4UNVA

Covalent dimer of lambda variable domains
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
108
structure length
108
Chain Sequence
ALTQPPSASGSLGQSVTISCTGTSSDVGGYNYVSWYQQHAGKCPKVIIYEVNKRPSGVPDRFSGSKSGNTASLTVSGLQAEDEADYYCSSYEGSDNFVCGTGTKVTVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Formation of Amyloid Fibers by Monomeric Light-Chain Variable Domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords IG LAMBDA CHAIN V-II REGION MGC
total genus 23
structure length 108
sequence length 108
ec nomenclature
pdb deposition date 2014-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4unvA00
5KVEH 3S5LB 5J1AB 4G8GA 5MHSD 4X7EC 2QQLH 2OK0L 4RWHA 5CEZL 5IMOB 1IGML 5KJRL 4OQ1A 1J9CT 3D69B 3AS1A 4OUUB 3OGCA 5E4EC 1H5BA 4G7VL 4LGPB 3EZJB 2MJWA 3DROB 1EO8H 1QD0A 5DJ6B 2CIIA 3KLAA 4NM4L 5EZJA 3FO9A 4JFHD 1X5KA 3NPSB 3IU3A 5TDOA 1IAOA 4L9LC 3QQNA 1U3HC 1LK3H 4PRNB 3WIIL 3HPLB 4RX4D 1FORH 4NC1C 2C1PB 3GMMA 3L95A 3PL6B 2HRPH 2G60H 2XYCA 3SDCB 1Z9OA 1KTKE 3VMPA 1CLYL 1RV6X 1EZVY 4ACPA 4D3CL 3OB8A 4OLZL 4K3EH 1LHZA 4LEOB 4J4PA 4OBRA 2J3SA 3L3OA 4P46D 1NCCL 2GTWA 5GZND 4UU9B 2GW5A 2I9TB 1Y6MR 4XXCA 1F97A 3PIQA 5DA4A 3TA3A 1HQ4B 3DVGA 3LN5B 1QFUL 4Q9QL 4M7LL 3ZDYE 3OPZH 3U0WL 3BGFB 3FO2B 2EDLA 4X6DF 1M71A 2FH8A 3GKWL 3W9EA 4JFDE 5CBEA 1B3JA 1UFUA 4X4XA 1HINH 3IGAB 2YN3A 1VFOA 3RU8H 3R8BB 1A1OA 2BSED 3IKCA 3WLBA 5DQJA 3UYRH 4AEHH 2QLVB 1I8MA 5L2KA 1GAFH 1AC0A 3BPLB 1RVFH 5FYLE 1C1EH 5KZCB 4HGWB 2C26A 2B2XL 5EU6E 2PO6A 1G9NC 2PTTA 3DECA 5FXCH 1X5GA 5A2FA 3QPQD 2AABH 3QR2A 4KHTH 1B4RA 4AZ8A 5FOJA 4NPYA 2CGRL 2OTUA 4PJAB 3EJZC 4N0YL 4MLIA 1LE9A 1PX3A 3PGDB 3RWHB 1QFUH 1S3KL 2UWEB 4HWBH 5MEPA 4X6DA 5ALCH 1NBZB 2R0KH 4ZAKB 5IFJB 1D3CA 4NNYB 1FYTB 4KI5D 4XWGL 4HH8A 3QUZD 3LPFA 4EUPG 4NZRL 1MCHA 5FYLD 2D0HA 2EO1A 3WSQL 4NQEE 3NBNA 5GZNC 3H6JA 4U0QB 3FQRA 3BP5A 2NY2B 3K4AA 4DGVL 5HGAB 3L3GB 5ISZA 1BLNB 4PPTA 5C2UB 4I0PD 5EO1B 1MLCB 1HDMB 5DRWA 1N6UA 3RZCB 4NWTH 3ZYZA 1EV2E 1U8KB 2V5YA 1NL0H 2VR4A 1ZLUH 3G6JA 4AEIL 1QQDB 1I4FB 3EHBC 4LLWB 2F54E 3C6LB 6FABL 1KLGB 4C4KO 2VNCA 1JFQH 2YPLE 4WJ5A 1I7RA 3UROR 4JFYA 5J12C 1DBAH 3M17B 4L5FL 1FNGB 3QA3A 4DEPB 3QEQA 3RBSA 1LGVA 4N1CA 3BVNA 4NQEA 4IIQB 4Q9RL 3FRUA 4K55A 5JQHC 4TSBH 3QHFH 2AGJH 4GRLD 4ZNEE 2DBJA 4PB0L 4PJGE 1WTLA 5D70L 1RJYA 4HQQL 5FKAB 1TTUA 3O9WB 5JOPE 4UT7L 3QNXB 2VIRA 3OB0H 1K9TA 3Q5YA 3CMOH 1DQQA 2VZ1A 1IGIL 5J13C 3BFOA 4HGMA 5GSRB 4U1NB 2PNDA 2ZSWA 4CMHC 4Y5VB 4V2CB 5GZOC 1QBBA 4EBQL 4YR6A 4JM2D 5IMMB 3HN3A 3WNMA 5LCVL 1J86A 5JXED 1ZA3A 4CW1A 2NXYD 4O2CB 4H8WC 4UILH 4JO2L 4P2OA 4N8VG 4CU8A 3DHMA 4MZ2A 3KYOA 4YDVB 4C56A 3TBWB 1XIWC 2A38A 3T4YB 1AE6H 2C3VA 3IYLW 4Z18A 1WAAA 1H3PL 4JFPA 4X5XA 1CD0A 1HXMA 1RZKC 2FIKB 5HHOB 1M05A 1JUFA 2DQIH 3NVQA 3SGJA 3L3GA 5ISZB 4KK9D 1N5YL 1AGBA 1LK2A 4YBLB 1LO5B 3FZUD 1K5NA 4P0DA 1KULA 2MCG1 3VDBA 5DC9B 2PW1A 3GNML 1M7IA 1NBZA 5EU6B 5C07A 1OAYL 1S5IL 1L7IL 3OBAA 1JYWA 3HNSH 3MLXH 2BCKA 2CKBB 5AWNH 4QOKD 4XNXH 3UTPD 1P4IL 4JDVB 4Y19D 4KJWC 1Z9MA 5E5MA 5I17A 1J1XH 1C1EL 3BZFB 4Z76B 1W72H 2BVQB 1CLZH 2ZUQB 3KYMA 1TZGL 1YJDL 4WHDA 2QJDA 3O3DA 1GOFA 2AVGA 4RMTA 1JGUL 3I02A 1EGJA 2ATKB 2KL6A 1PVHA 2Z31C 1J18A 4N0UA 3AS0A 3WN5A 1INEL 1JRHH 3O4OC 5D1ZD 3PL6D 3LB6C 5GS0L 4LQFH 4OLXH 3RKDD 3UJJL 1LP9E 5DHVB 3MLUH 1T5WA 2GJ6B 4M48H 2YSSA 2QHLA 3MLWH 1PQZB 1JGLH 5KANI 4H25A 4OGXL 3CMOL 5IB4B 3NFNA 4RDQG 1MOEA 5IT2H 4XVJH 4KJPC 5L2JA 1CFSA 3O6KH 4QWWD 1E4WL 1HXMB 2FIKA 4H0IA 2LV4A 2D31B 3ZHLA 1Z6JT 2N4IA 3MV8B 3SDYH 3VG9C 3BT2L 3KPNB 1LDSA 4U4BA 2C7UA 5TE6H 3DUHA 4P2OB 2NXZD 5HD8C 4JY6A 3HB3D 5EC2A 5GRZA 1BGXH 4KJWD 4PBXA 4OQTH 3QNYB 4ELME 3WN5C 2WK2A 1FL6A 5JTWA 4J2XA 4ZUUA 4Z7WA 1QSEB 1IC5L 1GGCH 2ADJB 2DJUA 4UBDD 3MRCA 1S9VB 2FD6H 4DVRH 4ZNCD 3VFMA 4DUXA 3QH3B 4XP9H 1BMGA 4BYHA 2HN7B 3UYRL 4NJAL 3KPTA 3U4BL 3TZVC 2BNRD 1PBYA 3RAJL 2ZUQC 4E42B 3VRJB 2OX5A 3NPZB 3L5XH 4GFTB 1OT2A 3CC5A 1G7QA 4ZOCA 1FYTD 1BOGA 1SJXA 3RIAF 1CTNA 2P8LB 2PO6D 3FB6B 4S1DC 1MLBB 4OZGA 1QSFD 1UH2A 1YQVH 1T6VN 2QTEA 1JN6A 3HE7C 3UC0L 1PJ9A 4HWUA 2VN7A 3QDME 4JRYA 4XCNA 3NN8B 4Z8FL 1JHTA 3F58H 3SDAC 4XCCH 3VWJD 1I7RB 3FB7A 4JZNB 4O51A 5DVLA 4WFFE 2DM4A 3MMEA 5KBNC 3G5VB 2BY1A 3I3EA 3MV9B 1YY9D 1AIFA 4JFFB 5EU3A 3EAKA 4NSKB 5HGDB 3SKOB 3H2WA 4DZ8A 4ZS6C 2PTVA 1KCVL 1IGCL 3WIHL 1KCRH 5HTSA 1TVBB 3RZCA 1OAXH 4NYLA 3PGCB 4M9OA 3RNQA 1A7QH 2G2RB 2JK5A 3BEVA 5E5RB 4Y8AA 4LF3B 1T1WA 4HBCH 3PUCA 2GK0B 4PY8I 1RZ7L 3B2UD 2MKWA 1XZ0A 4AIXA 4ZO7A 5TQ2H 4NHUA 3VGFA 3LY6A 1QO3B 3Q5OA 4PBWD 1BPVA 1OAYH 4L3ED 3FO0H 4XNUH 1AGDA 5EBLA 4P5MA 3D2UA 1QFWI 3E3QC 5FGCB 3TBVB 2C1OA 4X6CF 5HHPB 4NKDB 4R26H 3P0YL 3H9ZA 3MRPA 1TZHB 4CAGA 5DQ9A 4S1DD 5TE6L 2YA2A 4WTZG 1RMFL 4YHIA 1XF4B 2ZG3A 4GUPA 1S7RA 4LEXH 3T3PF 5EU7C 3NN8A 2NX5E 4J3TA 3ZLQC 2GK0A 1KBGH 3RJQB 3PGFL 3MQIA 5FGBC 3ROLB 5DQJB 1F4WL 4S11A 4XP1H 3BGMA 2CRMA 1HZHL 4NYLB 3WV0A 3H7LA 4YFLI 1NANI 3KYOB 4YDVA 4ZTPH 1RK0A 5FHBL 3J7HA 3RDTA 1KPRA 4HBQA 2LAGB 2JJTA 3T8XA 3HTLX 3VDCA 3CX5K 2FZ3B 4GRMA 4RAUB 3WLWD 1A7PH 3VFVA 4LCUB 3GIZH 3RIFK 1MFNA 3SDYL 