QRVB 2KQUA 4CFZA 3RRXA 1IN1A 1DT3A 1CUGA 5DN6A 3TIVA 1EXNA 2R84A 5C2JB 5KJ6A 2YL2A 3AERA 3I58A 4GBMA 4KXFB 2V5VA 4YQEA 4MUGA 1F17A 3NXKA 4UCXA 5REQB 2Z2XA 1P60A 3MJEA 4JLWA 1ONNA 1Y81A 5KWSA 1XQYA 1T5OA 1Z47A 2GGSA 2GOYA 3DC2A 1JWLA 4W6QA 5F2NA 2C2KA 1V5GA 4WD3A 2JGLA 1FNMA 3FOWA 3NDJA 4RKWA 1IBRA 4KNVA 4IJMA 1AGXA 3M5PA 4NBNA 1JDZA 2P9FA 2COEA 1ULHA 3SN6A 3AJ9A 3H3JA 1IZ9A 5K2MA 5EEHA 4AQYB 2FOLA 4GYWA 1DU4A 1LS6A 4NL4H 4UNNA 1AE1A 1JQLB 4UHEA 3SYKA 3TOCA 5E9WA 3U26A 2PV0A 1U5BB 2HU2A 2IY8A 3DVQX 4Q4HA 1D04A 1P4HA 3ZHBA 5B30A 2X4DA 3KXIA 3DWEX 1VBNA 1NVGA 3E5MA 4IS2A 3M5CA 4GI3A 5ADHA 1V4BA 2AW3A 4NP6A 5HIMA 5CDHA 5KWEA 3KYBA 3HA2A 1FFEA 3F4LA 2B9VA 3LBAA 2ACEA 4G5XA 5ALHA 1KRXA 1IXZA 1EFVB 3OA2A 5FUXA 2F4NA 1SKQA 3T1QA 1NASA 4R1MA 5ECWA 2CMKA 1OROA 3A3OA 2QTFA 3CRW1 4UMDA 2HA3A 4DNQA 4U7PB 4LHXA 4V0NA 5CT9A 2ZB3A 4DG5A 1E7YA 1P4AA 4D4IA 5LWQA 1M74A 2QP9X 3L4SO 1C7ZA 3GEDA 3IQHX 3H0CA 2YOGA 1PTKA 1NM5C 3HU2A 3RVDA 4WGGA 4TRMA 1XTQA 3S29A 1HFWA 1RBZA 4WKOA 1YUNA 2XE4A 1O57A 1NOIA 4U6SA 1G6HA 1TMKA 5CFRA 2A84A 4HEJA 2OYSA 5JJKA 3G0BA 3VC7A 3A4NA 3RSZA 2I6QA 2H4ZA 1EYZA 4X92A 4ETMA 5DM2A 2EFJA 2VTBA 3TECE 1ENOA 3EPLA 3PQ2A 2NO0A 5D8DA 3RAPR 4BVKA 2FKAA 1DPFA 3PGA1 1MORA 2YV1A 4M1KA 1NNUA 4JI3B 2Z04A 2WFMA 3WAGA 1ESEA 2H63A 3GRYA 4O4LF 3OIUA 4WVFA 3WLKX 5KB3A 1J25A 1Y3CE 4OJKA 5LLTA 2X2EA 4LF8B 1X0XA 3RRMA 1SO8A 1R4NA 2AWOA 4HJXA 4ZVSA 3RTAA 3NBXX 3OJCA 4M7WA 4Z99A 3N87A 3T5BA 3UMJA 2WZCA 2BGTA 2NVBA 3HJAA 4QAQA 4CBVA 3NO4A 2VHVA 4EPVA 5IP5A 4JU8A 2ZIXA 4D97A 3PEYA 2CXUA 4DJTA 1JG4A 1I10A 1OZHA 2A4MA 2IHVA 2QN3A 5BNFA 1UJ5A 4ZV9A 4UE6A 3A0UA 1LD3A 4KFSA 4P32A 4WV3A 3PHJA 3TO5A 1KZ4A 3HWX1 3ADCA 3A9VA 3NBMA 1T15A 3TCXB 1E5QA 4AY3A 4MPDA 1U2GC 1VFNA 5HRUA 4OHCA 