4UOFA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with dadp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
b'MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Nucleoside Diphosphate Kinase from the Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 47
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uofA00
1HHQA 4FKXA 3FBCA 4FKYA 2VU5A 1LWXA 1NB2A 1F6TA 1JXVA 3EVOA 3VGVA 1NSQA 2BEFA 3PJ9A 4DZ6A 3L7UA 1NPKA 1B4SA 1NHKL 1HIYA 3ENAA 3FC9A 1UCNA 3DKDA 2DYAA 2DXFA 3GP9A 3ZTPA 3EVMA 3BH7B 3ZTOA 3EMTA 3BBBA 1S57A 5CABA 1BUXA 4WBFA 4S0MA 4DUTA 1NUEA 1W7WA 3ZTQA 2ZUAA 3EICA 3VGUA 4ENOA 1S59A 3VVUA 1NSPA 1U8WA 1NCLA 3FCVA 4UOFA 3BBCA 2AZ1A 4F4AA 1K44A 1PAEX 3Q86A 1EHWA 4KPCA 3WX8A 3VGSA 3EM1A 4CP5A 4UOGA 2DY9A 3VVTA 1HLWA 2B8QA 5IOLA 1NDPA 3BBFA 3JS9A 1NDKA 3Q8YA 4EK2A 3GPAA 4UOHA 4C6AA 3FBFA 1XIQA 1S5ZA 3B6BA 3Q89A 3ZTSA 5C7PA 1WKJA 3FBBA 2HVEA 5CAAA 2B8PA 3EVWA 1WKLA 2CWKA 1B99A 3ETMA 2HVDA 4DI6A 1NDCA 1KDNA 5BXIA 3PRVA 1F3FA 1NLKL 3Q8UA 3ZTRA 3NGRA 3MPDA 3ELHA 1BHNA 2HURA 4ANCA 1NDLA 2NCKL 3NGUA 3NGTA 3NGSA 2DXEA 3Q83A 4W98A 1MN9A 1MN7A 3Q8VA 1PKUA 1ZS6A 3FCWA 4F36A 2AZ3A 1VYAA 4ANEA 3EE3A 4ANDA 4HR2A 1WKKA 1BE4A 3FKBA 3R9LA 3EJMA 3BH6B 1LEOA 4O0NA 1XQIA 2BX6A 2DXDA 3FBEA 3G2XA 3B54A 3DDIA 3VGTA 1NSKL
chains in the Genus database with same CATH superfamily
4O3OA 4WTYA 4O3RA 2RHSB 3W2WB 2HVIA 3BYPA 3V4IB 1IBKJ 4Q43A 3DRXA 5ETMA 3AJDA 3AQOA 3LALA 2YWGA 4O4GB 2NXJA 1B0PA 4JOUA 4X2BA 1RAGB 2Z0GA 1JJHA 2GV1A 5BR8F 1H0HB 1S59A 3EGVA 4YMEA 4IDKA 2NLWA 3A8EA 2MKSA 2HG4A 5DDQC 2HQGA 5HP1B 1REGX 3VF0B 2CPFA 4RW7B 1ZH5A 1UWBB 2OD4A 3L7OA 3IR7B 3QZ7A 1Y3KA 4LF1A 4RNOA 2D69A 3NNAA 1NPRA 3BO2A 3I31A 4BS2A 2GVDA 1RT3B 2CWKA 2HQIA 4P2FA 5L9XA 1HD0A 1MMDA 2MZJA 3ELHA 3OBIA 3SEOA 3PRBA 1ZTWA 1PYTA 4A8KA 1RJJA 4HDGA 4YY3J 5DQGA 2YKPA 3M6UA 4OZJA 1AB8A 4HH1A 1X5TA 1FNMA 4LSNA 1RTHA 2CQPA 2DTJA 4OFZA 3KK2B 3R6LB 3TA1A 4DZ6A 1NPKA 1GX5A 2DNOA 3PM9A 4C2MA 3SXLA 4D3GA 3BSAA 5IC4B 1ZAVA 2KM8C 3DLGB 4LF9J 4OI6A 3I6PA 4QIFA 2W25A 3M2UA 4K4ZA 1FXRA 3SSSA 5DDOC 1WG5A 2CJQA 3FGVA 4WFYA 5GAGU 1LW2A 3C14B 3KLFB 2QLBB 2IBOA 2GX8A 3QJLA 1CULB 1T94A 3FZ2A 2O3DA 5KTQA 3UD3P 3W64A 5FDLA 3H7HB 1UP1A 3P49B 4K2XA 2BANB 4UQGA 2HZAA 2RB7A 3UI3A 1F5CA 1LWFA 2MLXA 5F8JA 2JRSA 1OYDA 4WFAQ 4RNMA 2R7WA 3SDEB 4DR2J 3PYDA 4IO9Q 1UFWA 4YEAA 2HGNA 1T05B 3V6HA 2FHKA 2CPIA 1RKJA 2KFZA 2M9KA 2LXIA 4KB7A 2R2TA 3D6TB 2GCFA 4ZVHA 1TKZA 4NWBA 4KTQA 1MN7A 1RT5B 1VRUB 3MM6A 1UPPA 3BM7A 4DSKA 4OX6A 4OYWA 1JLFB 3QT8A 1RT7B 1JLGB 4RW6A 4F4YA 3CMES 9ATCB 4QWAA 4OHZA 1DZ5A 1CBKA 1H7WA 2VDHA 2AF6A 1WDTA 2BR0A 3M6VA 2VG6B 3EPGA 4GO5X 3OQ2A 1URRA 4ATNA 2VPYB 3RBDA 1VBXA 3K5PA 3ZNUA 4DR7F 1XEZA 4FVCA 3D2WA 4PG6A 1S0NA 1U6BA 3V6JA 2EFOA 1O0PA 4XIUA 3IO1A 2IVYA 1LQ9A 3C15A 4GKJF 4Q45A 2QSWA 4R5PA 3W9JA 2DHAA 5LSLA 1SH0A 2BE2B 1RTJA 1FNOA 4TVAB 3PACA 1IKWA 2AZ3A 3AA9A 3H20A 2ACMA 1CJUA 4OLPA 2HLTA 4TN2A 3T6JA 4DCPB 5ETQA 1YQHA 3L9ZA 1APSA 4ZIWA 5A0YA 3PO4A 1QSLA 1FJCA 2BEFA 4F50A 4GO7X 3GCXP 4WP8A 2LFVA 1OY8A 3CJKA 3R1HA 1C1CA 2WVBA 1J27A 2GHWA 4NRTA 1DURA 3VHQA 1WELA 2ZVSA 5CYQB 4PUOB 2IA6A 3KLIB 4EMDA 5H1SV 3A12A 2DB1A 5C25A 3GB0A 1VGYA 2IRXA 5A2QY 2QLJB 2IPOB 1Q16B 3I55S 5HROB 2V6AA 3H0PA 4KGMA 5AXMA 4U95A 2UUTA 2HVEA 3KFWX 3H25A 1O6XA 4K2JA 5B0FA 4F4ZA 5F8LA 1NJIT 2HAIA 3QO9A 5E7OB 4NEZA 3D28A 3MM7B 2BDPA 1T7PA 