5D7IA 2XKUA 3S34H 5CLTA 4FXGB 4FFYH 3MFGB 4I9WD 2WIIA 3MJ9H 1KLUA 3JVGC 4YDJA 3W0WA 1XEDA 4UNUA 3DRQB 2O93L 1X9QA 2VLJA 2NY5H 5BVPL 4OFVA 3O6MH 1CIUA 3SDXE 5BRZE 4RRPA 4PJBF 4H1LG 2C1PA 2NNAA 2W60A 2D7TH 4OTXL 4DEPC 3CVIL 1V3LA 4BSJA 5F7YC 4JRXE 1JMXA 1CGUA 4DN4L 1IAIH 2D31A 1TCMA 4NKIL 1PG7L 4MA3B 3RZWA 3DROA 4EI5D 3ILQC 1TQBB 4NBXB 4WRLA 5TJWK 4BKLA 3EZ8A 3FRUB 4UI2A 2AV7A 3SE8H 3O2WL 4GLRH 4FXGA 4XH2A 4H25B 4IRZH 2Q87A 3L5XL 1OOAA 4ONHA 3UCRA 4UINL 5DC0A 1ZANH 3VE0B 1HNGA 2QL1A 3HCVA 4U6TA 1KCKA 4Y2DC 2ARWA 3BIAX 2EIZA 1C16B 3PP3K 4YAQA 2BNRE 2KKQA 1MI5B 4P2RA 2VDKL 1ORSA 4TSBL 4XPTH 2O5YH 1RMFH 3BPNB 1CZ8H 4PREB 1X5IA 2DLHA 1UCBH 3CVHA 3C5ZD 2IC2A 3BP5B 3WCYA 2YKLL 1UENA 1X4XA 4M4PA 4MHHG 4M6MH 5CHNA 5ELIA 5CEZD 5I1JH 4P48A 4PYGA 1XF4A 2YC1A 2XQYK 1H8OA 4YHIB 1NCWH 1DBML 2RBLA 3ZE0F 5GS1A 2UWEA 1CDIA 3I3DA 2BVYA 3LS4H 4XMKL 3UZEA 4HMDA 3I3BA 1L9NA 1PYWA 2VZTA 3GBMH 3UZQA 1D6EA 3ZT7A 4UQ2B 3DRTA 4UV7L 5ALBH 3QQ9C 4P5MB 1AGDB 1QNZL 1IARB 1JUFB 2FNBA 1VA9A 4RCAA 1HHKA 3FMGL 4JPIB 2PTTB 4M5ZH 4BSWA 4UQ3A 2CQVA 3V7MA 5E99L 2WP3T 4YGVB 1OGAD 5CJOL 2PYEE 2Y06H 2FYYB 3MCLL 4QLRA 4UAOC 2NR6D 2JJVA 4YXLL 1J0YA 4OCWH 2B4CC 3PQYA 1A1OB 2M1KA 5EPMA 3VE0A 2GTZB 2CIKA 4OZFG 1Q1JL 2X1XR 3ZHKA 2IGFL 1TJGL 2H8PA 2YOCA 5MP6L 1TJHH 1G9ML 3H3PL 5TPWL 4L4VB 3QWRD 1MCWW 2APWA 1R0AH 2E7BA 4U7SA 4FZEL 1GC1H 3SO3C 1IM9B 1QRNA 4M8VA 1YEJH 1A3LH 1RHFA 3FMGH 5MEND 1DFBL 4H20H 3RWGB 3WBDA 1EUTA 5DSCB 1KN4L 4MA8H 4GG6E 3K74B 2VN4A 3OKKB 1HK6A 4KFZC 5F7EL 4LRNL 3JWOL 3ZTJG 5SWZB 3VXUE 2AEQL 2OL3H 3L9RB 3ARFD 4R4NC 1KLFA 1PKQA 3HPLA 4L1DA 1M7XA 4L4VE 4E42A 3EDDA 2LU7A 3LHPL 4NQEB 5M94B 4MB5A 3HAEB 1FSKB 3DVNA 4LVOB 2A0LD 2ZJSH 5FCUL 3SE4C 2VAAB 1MHCB 4RMSA 5KSVA 5F1OB 2FZ3A 1F4AA 3IDIB 1ZWIB 2H2SD 5CWSA 3VG0H 1CVRA 3TC9A 3TBYB 1DQQB 4TSCH 4KK8D 2P5WB 5I16B 1N6QH 2IALA 4YBHA 5ESQA 4E41A 3PWUB 4QXWA 1CS6A 5IVOA 5I19L 4X7FC 3DGCR 1QRNB 4ODVH 4R4BA 3P0YH 5E9DE 4MCYB 3A6OA 3L3HA 4X0KB 4L4VA 3WJJC 4ZS6D 5AYQA 4HX1A 4ETQA 3MACL 4UV7H 3ALPA 1BJ8A 4GUPB 4R2GB 1CFSB 4GRMB 1K3ZA 4PRDB 5DD1H 1KLGA 1OCWH 1G1CA 1FE8L 1FNEB 1NGXB 4ODTH 4PRPD 1T5XA 2OMNA 2M8XA 4HZLB 3BKCH 1WCBB 3AS3A 4HPOL 3VXRE 5KVFL 4KRNA 3VH8A 3JZ7A 4HS6A 3KPMA 4JQVA 3HKFA 4OLVL 1AGCA 4PJFB 5DJCA 1DSFL 4EQ3A 3G04A 3GBLA 4OIIH 3BPLC 1WCQA 4OD1L 5HYJD 4TUOA 1N0XL 4WI7A 4KMTL 5B3JF 1FYTA 4NNYA 3MACH 3RWCA 4ZXBD 2NY3D 2HH0H 3GI8L 5MEOA 4CVZB 3ZYIA 3KPLB 2EDXA 2HG5A 5F8QC 1FNEA 1NGXA 4X7CC 2A83B 3SHSA 3U1SL 2VDPL 4HULB 2OTPA 3LN5A 3MMEB 3V8CA 5DZNA 1EHXA 5GGUA 4JEGB 1FFRA 1K6QH 1K8DA 3GMOB 2E27L 2X1QA 2I9TA 2ZNWA 5JIHA 1KPVB 3GSVA 4NWUL 5E6IB 1OQOA 4S1SH 3C5JA 4YAQB 1AQKL 2VQUA 4I4WA 4XNQA 1KEGH 4HK3N 4G7VH 1CIDA 2YPLB 4LVHC 4JY5H 3TJHD 2AK1L 2XA8H 5JXAL 1YUHB 3LMJL 1NC2A 3QQ9D 4HS6B 1D9KB 1FYTE 3WLWC 3VD9A 1TFHA 5B38A 3TBWA 4C56B 12E8H 3AREB 35C8L 1WCBA 3K46A 3DHJA 1IFHH 2PTUA 5EUOA 4HDIA 1A9EB 5EU3B 1IBGH 2X4OA 2GAZA 3F7VA 5DWUH 1MHCA 1VGEL 4P59L 2AXGB 3MZGB 3O2DH 4G3YL 2J8UF 1MHPL 4GXVH 4HFWA 4XCNB 2QSTA 2BERA 4X99A 5DJAB 5J1AA 5HI5D 4LSRL 3OAYK 3AM8C 2UY7A 2XWJA 1W8NA 1FRGL 4ISVB 5C08A 3IDJB 3PWJA 4ODBD 5DYOA 4LLVA 4EI6B 2FO4B 2HVJA 5IG7B 4JY6B 1MVUB 5DD1L 4GW4A 1FN4B 1ZT7B 4PRHD 1I8KA 4X9HA 5GS3A 4ZG1A 1WZKA 4XI5D 5EUOE 1ZHLB 3RWGA 1YMMB 3TFKC 4U3HA 1KTLA 4LCUA 3TA3D 5DWUL 1CLYH 4JKPL 1H5BB 1GRWA 3PXHA 5K9KB 1RJLA 3T2QA 1FV1B 2GI7A 4ZSOE 1AJ7L 1XIWD 1ONQA 1UEYA 2GJ6A 4M61A 4HG4K 3CIQA 1NKRA 2QKIB 3ILPA 5ENWB 1NCUA 2F53E 2JCCE 3UX9B 3A67L 4XPGL 1E4KC 4D3CH 2ICEB 1CXFA 1FGNH 4WFED 1SVZA 3JTSA 1W0VB 4W6WB 1YYML 2VXVL 4N0UB 4ENEC 4GRWB 1HKLL 5B39G 3MV8A 3O45A 2NY1D 2MKLC 3CDYA 5ALCL 4OD3L 1S7RB 4AL8L 3C60D 1Q0YH 3R1GL 4UQ2A 3V6ZA 4MNHA 3STLA 2BVQA 1U42A 1MF2H 3WO4C 3BZFA 4Z76A 2VRAA 2A83A 4M7ZC 5GGRY 3KPLA 3BH8B 4EXKA 1AJ7H 3I9GH 1QSZA 3EOAA 1PLGH 1WITA 3MODL 3PQYB 3C6LD 1K8IA 3PGDA 5D71L 4G8FA 4UUJA 4ZUSA 1LE9B 2AI0H 1S9WB 2CKBL 1UH3A 1LK2B 5J11C 4UT9H 2BP3A 5C0CD 4Q9CA 3D0LA 4UDUA 3V7AG 5T1MA 4BQCA 2FR4B 3LQAC 2WUCH 5GGTL 1ACZA 1FP5A 2DL9A 3CPLA 5B8CA 4EI5A 4UMGA 3CFEA 3ARBA 1ZLVH 5BXFA 2W9EH 3O9WD 4NT6B 1YNLH 5FUZH 3IGAA 5C6TH 1A7NL 3ARVA 3W9EB 1S9XA 1YEHL 2FHBA 4CW1B 4MGXA 1JHTB 4HIIB 2DLGA 2UWEF 3FFCD 4Z7UB 4OGZA 2V2XA 1A6PA 4LQFL 4KKBD 1DQLL 1J12A 1WBZB 4WHYG 2ZSWB 5I8EB 2C3VB 3BZ4B 1J1PH 1JGUH 5F3HA 3QDJD 4FQHB 1I8KB 4XCEB 3G5XA 3LEYL 2NNAB 5HHVH 3D3VA 3N0PB 4P59H 3JBG7 5KSVB 4O2CA 2AK4A 1XH3A 2EH8L 3VXPB 4DKFL 5DJ8A 3GIVA 5L88H 4OSUH 1T1XA 1J11A 1KB5A 3GIVB 2NY4B 2VH5L 4I48B 1BZ9A 5TDNA 3PHOA 4OLVH 5DMYA 1OTTD 2XN9E 4YIQB 3F7VB 3V6BR 2RHEA 5GGSY 3HE7D 4DW2H 3QXTA 1I4FA 4KPHH 5EU6D 1XCTA 2LVCA 3G6JB 2GSIA 2ZSVA 4I5BA 4LARL 2KUTA 2PCPB 4HXBL 5DXWA 3LD8B 5L8LB 5F9OL 3ZMRA 4H8WL 2AJXH 3C5SA 1GC1L 3ZDZE 1Z0NA 1EFXB 5J6GA 2D0GA 1KLUB 3GHBH 2DMCA 3BVNB 3BN3B 4M62L 2PYFA 2MQ3A 1T22A 4JPKL 4M1CD 2Q6WA 1S7VB 2OI9C 2WM0A 5GS0D 4BM7A 3QDAA 4HWEL 2XN9A 2G9HB 3M07A 4NT6A 3LKSB 4P2QE 2IBGA 1OGTB 3GI9H 4LDEB 4JCMA 1OSZB 3WN5B 3NCYP 1MREH 2DBLL 4KMQA 1JZ5A 2VDNL 2BDNH 5DK2A 1UCTA 2RFXB 3VXTA 2FECL 4NRYA 5GZOD 3V52L 3G04B 