2QTRA 3TZBA 2WC1A 2XWJI 1VKHA 2N0SA 3IEIA 2AD5A 1VE3A 4FT2A 1GGHA 4F1WA 3F5MA 3ZCSA 2GVDC 3GMDA 1Z36A 1F2TA 2QAGA 1ZH2A 2QY9A 4IIFA 1P1RA 4MVYA 3AOGA 3HKBB 2ZYIA 4F96A 2CV1A 1EDBA 1KZ1A 1ZGHA 1P4RA 1U2RA 1TZ2A 3MBOA 1T36B 2H17A 1ZOSA 2YS6A 2PIDA 3VM6A 2W37A 4FJ2A 1TM2A 3ZBUA 4IYJA 1ISJA 4BS9A 4O2RA 1VHDA 4QGGA 2CLDX 3UPDA 4EB0A 1L5RA 3WY9A 4CCWA 1PR5A 4BEJA 1FS4A 16PKA 1YUBA 2JGFA 3AZQA 2R87A 3MCWA 3MWDA 2F48A 3P9KA 4HQLA 3A6HA 4LBWA 1Z0KA 3VHLB 3ZWAA 5AM3A 1CEEA 1V7PC 2XMPA 2NSHA 5C4MA 1XRNA 1CRWG 5HFAA 3KQWA 3AWDA 1QDEA 3VAZA 2YJ4A 3I0MA 2DKFA 2LKDA 2YWEA 3AQ4A 3E82A 3GVXA 1PFGA 4ZT3A 3BORA 3I05A 1XJWA 1ZJ5A 2OCGA 2XDQA 4MS3B 4A9AA 5E3HA 1ABBA 2H5JA 2ZJ4A 2CLKB 4B74A 2NU7A 4HAXA 4AJ1A 1U0RA 13PKA 2V55B 4ITVA 3NWEA 3C45A 4IIEA 2ZYWX 4OF4A 5AIAA 4X7BA 4YJGA 5K9ZA 1NJFA 2H2IA 4TXNA 5SZJA 2V9ZA 1X80A 2I6GA 3IXMA 4M87A 2HLDD 5ETJA 1DINA 1ORWA 5F33A 3SIPA 1E8MA 1PL6A 4KFUA 2AB0A 2PKEA 4MGHA 4MI3A 4BLTA 2ZSUA 2UUBB 2R25B 2Y92A 1TEZA 3TN7A 1K9VF 5AHKA 5AJHA 3AVTA 4KR6A 2EJBA 4BLRA 4NBRA 5HXAA 2CNDA 6GPBA 3ZIDA 4H1TA 5C1IA 3SC2B 1Q1QA 3H2ZA 4UU0A 5KYWB 2CD7A 3R7AA 3RSQA 3HFRA 4KWEA 4E5DA 1FTSA 1Y3DE 1QBGA 1WCIB 3FKSD 1A2BA 1DJPA 2W9XA 4F71A 4WK0B 1OC2A 2R44A 2VJLA 4BJ3A 8MHTA 4D8UA 3CH4B 2IHYA 2QW8A 3HCCA 2LCFA 4YJHB 1IONA 5HM8A 1K63A 4I4CA 3FA2A 1CDOA 1EUDB 2D6FA 4NJEA 3OTGA 4BZXA 2QHXA 4M46A 1QMPA 2FX5A 5CXXA 2AMYA 3V46A 4I1VA 3QVXA 5A4AA 3WYBA 4EY7A 2ZRPA 3WSTA 5FORA 1HLDA 2J3KA 1WQ4A 1V3TA 3RSLA 1K68A 3N76A 3SR0A 3H0EA 2D1YA 2IEIA 4FC7A 3E9MA 3BD9A 3VR2D 3ENQA 3A26A 4QX6A 4XVRA 3ZHCA 4S04A 1YI0A 3TPZA 1YDHA 2P0AA 1VLVA 2R6CA 3UK7A 3PNKA 4J3NA 2Q1SA 2VK8A 1NVVR 1A76A 2YXDA 3OJWA 4QBGB 4P83A 3FMIA 4JXZA 1VJCA 2F1IA 3A9RA 4F5EA 3Q12A 4S1TA 4F3CA 4ETWA 4D0RA 2O2JA 