4DSEA 1VQNS 4O3PA 1U1LA 2DR8A 4J9MA 2XY5A 1YJTA 1TL3B 4WCEQ 1FFGB 2JFKA 4FDFA 3D3BJ 3IAM9 4YR0A 1RK8A 1QVGR 1KTVA 2IM2A 2OSQA 4DF4A 5HQMA 3R5BA 1SL0A 1R0AA 4DQIA 4ZKAA 2OMOA 1SIZA 2HMIA 3F41A 2HNDB 3FUYA 4Q5VA 3BDEA 3HJVA 3KNGA 3LUYA 2D1CA 3K2YA 1VQYA 5KFEA 3TUPA 1GTEA 3KJVA 3T1HF 4IR9A 1RTDA 4AT1B 1T9UA 2MLYA 4MKAA 1UZHA 2YWFA 3M2RB 4RKUC 2VPXB 2I38A 2K3IA 4IG3A 2Q3PA 3DXBA 4WE1A 3AT1B 4P2XA 2XHWA 3HO1A 3NGRA 3KKFA 2B43A 4OYZA 1ZAWA 3H98A 2KH9A 3CC2S 3K8WA 3SFUA 3T6BA 4NYZA 1U49A 5HMXA 1IBKF 3R5GA 2K7JA 4NZ7A 3MTJA 2AWZA 5ETTA 2WOMB 2K2PA 1ZPVA 2HHHJ 2GMHA 4NL5A 4N8NA 5A8WB 5HI7A 1FF2A 4DPXA 4ZLLA 2VV5A 3DOLA 5HAOA 1XJWB 3T19A 3SCLE 1Q95G 3VVUA 2RQKA 2W9BA 4IKAA 4TY8B 2QFJA 1MMNA 2ZDOA 5AJ3J 3WX8A 4C8KA 2WVDA 1L3TA 2DVIA 2K8GA 4OZLA 4AL6A 1IBMJ 1WG1A 4ECXA 3FBFA 4G6VB 1CS4B 1Q8BA 1PJ5A 4YY3F 4X64F 1XC9A 2IM0A 4L75A 4DSFA 5A6WA 4NLVA 1R8HA 4I6WA 1CJVB 1F5AA 3I0SA 2XNQA 1NK6A 3I4HX 1SKRA 2W2MP 2HYIB 1V5VA 3EYZA 1VRTA 1FI4A 1AW0A 1NHUA 2B51A 4LF9F 3HHDA 1X5OA 7AT1B 3FBCA 4Y2IA 1X7VA 3BPSP 4ID5A 2DY1A 1SC1B 1S1VB 2HQCA 2VQFJ 1KFSA 5LMNJ 3C2PA 1RABB 1FNXH 1XK8A 5H9FJ 3NWGA 1IJFB 2PC6A 5K20B 1XN9A 1WDDA 4U9RA 2JVOA 4GRSA 1JKHB 1V9OA 2AX1A 4IOCQ 4DV3F 3UN5A 3QGHA 3G8QA 5T7LA 4DR2F 3CJ8A 2FJAB 4LR9A 3M32A 4RUHA 2OPSA 3CO9A 1TR0A 4EK2A 3R7BB 2ZBQA 4YDDB 2KTQA 2VUGA 1F60B 2XY7A 4OYXA 2IJRA 1VQ8S 1UFLA 1WOOA 2OP5A 4OZ2A 2ZVIA 4FN5A 4P10A 3QLHA 1GXUA 2HHPA 1VCTA 2VASA 4XPCA 1JNZB 4DJBA 3W8PA 4Q8EA 2ERRA 1BE4A 2IHR1 2VOOA 1V3RA 3G2XA 1T8EA 3MXHP 5DGAA 4ZHRA 4IRKA 1RT6B 1GMVA 3NAHA 1RWXB 2GVDB 3NS6A 2W4PA 5E3QA 1LFPA 2A6MA 1FJEB 1VI7A 2DEJA 2CQ3A 2HFZA 1UVIA 2J6SA 1CJTA 2XB2D 3PCOB 4HH0A 3SV3A 1OO0B 1GNKA 3J80U 3GTYX 3H2LA 2HS3A 2AW0A 2KG0A 4H4KA 3HVTA 4LSNB 1RTHB 2MQ8A 4DFMA 4ZPAA 3DOKB 4ZLJA 2F65A 5CXTA 2C42A 3AOBA 3HMJG 5ITHA 3U1NA 3MMCB 3BGUA 1M1HA 1S6PB 2BA9A 1Y5LB 1HBMA 3M2UB 4EZ9A 5KG1A 2Z57B 3EXCX 2EPIA 2DHHA 1BHNA 2VQEJ 1X8DA 2W4CA 3DMJA 2DXEA 2QIFA 3CD5A 5CZVA 4MT1A 3M2VA 2VFVA 5FDLB 2UUAF 5LT5A 3OFFA 4QW8A 1FRHA 1H72C 2MY7A 5KFFA 4BDPA 2MXYA 4ED4A 4RPFA 4J90A 2FTRA 5GMKa 1RDRA 2DIUA 3HPOA 4O44B 2IYGA 3NAIA 1VLOA 4EO6A 1SXLA 3MM6B 4OYOA 2IYIA 4C8MA 2KFNA 3LP1A 2D3UA 3TW0A 2Q66A 2KZMA 5KFKA 2RRBA 4WPAA 4DX8H 3PX6A 1HR0J 3R7SB 4CTAA 3RW6A 2IFXA 4DXLA 2FVRA 3TJAA 3DLKA 4LRCA 4F3QA 4CLPA 3Q83A 3MD1A 3EE3A 4B9SA 4YB7A 4N56A 1VQMS 5L9NA 3I9V9 2PI5A 2CG8A 1Y00A 3L7UA 1X31C 4NRUA 3BO4A 3VAFA 2AJQA 2JLGA 5DG8A 4LJMA 4R5PB 3IA0A 3I9ZA 3DRRB 2C2ZB 2BKOA 1IKWB 4TYBA 3MDFA 5A8KA 1CJUB 4JP8A 2ZH2A 3OLBA 2DISA 4UTGA 2HBZB 2XS5A 1CQNA 3CXCR 3KJQB 5B0GA 1FTCA 5D6GA 1F3VA 2PDAA 5A0YB 1NNDA 3VGSA 2QL5B 1R0CB 1W26A 1C1CB 1C0TB 2CPZA 2QX0A 1EP4A 5JJBA 4NYPA 3I5CA 2HRUA 3QSYB 4QYZJ 4UZCA 3M8PB 3MPDA 1QY7A 1NK8A 1X4FA 3M8YA 3DC2A 2HHHF 2N7CA 5C25B 2BJ9A 3H90A 1Y11A 4WP9A 2N82B 4I4BA 2VF3A 4CH0S 1YJVA 2H4YB 1AXQA 1NB2A 2EI5A 2R7TA 2Q6BA 3QO9B 2YKMA 7FDRA 3HHKA 1TELA 3DGPA 5GAEI 2HFVA 5AJ3F 1HHTP 1S57A 4NLXA 4LF8J 3CIMA 2CQ2A 1NSAA 1IBMF 4IG0A 1WG4A 1FRIA 1S97A 1DTTA 5HQ8A 4WU2A 4ZS6A 1Z2LA 2XYHB 3E3XA 2MB0B 2AGOA 1WKJA 2XI3A 3IS9A 2XS7A 1WKLA 1WC5A 2LQ8A 4CYUA 2HMIB 1IM6A 2DKOB 2VQFF 5LMNF 4TYAA 3KJVB 1K0VA 1A6LA 3CJ0A 2UP1A 2XSJB 2ABYA 4CLTA 3RB4A 4IQMA 3FQKA 3C6UA 1D9DA 2GQQA 3GFZA 1FD2A 1RLDA 1SI9A 2G2ZA 4MK9A 2O01C 3GCWP 4MKYA 2M8DB 4JI1F 2A0FB 3IR6B 2W8LA 1SUQA 2L9WA 2YKOA 4IG3B 