1A6WH 4G80A 3U7YL 1IGYA 5F1IB 1BQHG 3ULVE 4JO3H 4LMQE 1A4KA 3VWKB 4JFXA 1OAXL 1JGDA 2M26A 3DX6B 4IHOA 3QQ3A 2R29L 4JPWL 2WMPA 4LVOC 5I0DA 1P7QB 4HHAB 4Z0XB 4OZIE 2Z93A 1DL7H 1JNNL 4Q0XH 3GMNA 2XQBH 4JFEA 3STLB 2FSEA 4HUMB 4X5XB 3QG7L 4XPTL 1FHGA 3FQTB 2YPVL 3IFPB 4PGDB 3WFHB 3MRHB 4FABH 1RFDL 1UM5L 3H42L 4OZGB 4HIXH 1ZK9A 4GXUM 5D93B 3C6SB 3L95B 3LIZH 5IBLC 3QFDA 4PYHA 1HYRC 1F4HA 1DBBL 2B5IB 1ZHBA 5B4MC 4X9GA 3MNZA 3N85H 5TGBA 1U41A 1BVKA 4PD4K 5EBWB 4MQ7B 3DBXB 5JPMA 5IJVA 5DJ6A 3CDFA 3OJ2C 4D9LL 5IVNA 1FIGH 5JLZB 1GGUA 4EIGB 3BT2H 3X14B 1HE7A 1BM3L 4Z7WB 3PWLB 1OHQA 2XA3A 4PUBL 4OCRL 2Z31D 2VDOL 4X6BB 4MWFA 3PQYD 5C07E 5JW3L 5JO5B 3TA3C 4HC1A 5SWZA 4AT6B 2FX8H 3VXRD 2C9AA 4PS4H 4MA1C 2EO9A 5E1AB 4E5XB 4KTYA 3P0GB 2DLEA 5ESAA 4W6YB 3GRWH 4OGAC 3V6FB 3QEQB 4IRJA 2DD8L 3HG1D 3L1OL 2KDGA 4ZAKC 2ADJA 3Q6GL 3Q0HA 2EXWD 1WIOA 1Z9SA 3IF1B 3NABH 3UO1L 3D18B 1F5WA 4G8GB 5TGBB 2H8PB 3IJHA 2NZ9C 3HC0B 1Z2KA 3HHRB 2EDKA 2WUCL 5GRVK 5IWLC 1XGYL 1RURH 2Z8SA 4ZODA 3C60C 4Y2OA 1P53A 3P3YA 4GKSA 3N9GH 2O5XH 4Y1AB 3Q3GA 4HUVA 4L8CB 2EECA 1FFNB 5KTEH 1H5BC 3FQRB 5EORH 5DFWH 3WKML 5BJTA 5EUKB 3QZWG 3MGOA 2NX5D 4Y4KA 4M1DH 2CR3A 3O8XC 5FHAL 43CAB 3PV6A 1EX0A 3DTXB 1UA6H 4HWNA 4JO1L 4G43B 5DMIH 3T3PE 1HWHB 4XXCC 4HBCL 4BZ1H 5EBGA 1EO8L 1UACL 4FABL 1MAJA 1P7QA 4K9EL 2XOTA 2ZNXA 2CUIA 2EDFA 3T0DA 4R7DB 3DWTA 2DICA 1WFTA 1FL5A 5EBLB 4UNVA 4M1GL 1AGFB 4PD4J 2DQEL 5D5ME 4J3XA 4Z0BL 1WBYA 4XNMB 3RVVC 2OR8A 3NGBB 2FIRT 4PJ7E 3HRZA 1XIWA 3FO0L 4J3WA 4XNUL 3G6JE 1QACA 2Y1VA 1A7PL 4L4VD 2UV3A 3S37L 4YXHH 2A9NL 4HZLA 4RGNE 1JGVL 4NOFA 4PJ9C 4U6VL 3GJFA 1IM9D 5GRWA 3G5VA 4LSTL 1QLFA 4JJ5B 3PIQB 2R4SL 4LASH 4HJJH 4YPGB 3DURA 4BZYA 4OZGE 2FWOB 5DJZB 1Q72L 4HPOH 4EDWL 5D5MA 4BFIB 5DD6A 5IMMA 4HXBH 2AJUH 1LO3H 5EDXA 3RL2A 1AKJB 3QRFM 4Z7VF 3PWVA 3H9SB 3SKJL 4NCDA 4L4JA 3KPOA 1G7QB 5F7MC 1HI6B 5CD5D 3KVQA 1DUYB 4WFEE 3IAPA 4Y2DB 1IEBA 4M4RA 4QRRD 1XR9B 2Z92A 3HNVL 2DQCH 3CMGA 3RTQA 5DD3H 4OCWL 2DDQH 3DARA 5C7XH 1K3IA 1KJ2B 1NLDL 3F65A 5CBAA 3ZSTA 1B0WA 2EDBA 2OZ4H 3L5JA 4MA7H 4HK3J 4PJBA 4PTTA 3OGCB 3U6RB 2EH7H 5K59E 3ALWA 3SGEI 2E9JA 3CX5J 5KVEL 5JQ6L 2PW2B 2YRZA 5DK0A 4MD0A 4JZJB 1CXIA 1F58H 2VYRE 3E1F1 4X6EA 5E7FA 2XZZA 5D8JH 3EGSA 2NTFA 3HAEH 2NLJB 3MRFB 4C56E 1WFOA 3ARUA 1D9KD 4KI5E 2HJLA 1WAAE 4CRPA 1NC4B 1IGMH 3NOIA 2Y5TB 2CKNA 2R2BA 1MCWM 3RVTC 3E6HB 2K9UA 1ZEAH 3QCTH 1DQLH 5FKAA 3QZWA 4R90L 1IGJA 2R0WL 1FC2D 4U1LA 1BBDH 4DFHA 5L2JB 5GSVA 1CQKA 4NKMB 2DOCA 3CLFH 2A74B 3OAYH 2YS4A 4HIIA 5JOEA 1A7BA 1UG9A 4OFYD 1PQZA 2B4CH 3V7AE 3CXHJ 4B5EA 2ICCA 5DT1L 5B21A 1UVQA 1M6OB 4GW5B 1IGTB 1T5WB 4JFED 3UMTA 3TYFA 2Z91B 3TM6A 2YN5A 1LWRA 4LSVH 5K9QG 5E99H 2N1KA 2A9NH 4QRSB 4OLUL 2WIMA 2X4UB 4UT6H 3SDXB 3OAUL 1N5AA 3U7AA 2CRIA 3SDAD 1RZJL 3I02B 4LSQH 5C9JA 4NHUB 5F7LB 1F6AB 2WSKA 5C0FA 2A6DA 5D2LE 3MGAA 5D5MF 2I26N 4HGWA 4LNRA 5DFVD 2EXYC 3F7YA 3IVKB 1RZ8A 1PYWB 3TNMA 5E4IA 2UZYB 1MFBH 2VXSL 5E5MB 2BOBA 5I17B 1OP5K 2VWEE 5IW1B 1FIGL 3PHSA 1A6TA 2QQNH 4RBPK 3B2VL 5DLMH 1DN0A 5GRXG 5HXMA 2NY5C 2NY4C 1K2DB 4H0GA 4N9OB 4RWYL 1MH5A 4UILL 1MCDA 5SWZD 2VL5A 4RSVA 3X12B 4GG6F 2MOVA 2E7LA 4Z7VA 5ICZB 1LEIB 1KPUB 3BI9X 5JIKA 2GTWB 2R56L 5MENA 4OZGF 1BZQK 4LPUA 4KJQC 4O2FA 1AXIB 2PYED 4JDTH 5CGTA 3T4YA 4M7KL 1MELA 2QQKH 5FYJD 3UJTL 3RGVB 5JORB 1PZ5A 5FA3B 2LE9A 1MHHA 2H2SC 4J1UB 4Y1AD 5ABDE 1VDGA 1LEGA 1JZ6A 4YHOH 2VXUL 4XWGH 2IAMC 1M71B 1DN2A 4WEBL 1A1MB 3RPKA 4FZ8H 4G42B 2P5ED 4W6XB 2IH1A 1T7VA 3V5DB 1QR1A 4YHMH 1U8NB 4QRRA 3RDTC 4M6NH 4MS8C 4MA3A 5MENE 1RUKH 3L3OB 2L7UA 4H20L 3P30L 4MAYC 4OCYL 4F9LC 1UC6A 2R1YB 4CMMB 4JFQA 3T0EE 1ZHLA 2AEIT 2FJFB 1TPXC 1AI1L 1IM3B 2VL4A 3O9WA 4FNLL 4XBEH 2FHCA 2EYSA 4H26A 3TWCL 4S2SA 3PL6A 3RJDA 2BJMH 2V7NA 3BESR 3IDJA 4XP5L 3S96B 1ZOXA 1MHPH 1CL7I 4S1QL 4YHOL 1N4XL 3NIGF 3KPNA 3OJMB 5EC1B 3S35X 1U58A 2MCPL 4OCLC 2CIIB 3KLAB 3GJFK 2CK0H 5LJYH 2G60L 3O4OB 4BFEA 2QV2A 4I3SH 3MA9H 1A7RH 1GXEA 3FQUB 4FTVE 3P9MA 3LZFL 3HNTH 4LKXB 4LLWA 3V2AR 3CJJA 1L0YA 2ARJA 3PWPA 2NY3B 5GGRB 5GGTA 4WHTA 4OI7A 4XB8A 3T65B 2HFFA 2F8XC 2OMBA 1PEWA 2GCYA 4TULH 4I4WB 4XNQB 4XXDB 3BWAB 1UB5A 2LTQC 4TUKH 2XRAH 4PRIB 4ZQKA 5E8PB 4OSUL 4K71C 1NFKA 1ZGLM 3NCEB 1UKQA 4KY1H 2FEEL 3PNWB 4BK5A 3MUJA 1LEKB 4FQ1L 4R0LC 4Y2DD 3MSPA 1JPST 2Y4SA 3MLRH 4RFNC 4FG6C 2VDMH 4X5WA 3UJTH 5IESL 1TLKA 3IXAA 1U8IB 4QF1B 1IE5A 5IK3B 3OJDB 5C0BD 2W0PA 3RWCB 2AABL 1HXYB 3HE7A 1QO3A 3BMVA 4JM2F 4PJDA 4OZHA 1YECL 1U3JA 5H35A 4OIIL 1R5VA 5C6PB 4XBGB 3QDGB 3SJVA 4AM0A 4D94A 1V7NH 4L8SB 3GBNL 1ADQH 4JRXB 1CFVH 4LLDA 4ORGB 3HZVA 4XVSL 5I0ZA 1F42A 1KCUH 3QWRA 1PFCA 1I9IL 4PJHB 1BQUA 2K7QA 5FKPB 4MDJA 4PRHB 4HIHA 2ED7A 2NW2B 4JG0H 3DJ9A 3QSKB 4UU9A 3ARXA 4MJ4A 1I1AB 1XMWA 1S7QA 1OB1A 4PJDE 5ESVA 2FDBP 1N4XH 1IJ9A 5E94B 3W2DL 1YNKL 1VESA 3MRRA 3OKEB 4F15C 4AEFA 4PLKD 4R90H 1Y6KR 4KJYA 2VTFA 3Q2CA 2ID5A 3LKRA 3RWDA 5IMKB 5L9DL 2E8ZA 4LCWE 5D7LB 4MQTB 2B4CL 1WBXA 4KK5C 3TBSA 4YNYB 3DX9A 5HHQA 2YD7A 4GLRI 8FABB 5DURB 1YEIL 3QDJA 3D2UD 4JAMA 1FCGA 2PR4L 2V2TA 2FLRT 2EDDA 2UZIH 4ZUUB 4U1JA 1T03H 3OF6A 4GRWH 1J1OL 