5TPZD 2RONA 3PUVA 3IJ5A 3UMRA 4E6EA 3GJ3A 3D8RA 5CJ2A 1N32B 2OZPA 3CW2A 3JQGA 1VKOA 3VHQA 4BO1A 3BL5A 1ZUIA 4TTIA 1CRPA 1MX9A 1Z13A 2H9AA 4P38A 3EUAA 5EMLA 4BASA 4FJ0A 2M98A 5EMKA 3CQ9A 2CBGA 5I7RA 3CKLA 1PFQA 1T5TA 4L3VA 3AINA 4UCFA 1NNLA 2HKIA 3HXOA 2OAP1 1ZSNA 1B0AA 1WLSA 4GBJA 4YJKA 3BREA 2YVLA 1PR0A 3ONVA 4G97A 4JLOA 4IICA 4PZCA 5F1KA 3ZV7A 5HOEA 2ECOA 4MR9B 1I3OA 3ID6C 1A96A 1NXSA 3OPXA 4GMDA 4ACBA 2W8BA 3K96A 4M83A 3H1PA 2VTDA 4O5OA 4DCTA 4EX6A 4MHSA 4B75A 4EGFA 3FHOA 4M1TA 4U2KA 3ZDRA 4G1VA 3OZ7A 4Q24A 2QUJA 1KA9H 3BZWA 3FUXA 4PGGA 4B6EA 2HHHB 1NW6A 1QOPB 1Q6ZA 3VYTB 1XA3A 1M2FA 3M0EA 1NJGA 1H6AA 5LKAA 3PTAA 5IC5A 1P5JA 3MS7A 4M1YA 2ONCA 2EFHB 4X7PA 2V0GA 3TR6A 3D4IA 1PR3A 3FFXA 3U40A 1CEQA 5DYNA 4XWWA 4KSBA 4DR3B 2EATA 2PLWA 4DLVA 1DLJA 3SKYA 5FUBA 2JKZA 2R97A 3EF0A 5K0NA 1UKVY 2NV6A 4COKA 3WP1B 2VKTA 1DNPA 1GTZA 2QL9A 3C7CB 1ZFNA 4MWGA 1MJHA 1TIBA 4QUAA 1CBUA 5AUNB 5BMVF 5K6TA 2CFTA 2ZIUB 3AZOA 1JBEA 2WVGA 3OX1A 4B4OA 2A9VA 1QHHB 1F8FA 2NO4A 2ZE7A 3IMCA 5DGCA 1Q74A 3SFTA 5MHTA 3R74A 3E0QA 4H15A 4JVLA 3FUCA 1RWXA 4FZRA 5IAKA 3ZWDA 3AHDA 4EKGA 3OO0A 2Y9MB 4Y7CA 4DQ0A 2WIDA 2PSEA 3ZHYA 2UVPB 4ESOA 2WG0A 1XPRA 1BX0A 4F4UA 3SP1A 1DX4A 2CF6A 3FNHA 3WOVA 2IXFA 1J56A 4QPPA 3M6XA 1GL6A 2EWVA 4D99A 4EA8A 3CVWA 3JQBC 2R1UA 4YAFA 3JQ6A 5I3ZA 1KDTA 1LLCA 4KQ2A 3KQTA 4NHOA 1G9XA 4QULA 2O8CA 2COUA 3L8FA 5FO0A 5ALKA 1EAYA 4JGIA 1XQXA 4HQKA 5EJFA 3TL2A 1P31A 2VA8A 4CKEA 3GT4A 1ECLA 4DXDA 1GZDA 2R8BA 1DQYA 1XF9A 3V6LA 5KMGB 1GRNA 1PYOA 1VI2A 1GZ7A 4HEQA 1ZM7A 3FYSA 1SHTX 1IB6A 1J70A 1PT8A 3IERA 4BP8A 3TPCA 1WABA 4B7CA 1FFHA 3LWDA 3CUUA 4ZZ3A 1S7GA 4YACA 2C2BA 2L42A 2FZKA 2ZJOA 4MRMA 1QQBA 4EEZA 4EZEA 2IY7A 4P8RA 4PZAA 3ZU6A 1I8TA 2YY6A 1D1SA 4LSGA 1XMPA 1A8PA 4HDAA 