1NJWA 1S1WA 1NJZA 4N47A 3MAAB 3UVJA 1UA0A 5HBMB 2YY3A 4DZDA 5HJYA 4GKKJ 4GMKA 1AROP 4JYAJ 5F8IA 4CO4A 2XZWA 2HKEA 2MKIA 1HBNA 5D78A 3V2UC 2UXCJ 4AL7A 3EICA 4NLGA 2QFIA 2GC8A 3KHHA 4B3TJ 2HBQB 2FZCB 2E5JA 3RR8A 4BLGA 2R7VA 5CCLA 3CCES 1BQNA 1BGXT 2XBPA 3HD2A 3GPAA 3D67A 4ES3A 5A8RA 3A8IA 3CC4S 4RW4B 2OKQA 2VD3A 1ICEB 3POTB 2IJFA 4J9UE 3MUMP 2R7XA 3IG1A 3DOLB 2ZBCA 2RS8A 4ILLA 4LF7J 3MEKA 1Q7LB 2W9BB 3MECA 4EO8A 4X66J 2E5GA 1HMVA 2WSCC 3WZ0A 3QRPA 2MQNA 1SV5A 3EJMA 4YDXA 2O1PA 5J2PA 3LF0A 3J80Y 1JWWA 1QAYA 4JI8J 3NGKA 2W2QP 4L6V3 4PABA 1HNIA 4DV7J 2XI2A 1WEXA 1KN6A 3GWCA 1HWJA 2VKZG 4G65A 1SH2A 4XPEA 5IC6B 3DYAA 1Q8IA 1RQ0A 1KWMA 2JDJA 1VRTB 2G2YA 3JTNA 3MEDA 4GVBA 2ZJQQ 3RBEA 1I3OB 4A8WA 3CCSS 4ID5B 3RRKA 3D6FB 4PPDA 1JLQA 4NOHA 1H2UX 2VQEF 4P7VA 3Q89A 3T9ZA 2BE9B 2C2NA 1OYEA 1NRKA 4CCHA 3PHEA 3DNCA 3IWXA 1NPPA 2ADCA 2L48A 5AXLA 4WK3A 4ZVUB 5LXRA 3QJPA 3LAMA 5T7LB 1LWEB 4I1TA 3AQPA 3M32B 2M8HA 1F9EB 2EC2A 2BVZA 2E7VA 3TQEA 5GAEU 1VQSA 4EYIB 1EAYC 3WIUA 4QBUA 1Y3JA 3O2IA 5L46A 2RH3A 1S9EA 2CQGA 4YB1P 1RB0A 1VK3A 3QLHB 4NMLA 2EG1A 4IUFA 3BH7B 4NASA 1UZDA 1TFWA 1PYOB 1FE0A 1ZTTA 1NO8A 3V5RA 4ED5A 3OL7A 1WI6A 4R8UB 5DDPC 2KYXA 3C8YA 3GR0A 2W24A 3CMQA 3UQSA 2OHDA 1RHKB 5CA5A 2AGPA 4WXOA 5KT7A 4DUZJ 5KFLA 1GMUA 4OX8A 3JYTA 1CJTB 4QZVB 3GILA 1KOOA 5HLFA 1P6TA 2IRYA 5I3UA 1FWLA 1PBUA 5HK4A 3T5KA 3BQ0A 2XGPA 2QGFB 3D1HA 2B7CB 1RA6A 3LWMA 3G82B 1VRQC 4NZ0A 1VQ9S 4CLWA 3DM2A 5HMZA 1HBMB 2FVSA 1QVFR 3RZAA 4F3MA 4USTA 2UVUA 1H6KX 4B9NA 3DMJB 2D9OA 2HPUA 2WTFA 4BC7A 1WOPA 2UU9J 2JC0A 5CABA 2FVPA 1AFIA 3TQ1A 4A47A 4FF2A 4B3OA 1K8AT 2JNJA 4WP3A 5D0GA 3PNIA 4ZPWR 1R8CA 5J2MA 2QZ8A 3R5DA 4I68A 3QJJA 2JEGA 4LIRA 1ZA2B 2KO1A 3KDOA 2YQ3A 3MR3A 4NLOA 4KR0B 3ETMA 1RACB 2HRYA 1U0HA 4X4NA 2XMAA 2CADA 1RTZA 1RSCA 1XERA 1X4BA 4PXCA 2DCUB 4MAKA 3FEXB 5L1LA 3CEDA 1FEEA 1U2FA 1PKUA 2B4UA 3MMBA 2VODA 1LK5A 4FYWB 2B9XA 3PIOQ 2ZH3A 1XQIA 4KQZA 4Y3CA 2AYBA 3ZXWA 4UY8T 4LF8F 3L09A 1FCAA 2J5AA 4MIWA 4PQUA 1PYSB 5KFDA 4CTAB 2AJ0A 2IM1A 3D3CJ 4F4WA 3SSRA 1KQGB 3RB0A 4ZLPA 3TX8A 2PT0A 4CIOA 3TAMB 4ZJQA 6FD1A 1HBOB 1QDUB 4XAKA 1YX2A 1S79A 2HQDA 1LXNA 3K89A 3UW1A 2H51B 1G7CB 4X84A 1B7FA 3B4MA 1UVNA 2DGOA 4NZ6A 4QOTA 3D9BA 2XC9A 4C9DA 4JI6J 1CG2A 1EARA 3QAUA 2DNKA 4P73A 1ZOTA 2F3JA 2IM3A 1XNQJ 4P71A 3HHLA 1WEZA 1HQEA 3FJ2A 4JV1A 3ZZZA 2BOPA 2HURA 3HX9A 4B02A 2FHMA 4ELUA 3K0JA 1P27B 4KFBA 3J7YI 2FZGB 1FKOA 3V81B 1DLOA 3HD1A 2W9CA 2MZ1A 4W92B 4KAIA 4U8YA 5ETVA 4GKKF 4IFVA 1IXKA 4JYAF 1WJ9A 5EX3A 5CZXA 5GVQA 2D74B 2UXCF 3HDSA 3UCUP 3EGZA 4B3TF 2EFNA 2CPHA 4DPOA 4CNYA 3OR1A 2ALZA 1U24A 4ZVTB 4IRCA 4M5NA 5KG3A 3RU0A 2VBXA 4P75A 2YH0A 1KVIA 3OJUA 1JJ2R 4R0EA 3P5TL 1VBZA 1HFEL 1T02A 3O3LA 3PYGA 1C0UA 2HHTA 4LF7F 4TLQA 3UN3A 5K9FA 3QRQA 4RNNA 2YKMB 1IQTA 1S5ZA 4NPOA 4X66F 1FRJA 3MM5A 4PCQA 4ECSA 2KRBA 5L1JA 4V19X 1Q0NA 3THTA 3HKZD 3MPVA 3MM9A 2CQBA 4ZVGA 2F1FA 4IG0B 3T9NA 2BM1A 2ZITA 2L41A 2M5YA 3UE2A 4DV7F 2QEXS 3QGIA 5D4PA 2J0WA 1PG5B 1SPBP 1YJNS 5JMNA 4PXDA 1J2VA 5AXKA 4Z37A 4A46A 4ZCMA 5EX0A 1S4FA 2QMXA 1N32J 5KFQA 3Q8RB 3E51A 2NS1B 3KNAA 1BY9A 2E1CA 5KT6A 3PEHA 1AA1B 4DUYJ 4B3SJ 3JQMA 4P7TA 4M5IA 4KO0A 1SUQB 4Y34A 3RGIA 4C3MA 3PIPQ 1S1WB 4ZA1A 2O5DA 1RAAB 4V1Ak 2E1MC 2M2BA 3UVJB 4HDHA 2H5EA 3FMWA 4I69A 1U7LA 3K17A 5HMWA 3EZOA 3CCZA 1HBNB 2DHSA 3V6KA 2QYGA 1YG0A 4ALZA 4NA3A 2C3PA 5GMEA 1TZ0A 2CQ4A 1Q53A 3GJQB 