4AIOA 1MAML 5IW3A 1C5DA 1FZKB 4MAYB 1QEWB 1FLTX 3CU7A 4IRJC 4MXWL 4NQDB 2J6EH 3NCMA 4WV1A 3TO4C 5GIRA 2B20A 1RHHB 5FO9B 4EVNA 1N59A 1NAMH 4QGYA 5ILTL 4N0FB 1DBBH 1NQBA 1ACYH 3PDOA 3TYGL 2WUBH 3KLHD 1T2QH 4L1HA 4DAGL 4XNZB 4PJ9B 4HT1H 4Y19B 3GM0A 5TFSL 3V5HB 3BD3A 4HKBB 5F8RC 3LSOA 4PJ8A 3RY5A 5L2KD 2JJSA 2NY7H 3C60A 4GBXD 5DRNA 3M1BB 3R8QA 5GGVY 5DUBB 5ID0A 1KEML 1OARL 4B53A 3QDMD 2JF1A 3L7FA 5D1QA 3U0WH 3JWDC 4R4FL 2IBZY 3WJJA 4GW1B 3TPUB 2H6PA 4WENB 1CLOL 1VKXA 3QAZB 3DUSB 2H41A 2YWYA 3SDCC 5BVPH 1SYSB 3UP1A 1O7VA 3MO1A 4HUWB 5KN5B 5H8DA 2XKNB 4PB9L 5CLWA 3IXTA 4WW2B 3BPOB 3CVHL 5DZLA 3AUVA 3QIWD 2HT4C 1LP9F 1CGTA 2I5YH 5E08H 1A7NH 4ZDHB 3VI4F 4WIQA 2BC4B 4XPAL 5BQ7B 2C3GA 2XICA 4JPVH 2VISA 4WI9A 3NMEA 4L4TA 3SY0B 4RQQA 3FB8B 3L3KA 1C08B 1NBYB 5ADOL 3WXWH 4GQ9H 3HA0A 2A6IB 1P2CB 4JRYD 1Q9OA 1I8LA 1G7HB 1LNUB 3MRIA 3O41A 3D1MC 3EFFA 4K3DH 3QFJB 2CKBH 2CO7B 4LLUB 4XVUC 1J7VR 2E6JA 4MMXC 1LO5A 1AR1D 4U6YB 1NGWA 1CL7H 5D1QC 2AAVA 2ENSA 5BZWA 4C57C 3U0PB 5I15L 3QQ4B 2VDKH 2W65B 1SQ2N 5ID1A 1Q94A 3QNZA 3MNVB 3GBNH 5GRJH 1FFQA 4KVNL 1BFSA 2FJHA 1CR9H 3O6FD 1ED3B 1KIRB 1QPXA 1U91B 4ZSOA 3VWJC 1MCKA 3LKQB 4OLYH 3IT8D 3OF6D 2IF7A 4Q0XL 3EO1B 4I0PB 3W81A 4G9FB 4BZ1L 2VH5H 4FOMA 4AENA 4HWZA 1YY9C 4X4MA 2LU4A 1KIUA 1NGZA 1X5ZA 1HEZB 3A6CH 2KPNA 1Z3GL 2AJ3A 3RVXD 3RVTD 1JF5A 3MV8E 4LAQH 4GRWE 5DEFB 3QPXL 1BGXL 4L9LB 1RZFH 5BV7B 4GKZB 2QQNL 1J1PL 3BQUB 3B9KC 3QI9B 1C08A 5L88L 5C0BB 4PJIE 2WWMC 3T77B 3MLTB 5EU5B 4NNXB 2XV6B 2Y06L 2WINA 1E27A 1NCCH 3TNNA 4I3RH 4M5YH 2FX9L 1KOAA 4QRPE 5JNYB 3THML 1U3HB 1CDYA 1E28B 4TNVF 4XBPA 1FH5L 5F44A 3KPQB 5AUMA 3MUGA 1E6OL 5ECJE 4POZC 1J1OH 1EXUB 1SEQH 3R0MA 4OCMC 5E8OB 3TT1L 3O3UN 2FRGP 3KNBB 3OKYA 1R0AL 1RIUH 3BOVA 4RGOH 4K2UH 2DF3A 4XC1L 3D5OF 1CVSC 5JUEH 2X89D 4P3CH 3RVWC 1GHFH 1DCLA 4RGND 4JPWH 1MRCL 5J12B 4AG4L 4P5TC 4I2XA 2VUYA 2P8PA 3VWKC 2CLRB 5C0AB 3MC0A 3HC3H 4WGVB 3RVUC 3FAXA 2R0KL 5I1HL 5LVEA 1MJJB 4TUJA 1HQRB 1LMKA 4Y1AE 1S78D 2DYPB 3FFCE 3FJTA 3T4AA 4DZBB 3P4LA 1IKNA 4HC1H 4LP4A 1ZLWH 3MRPB 1DVFC 1H3UA 5MEQA 3PABA 1X6LA 2X4TB 5TQ2L 1UA6L 2OTWA 5CEZE 3REVA 3U9PH 43C9B 5HVHB 3IU4H 2O26U 1QLRA 5EWIH 5FYKE 3KPSB 1ZS8A 2XZQL 4HLJA 5CIPB 4M6ML 4YK4C 1WC7B 1A5FL 4EJ1C 3KJ4B 4PJEF 1JNNH 4HAFA 4QYOA 1WGOA 1A6AB 1JMZA 2AEPH 3V5KB 2YEZB 1QNZH 1W0YT 4TTDC 1TVBA 1DBAL 2R4RH 4KXZH 4LEXL 4F7EB 3HUJF 4RMWA 4IDLA 3NIFF 4OF0A 3AU1A 4HSQA 4QKXB 4ZO8A 4NRXA 1IAKB 25C8H 4PB0H 3O0RH 3MJ8B 2HLFD 1JWMB 4PJAF 2EE3A 4HIHB 1Q1JH 1WVZA 5JW4Q 3VW3L 5BMFH 4OZ4B 1MRFL 3LKPA 4YXLH 3UYOD 4RFEB 3TN0D 3VFWA 5EIIA 1K85A 5FDWA 1HNFA 1MLBA 2NY0B 4LBEA 1YEDB 1FNSH 5SWSA 3GIZL 3UTTA 3SE9H 2A6JB 2F74B 3Q6FA 5C0JA 2IPKA 4CN6A 4H88L 4X6DE 2HLAA 3WUWA 3MXVL 3JV4A 3SKUD 2EIDA 2GUOA 4LSTH 4YBLC 3P4MB 3MBED 3PHQB 5CINH 1PEZA 2GJZB 1FL3B 3MROB 4ELKB 5I1GH 3G6DL 3B43A 4M03A 2OJZL 2Z0BA 5ERWA 2E9IA 1KJ2L 4FA8A 3ULUC 3ZL4H 1WEJH 4QRQB 3HNVH 1MRFH 3QNYA 3LQZB 3T0XA 4NKIH 2DJ4A 2IANA 1JHLH 2BNRB 3CCHB 1G7MB 3G08B 1UZ8B 5EZLB 4F7CA 5D7KE 2W0LA 1S7SB 3LPWA 3UTTE 4CVUA 2EH7L 2CMRL 1RUML 2HLFC 3ABZA 4Z7UE 35C8H 5TE7L 3IS1X 1LK3L 5E6IC 3WIIH 1QHPA 5I1KL 1YNKH 2BMKA 3L1OH 3AXLA 3OXSB 4TVPH 5HPMA 2XTJE 3I84A 2JJTC 3MXVH 1BF8A 1T4KA 3FL7A 3ZT5A 3WIHA 4AIZB 3NH7H 4QTHA 2WLYA 4X7TA 2YD9A 3BZDA 2BX5A 4QTHB 2LU3A 4F2MA 2HFGH 5T3ZL 1ZGLA 2IMNA 2R0LH 2CK2A 5B3JE 2R0WH 2IANE 1ZXQA 2EYTB 1D6VL 4EI5C 1JBJA 3MUGB 1U8JB 5FYJE 5J0BA 3ZE2F 5FO8B 4A6YA 1RU9H 2K1MA 3MRLA 1DEEB 3LEXA 2XG4A 4U1KB 3I6LE 5E6YA 4CL7A 4HJJL 2UYLA 4ZFOA 2D7MA 1MWAB 3KYMB 1NEZA 1IM3A 4MCZA 4BELD 4XMKH 1NBVH 4XGZA 1AY1H 2VABA 2WBWB 3AROA 1NAML 1T0MB 5DJDB 1WIPA 2PYEB 4NNPH 1KT2A 3O3BA 1ADQA 1U8MB 2MMXA 5DT1H 3ECBB 2AKRA 3L6FB 1M7IB 5EU6A 3S88H 1KIQA 3RWFA 5IHBA 3S8WA 5I2IB 4U6XB 2RQ8A 1U8QA 5MI0B 4GKOA 2Z31A 2NY3C 2DTML 4NZTH 5ACZB 1JNLL 3WS6A 1XR8B 4R3SB 5CINL 2ORBL 2OZ4L 1D5ZA 2VXQH 2A9ML 4L8DA 4NQUA 1U91A 3HG1E 1E6OH 5MERB 5T3ZE 1MF2L 3BYTA 4IRJD 5DK3A 4PV8A 2HMIC 1H8SA 1MI5D 2P5WD 4JDTL 4MSWB 1CE6A 4PRPE 2CRYA 4ZUWB 3RUGE 4KVCH 1NGWB 4UDTA 1MH5B 3EFFB 1UYWH 1A9BB 1LO3L 3AU1B 3RTQD 1MCNA 4LRNH 4FXLA 5D9SA 2IFFL 2HTLD 3MJ9L 3W0WD 5DD3L 2IPTL 2F54A 1J8HA 4F7PA 4KKCC 3EFDH 3SE9L 5JDSB 5IQ7H 2OSLB 3O3EB 1BFTA 3LHPH 1KELH 1SBSH 5GJTH 3SY0A 4AH2A 3QNXA 5DQDL 4LP5A 2NY0C 4Y4FC 5IM7B 1A2YA 1SHMA 3IJYB 4PRPB 5C09A 1Y0LB 4JE4B 3RUGB 1GAFL 4NQCD 1JTTA 1PG7H 4U33A 3IXTB 2H2PC 4WW2A 1KYOJ 4WWKC 1YEHH 3H3KA 3I6GB 4NFDA 4E9LA 3OAUH 4W68A 4WFGE 4X6FB 3SDDA 3BRFA 3QHTC 5HVWA 4WJ5B 3U2SB 1B88A 4HEPG 4R4ND 2P49B 5ID0B 4ERSH 2EKSA 4FN0A 1MCOH 2APVA 5E2WH 4K94H 3A0OA 4YDLC 3EFDL 1UGNA 3I50H 3NZHH 4X6CA 2EIBA 2FJGA 1CD9B 1GVIA 3QG6A 4UB0H 3V5HA 5I66B 4XVUD 1BBDL 1L7TH 3WFDL 2HVKB 4P23B 2R2BB 5HGAA 4RISH 1SM3L 3ROOA 4NO5B 2Q7YB 2W1NA 1Z0MA 1TVHB 4WU7B 1FBIL 4MNGA 3VFTA 1IC4L 1WT5A 5JDSA 3RY4A 1FZKA 5EZIH 5LWYL 4Z7NE 3O2VH 2K3TA 4EUPB 4TRPL 2OQJB 1MAMH 4ZUTB 1QRKA 4PRIE 3EBAA 4B50A 4JAMB 5F89B 1KJ2A 4UZGA 5I1LB 1Y0LA 2VXUH 5KSAA 4WI3A 1EDQA 2F8OA 2VXTH 2FGZA 2X40A 2R2CA 1KFAH 1NBVL 3ZTNL 4GSDL 4P9HH 2XN9D 5D1ZC 5H94A 