3OY2A 2PCLA 5DHRA 1GY8A 3B3FA 1R0XA 3VHXB 4IJUA 5DHTA 3RIGA 2VP3A 1P2DA 3S68A 2WHYA 3D4BA 4QPDA 3U4GA 5CJPA 3SE7A 2H7YA 4BBAA 1OFIA 5CHEA 1XNHA 2VR1A 3H5WA 2HIAA 4LRTB 4XJXA 3A06A 2OPHA 5SYNA 4GNRA 3CE6A 1IZZA 3ZVNA 3QF4B 3SG0A 3T9EA 2P1DA 4AF8A 2QN9A 2FOXA 3DNPA 3N2LA 4KJZA 1VC2A 1DJOA 4AL4A 4BQQA 4P0TA 3ZG6A 2WJPA 3ZOZA 4Z1OA 1E3MA 3VKGA 2N1BA 3OAAD 4R5MA 2XDWA 3TBFA 4D82A 2D3WA 2ICAA 4G65A 3NKLA 4MARA 1N2JA 5AO9A 3AF4A 2NYUA 4BLQA 2CXHA 1GA1A 3DTVB 4P3YA 1NF2A 2V3VA 5CDFA 5B4UA 3IFSA 4H27A 2PS0A 3AEKA 3OJFA 2P9CA 3OC0A 4P36A 3U6KA 3TFOA 1G5FA 3WQQA 4HAYA 3MINA 4KQXA 1XB2A 3GFBA 4N4AA 2IYZA 1X80B 2CDRA 5BWNA 2GJKA 4AD8A 4RJJA 1CZUA 5BYKA 2B61A 5EC8A 4JI2B 3H2HA 1U1GA 4Y2PA 3C4QA 5J9FA 2C9DA 1CRQA 3ER8A 1M7BA 3MAGA 1C7FA 4MWDA 2IEBA 4UEWA 3U7RA 5JHGB 1FP4B 3LQ2A 3SBOA 2V7UA 1JJ7A 1T1SA 5EZYF 4MQLA 4WXEA 1PW5A 2FP3A 4G01B 3QH4A 3PUIA 1TA4A 4HAVA 4KQMA 2VC2B 3IR6A 3U3ZA 4ND8A 1ZIYA 2C77A 2IRWA 1YE3A 3TUIC 2YN2A 4TTQA 5IH3A 2OHVA 5B3AA 1U2SA 3W5IA 2XVYA 3WL7A 4D9EA 4DQDA 3E4CA 3NYIA 4XX0A 3VX4A 3AETB 1ISPA 1BU5A 2RHMA 3FVRA 3JTMA 4PVCA 5F3RA 5E1DA 1E2NA 4QLAA 2CWDA 4ZMRA 5AVZA 1JG7A 1NYRA 3RR2A 5FPPA 5KNDD 3JVIA 1U0FA 3WTCA 2QQFA 2Q9AA 2QPAA 1E99A 2PGJA 3N7UA 1B23P 3F3KA 4C0KA 3T9CA 2C82A 4MWSA 4N0EA 5KVAA 4L5CA 4PNPA 1QPBA 1CB0A 2WKPA 2BJWA 1N2XA 4M9UA 3G2KA 3QFFA 1FTYA 2X4LA 4FINA 5F2KA 4YAGA 4HPJB 2NP6A 2GFIA 3KHTA 2VEOA 3TRHA 4QHTA 4BVAA 3FXAA 3O3CA 1L4GA 2C04A 4LGCA 5AW7A 2WMNB 2JIPA 4K6KA 5KQLA 1FNCA 4Y2XA 4YRMA 3UG7A 2YV5A 2ZIXB 3LUJA 3WGTA 4W9NC 3S2YA 1KBZA 3AJEA 3C6MA 3DTVA 4I9FA 4KLZA 5KNCH 5CBPA 5C1PA 2DE0X 1C4OA 3BWBA 3ZY4A 1HYGA 4B6OA 4JWKA 2V6IA 3A05A 1N2GA 4GX5A 5AP9A 4OK5A 3CEJA 3V6MA 2HPHA 4OHVA 1XNJA 3EEIA 4KUGA 3P0HA 3FKSA 1XRSB 3UMCA 2AG8A 