2B9YA 2Y3YA 3HVAA 4F2RA 2PA8D 4YFUA 1HARA 1BQNB 3D6HB 2DXDA 4H4MA 5KFMA 5A8RB 2D41A 1OSDA 1H2TZ 3CPWR 3IG1B 2R7QA 2PE8A 3UFCX 1DRZA 2Z2MA 4TQRA 1HNZJ 3MECB 3CMAS 3HULA 4E8UA 2MSTA 3BSNA 3K59A 4WBFA 2DGXA 5I3PA 5F0WA 1SV5B 2A6OA 4DUZF 4MTPA 2NUHA 4C8NA 1HBUB 4LR8A 2OJ3A 1HNIB 1G3OA 2ROPA 3VAKA 3UDEA 1NH7A 4M5LA 1CPZA 1R27B 1KOHA 1FKAF 3DYAB 1XBWA 1S76D 1LWCB 4J7CA 5GAHU 1YZ6A 2NXUA 3T41A 3MEDB 5DETA 1NDLA 4GVBB 2GVZA 5B0EA 2OO4A 3ENWA 5DGBA 1Y5NB 1R8AA 1NEEA 3M8QB 3GJRB 2UU9F 5MAOA 4WXWA 5HVFA 3JQKA 4CLYA 2M3DA 1QSYA 1TL7A 4N76A 4PYAA 1FXLA 2XEXA 1KNZA 2ZJRQ 4HYKA 2BZ2A 1GMWD 1TV6A 2PFFB 1WC6A 5H9EJ 3O6QA 1U8WA 1QAIA 2QG9B 2GGPB 1RBAA 1SVDA 5T41A 3Q8SB 3BBCA 3Q8PB 1ZA1B 4IYQA 2X1AA 4RW8B 2I6WA 2R2SA 5E3AA 3LGNA 4DR5F 1ZBTA 5J2NA 3MM8A 1YJ9S 2V0NA 3G6VA 1S1XB 5IV3A 3BDPA 3WHIA 1R89A 5KAKA 2XO6A 3Q24A 5I42A 4A8MP 2V2KA 3WDOA 3WC0A 4LF6J 2ZUGA 2GAGC 3LP0B 3N5BA 4XDDA 2E66A 4ELTA 2BBEA 3G71S 3HI9A 2K1RA 1WI8A 3JYTB 3K57A 2MMYA 1RAEB 1J5OA 2Y8WA 1RZMA 1S1TA 4KHPJ 3KK1A 2YKNA 6AT1B 1BQMA 2CPJA 4B08A 5I3UB 2ZKUA 3D0GE 4JI6F 1NAQA 1RT2A 5E2QA 2VA2A 3AHPA 1MU2A 2YNHA 4C8OA 3IRWP 3BZQA 3BYRA 1GQEA 1XNQF 4K0KF 3DM2B 3TRGA 3NG8A 3P96A 2KT3A 3LGMA 1S7HA 5KFUA 4OI0A 2Q79A 2B8PA 3LP2B 2CQDA 5HMYA 2CAJA 2W9AA 3FQLA 1EKSA 3PYFA 2FJWA 2Y9HA 4B3OB 5G0RA 2QJ3A 1SQEA 2DNNA 1UWAA 4H4OB 1N33J 4DQPA 4HR2A 2Q1LA 3W63A 2EK1A 5J2MB 4DF8A 1JLEA 3CDWA 4X4TA 2VJUA 1IBCB 2MZSA 3CDBA 5DZ6A 3DRSA 3HHEA 1RHJB 1N5VA 2LCWA 4PXBA 2PI4A 2EEYA 2D3ZA 2R7SA 2AT1B 4J37A 3BBBA 3PX0A 3KWMA 4FYDA 3MMBB 1W7WA 3AD8C 1GTHA 2JLEA 1X4GA 2R7OA 2YBVA 2XLIA 1KVJA 1ELOA 1KC8T 5D8HB 3ET6B 3NS7B 1R3NA 2DY9A 4PQUB 2CVEA 4L72B 3N6LA 3CE8A 1H38A 4DG1B 1LV5A 3S8SA 2FHJA 7FD1A 3FZBA 3OHBA 4Y2CA 1UEUA 3KUHA 3WBZA 5AT1B 1IVZA 1FK9A 3SYZA 3MURP 3OTBA 4DPTA 1FTRA 3W2VA 2KU7A 1DY3A 3U27A 2KJVA 3D54A 3EZUA 3PDNA 2IDEA 1TTHB 4UOCA 4BHQA 4FNHA 2LMIA 4G1QA 2CPDA 1RHQB 2DNGA 2DD8S 4A8FA 2LKZA 4DUYF 3HHLB 4B3SF 1S6UA 2H54B 1RYRA 1C4CA 2ZD1A 2C3UA 5HANA 4YB5A 5F8MA 1DARA 5KFOA 1VQ4S 3F44A 3WIVA 3F0NA 2HZVA 2ALYB 2ZH9A 2X3GA 4IFVB 4P72A 4AYBD 3A4TA 2IC3A 3H8YA 2WCXA 2YX7A 1RI7A 4NEYA 4N41A 3TO8A 3EVWA 4R25A 2VPWB 2HVDA 4WYLA 4M5JA 2XQCA 2CQHA 1PC5A 3PZPA 2D3OR 3IBWA 3PJXA 4OYPA 3VWSA 1HNZF 2CJ9A 2AJ2A 4B9TA 4TNOA 3MM5B 5U47A 2XG8A 1HI1A 1TFYA 2MJUA 3Q2TC 2F4VF 5EGYA 1ITPA 2XM3A 2C2MB 1T11A 3BR8A 3HT0A 4A8XA 4QU7A 3OL6A 5LJ3Y 5A6PA 4QR0A 1RT4B 2YNIA 3GV5B 3DOMB 3C6TA 2IVFB 2WBMA 2HBRB 3UDCA 3TYTA 2KL8A 4FPRA 4PPZA 1U6FA 2U2FA 4ECTA 4NLWA 1AUDA 4J9QA 3NGDA 1JJCB 1VC0A 1T9TA 2BW7A 3I96A 3R97A 4DL3A 4OQJA 2JX2A 2XHCA 3HSJA 3C16A 4ZCLA 2A10A 4HLBA 2B9WA 1U25A 3CJTA 2DR7A 3OR2A 4KO0B 4U96A 2B56A 4CH7A 2OPRB 1VS3A 1R6VA 1DBDA 2GO9A 1NHKL 4DR4J 2QTWA 3S7RA 1FRKA 3M4XA 3JAMU 4QWCA 1S6QA 2FD2A 5CH7B 5KT4A 5J2QB 4KT0C 2HIQA 3TNVA 3QT6A 1N34J 2VC0A 4EFAC 1WF2A 4IOAQ 2H9ZA 3CJSA 1E6VA 3H5UA 2JH3A 4QWDA 2OPPA 3AOCA 2DNLA 1S6OA 2ASLA 1JMTA 4EUVA 5DDRC 2BJ8A 1NMEB 2APOA 4LF6F 1T9XA 3T5JA 1JLBB 4PRFA 3G8SA 4W90B 1D9AA 4ANCA 5DM7Q 1FO1A 1CJKA 1SJ3P 4J9KA 5EHHA 1U8SA 1FRXA 4MYTA 1GH8A 4O23A 1LEOA 2HNYB 2VBYA 4TLRA 2QL9B 4JV5J 1Q8KA 2ZOMA 2I5JB 2OLWA 1KKHA 2P9CA 3DLBA 1B4SA 2HS0A 1EQMA 2IMOA 3VAIA 3D6MB 3X3UA 3QWUA 3JSMA 4QIWD 4X4SA 1KONA 2W7OA 2WAQD 4ZOSA 2GVZB 4K4YA 2XMTA 3L4BC 1S1UA 2I8EA 4Q2LA 1XWLA 5GAGI 4I6YA 2M7SA 4O3QA 3HFKA 1TVRB 2V8DA 1IKYA 