3JWDH 3C08H 1T83A 3G5YB 3WE6B 5L2KB 1I8MB 2OSLA 4XC1H 3WLBB 3O8XA 5I1EH 5DDHA 3FT3A 3I6LD 3S88L 3VXNB 2Z8VC 3NFPA 3GGWA 2XTJB 3MCG1 1TQCC 3EYOA 4OD2B 4D9RE 1XGQB 3REWA 4UDTB 2MWCA 3BH9B 5IROC 2XIDA 5CJ8A 4PLKC 2VITA 2LTQB 1Q0XL 3RX7A 4YH6A 5FOBA 2DBLH 3MJ8A 1KT2B 2RCSL 4OTXH 3EO9H 5MERA 4OI9A 4H1LH 4R2GD 4UIKH 1OAQH 2W38A 5SV3A 2ZZUT 1BX2B 4I77H 4PJ8C 4R6UA 4ZPTA 4TVPL 4LLMA 1W72B 2CK0L 1KXVC 4RAHA 2ZCKL 2R9HD 3FT3B 1OP9A 4HH9B 5C71A 3ARDD 4WEBH 1DQJB 1M7DA 3NH7L 2C3WA 4S1RH 5ITBH 3TIEA 3D6GA 3H3BC 4P3DB 3MNWB 4KHXL 2VZOA 4LFHD 2XWBA 4APQB 4RFOH 4QXGH 1S7WA 4NQDD 4DWHA 2EYTA 3EW3B 5F6HJ 2HRPL 1SJVA 3ECBA 5F6HI 1YEGL 5IK3A 3ULUF 4NQED 4V1DD 4OV5A 3MUY1 1NMCB 4JZOA 2A6IA 5DJDA 4TYUA 1EO7A 2NTSP 5ACMA 1QFOA 4ZXBB 5H2BB 2R0ZH 4CJ1A 2CH8A 1N7MH 4Z7WE 5KANG 1IC1A 3C5ZA 4DVRL 4P4RB 4G9FD 2KQMA 4X7DC 5D6CB 4X9IA 2N7AA 2DTSA 4AQ1B 5T5FH 3QWOB 4C83B 4NO5A 3H7BA 3VWJB 3P4OB 1N0LA 5BW7C 3DO7A 4Q6IC 2ED9A 1CN4A 4K3JL 1WWBX 4N0UE 2BVPA 2H6PB 1JWSA 4ODXB 5I8CA 1BBJB 2BOCB 1MJUL 2CLVB 4ZPVB 3TGXA 3MLSL 3LAFA 3VGHA 4WCYL 4FS0A 3WEXA 1CYGA 4QRQA 3KG5A 2D4DA 3BUTA 3JV5A 4KTEH 3N06B 4UTAH 1V7NL 1IAIM 4WI6A 2B2XH 5MHSE 1ZLWK 3WO3B 1MFEL 1XF2A 2WBKA 5E24E 3BP7B 2RB8A 5JW3H 1OPGH 1G7LB 4Z7OE 2OR9L 1BJ1H 4HQQH 1UB6B 4PJXB 4HWEH 1PKOA 5D1XD 4M6AA 3TVMA 1MFCH 1RHHA 2ESVE 4Y16C 1XGRA 5FO9A 3RZCC 3MUZ1 4E5XA 2W0FA 1CG9B 1P7KA 4GO6B 4JM4L 3DIFA 5DMJB 3MJ6A 3UPCA 4FQ1H 4BQ9A 4ZUVB 4ZPTB 3T0EA 5TFSH 3T77A 2VLJD 3OR7A 2A0LC 3DYMA 1YECH 3ZE2E 3GSWB 2AI0L 4YDIH 5HYJB 3VD7A 2P42B 4ELMA 2JB6A 5TE7H 5I1AA 4L3CA 1ZVYA 5GHWL 1M1SA 1F2QA 4YHLH 5FOBB 4MJID 3UAJD 1C5BL 5I1CH 5ICYB 2D3VA 4APQA 4GSDH 4P9HL 3RRQA 3VXOA 4P3CL 1BVKB 5EBWA 3VFPA 5D7LA 5BO1H 5HPOA 1D5IH 6FABH 5AZ2L 3ZYJA 1HHIB 3NFPB 5FGRA 1NH6A 3IDYB 4HH9A 1DEDA 3QXVA 2VLRA 3HFML 3BKJL 4JANA 1A3QA 5EO0A 2X09A 4HPYL 3U9UA 3VXSB 1Q9LA 3MRRB 3OKEA 4X98B 1F11B 4FQQB 3EOYG 1KXTB 4OIBA 4QT5B 5JHDB 1PX4A 1B90A 2J7LA 5DMKA 5ANMB 4ERSL 3HUJB 5CUSL 4PRHA 4K94L 3O6KL 3KXFB 4XMLH 1SEBB 5D72H 4I13B 2D0FA 5IR1A 4WU5B 4Y7MA 4OD2A 1UWXK 1QLEH 1RSFA 5CJQL 4UNTA 2VJXA 4IDJH 2EC9T 2X9YA 2ZG2A 5T1KA 1H0DA 3ULVL 4G80B 2ZUUA 2P8PB 3VD5A 2VISB 4U0RB 3OG4B 3CDGB 5CGYD 1X5HA 2BC4A 4PJXA 3SDCD 1TNNA 4Z7WF 4ONGL 1QKZH 1RK1A 3LKOA 4YDKH 2P44B 4OV6F 3IFOA 3HZKB 3P73B 3RX5A 2W59A 1WF5A 1MFCL 4GMSL 4HFUL 1BD2E 1D5XB 1CDJA 1JVKA 5F9JB 3VFUB 2AJXL 1S7VA 4XVJL 5C0AD 4GG6A 3BUYA 3OJVC 4L3EB 3SO3B 3M1BA 4F9LA 5DRNB 4YUEL 2B0SH 5EO9B 5D4QA 4OFIA 4XRCA 4DCQA 3QUML 5I71C 3OR6A 5GS2H 3RGVD 5B22A 5I6XC 3GMLA 1JK8A 2BY3A 3IRPX 5AZEL 4PBVC 1YPZF 2BMKB 5I1DA 3QG6B 2VZVA 4XAKD 1NAMB 1UM6L 3NAAL 1GOGA 2YD8A 1Q0YL 4AYFA 5IUSA 4QWWC 4K2UL 3DV6B 5IB1B 1OARH 3G6DH 2KZWA 3FQUA 4PJ7F 2BNRA 3HE6D 4I0PC 1NCDH 2EE2A 5F9JA 2B8OT 2Y36H 3VI4E 4OBSA 1DQTA 1BQLH 3ARSA 5D8JL 3T2PA 2RIKA 4QHUB 4XNXL 3CVHH 3RFZC 32C2A 1JGEB 1CD1A 3U30B 4LLAA 5D7IE 3OKMA 3KYKH 1TPXB 1T0NA 4PV8B 2RAMA 3TLRA 3EOTH 2E5EA 3HR5B 2EEDA 2ZCLH 4KROD 1BEYH 3D25B 2BRQA 4P2OC 1GZQA 5LQBL 3WDJA 5K9OB 5BRZA 2NY2C 3QXDA 3KJ4C 1I7ZA 4WUUD 2SEBA 1D5ZB 1NMAH 4ZOBA 3U0TA 4YHLL 3RZCD 3MNVA 3H9SA 3PWVB 3QUKB 4D8PA 2I9LA 3OX8A 3VFWB 2IH1B 4OZ4A 3V5DA 5BVJA 4OT1H 4PJIF 4ZO6A 4U6VH 5IGXL 1B0GB 3S35L 5JW4R 1AHWA 3BRDA 5JW5A 4Y16B 4MNQA 1NGZB 1EEZA 4U1IB 4YPGA 4XP4H 1LEGB 1UQSA 4BFGA 4LSQL 2UZXB 1IMHC 1F4WH 2J8UB 3FT4B 3THMH 1I85A 3L3KB 4IMKA 2XZQH 5K9OA 1VB9A 2J5LB 1KIRA 4HFUH 1RJZA 4FFZH 3ARPA 3MRKB 3DIFB 3A6CL 3F12B 5T1MB 4PJ5D 4GG8A 2WQRA 3OKNB 3VI3F 4L29A 2E7LC 1QRNE 4G9DA 4OGYL 3RAJH 5BOZG 4ZYKA 1NLBL 4MLSA 3QFJA 1DLHB 1WBYB 3LN4A 1UCBL 3QPXH 1AP2B 1CICB 5CP7A 4BZ2L 4QXTA 3RWIB 3L7FB 3O3BB 3SN6N 2FBJH 2R56H 4M3KB 4KDWA 4CBPA 1IKNC 1OTSD 4K7FA 5I1JL 4J3UA 2WNGA 2XI9A 3BW9B 1TMCB 2Q3ZA 1ORQA 4JLRB 4ZUVA 3T0EB 3WHE0 2XWTA 5FB8B 1HOCA 1JWSB 2A6DB 1CFQB 4ODXA 4F9PC 3ARTA 2MNUA 5I1DB 5I8CB 3T0WA 3R1GH 3ZKXC 4M3JA 2FJGB 2VQ1A 2OJZH 4RGOL 4HEME 1N5AB 4XB7A 1KSRA 4C56D 2PKDA 5JQ6H 3WFBL 4A2MA 2VQ1B 1HYSC 1JYXA 1T66D 3CFBB 2H45A 4GT7A 2R69L 3C87A 4JGMA 4L4TD 2IANB 5JHDE 2EXYD 3EOBB 4Z7OF 1I1AC 3N9GL 1R5IA 4QY8A 4HXAL 5GGSA 2JJUA 3HC0A 5H2BA 4S1RL 4OLWH 5JR1H 2VDLL 1RJLB 3QUMH 3LS5H 2A74A 4JZOB 3PL6C 2X7LA 1OGAB 1WJ3A 5BRZD 1U2CA 3V6OC 4JKMA 2HT2D 2L0DA 4ZYKB 5CILL 5C0DB 1UM4H 1KJ3L 5JNYA 4NM8L 3QWOA 2F74A 3Q6FB 2NZ9D 1FIEA 4FMFA 4JN1L 5CZXD 1B6DA 4EN3D 2P7TA 1G7MA 1A3LL 4GS7B 1JF1B 1B4JH 2NTFB 4KJYB 5EWIL 5C08B 3ZSSA 5DVKA 3QXWA 2Y72A 3H9SD 4CMMA 3G9AB 2R1YA 3F6IA 1PKQE 4F7TA 5ERWB 5AD0A 1QG3A 1HHHA 3QIWC 1CDCA 2GJZA 2VDLH 4XP1L 3FN0L 4PJFE 1HZHH 3WL9B 1AHWB 2DIAA 1IAII 4HW6A 4M7ZB 5LQBH 2CD0A 1B0RA 3QPQC 2PXYA 4FQQA 3RWJB 2BSSB 4K8RL 4KGJA 5D70H 3QISA 3AREA 1MIEL 5T3XD 1E6JL 2ICWB 5HGHB 4N90D 4KRMB 1AD9B 2DQJL 4O9HL 4IIQC 1I9JH 4JFDD 1UJ3C 3ZE1F 3BN9D 4WY7H 4U0RC 5C0IA 1A7OH 5JORA 1ZHKA 3DYPA 1DDHA 3LIZL 4I8DA 1F6FB 3LKPB 5D7KD 4P2OD 2HFTA 3IFNH 3FQXB 3P4NB 4NNPL 2CJUL 3WHE1 5KAQF 2X4TA 4HWBA 5DGQA 5ICZA 3GMPB 6CGTA 5KSBA 4WHYH 4PY7B 5LCVH 2W92A 4DW2L 1WAAF 5EUOF 2IWGA 1BFOA 4H88H 3QQ3B 2OQJA 4EUPA 1FO0H 1HQRA 3TCLB 5EN2B 1ZT4B 