3UMFA 5JSFA 2WYUA 4LBZA 4NYJR 5FULA 2WB4A 3RPEA 4P3NA 5K03A 2F8MA 4QSHA 4CTMA 3JR3A 3OD5A 3FTCA 2J45A 5JMPA 5KNCA 1RXIA 4A1OA 4CR7A 1YA4A 1ZIDA 2FB9A 3ZEIA 2Z4SA 5TIIA 3WNDA 1UOQA 4ZZ1A 1NHWA 3O4GA 2IVFA 4RA9A 4Q9IA 3OZWA 1N2CB 1YOBA 4ZU1X 1VLLA 2QQ5A 2AFHE 4XXHA 2LUOA 1ZD5A 3E61A 4MVJP 1Z4OA 4OY3A 5G0VA 2G9NA 1LWOA 1H1LA 4UPDA 1U0OC 4QRIA 1C9YA 1I7NA 3HB4X 1XPOA 5CNJA 1EZ1A 1KJYA 3DM5A 6REQB 4RF3A 2G63A 3HS3A 3GOQA 4Y6RA 2J41A 1TJPB 4QEKA 3SCZA 4HC4A 2OXFA 3AL2A 1PT5A 4FOSA 1A9PA 2PGNA 5FBLB 4M0CA 4M7PA 4ON9A 5B12A 2DEUA 1LX7A 2Z3ZA 3FMPB 4F12A 3PXDA 4OMUA 4BVJA 3V4ZA 1G7CA 1DFIA 1UPFA 5EE5B 2GK7A 2R96A 1CJVC 3LBFA 4TTTS 3DWFA 4EITA 2ZAYA 3MCUA 3KD2A 4ZQBA 4E94A 5KQSA 5KNLA 2FF7A 4HAZA 3IMGA 3SC3A 2ST1A 4CG1A 1EFRA 3C6ZA 1Y6FA 1RC1A 3HR7A 2AEJA 3MWFA 4GP6A 4C87A 2J3IA 2GJAA 1H94A 1AS2A 4JVMA 3BTUA 1NQXA 3OLWA 4LNAA 3REQB 3PK0A 1LBQA 1Z75A 4QUEA 4XM1A 1EVKA 3OCUA 3EFHA 1DPGA 2AN4A 3D5TA 2GK4A 4N3CA 5DM1A 3I52A 3JRXA 3JYHA 2OENG 3BCSA 1YI1A 2XBUA 2LDBA 4N01A 1UK7A 2IW3A 3OZUA 1ELOA 2GNPA 4GOLD 1MEOA 3QFTA 3ZZ1A 3K5WA 4YMGA 1XCLA 1W1IA 3NGXA 3KSZO 4LY3A 5GIPE 1LK7A 1P4JA 1I4DD 5KU1A 1AQNA 1DCMA 1XTVA 2QTLA 3LL4A 4X8LA 3QI2A 1ZK0A 2QVCA 4ATNA 4C1NA 2P6NA 3LIIA 4YUXA 3OZFA 4EGCB 4H60A 5DHUA 2J3LA 1QIFA 1FDSA 2AG0A 2BFPA 3MJFA 2CY0A 3NORA 1ORVA 3S2SA 3TNLA 4AT1A 2C99A 3IQDB 3COWA 3UBTA 5CCEA 4CQJA 2BBWA 1PQ4A 1ULAA 3KWJA 3LDAA 1WQ1R 4I5EA 4JEIA 5EE9A 5JCJD 3H1AA 1OIVA 2ZROA 3H6GA 4GSYA 4ED9A 4D42A 2XZTA 3DA8A 4OHKA 3SHVA 3TLKA 1RBMA 4NNJA 3HL0A 1BS9A 3TMAA 1D0IA 1JEQA 2FJUA 2FSIA 4RD6A 4CCSA 1N1GA 4LDZA 4AULA 4DWVA 1KJNA 2G7ZA 2CCKA 4J07A 3SZOA 2ZBVA 4IIXA 4MA4A 3TW4A 1BGWA 4RTNA 4Y2QA 4JLDA 4Y1RB 3H9UA 3TXAA 1QHFA 4EGAA 3R8FA 2NSDA 2B1IA 4AJ2A 3H42B 3AU8A 3KJHA 3HMQA 