3OV7A 2KKHA 1WACA 4DV2J 2F8EX 1NZAA 2YWKA 2HK2A 5GADU 2B8QA 2KYZA 1M1KT 4O4RA 1TL7B 2ZBPA 2XZDB 3G9CA 2HVZA 2C1EB 1N33F 4ZCKA 3ILIA 4MJKA 3AXMA 2AJ4A 2NZCA 3PRVA 1N52B 4CLUA 1NKEA 3FEZA 2R8IA 2B4PA 2RUSA 4ED2A 2RMLA 3TUIC 2P6SA 2DEIA 2UUBJ 2BX6A 5C42A 2GW8A 3D7SB 4KBIA 1QE1A 3AAWB 2W8KA 4KH1B 1HHSA 2NXCA 4WTOB 2EW9A 4XTTA 4PG4A 2NPFA 3OL9A 1ZZNA 4RBTA 4KV8A 1N0UA 3ILOA 5F9NA 2ZUAA 4PG8A 2NQPA 2CXEA 3M6XA 2YXLA 1SC3B 1G1XA 4FS1A 5L38A 3OFHA 4ZP9A 2ADBA 3THVA 1GX6A 3DLEA 1C4AA 1S1TB 3UDLA 2R7UA 3KK1B 2YKNB 3RRHA 3B6BA 3CJQA 1UW9A 3QBCA 1HA1A 4ECRA 4FF4A 1IJEB 3NLCA 4M94A 3DU5A 4DMZA 2U1AA 1I94J 3VAJA 4JI3J 3ZTRA 3TOQA 3N5FA 1RT2B 2J7UA 1RHRB 3CD0A 2YNHB 2NCKL 3ZC4A 4LT6A 4W98A 4ED8A 1UEKA 4XK8C 1TQLA 1VYAA 1FJGJ 2IDLA 3CDUA 1CC8A 4TKTA 4DV5J 2L9NA 2BJDA 2HHSA 2XYPB 2VG7A 3CCTA 2MZRA 5IFMA 1F0XA 3OXGA 4DL4A 2RSQA 5T14A 3ENAA 4C11A 3UN2A 1UCNA 5KFXA 2UXDF 1M0SA 2EC0A 3KLGA 1WEYA 4C97A 2GHPA 1Y7PA 1Y4ZB 1MSWD 4WU3A 2K06A 2GAHC 2WONB 2VKRA 1O8BA 3FDSA 4YR3A 1IR2A 2OUGA 3I87A 2CPYA 3JSYA 1PAEX 4CP5A 4WIIA 3ZZOA 1IWAA 4IQXA 1QTNB 3CTRA 1QSSA 1Z2ZA 2LQ9A 2YPZA 3RG6A 1HNWJ 4DSJA 1Q82T 3OSNA 3DCAA 4DHVA 2AYMA 2COLA 4WIQA 4DR1J 4QYRA 4PG5A 2X1GA 3CCJS 3OVAA 4BWJA 3JSRA 3HF5A 1S9GB 2DGVA 1IWGA 3KDNA 4Y2MA 3VGTA 3O44A 5DG9A 3OSPA 1X0FA 4ID8A 4YUDA 1YITS 4KC5A 2RILA 4DFPA 2XNRA 1FK9B 2RDJA 3QSIA 4DX7A 3OVBA 3SI8A 2X1BA 1LW0A 2LA6A 4DCJB 2KVIA 5D0RA 1IKXB 2PFDA 4HTJA 5KT2A 5AE2A 4FXWA 4AXJA 5B0CA 1VK8A 2B6AB 2HS4A 4RWWA 2UVWA 2MSSA 4OJGA 5KG0A 3Q22A 1NH8A 3JAMY 2UXBF 2GIQA 3OUYA 4ZVRB 2FB0A 2LXUA 4A8YA 2YPYA 1JXEA 4DR4F 2RDIA 1SC4B 3E8OA 2IC3B 2RJZA 4B9MA 1W25A 2PMZD 5DM6Q 4Y65A 3CW2C 3ENQA 2C28A 4NLTA 4ILRA 5FD1A 2DT9A 3PTWA 1FKPB 1UEVA 5CQGA 3PR5B 3OLAA 3KHLA 3MR2A 1N34F 1UL3A 1XR7A 4PAAA 5M2RA 5DO2A 3IRXA 3BSCA 4JI4J 1KTQA 3GG0A 3GIRA 2X51A 1N5TA 3CVKA 3M8RA 4WK1A 4USUA 2BUNA 2E7WA 2MGZA 1L5UA 4USWA 2FVQA 5D3GA 2GMLA 4F4AA 1HI0P 4LFBJ 4QR2A 1UFKA 2RKIB 4RBUA 2YTCA 3CWJA 3CD6S 2IAJA 1ZM9A 1U45A 5LJ5Y 4LF5J 3QRRA 3R1LA 3R2DJ 1S4EA 4USMA 5KFTA 4RL1A 2F63A 5IV4A 3ULHA 3PKYA 3EX7B 2MDAA 4JV5F 1UW4A 3C6TB 3BSOA 3CCRS 4M63A 2FJXA 3LTOA 4DEZA 4DV0J 1VHFA 3O5TB 1WHYA 3NWRA 4L3KA 1H7XA 5IQ6A 2WZ1A 3E01A 4DL2A 3ITHB 1Z1ZA 3H2UB 1WOSA 4DU7A 4I7FA 4DOZA 3OD2A 2P8IA 2DYAA 3I5AA 4DV2F 4O3NA 2HEKA 3C16B 2FJBB 2W4DA 2XS2A 2MYFA 3O1LA 2J9DE 3H59A 4CLFA 4B9UA 4WF9Q 4GVLA 3OR2B 4F0KA 2YQ0A 1HNVB 4NLRA 3M30A 4LREA 3US5A 1JQGA 1NCLA 3N01A 3A3OB 2CA9A 2WK4A 4G3IA 1EHWA 2VFTA 3NCRA 2ZBRA 2MZTA 4B3RJ 2HW3A 4LBIA 5D0HA 1S12A 2OFHX 2V4JA 4NLSA 2HK3A 1F5BA 1N6QA 3IM8A 4DV6J 5KFAA 2UUBF 1S0VA 3W7BA 2G0CA 2D7SA 1TK5A 3F56A 1NBEB 2OPQB 2XCPA 1U1KA 4NCGA 3UCGA 1YGYA 4ANEA 3BN4A 1WKKA 3W2WA 3KOAA 5CHCB 2RVJA 2V9WA 2HHUA 5JXSA 2C3MA 4OZ0A 3IBFB 1R8PA 4UY85 1TL4A 2DXFA 3MOZA 4GC7A 3CT9A 4USKA 1R8BA 1RU2A 2E1AA 5A76A 3HHNB 2DNMA 3TVYA 3I0RA 2DR5A 4OLOA 2BE7D 2HFUA 3H4DA 2CG4A 3L7PA 2VJVA 1X4HA 4HEA9 2DCLA 1UWBA 2BOAA 4AFFA 4USVA 1I94F 2KDOA 1H98A 3CJ3A 4UOGA 4JI3F 1RT3A 4RW9A 5DJBA 4OIXA 3QZ8A 1NKCA 5K14A 3JSMB 2ZH4A 1S77D 1MWZA 1CQMA 3DRPB 2ATLA 4Z2XA 1FJGF 1VBKA 1ZYQA 3CNQP 4DV5F 1FVSA 3O8WA 1RWWB 4HT5A 5HJXA 1SQFA 2RT3A 3CC7S 2XWYA 1VQ5S 2HWIA 1EETB 1OWXA 4ED0A 2UZAA 3K5OA 4PWDA 5KFPA 3KXDA 1LKZA 3KK2A 4J91A 1XMBA 4K5SA 5C2CA 2BRKA 1SQGA 4Y2KA 5B0DA 2R8KA 4U7UK 8AT1B 3RAXA 5KFIA 1YJUA 3SCJE 2H5JB 2LDIA 2DK2A 