3GSOB 5C0CB 1CF8H 3MGTA 4BH7B 2UYLB 5CP3H 2W9LA 1CT8B 2NXYC 4TQEL 3P9LA 2J5LC 4LL9A 4P9MH 2HFEA 3CLEH 1CQYA 5A16A 1R24B 1G7LA 4AEHL 3S9DB 5DD0L 5IQ7L 3ZZ1A 1I3VA 1KCVH 2E8YA 3SE8L 3LD8C 3WEXB 1IZKA 1QTYT 4XBEL 3DI2B 1UYWL 1EIBA 3EOTL 3M8OH 4Q6IA 2EYRB 4WU7A 5CUSH 2I60L 3GSNA 4HX1B 3T2NH 3ARWA 4FFVD 2B39A 3C60B 4DGIH 1NL0L 4KKLD 4C83A 2WWKO 1A6VH 1S7SA 3LKOB 3T04D 3X3GH 4H26B 1F90L 2HFFB 3RBGA 4E41B 1ZKAA 3I6KB 1JFQL 3DMMD 1GGBH 1X44A 3RNKB 3LS4L 1N59B 3HZMB 4QHNA 3BD4A 1OVZA 1GZPB 1E6JH 1W2KT 5KS9A 5SWSE 3RA7H 5I8OL 1T80A 3SGDH 1AP2A 1CICA 5CP7B 2N56A 4RGNC 1JZ8A 1S7WB 4U1JB 1A9BA 4IRJB 2XWBB 1P4LB 1DLHA 2VXQL 4MA1B 2IEPA 2HLAB 1RFDH 2Y7QB 1CGWA 1MCOL 1U3HA 1A1MA 3QI9D 3QUXC 4Z95H 5DJ8B 1MCSA 3VFRA 2B7DT 3HUJA 1Y6NR 2YA0A 4NC0B 3L9RA 1N3NB 2VDQH 2Z92B 3RTQB 1ODAA 1OT1A 4HS8L 4WEUD 4Y2DA 5FDWB 1WBXB 3RGVA 5C1MB 4TNWF 2Q8AL 2X4RB 5IWLA 1JNJA 1AR1C 3GO1H 4JFQB 4N0YH 3HS0A 2X4QB 4LLYA 4MD4B 2HWZL 2Q7NA 1LQSR 1XR8A 4KK6D 5JLZA 5KS9E 1EEZB 3QQ4A 2F54B 3U0PA 1NC4D 3CNKA 1R3KB 1F00I 1HILA 2VITB 5DUPL 1KXQE 2VDRH 4NFCA 5DEFA 3V6OA 1QSFA 3BHBA 4FQXC 5DFVC 1CFVL 7CGTA 4CVWA 3VXOB 3S4SA 3DOSA 4WW1B 5AG9A 2X5PA 4WTXA 1TJHL 5DJ2A 4JQIL 2JLLA 3LEVH 1LNUA 4XI5C 4PB9H 3DURB 1F4XL 4TPRL 1HINL 5DDHB 1VEOA 5FA3A 5HJ3B 3NZ8A 3FCTA 2VABB 4YC2C 4HS8H 2HKHH 2CPCA 3WFEL 5H37H 4IRSD 4V1DB 3NIDE 1OP3K 3IKKA 1LO4H 1XIWB 5I1EL 1CG9A 3CDCA 2VLKA 2H1PL 2OTWB 3GNMH 3P30H 1KPUA 1XGRB 5HHME 5C7XL 3GMNB 4HF5H 1V7MH 5EZOL 4X8JB 1SYSA 4XNMA 3ARBD 2HKFH 2Q20A 2NR6C 2CDEB 3HE7B 4ENED 1A6TB 3D3VE 4EUPH 2YC1B 4DQOH 1FFOA 3C8HA 4D0CA 3BH8A 1GZPA 1T0MA 1CI5A 3VG0L 3MLPA 4LNVA 5HHXH 5DR5L 4FFWC 4OLYL 1B4JL 1BBJA 2BOCA 4JHWL 3RA7L 3AXLB 3OXSA 5I8OH 2Y23A 1J0IA 4RFNB 4AK1A 2VLKE 3O4LD 1PD6A 4OQTA 4P5KB 4Y0GA 3H0TA 4XXDA 12E8L 1UWXH 5DGRA 4HUVB 3C6LC 1WZ1H 5E8NA 1G6RB 2R1XB 4U1HA 1FG2B 2B1AH 2XN9B 4HCRA 4FHBD 4RFOL 3GJEA 3SGKA 2XXCB 3MRDA 3UYPA 1VPOH 2APBA 5DUBA 3MV11 4JO4L 5T33L 3IJSB 4G3YH 5AUMB 5K9KA 2F5AH 4MQSB 1DANT 1KCSH 3QO1A 5D2LB 4PRPA 5C09B 3RUGA 2EDOA 3V4VH 3DX9B 5HHQB 3KPRE 5DD5H 5DUPH 5EFIB 1PG7W 1ZV5A 3TBSB 1QBMH 3ARGA 3MLTA 3V9FA 4KZEL 3BX7C 2JB5L 3O11B 1DUYA 4W4NA 2LFGA 5J89A 3DV4B 2FX7H 1MREL 2R4SH 4LASL 1MI5E 5FYJU 5J1TC 3O6FC 5DVMA 4BFBD 4TRPH 1D5BB 4HIEB 4K3JH 4BUHA 2DI7A 1OPGL 4X6BA 3KXFE 4N8CL 2Y6SC 5LGJA 3IFLH 3E3QE 1XAUA 1MCRA 3K3QA 4N8VB 4XP6H 3QB7C 4Z95L 3HNSL 3MLXL 3ET9F 3WFBH 5IR1B 3TBTA 4YHNA 5T33H 3O8XD 4OM0L 4KTEL 1CE6B 4ZUWA 3PHQA 1S7XA 4NZUH 1CDGA 1OAKL 2IADA 1MQ8A 5AZEH 4JQXC 3C08L 5A1AA 1IEBB 5HVFB 5EUOB 4FQHA 2WW8A 3ZYOA 2GY7B 4OZIA 3GSXB 4J3SA 5HHNB 5ETUB 1NLDH 2YPLA 4JY5L 1QSED 1AKJA 4D9RD 3RI5K 1BFVL 2NXYB 5SWQB 3QJFA 3TJEL 1YMHA 3E6FB 4CVXB 3DETD 5J57B 2V2XB 3QEQE 1U8QB 4R0LA 3MLWL 1F3JA 1FLRL 3R4DA 4E41D 1KPVA 1A6ZB 5GRJL 1FC1A 2FWOA 5F89A 5BS0D 1H3VA 3PABB 1UJ3B 1MUJA 5T5FL 1HYSD 4PJ7A 5HHMB 4ELMB 3KHOA 4N1HB 1NBYA 4HHAA 1Q9KB 1RUAL 4JHAL 2IH3A 3WO4B 4ORGA 1RULH 4LLDB 4EOWL 4LSRH 1G1YA 4NP4L 5BQ7A 1EMTH 3MOQA 4XC3H 2E3VA 5C8JA 1FDLH 3QEQD 3W39A 3TWCH 4PRIA 1QA9B 3LEXB 1RZ8B 3U4AA 5BJTB 4XP5H 4F7MA 3C2AL 1ZSDA 4K8RH 1NUGA 2HVKA 4P23A 3IAGC 3TZVA 1MFEH 3KPMB 3MV9D 3WNPA 3QHZL 3PV7A 1NUDA 2X4PA 4Y16D 3VCLA 3WIFB 1QPPA 3IXAB 1T7YA 2FX9H 4RDQF 3PDDA 4XP4L 2JB5H 4M48L 7FABL 4UT6L 4HV8A 4XCYA 4MXVF 3FZUC 3LZFH 5GGSB 4ZPVA 4DAGH 4ONGH 5D1ZB 4OB5L 1I3UA 3DTXA 4PP1D 1OSPL 3HMXA 1FH5H 3L3HB 1E4JA 1JHKH 4JFHE 4MCYA 5INDA 4L8CA 3UPRB 1CBVL 1U3ZA 2AJZA 1JZ4A 4LSSH 2E6PA 5GISL 5CJBA 4AMKL 3CUPB 1F2XK 2P5WA 2DM3A 5SX5K 5C0BA 1NEUA 3AB0C 1CFTB 3ESUF 3S34L 1TDQA 2W9DH 4KROB 2RGSA 2R39A 3LOWA 5TDNB 4GMSH 3HZYA 1EEYB 4XP9L 2NXZB 3LN4B 4NN7C 5CGMA 5A43C 3DUUA 1F4YH 2I24N 5L8KB 2PF6A 3BP6B 4LU5H 4YUEH 4XX1G 3U79A 4OLXL 5HDBF 1OAUL 3VD3A 3MRKA 1LP9A 4N8CH 3VFSB 1INQA 2ZOKB 3CK0L 4K3DL 4YC2B 2WLZA 4RFEA 2C4FT 4OGXH 3S3PA 3B5HA 5ITFA 2YPLD 3VG9B 2YD5A 1U8HA 3L5IA 1LDPL 4PJCF 4U1IA 4R96B 2W9EL 3KDMA 3QXAB 3U48A 4IMLB 3C2SA 5FUZL 5C6TL 4Y19E 4YXHL 3MV7D 1D6VH 3X12A 4HUXA 4Y5XA 1X4ZA 2ZPKL 3RPIB 4P5TD 4R7NB 5ICXB 4IHOB 4WNQB 5DHYA 4LU5L 4RX4A 4JVWA 3SGDI 1Q8MA 1CXKA 1KCRL 1D9KA 1T6WA 4FQLH 4S0TD 3JUYA 4HIXL 4X9BA 3PP4H 4I0PA 3K1DA 2ZCLL 4C59B 4I0KA 4XZUA 4NRYB 3WXVL 5C08D 1GZQB 1J05B 4DN3H 5ISZE 1MFDL 5H35B 3FQTA 1NFDF 4JPIA 2QR0A 4KMLB 4P57A 2W65A 4KI5C 2BVOA 1P4BL 5BZWB 1BZ7A 4Z7VB 3ARGD 1QSEE 1ZA6A 2ESVA 1B9ZA 4MAUH 4XAWL 2Z93B 1QLEL 5GS1B 1CLCA 1G7HA 1KG0B 2IMMA 3V0VB 1ND0A 2J8OA 5SWSD 1I8IA 2VR5A 4X6CE 5E8PA 1F6LL 1XF3B 5A3IC 1KGCD 5FYLL 3SBWC 2D2OA 4MXVE 3FQNB 4HAGA 1IQWL 4U1LB 5FECB 3LKNA 1GGIL 4MAYD 1DJSA 4B41A 4ZFZB 5CSZB 5CCKH 3T65A 3O45B 5C0ND 2YUXA 1HHGB 5CMAA 5E2UL 1KJ2H 3JWNC 3T1WA 1LD9B 3PWNB 3C9NA 3MLVH 4ZO9A 5E95B 3GK8H 4EQ2A 1KTRL 3O6FB 4PR5B 1QEWA 1NLBH 3GMQB 2PXYC 2QKIA 1U8LA 2Q6WB 3AM8A 2EEBA 4NGHH 4DGYL 3CFCH 1FJ1A 1CF8L 4ZD3H 5HDLA 3UBXI 3MYJB 1S5HB 3LQAL 1DFBH 5FV1L 3EYFA 4Y4FB 4PRHE 5H37G 4LCWB 1ADQL 1X5YA 1UZ6E 3UDWC 4EN3A 3HLAB 5IB3A 2ERJB 1R6VA 3SBWA 5I16A 2VUOA 1A0QH 3L3IB 4LDOB 3CVIH 1QYGH 1YNLL 4MB4A 1MVUA 2NLJA 5I8EA 3TO4A 1FG9C 4NDMA 