5JSHA 5MFZA 1Y80A 3LMKA 1WPQA 2XODA 4H17A 1F06A 1E2EA 4XSVA 5CAEB 4F11A 5L3QB 1RAHA 1JU4A 2J1LA 1U3VA 4E11A 5IBPA 4TXLA 1H93A 5T57A 3II6X 4MWBA 2PKRA 3GP3A 2QL6A 1ZR2A 3DZCA 1R5NA 3H11A 5THQA 1GAEO 2PVPA 4DMMA 2R8PA 1EQAA 3TIFA 2P1RA 4LDQA 3ZXXA 5ECGC 4QTZA 3ZJ4A 5A62A 4XJTA 2YV3A 4QBIA 3AGQA 1RJFA 4RK6A 2AC7A 1PO7A 1TX4B 4DWWA 1DKLA 2G09A 4DJJA 4KQ6A 4V1CB 2UZ0A 2ID7A 1P0PA 1X42A 1EFPB 2WM9B 4ZVRA 1I9GA 2VP0A 3EZNA 2FP4A 1FP4A 5A6VA 2XZDA 4OYHA 1CR4A 4AWXA 2X1HA 2OA0A 2B4AA 4BGDA 1NQUA 4WBXC 2R8XA 2XCOA 1KZ6A 4ARAA 5K0FA 4LZLA 2H4WA 4MS4B 4C3OB 2DRIA 2PX4A 1N0VC 4Q9DA 4X1IA 4W5OA 3JQQA 2XMGA 1X92A 3AHEA 4O2AF 5IC6A 3QI7A 4FGLA 1QE5A 1XYYA 1FP6A 1BJKA 1GKYA 1V96A 3C1AA 3MD0A 3NIBA 1L5SA 1OLUA 1HWYA 2Y1KA 4AN0A 1Q44A 5LNK6 3L8YA 4FYWA 2GASA 1T9CA 3PJDA 2FMTA 4F4JA 1YZYA 3ANSA 2R5NA 5EKDA 1W0JA 2VZ9A 4V39A 4X85A 4W9MC 1C0PA 1R8QA 4JR2A 5T3UA 5FEUA 1SBQA 3L46A 2BOVA 4DR7B 5BT8A 1ULZA 2J9FB 2QN1A 1MHPA 1I32A 1BQEA 1N7JA 2PSDA 4DV4B 2BTEA 5JASA 1OHHA 3FCUB 3OWHA 1TZMA 4XIGS 4PYQA 1QVZA 2UUPA 2FUG1 4RVSA 4UHCA 4C9BA 1J0XO 3GNSA 3MWKA 3B13B 2BEVA 5FR1A 1BCRB 3CH7A 1STOA 3BB3A 4MITA 3V8EA 3OE7D 1K06A 2AVNA 5DE3A 1BXGB 5TGDA 2FG5A 3LY5A 2OM2A 3ICOA 2W11A 1WUKS 3AC0A 1L5WA 3QVLA 4RH0A 4ZJPA 2RGUA 4UDOA 3V1YA 1YZTA 2DF8A 1GPNA 2PUWA 3AM4A 2VHYA 5HKKD 5JZMA 3ND7A 4MDHA 4MRVA 4LKRA 4S0ZA 3PEUA 3ECAA 3M49A 4JZKA 4ZPXA 2VHQA 3Q85A 1Y9JA 1X9GA 1CZKA 4KI7A 2R62A 1DWUA 1E89A 2J87A 2P41A 3VH1A 2AF4C 1A5ZA 1D07A 1T4DA 3EXIB 2OBBA 1R9GA 4HY3A 2Q9CA 1PAUA 1U63A 2ERYA 3K09C 4IQ0A 3CJRA 3D6AA 5EJ5A 2B83A 3AR5A 4TMWA 5EQDA 3AR9A 4R6WA 2EW2A 4ZQHA 1CUWA 3NC4A 3KEOA 3R40A 3L06A 3L8GA 2APJA 4WJKB 4DV1B 1ZYUA 3BGSA 1Z83A 1RMTA 2EGHA 1R8SA 3HZZA 3LLCA 4WLOA 1TUEA 2OVFA 4FCTA 1YZVA 4FN4A 