4PEOA 1V3SA 2RE1A 2GO8A 2C22A 3KLFA 1UJ6A 2QO3A 1YJRA 2CQ0A 2KFYA 3BO3A 3J81U 1CULA 2Z2ZA 3AODA 4L73A 2AQ4A 1WTFA 3W5XA 2UV8A 4ED3A 3RBZA 2ZE2A 1HNWF 1JLCB 3FCVA 3P5BP 1QE1B 4N5SA 3KHGA 3FFIA 4G1IA 3DFEA 2DH7A 3SCIE 1TKTA 5HN0A 2CDQA 3SDEA 4DR1F 4AD6A 3OTCA 4Q0BB 4ZIVA 5E33A 2BQUA 1XMQJ 3V6DA 1Y0HA 2G1HA 3R6GB 4M1KA 1RT5A 2ZZTA 4KV8B 1QUPA 1VRUA 4KSEB 1F3FA 4WFXA 4HHJA 5D4NA 2K7KA 5D4OA 5LMUJ 3FVYA 4LRFA 4OZ3A 1WF1A 1JLFA 1RT7A 2FJVA 2FYXA 1JIHA 3HZEA 2A18A 3D68A 1KRPA 1I6JA 3MCMA 2OEJA 2VL1A 3I4PA 4CZCA 2HVHA 2KB2A 1RKIA 4FBTA 1F6TA 4ZPTR 4M5MA 1D1UA 1VBYA 4J9RA 4JUZA 4JI7J 3ILJA 1FX4A 3VZIA 4QIGA 3KLVA 1U4BA 4M5KA 3BN7A 4E0DA 1E6YA 3SCKE 3TX0A 2ZOGA 2W2PP 1R7IA 5AE1A 1U1RA 2N7YA 4RWXA 2VG7B 2LECA 2HGLA 5HQLA 2ZZMA 2JLFA 3Q86A 4KPCA 1KVKA 2QMUB 2VFRA 3BGOP 2MKJA 4IDKB 4C11B 1N48A 2MZQA 4HVZA 5DG7A 4O3SA 4DCOB 4JBCA 2HWHA 3EWGA 2FGOA 2WB1D 1UVJA 4HI1A 1G4CA 2MKYA 1NDCA 1NJYA 4ZP7A 2E1RA 4CLKA 2Y0SD 3ADAC 1VJQA 1B7YB 2I0XA 2VOPA 4ZLNA 4YQWA 1Y9OA 1X5PA 1Q5VA 3TZXA 3TAPA 2ZH5A 4K5RA 1LWXA 1QLNA 1MWQA 3R8YA 3S01A 2AMCB 4TY9A 3RB3A 2OH2A 4OHXA 5CYQA 3OTDA 4PUOA 3KLIA 4LRBA 1SJQA 4RO0A 3M8SA 1D09B 2IMWP 2W01A 4LFBF 2LEBA 2EK6A 4C0OC 2ROGA 2J0XA 3MPUB 2YVSA 3LAKA 1KFDA 4DUTA 4LF5F 5HROA 3NBPA 2CYYA 3TARA 2WB4A 2V2ZA 2RU3A 1LW2B 1NDPA 1FVQA 2HFNA 4DLEA 3MFHA 2C2DA 4DV0F 4DSIA 4A8OA 3DLJA 4FZVA 5BXIA 1VDHA 1FRMA 3FSXA 3MWBA 3G6YA 1LWFB 4F3OA 3W62A 2FHOB 3SV4A 4KY3A 1FX2A 1K73T 4OL8A 1TL3A 2JEJA 2OMLA 3AFGA 5IT9U 1ZS6A 1RUSA 3FCWA 1HQ2A 1UTAA 2HAFA 1I5OB 4P6QA 1DHMA 2HIYA 4X4QA 1QD1A 3RRGA 4YOEA 2RRNA 1YTYA 1TKZB 1FD8A 4KHRA 5KFZA 4DPUA 1R0BG 3U02A 1TAQA 2BXJA 2IVMA 3TVZA 2KXHA 3AJ1A 3HJFA 3HZGA 4LF4J 1OQ6A 4OV6A 4JI2J 4F67A 4RW6B 1SCJB 1RCOB 2W2NP 3OUYB 4QPTA 4ZVFA 4B3RF 1FDNA 2WVFA 2ZBIA 1T03A 4USIA 1EKRA 3W66A 2MEWA 3AY0A 4P74A 3T5HA 3PEJA 1RHUB 1WORA 3W5YA 1HLWA 3Q8YA 3K58A 1KSPA 4ZVSB 3KHRA 3RTVA 2GQ2A 3IRXB 4M95A 2GQCA 2I9SA 5F3TA 5H9FK 1FEHA 2VC1A 5I4MA 1RBLA 6FDRA 1UKUA 3LWLA 4ZITA 1S10A 3C15B 5BJRA 3U1LA 2WOMA 1SL2A 4DX5A 3RW7A 1LNQA 2IAJB 1MROA 3S6EA 4K50A 1RTJB 4FKXA 2VH7A 2FDNA 2KHDA 3CF5Q 2AD9A 4LRAA 1RWNB 1TL1A 1SBRA 2YWWA 2ZDPA 1GT8A 2MKCA 3LH2S 3GU0A 2MLZA 2ATCB 2QRRA 2FPHX 3CUNA 1FDAA 5LSOA 3CJKB 5M2PA 3ISND 4ZPVR 1SB6A 4EBCA 1KHWA 3E01B 1M5KC 2FQQB 3JS9A 5KFHA 2F8MA 4MMOA 1SKWA 3RJMB 1N54B 3L95X 2BQ3A 2JEFA 3G4SS 5D4LA 3VAGA 3HFZB 5KFCA 2XSFA 3MR7A 4ECYA 3M30B 1RWKB 3THPA 4IRDA 4IR1A 3MTKA 2FJEB 3J81Y 2RDDA 5DZ7A 4AL5A 2MPUA 3TA0A 1L3KA 2MY8A 4DDFA 2QA4G 4ZPCA 2E9RX 1KEKA 4DFKA 1HYSA 2ZZNA 2UV8G 3PJ9A 3IM9A 3TUJC 3CD7A 4C0BA 2BABA 1G6BA 2ZEJA 4DQSA 5K5MA 1TKDA 3U7JA 2NXEA 5F41A 1Q1KA 2CZ9A 4YS2A 4H54A 3ZTQA 8RUCA 1YKWA 3PFEA 4LFAJ 1NK7A 3QIPA 1XMQF 4LFCJ 1Z4UA 1R0AB 3OVSA 1WNEA 3MEGA 2CDRB 5LMUF 3CCMS 2WBRA 3VCDA 3ZTSA 1C1BA 4TU9A 1TK0A 3GLJA 2JSXA 2DNYA 4I0WA 1RTDB 3I0RB 1YI2S 4DPYA 3GSDA 3R2CJ 1W2IA 2VFSA 3PW5A 1OPIA 4F25A 2DR6A 4WE1B 1RT6A 4JI7F 3W9HA 4RW9B 1K9MT 4O0NA 5K14B 1QJHA 4U7CA 2V5HG 1X4EA 3PRDA 4X64J 1S0MA 2P9EA 4J9SA 4PWDB 5CCMA 1RLCL 1U2CA 2M52A 4K59A 1BUXA 2QV6A 3HSGA 3DOKA 2RNEA 1CC7A 3D0IE 2YH1A 2GMJA 4XO0A 4FPIA 4F4XA 3LOUA 3MMCA 5CD4H 3HHLC 1S6PA 1KHVA 4C6AA 3N79A 2JOQA 4J9OA 5MLCV 3M8WA 1VISA 4F2SA 4CT8A 3H40A 4K8RA 1QM9A 3SBMA 2ZHAA 1U2RA 2ZE2B 3MAQA 1Q7YT 4RR5A 4EYHB 4LR7A 4PQAA 2I2YA 1JK9B 3BS9A 4CDIA 4DV3J 1WC4A 4M5GA 3FFIB 