1RZGA 1UXSA 5DD6B 4D2NA 2DQEH 5B38G 1T1XB 2DI9A 3B5GA 1N64L 5IBUG 3PG2A 4OLWL 4NQVA 5I74C 4PTTB 3NCBB 4Z5RB 1TZIB 3VXPA 4P2RD 1CL7L 3Q5TA 1T7XA 4MDJB 1C7TA 3TEUA 2GY5A 3B5TA 2V2WA 4QRUB 2X4OB 4G8IB 4HDIB 4RIRA 4EI5B 1CICD 2AJVH 1T83C 4LKCB 3K4ZA 4QTIL 1U8KA 3N50A 1BD2B 5IP4A 5FHAH 3VXMA 3QNZB 1Q94B 1NGPH 2JIXD 3IDNA 2KZ1B 3BAEL 4JG1H 3O2VL 2YKLH 1H9VA 1FNAA 3KPSA 4JFZL 2FX7L 4OZHB 1GPOH 1NAKH 4YBQC 3OSKA 3QRGL 4GQPH 2AKRB 3L6FA 4X6DB 4ZAKA 4TVPE 1Q9OB 4NC2B 4MDIA 3O3AB 3GSQA 2NPLX 2ADFL 3WD5L 3WXVH 3BPCB 1JPFA 3AY4C 2XTLA 1O7SA 3QUXB 4JRXA 2DD8H 4XMPL 2P8MB 5B8CC 1A4KB 4ZDHA 1XZ0B 1CE1L 3BO8B 2CLRA 5C0AA 3TVMB 2CDFA 3EYQC 2X6MA 4J8RB 5CJOH 1A6UL 2HA1A 3MCLH 4D0DA 1AGFA 4HG4J 5I30L 2Z91A 4FTVD 4OCSH 4BA8A 1A3RH 1IGTA 4K8RC 2DM2A 1CU4H 3RIAK 5HGGS 4QHLB 5JZ7C 2NW3A 1LE5A 2CLZB 4QNPF 4GAJH 2M2DA 4O58L 2G9HA 5F9AC 3IDXL 3P77B 3MOBH 3MBEC 3TH3T 3D85D 2L4OA 3QCUL 4IRSB 1MCIA 5F96L 5I19H 1U95B 3MTRA 3V6FA 4U2ZA 5C0AE 4IBLT 4F57H 5EUKA 3OHXA 4EVNB 4MJ2A 1U36A 4XVTL 3HAEG 4K9EH 4MNQE 3RX8A 1BVZA 2HVJB 5IG7A 1AC6A 1TXKA 3PWPE 3FB6A 4M7KH 4P4RA 2EDQA 4NNXA 1JRHL 5EB9A 3BE1H 3ZKND 2UWEE 4G7YH 2VLKD 3O4LE 4KTDL 1PGRB 3D18A 4HFWB 4N5EC 1WFUA 5E6ID 3GMRA 4QHKJ 3X3GL 3B3IA 5HHXL 1F90H 2PXYD 1F58L 3EIFA 1QR1B 1XGPA 4JHWH 1KB5B 2B1HH 3DBXA 4Z7QF 5JPMB 2ESVD 4QGTA 5T3XH 3MA7A 2I60H 4P9HC 1J5OL 3TIEB 1FL6B 5HI4C 1IC4H 1CFNB 2OL3B 5SWSB 3GSRB 3LV3A 3KPSD 5CKGA 4AT6A 3DI3B 1BIIA 3LDBB 4W4OC 3RL2B 3OKKA 1QP1A 2X2YA 1QVOB 4JDZA 4PY8J 5HHVL 1I1AD 5TPWH 4B0MM 2R2HB 1JHKL 2VMFA 1S7UA 4FRWA 1OB1B 4S1QH 3UTPE 5GRVL 5LKNA 3ARFC 4AMKH 3CZJA 1ZAGA 2GAZB 5KVGH 3V79C 1BIHA 3B8YA 1A9EA 3CLEL 1K2DA 1RK0B 4U1SB 15C8L 2Y25A 5I71B 3E0GA 1JGDB 5FM4A 2CIKB 3C6SA 3B9DA 3K8MA 3DNKA 4PP2B 4KKNA 3ARGC 3BAEH 1AHWC 4JG1L 1U8OA 4M7JH 1WWWX 2AXFA 1T7ZA 4LPWA 1I3GL 2BY2A 5CIPA 3SGKC 4H8WH 1ZS8B 5BZDB 2RFXA 4FZ8L 5FUOH 4NKQB 3LH2H 2H26A 4U7MA 4GBXA 1CGYA 1HKFA 3GMOA 1MWAL 4JKLA 1EAPB 1OW0C 4CMHB 1JPGA 5HI5C 1K8IB 2CRZA 4HK0B 3EOAB 5SX4H 3JWOC 4WW2F 1YY8A 4FQJH 4KWUA 4E41E 4G43A 4BH8B 4G8GD 2FB4L 5D6DC 1DZBA 4G6MH 5CP3A 5DVOA 2FATH 2ZKHL 1ETZB 5CZVL 4I1NB 4HLZG 3BSZH 3RKPA 1YYLL 1H3TA 3Q3GB 1AQKH 1V05A 1X5AA 2G2RA 2JK5B 3BEVB 3QZWB 4QOKA 2VLRD 4KRPC 2EICA 2BNUB 3VRIB 3MRNB 3GHEH 2P5EE 1MFAL 2ARJB 2D7PA 3DPBA 4HUUA 1BD2D 4NQDA 5C09D 5L7XL 3IDXH 2VZSA 4I48A 4GW5A 4MD0B 4QXUH 5F93C 4PJIA 3HI1B 1WK0A 3T2NL 1KGCE 4G6JL 2ZOLA 1RUKL 4XH2B 2AV7B 2Q8AH 3I6GA 3UTZA 4YPJA 3ARED 4NDMB 2AK4B 4Y4HD 4ZFGL 4YWGH 5JO5A 5CD3A 5ESQB 3HRPA 2Y6SD 3G5XB 5E2JA 4JO4H 3QXUA 4Y89A 4OF8A 1U3HD 3QI9A 4UTAL 2YXFA 4NQDE 1CGVA 2C3HA 2FO4A 4LCWA 2UVFA 4YGAB 2ADGA 5J6HB 1KTDA 4OZFA 1WBZA 4HKXA 1UZ6F 3WHXB 3WD5H 3RVVD 1KFAL 5E94A 1DBJL 1F3RB 3MODH 2ITCA 4U05A 5BV7H 5D5MB 2EH8H 4DJMA 3Q1SH 1NGYA 5I18L 3QFDB 4QHKI 2XFXB 1KJVA 3MRBB 1EEUA 3RWEB 3EO1A 4HUUB 1IBGL 3FTGB 4X83A 3QIUD 1AKJD 2DMBA 3MV9E 5GHWH 4W70A 4PGDA 2BNQA 1ZHNB 4KUZH 5AZ2H 4Z8FH 1HWGB 3AREC 3OXRA 1TQBC 4AM0B 3NA9H 1SYVA 3X17A 2X41A 3C5JB 1I75A 4BFIA 1YEEH 3S6CA 4HT1L 4Z0XA 1XGUB 1JE6A 5ADPL 4NQXA 5DHXB 4HIJB 4WI2A 2QADD 3NIDF 1MCQA 3QCUH 1D5MA 5EU4A 1YY8B 1U8MA 3KYKL 4R7DA 3I9GL 1V3KA 5GS2D 4QO1A 4DTGL 5HVHC 4KHXH 2C1OB 5FM5O 4UQ3B 5HGBA 2COQA 4GBXB 4CN4A 1U92B 3LEYH 2H1PH 1Z5LA 4GAGL 1QBAA 1U92A 2NY6D 3C8KB 3QDMB 3OZ9H 4JO3L 5DJXA 1EGJH 1I7UB 2VLME 2ZCHH 2VC2H 3BJLA 3MR9A 2V7HA 3ARFA 1RUAH 2EIZB 2AJVL 1ZLUK 5EULV 1A14L 3KHQA 4GKSB 2BCKB 2CKBA 4WI8A 3SDDD 4WUUE 4MQXD 3A67H 4GW1A 3TPUA 4PJHE 3MOAL 4P5TB 1T04A 4PTUA 4KGLA 4NSKA 2PYFB 3JV6B 5KG9A 4ZOAA 4ODHL 3TA3B 1HCVA 1TJIL 2OZ4A 3OXRB 1IGJB 3V6OE 4QRPB 3MJ7B 3E6HA 1EEQA 4Y5YA 3TJHC 1DBKL 1YMMA 4LCCA 5FUCC 4JRYB 4XTRD 3VWKD 4LFHG 2BFVH 1F02I 2J4WL 4RISL 4QNPE 4FP8L 5GIRB 4K3EL 3MRGA 1UH4A 1BQSA 1G6RH 3P2TA 1BECA 3TZVD 4YHKL 3S5LG 4R9HA 1A14H 4O2EA 2YUWA 3PWJB 3CC5B 1BZ9B 3NCFB 4FQ2L 5KZCD 4R4FH 3MREA 1YEIH 4X7SL 4JHZA 1ZWIA 3U6RA 1KJMA 3FB5A 5CBAB 2AXGA 3QH3A 4X8XA 3VFMB 4LSSL 4X4YB 3GM8A 5INCB 3E2HB 3C5ZC 3JV4B 4OUUA 4APQD 1FZJA 1FAIL 2QQKL 4I18A 4M43H 5GGQL 3BIKA 3NCYS 1ZHBB 1A22B 2WWKT 1VFBA 1UJTA 5FUOL 3C09B 3BZEB 2XNAB 3V52H 2ARJQ 3SKJH 4U7KA 1YEDA 3MV7B 3KXFD 4WDIA 3TV3H 5ADOH 3LPGA 3BGMB 1PZ5B 1L6XA 1BQLL 1VACB 2A73B 4ORZC 3MRHA 2DQCL 1XT5A 5E0QA 4F57L 2CGRH 1T2JA 4A6YL 1T21B 4XVTH 4CADA 3QIWA 4QRPA 2AERT 1XFPA 4NP4H 3K0WA 4IRZL 2CSPA 4RAUA 4Y4KD 4KI1A 3P77A 5M95B 2ZUSA 1LEIA 4O4YH 1BEYL 2J8HA 3LN9A 3OGOE 4KI5F 2BSRA 1P1ZA 4MQ7A 1EGJL 2ZCHL 1CLOH 3CFEB 1OM3L 4NKDA 2D03H 3C8DA 1WISA 4M93C 4NM8H 4GS7C 2CDGA 3V95A 3VXQB 2V17H 1MCCA 4TUOB 1OTTC 1CLZL 1CK0H 3ARFB 4XMLL 3MR9B 1YDPB 5DMIL 1WC7A 4OT1L 5IGXH 1I7UA 4LNRB 2UZIL 5BOPA 1CTOA 2CO6B 4ZUSB 2DQHH 3WNOA 5A2KH 1KF9B 4YE4H 1LDPH 1IEAB 1I1FB 3KPRA 4FQLL 1TITA 3VFOB 1AXTL 1MAKA 3DGGA 4D9LH 4MXWH 4DZ8B 3BPCA 1CWVA 5LXGH 4QRSA 1EH9A 3S36L 1OLZA 4P2YA 2XZAL 1IKFL 1MUJB 1P7HL 1UJ3A 2WUBL 4PJAA 2OTUB 1RQ5A 3PNWA 3DX6A 5GRUH 5DRZB 2AGJL 4ODSH 4HIJA 2GIYA 3OZ9L 5C0NC 5I15H 4YXKL 1N6VA 3QG7H 4PJGB 1T21A 1K5NB 2VWEC 2J6EL 1YDPA 2JIXB 4CVXA 2NZIA 5F7NC 4L3EE 3VXTB 