2GBCA 2V7BA 5JS8A 1OKKA 4RA6B 3KUCA 5DEOA 2XE8A 1TUGA 1U7TA 3VTAA 3UC5A 2IOQA 1G38A 1AUPA 1Y4UA 3NOXA 3Q7IA 4P5EA 1G1MA 2V96A 1U7WA 2C31A 2PGAA 2EV9A 2PSSA 4PLTA 4WHMA 2WFZA 3T3IA 3SHWA 3D2CA 4RTQA 3IESA 1YZQA 2IOFA 4D5GA 1ZJ4A 2IYAA 4F86A 2O8BB 4CUKA 5JG7A 3NCTA 2YW9A 4DR6B 3JYQA 3WHIA 3MC1A 1S8NA 5GONA 3A6LA 1YCGA 1G5HA 5LZ7A 2A58A 1VJ1A 2GPAA 3Q1KA 1KMCA 2W4MA 2FHSA 3A3NA 2XNJA 3RTEA 5A1TA 5D51S 2OCDA 3RS0A 1YZLA 4J0JA 2ZB4A 4WXHA 2B5VA 4CL2A 1TMGE 4CODB 2P65A 5JXGA 4UM9B 2EF0A 1DQSA 2Q1XA 1E3WA 3EGXA 5HIKA 1Z2DA 3CX6A 3DVRX 2Q50A 1UXJA 4ZEMA 1VCOA 2JGRA 4Q1VA 2AFIB 3MRTA 1G2IA 1P9WA 1D2HA 2XUPA 5SY4A 4KOEC 3WWZA 4QSMA 4BMPB 4DIDA 4F46A 4POAA 3LGSA 3PDJA 3QM1A 4ZEVA 5JNWA 3KCNA 3VKHA 2WJ4A 3QU7A 3BDAA 4FUQA 3USCS 3I9V1 4DDTA 3TJRA 5ICCA 1UMBB 1YQGA 1QF6A 2ZWOA 1PBNA 3VQTA 2ZWMA 3O83A 4C7MA 2F59A 3UAXA 5JXJA 5IJAA 2QZ9A 1W34A 3FOAA 3KKOA 3M83A 4GGPA 5HE8A 5LZ2A 4MTLA 4PTLA 4EKEA 1H4VB 3EX7C 4D5EA 1RSZA 4R9VA 3HZOA 3DEYX 2G83A 3CNHA 2BMFA 2OO5A 2Y1OA 2WYWA 3LW8A 3F4BA 1N3YA 4Y7DA 4YP1A 4ER0A 5BXYA 3ZE2B 1UIMA 1YHYA 1PR2A 1ZOIA 1T9ZA 1ZH0A 4JEMA 4PR0A 1BMFD 1RWWA 4TT8A 2E5WA 4X6YA 1J8VA 4PCVA 5DU2A 1BW9A 3V97A 4U9UA 4UKDA 1EFLA 2I99A 5KTYA 1US8B 1I13A 4IIHA 4XPIB 1A9YA 4J1TC 4WJLA 3IKLA 1YBHA 1NW9B 3PDIB 4K6CA 4B17A 4CDRA 3GJXC 1PNTA 1V3UA 1E3TA 2GRJA 3G6KA 5GJWC 1I4EB 1RLJA 3SR3A 2BRUC 2XNKA 4HFNA 1V25A 2GO1A 2Q3EA 3AO0B 4EHJA 2WQZA 4C0HA 3I6QA 3O4HA 2CXSA 1TFUA 3FMOB 2X0RA 2A5FA 1L9XA 1P2VA 2I1LA 1T6NA 2IWRA 3A0RB 2EZ9A 1CQWA 3V32A 4UTPA 1IEVA 2ZJYA 4MW5A 4NFSA 3I92A 1WMBA 4FE3A 4BWVA 2WIGA 2HPVA 3I3OA 3IQEA 2XX3A 2BGLA 1SKAA 4ZT5A 5AVQA 1TA0A 4JLSA 2PX5A 1C3JA 1PG5A 4JU9A 5ALPA 4E46A 1DBPA 1UBEA 4O4HA 3FOEC 3G2IA 2CXQA 1RJGA 4QUGA 3FN4A 4E51A 3UMGA 3L41A 