2RQ4A 4WFZA 4ECVA 1KLNA 1TKTB 3I0SB 2DNPA 1SJ1A 2OI2A 1P9QC 3DDIA 1NB7A 3K8VA 2VG5A 4O44A 4FKYA 2DGWA 2VU5A 1H3DA 2WHOA 3V6DB 3MFIA 3NCQA 5C5JA 1HWIA 3W5ZA 1OY6A 2F8HA 5JUMA 4J9VA 2RQMA 3KTQA 3BKTA 1BWEA 3ICLA 3GIMA 3MPWA 2N4CA 2Z30B 3J81j 4QYZK 1S0OA 3KJFB 1NUEA 1HQUA 2V69A 2EBEA 2RQCA 1K1QA 2DO4A 5CD4A 5KFSA 2BV3A 5IT9Y 1PO6A 2UVVA 4ETXA 2Z56B 1VQPS 3DDNA 1YRXA 1D9FA 3KLHA 2DH8A 2NYHA 2HFSA 3GG1A 2OPSB 4WKYA 1OJ4A 1E6YB 4YHHJ 3B78A 4ES1A 1FRLA 4BWMA 5DRKA 1RYSA 2ZH7A 4LF4F 1AT1B 4JI2F 2G0IA 3BH6B 3FBEA 2DIVA 2EFVA 3G87A 2CVIA 3W65A 4IH7A 3G6XA 4CLZA 1RGVA 2P5VA 3MZIA 1M5VC 3DRRA 3IR5B 5F3ZA 1HR0F 2FZKB 3QWPA 4ZHRB 4JV2A 3D5MA 2LYVA 2QN6B 2HGMA 3QATA 2NUUG 1FFSB 2MKKA 3KG4A 3OTOJ 3UNGC 1PJ6A 3PR4A 3A8JA 3K5NA 1BD6A 3NEKA 3PFOA 4V19J 2FC8A 3HKWA 3UR3C 3OT9A 4FYXB 2UUAJ 2DGTA 1C0TA 1TKXA 3EM1A 3UNYA 5DLGA 3M8PA 3HVTB 1L3VA 2QA4S 5HVGA 3UDVA 2R8HA 3Q8UA 4KGXB 2FGCA 2VZ9A 1VC5A 3LPEA 3NBPB 3NGUA 1U02A 1C2PA 2ACYA 3Q0AA 2CJBA 2DGUA 1U47A 4LBPA 1S48A 2GIRA 3UPFA 1KLMA 4X4VA 3M9NB 1PC4A 1M5OC 2J6TA 3M2VB 3M6WA 3E2EA 2DGSA 2N3OA 3CCVS 1LFWA 2QLWA 5EWFA 3QT5A 3CDAA 1SJ4P 4ECWA 3PW7A 1VJWA 4X4PA 4DQQA 1RWUA 3ETOA 2Y1RI 4O0IA 2PA3A 4LBHA 4NE9C 5KFWA 2ZFHA 3QIDA 4ZJOA 4K4SA 1KP6A 2ILZA 4KE5A 2AEFA 2BMBA 4AXIA 3FSYA 1NHVA 3LP1B 4RX6A 5KFYA 3W9IA 2B3TB 5EN1A 2JZ5A 1T0TV 3MMJA 1T03B 5DQHA 3UD5A 3GFYA 5IWAJ 2XSJA 3QPIA 2ILYA 1JXLA 1XNRJ 4J5OA 3FRZA 1JB0C 3L3CA 2ZC4A 2ZM6J 2VDIA 1D3WA 3DLKB 2N3LA 4U7UD 4CO0A 1SH3A 4RUAA 1YJ7A 3MAAA 3NOGA 2V9KA 5HBMA 2KXFA 3SFGA 1F9HA 2Y1JA 2CZVC 4LFAF 2KRRA 2LA4A 5DLFA 4LFCF 2XWXA 2J9CA 2G2OA 2MTLA 1REVA 1D8ZA 2EXUA 4ERDA 5LL6d 1VHIA 3TZWA 2XGQA 1MROB 1VQ6S 2OFGX 1TMJA 4NXMJ 4OI4A 4NXNJ 3R5AA 1TP7A 2CWXA 4RW4A 1B0TA 3POTA 3EGWB 5A8KB 4ZVPB 2HQ3A 5K8MA 1L3UA 1TL1B 3FCHA 1JX4A 1RU1A 3FEYB 4JI5J 2YWEA 2J7WA 4I2QA 3BQ1A 3ZZYA 4DSLA 3OW2R 5GAHI 2PSZA 4K7QA 1ZM4A 4URQU 5K8NA 1EP4B 2ZH8A 1EJ7L 5K8OA 4CO5A 4B9VA 1RWMB 2OELA 2XMUA 2CKWA 4ED6A 4HT7A 4F7VA 4KIAA 5E3CA 5B0BA 3EVOA 4KGVB 4C8LA 1N5SA 5DS7A 1F1BB 2UUWA 2D9PA 1OIAA 2HLUA 2LLZA 3CSKA 4OJ3A 1JLAA 2C2KB 4CO2A 1ZAXA 2QT7A 2KI2A 4KJIA 4OMFG 4NA2A 2EKYA 1IM4A 5LM7E 3DGPB 3G86A 3HHLD 2G4BA 3GR1A 1WF0A 5SZTA 3GJTB 3MMAA 4UOFA 1HYSB 5KG7A 2ZKTA 2CNNB 4JI8F 5KG5A 3TJ9A 4UOHA 1IKVA 1GK8A 2KVQE 1DTTB 4C48A 4NMXA 4B17A 4JI1J 2DPIA 3CJ5A 1HPZA 4MIBA 2LVWA 1PBAA 1LWEA 5HVHA 4ED1A 2E9ZA 4FYYB 3J7ZT 2XTJP 3IS9B 3QIPB 1KS2A 2DGQA 2YKAA 3BKUA 5ETKA 2QL7B 2LEAA 3NGSA 1NJXA 2Z2LA 1X9WA 4I56A 3MEGB 4MIAA 4CYUB 1WC0A 2GJIA 2D3O1 2OSRA 2VB6A 2RUGA 1C1BB 3D0HE 4P9SA 5IT0A 2E9TA 1X60A 2DRAA 4F26A 4UW2A 5B08A 4MK7A 3C6UB 3QFHA 4Q44A 3GONA 4F8RA 1P8GA 2LU2A 4R8UA 2YNFA 4OHYA 4HL9A 3QGPA 2MQQA 5F0UA 3PW2A 2CNKB 4U8VA 3T3FA 5KFBA 1Q4RA 3C66A 1H2VZ 2XMVA 3TWZA 2GJ2A 3ILLA 2G1DA 2QA1A 2HFOA 1YBUA 4A48A 1NK4A 4DU8A 4YHHF 5KFJA 2LDYA 1U1OA 2J0QD 2A2CA 3RR7A 4KH0B 3B8HA 1OS5A 4C8YA 2V2QA 1RISA 2WVCA 4OYAA 3G82A 3NNHA 1YVFA 2KT2A 5LOQA 4F36A 3HSDA 4USJC 4QIEA 4WZMA 4ITSA 4DWIA 3B54A 1LOUA 1HMVB 2BKPA 4CO3A 3OTOF 5LSRA 2JC1A 2H4WB 5J2PB 1FWKA 1NK5A 1HWLA 3DI6A 2BJ3A 2KZZA 2WSEC 3N6NA 4XDCA 3BEGB 1R31A 1OSCA 5ETLA 2VFUA 2QC3A 1FDBA 4FP9A 2WSFC 3PW4A 2B9EA 1LXJA 1NK9A 3MOJB 3VAHA 4N7TA 4MKBA 2PGCA 4MFBA 3U1MA 2VG5B 1IR1A 4RNHA 1EX8A 4UUWA 2R8GA 1K0TA 3OFGA 3EZ5A 1X5SA 2R4FA 2BJEA 4YB6A 1JLQB 2RHQB 4FF1A 1HI8A 3VQTA 1I51B 3TP2A 1HQUB 