2Z9TA 4PP2A 3JXAA 5KAQG 1T0PB 5T3XE 3PWUA 2F5BH 5ENWA 3ILPB 2LABA 5L8JB 4WGWB 3B9AA 1P4BH 1MFBL 1OSPH 2VXSH 5IVZB 3FO2A 3MBEA 3VXSE 3EYUH 1FQ9C 5D2NB 5HY9A 3ES6B 4OQTL 3U46B 4F3FB 4YIQA 2XFXA 3IF1A 5HHOD 3S7GA 3HCVB 1G9MH 2NMSA 3H3PH 5HDBE 2NXZC 3S36H 3S37H 1IKFH 4RZCB 3EJJX 3G5ZB 5JHDD 1MWAH 4YHNB 1SJEA 1S7UB 1U58B 3O0RL 4WWKD 1HCFX 2ILLA 3OKDB 3WXWL 3L5HA 1ZT7A 3HI5L 1YZZA 3VGGA 3CXDH 2ADGB 5J6HA 4P3WA 4UIMB 1R3HB 2D9CA 4JM4H 2GSIB 2ZSVB 4MJ6A 1CFNA 1YC8A 2OL3A 5DD0H 1NJ9B 3LMJH 1KJ3H 4X99B 4GXUN 5DJAA 1OM3H 5IBTL 2ZUXA 1AO7D 5EZJB 5INCA 5E00A 4Z9KB 2R8SH 3VA2C 3SDXF 4KAQL 5CEXA 4J23A 2FO1A 3UTZB 2DAVA 2WIIB 5IJVB 5KSAC 3STBA 3GHEL 2A77H 5KG9B 4XWOC 1EVUA 4N1EA 2AJ3B 1T04B 1ZTXL 4TSCL 1F3DH 4J4PC 3CFIC 1M4KA 5DJZA 4GXVL 3FOMA 1AGEB 2XKSA 4ZXBC 4WFHD 1YN7B 3B83A 1NCBH 5HY9B 1I1YA 2C4FU 1LVEA 4ZSOB 1R5WB 5DO2C 5JXEC 3X11A 1RUPH 4KTDH 4CNIA 2FBOJ 4MXQD 1HH9B 1RUMH 3V6ZB 4KUCD 5HGBB 4NFBA 1ULVA 3PP4L 4U6YA 2BVEA 4ODHH 3SCMD 3NFNB 3K1KC 4K07A 2OBGA 5BV7C 4POUB 1T03L 5JPNA 1REIA 1PY4A 2XZCH 2DQJH 2F53B 2JCCB 1EUUA 3CSBA 3BKCL 5IHZA 1V3MA 4PS4L 5EPMB 3HNTL 3U83A 2BOBB 4NZJA 1FVCB 2EDRA 5IHUH 1JZ3A 1IZJA 2FH6A 4L4TB 1DSFH 4ZMAT 3LVEA 5JHLL 4WO4D 4YHKH 5D1QD 1WWAX 4LOUD 1IEAA 3KPRB 3ZKQD 1YMMD 4NGHL 4WCYH 3VH8B 2FBJL 1JZ2A 1FO0A 1U3YA 4PJ8D 4K9EC 4Q6YA 1JPFB 3GSNL 1UWEL 4UUJB 4G8FB 2H32A 3OKLB 1JGVH 4KDTA 4XPBL 5HYFA 3PGCA 3RNQB 4PJGF 4PRDA 1CE1H 1KN2L 4WUUB 4XTRC 1Q72H 1XGUA 3SKOA 4WW1A 1JV5A 5FGSA 3EDEA 5D2NC 3KR3H 3HMWH 3JSSA 4HKXB 4YLQT 3TV3L 1I3GH 2R69H 1M05B 4AQOA 5HHOA 4OZFB 1HH9A 3RKDC 4Y19A 4RMUA 1KTLB 1MRDL 2FHFA 1HHJA 1AQDA 3KYNB 4H1LA 3B6SB 1CU4L 1MI5A 4P2RB 1UACH 4UT9L 2ZUWA 1XCTB 1OP3H 1C16A 3TBYA 1I1YB 3DX7B 2R15A 1MPAH 1C5DB 1FVEB 1NDGB 4N8PA 1C5BH 5JIIA 3ELAT 4Z0BH 1JP5A 4JZJA 4M61B 4KJPD 3OKDA 4F37F 4KH2A 3F5WA 4JR9H 1FV1A 5I1GL 3IU3B 5TDOB 3X14A 2ZOLB 5C86A 3F5WB 1XGPB 4HC1L 3B9VA 4DKEH 1FGVH 3D48R 5HHOE 4NO2B 3MRCB 3SQBA 1A1NA 1QSEA 3RDTB 4N0CC 5K59F 2F19H 4UTBH 1HI6A 4L9DA 3CUPA 25C8L 2XTJD 1X5JA 5EIQA 3UPAA 4NO0B 4HWBL 1RJCA 2HJFB 4O5LH 2J6EA 3FRPG 2WANA 3BIBX 3W0WB 3Q48A 5J11B 5EOQL 3IAQA 1MCFA 1ERNA 2BFVL 2J4WH 1FJ1B 5DEGB 3NA4A 4ODSL 1NCTA 2GTZA 3EYVB 5F72S 5FKPA 2R0LL 4NBZB 3ARBC 4XCYB 1B6UA 2ICWI 4LSVL 4U1GB 5KSAD 4CVZA 5B8CB 3N1QC 3EDJA 2HWZH 4OCXL 5B38B 1GGTA 2Q86A 3W5MA 4P4KC 2XG5A 1C8PA 1KV3A 2YMXH 4G6AC 1VADB 3LKNB 4LSDA 4FFZL 3HRZB 1BQHB 2EE6A 1ZSDB 3EHBD 1V5JA 3QDGA 3TYGH 3WMSA 1XF3A 3CX2A 4PGCA 3QDMA 2FL5B 3C8KA 4JRYE 5DJXB 4PJGA 4LF3A 2DIBA 1RIHL 3QRGH 3IKCB 4BH8A 1GSMA 5IESH 5DRZA 4G8EB 1KG0A 4M6OL 4MNGE 5DA0B 3UBXG 1U0QA 3MLYL 5HGDA 5JHLH 2BSRB 1TTGA 3O3AA 1A6UH 3TF7C 1IQDB 4G9FE 2ERJC 3QIUB 2DLIA 3CVHB 1C5CL 4PGEB 5I75C 1WZMA 2X44D 1ZLSH 2YZ8A 2NQCA 4O58H 1IILE 2A9MH 2IG2L 1MCJA 1F3DJ 1FGVL 2OCFD 5C6WH 2P5WE 3GDBA 4LOUC 5TH2B 2PCPA 1OD7A 4PJEA 2L7JA 2O5ZL 1ONQB 2QHRL 4PRNA 3H9HB 2F19L 3MA9L 4JFDB 3FO9B 4U49A 2IAND 3MLYH 3IDIA 3N1MC 2X70A 3TO2B 5FYKL 5CS7A 3G6JF 4IMLA 1NGYB 5IW6A 4K7PX 1S9VA 1NCBL 1TZIA 5A40E 2OXGA 3FB5B 5LBSL 1VPOL 5EC1A 1Q0XH 4MNQD 3S5LA 3OMZA 4IOIB 1J87A 5JA9A 5E1AA 2B1AL 3VFSA 1CXHA 1EA9C 4O2EB 4LLVB 4EI6A 4IJ3C 2EXWC 4PG2C 1OAQL 2XNAA 3FONB 3DRQA 4G6JH 4Z7QE 2FJFA 4HJGA 3KPRD 2YD1A 1IRAY 4FFVC 3ARGB 4P46A 3UTQB 5CD3B 5CWSB 1AQDB 4LK4A 1PSKL 4K71B 1A1NB 4J4PD 4Z7VE 1SY6H 3CSGA 3OPZL 1RJYB 3QAZC 4OLZH 3T0EC 4X4YA 2VAAA 4HKZB 5FYKH 1U8NA 3V4VL 2EDJA 1NCAL 5IMOA 3K7UA 3IJSA 4OFPA 5T5NF 3SQOL 3QIBC 4OFDA 4N9GA 1FNGA 3MV8D 2VZ3A 3QA3B 1PKQB 4PJEB 4RMQA 2EDNA 2DLTA 2UUDK 4OKVB 4UB0L 1DLFL 1LO2H 5E8NB 5GJSL 2AJZB 3OKLA 2H32B 3K4DA 1MEXL 3ARBB 3MRQA 1I9JL 5INDB 2BXYA 5IFAL 1UWEH 3LRHA 4WY7L 2D9QB 4YGVA 3MRNA 3WFHA 4LCCB 4Y5YB 4ZFZA 5FA4B 3CFDB 4BZ2H 4M62H 1E4WH 5MENB 3MRMB 3GUTB 3HE6B 4JLRA 1JPSL 2VLRE 5GGUB 1QFHA 3R06B 4PJ5E 1TZHA 4LPTA 2HT2C 1HH6B 4OF5A 3TBVA 3S37X 5HI4D 3BDYL 4NQXB 4UV4H 1PZUB 5K9JH 2FL5A 4PGCB 4PJ9D 1DLFH 1V7ML 1YEEL 5EZOH 1RURL 3F7YB 3IVKA 2HKFL 4LHUA 4MNHB 1E4XH 1GJIA 4NHCH 1FNHA 1ZTXH 3BGFC 3F12A 5C0FB 1F6AA 5I8KH 2EDHA 5FA4A 3WSQH 2FECI 4KUZL 2F15A 2Q86B 3RI5F 2AXHA 4WFGD 3VFGL 1BVLB 3EJYD 4XZUB 4NO0D 5E6ZA 5HJ3A 1AIFB 4JFFA 1W0VA 5D7IF 4XPAH 1DL7L 2GJJA 4WUKL 4LLQB 4NUGL 2FEEI 1J0JA 2E7CA 4PJXE 3E8UL 1GYAA 1JGLL 4PJBE 2PW1B 1FSKC 3QIWB 1URLA 2BY0A 4NQCA 1UM4L 3BDBA 1MHEA 1UXSB 1CGSL 3QUYB 1S78C 4NKMA 5IVXF 4M9PA 4R4BB 5IBLD 1P4IH 1BHGA 4WDIB 1BD2A 2BNQB 4MZ3A 3HS0B 1BOGB 1NUFA 1MFAH 4K8RD 5J13B 2X4RA 5EOCH 2MSPA 4HJGB 4LKCA 2HJLB 4RIRB 2K7PA 4MJ6B 3V0WL 4MAUL 4XAWH 5BS0E 3QFJD 3SDCA 3ULUH 3HI6L 4NO2A 5LWYH 3QIUC 5E2VL 3OKMB 5E8DH 4KKBC 4PRID 4YDJB 4OZHE 4NQVB 1YEGH 32C2B 4NQCE 3VMOA 4N8VA 2FEDC 4NZTL 4YR6B 1MIEH 3VXSD 5I1IL 2GT9B 2HT4D 4PJCE 2WP3O 1U8LB 1KTDB 3ZDZF 4LQ1A 3TO2A 2X70B 4P49A 2ADIB 4ODUA 1YC7A 4LAQL 4LIQH 5DSCA 4XP6L 1II4E 2VIRB 4X7SH 4J6RH 3B6SA 1HHGA 2HYMA 5CMAB 5K33A 3KYNA 3HMXL 4TNVK 2P46B 3MJ7A 1DR9A 2CUHA 5GXBB 3MBXL 3QDGD 3QO1B 3KPSE 3DSNA 3TT1H 2WQ8A 3QUYA 3VMNA 5FDYA 4FMKA 3S98A 4FQPA 3SOBL 2H9GB 3F6LA 2DQTL 4U1GC 3Q1SL 4Y88A 1INDH 5I9QB 3T09