1ML3A 1WU7A 3AHJA 4BV9A 5AUPB 1NU8A 3D6NB 4Q93A 2QPTA 4LZZA 4ZWNA 3R9IA 5KDDA 4BNMA 1H23A 3Q8XB 4F3KA 4RBNA 2PUFA 3L18A 1UKBA 1Y8CA 4MUYA 1EA7A 2MSNA 4YJ3A 4YP0A 5AI4A 5JDCA 2WYVA 1ID8A 2A59A 3DW3X 4BAUA 2AMFA 1VPTA 2NU6A 2PX3A 4CCYB 2OQIA 3UEOA 3VR6D 4C04A 4WMLA 4GSKA 4KPYA 2QB5A 1Q77A 1AG9A 3AJDA 1QYRA 3L6CA 3TLAA 3V2GA 1OH7A 2JLCA 2HRCA 5KHLB 1GNQA 1WNFA 4G5HA 3D0QA 3GZNB 4MQ4A 1J09A 4JEHA 5J2UA 2Y1DA 3MHPA 3L02A 4EZBA 4FYXA 4Y6LA 2DBRA 3B6IA 2AOWA 3LW7A 2B1RA 2GYUA 5K05A 4BQFA 4M0KA 3N8KA 1JDBC 3H86A 2W6OA 3LHIA 1NLZA 3C3BA 3KL2A 5DB4A 3SJUA 1GEGA 5K8IA 1LBIA 3ZY5A 1ZO8A 3IXQA 5J63A 4MW6A 2GXUA 1NXPA 4GMXA 4F92B 2YIMA 5J58A 4I1UA 1BNCA 2YY7A 4HDOB 4WNAB 3ORQA 1JFSA 3AKCA 3A1FA 1GTJ1 4JA0A 3IBSA 1DARA 3Q7PA 2YVUA 3D6HA 5HVNA 2HQRA 3W9YA 1H9CA 4W9NA 4E4RA 3KWLA 5CFQA 4MXDA 3WDMA 4C2BA 4MQEA 1GKLA 2G5TA 1JQ5A 3HRHA 3QXSA 4PRLA 2HJRA 2V6BA 3GJ5A 4RK7A 4DILA 4FFDA 1PDWA 3PXBA 2QIPA 3WIDA 3GFQA 4H2DA 2FW7A 3NT2A 1Q0UA 1TL7C 4JAVC 5AOAA 3LV8A 5EKTA 4C0XA 3LNTA 3V4FA 1UBJS 1RJDA 3FVWA 3KSRA 4G63A 4RSMA 2Q46A 2ETXA 5IZCA 1E66A 1JDPA 1CFJA 4PRZA 4Q3LA 3T34A 1XVTA 2HHCA 2Y71A 2ZWIA 3C5HA 4AUNA 4G26A 4ZP1A 1VG9B 4BQNA 1Z2PX 5FWYB 1E3WB 2CMFA 2J4CA 2Z9DA 1IOVA 4GVXA 3SJ7A 3VR4H 1IG3A 2A0KA 5AKIA 3GLGE 4KFCA 4QXAA 4MWCA 1ZU5A 3W05A 1RADA 1OYWA 3OMLA 4BO9A 1WTCA 5L3RA 2MR5A 2AXEA 3VKUA 1IPFA 2B6HA 3OFVA 3O8OB 4UBLA 5H02A 4XSGA 4KPEC 5KHAA 1M2OB 4IV0A 4KV9A 4YRRA 1Y6GA 4WLNA 1K3UB 1EFUA 1QG2A 3F0TA 5FJIA 4AS2A 2Z6QA 4JLJA 4LOIA 4WZZA 1BOOA 1I3LA 2QBYA 2I8LA 4UPVA 2W71A 1BDBA 3DMGA 3ASUA 3JZAA 3L1KA 4CKBB 2GWHA 3RC1A 1DO8A 3L0IB 4IGFA 4BQIA 3THSA 5I9SA 1FXSA 2P4UA 3AG6A 4CLOA 4X1YA 1RVV1 3GLHB 3LUPA 2G88A 3BK7A 3GFOA 4O2AB 1NRWA 2QX7A 4A6PA 5KBYA 5HIAA 1YK0A 2DWPA 4KLRA