4OHVA 1U1PA 2Y1LB 4R0JA 2K3KA 3PXGa 5KFVA 2LU1A 4K4XA 2BACA 3GIJA 1UA1A 1TUWA 4EBEA 4A4JA 1O5JA 4WZQA 3B4DA 2OEMA 3KLHB 2MQMA 4ZDNA 1UJ5A 2KJWA 3TAMA 1U1NA 1YWXA 1HBOA 1S99A 3GZ7A 4HHHA 2JHEA 5CYMA 2LEPA 2YX4A 2HRTA 3PJWA 5SUHA 5E0OA 1S9EB 4HHUA 4Q8FA 4OV1A 3K5LA 2HSEB 4F04B 3GV8B 4OX9J 2RD5C 4TU7A 1T3NA 4EWTA 3BGFA 4IFYA 3FNNA 5IWAF 2CJYB 4ZMMA 2IJNA 3ZNJ1 1XNRF 1GAOA 2ZM6F 3QNWB 4X4RA 3IGNA 2HQFA 3PX4A 3V81A 5BYRA 4CI0B 4QPXA 1SJFA 3N4WA 1SJRA 1XTZA 4LVOP 1FWPA 3OXLA 3CDEA 4E2FB 3Q8VA 4CM0A 5HLFB 1TKXB 1RAFB 3QGGA 5EWEA 1NSKL 4EI2A 2V34A 5HL7Q 1L3SA 3DHWC 4RUCA 4NXMF 5B09A 4NXNF 3LPYA 3AJ2A 1PIEA 3CJ4A 3IWNC 3N28A 1KLMB 4JI5F 1VQLS 1BC6A 4N8OA 2ROEA 2YX1A 2GA7A 3MD3A 4LQ9A 1KQSR 2AZ1A 4CNZA 4ZVEA 2GS8A 2UVRA 1DFDA 2XZTB 2L9DA 2KT5A 1SC6A 4YN3B 3WC2A 1MLAA 1NXIA 4M5HA 4LRDA 4DR3J 1A7GE 3NKYA 1UVLA 3IC1A 4P52A 3DLLQ 2LXFA 2CJAA 3IMQJ 3N9UC 4X4UA 3MHYA 3KMSA 2OEKA 3BREA 2B7BB 4DN9A 1IBLJ 2DR9A 4OJ1A 3IN5A 2CQ1A 2CUYA 1U0HB 2ZNYA 4ZP8A 3GYNA 4RJVA 4ZVOB 3FKBA 1P1LA 3KG1A 2I1RA 3H5YA 4RU2A 3VGVA 4EU0A 2V63A 2E1PA 1RT1A 2J7KA 4AQYJ 3V4MA 1XR6A 4ZJLA 3GP9A 3WQPA 2EFPA 1RAHB 1HKAA 3EMTA 1SKSA 3AXKA 3HP6A 2QSFA 2V8HA 4OI3A 2FIUA 2CJKA 4PWWA 3HSZA 3ZZRA 3W3SA 4ECUA 3T5LA 1X9SA 3EUNA 1N32F 4B3MJ 4PKDB 3M9OB 1VR6A 1REVB 1HL6A 3EDRB 2HBYB 5CYJA 2VICA 1KDNA 2DRBA 2QLFB 4ECZA 4E98A 4C3KA 2C3OA 3HM9A 2R7RA 2KM8B 1DJ0A 2ZH1A 5H9EK 3ZZUA 4F02A 2B5JA 5JVHQ 2ZHOA 2EG2A 1F9FA 1HQEB 2PO4A 4HACA 3CCLS 2H3EB 4USHA 1Y5IB 4DFJA 2HHXA 2CPEA 4KFBB 3ENVA 1FE4A 1FKOB 4W4MA 1DLOB 1VOMA 2W9CB 1PILA 4I2QB 3Q8QB 1VMBA 3I5BA 3BV8A 2UUCJ 2BJ7A 4DBQA 3BF4A 1U0SA 2FHJD 4PXEA 9RUBA 1HBUA 4IOBA 3RBXA 3UO0A 4WFBQ 2WVEA 3OR1B 3HVRA 4NLDA 4CQ1A 4NA1A 5GADI 3HT3A 1RWVB 1D8YA 1ZM2A 2ASJA 4JI0J 3G6ES 1DTQA 4C8ZA 1LWCA 4KPYA 1YBAA 2Q6CA 4ZN3A 5IM0A 1C0UB 1BLUA 1JLAB 3ZO7A 4Q7AA 4F0MA 4NI2A 2RF2A 1VIOA 1EZZB 5D77A 1AZSA 3FMBA 3MPYA 2DITA 3M8QA 3MMAB 3CO0P 5D0EA 3MM9B 1XR5A 2DPJA 5I3QA 4C0HA 3R9LA 3NY0A 2LQJA 1IKVB 4HI2A 1EB0A 4RU9A 3TEHB 2C2RA 4M5DA 1HPZB 3P8BB 4EBDA 2AJ1A 3JTPA 4Z7YA 1WHVA 3SIPB 2ZC3A 1R43A 4L3NA 4DX6A 3MR5A 2GGPA 2PMHA 1P1TA 3ZTOA 5F8GA 2NPIA 1P9YA 2DRDA 3A8KA 4OZNA 1VQOS 1T3OA 4RW8A 5HATA 1QTMA 2V8PA 1Q5YA 4OYBA 4URGA 2QYCA 2PN6A 5D15A 2Q43A 4WFNQ 3BQ2A 4LVNP 4CLSA 2R3VA 3PG9A 1S1XA 2FJDB 4PG7A 2WW8A 1FJ7A 2YNFB 1ZPWX 2CPXA 5EUHA 3KK3A 1PSDA 1RA7A 3GMGA 2Z2YB 4GC6A 2F9JA 2CQIA 3LP0A 2JVRA 1J5EJ 3A3NB 3GIKA 2G13A 2PD1A 1WWHA 5L39A 4QCLA 3D4JA 4L74A 3IAS9 1S9FA 3M8ZA 5HSPA 1WC3A 5EDWA 2VHGA 1V5IB 1UVKA 1I1GA 2R2UA 4H4MB 3PY8A 4OX9F 5ETRA 3N6MA 2KHCA 4MK8A 1GEHA 2XLJA 4G1PA 3F73A 5FLXU 1RBOB 5M2UA 1IN0A 3FK4A 2OTLS 2XY6A 3RAQA 1HWKA 1AYEA 4P2SA 4KKOA 1NU4A 3H5SA 2MQOA 1NDKA 2EFGA 3LP2A 3DI6B 2C2EA 1T9VA 3IBCB 3GFXA 1HW9A 1MWYA 3GFHA 4KHPF 2H65B 1Y10A 3RAMA 3KG0A 2XULA 4H4OA 2V68A 4CLLA 2ZH6A 4CT9A 5FIIA 1PGZA 4QW9A 2W1BA 1MW7A 4MFBB 2M88A 2JFDA 1YHQS 1RWOB 2AIRB 2NYIA 4FNIA 3VV2B 1T9YA 4ICLA 4ZP6A 3TR5A 5KG2A 4DV4J 2BJ1A 3MI7X 1AFJA 2R9LA 2CQCA 1GXTA 1PCAA 3KJNB 2N4DA 4DR5J 4C3LA 5L8RC 2WW4A 4X65J 3PKMA 4DLGA 3NOCA 3A3PB 1NM2A 4Y6IA 5LXYA 2R42A 1DQAA 5KT3A 3ET6A 1WSVA 4DR3F 5BYSA 4DG1A 1TV6B 4LQ3A 3EXYA 2EVZA 4I2PA 1X4CA 5KOXA 2DHGA 3VQSA 3FSIA 1IBLF 1JJ4A 5CYMB 2FUG9 4QR1A 3NCPA 1YDLA 3CGIA 1B99A 2DNQA 5DQIA 4ER8A 3SMZA 4HKQA 3G8TA 2F4FA 2EBGA 5J2NB 1BMQB 3MM8B 3C46A 5ETPA 2Z8QA 2FC9A 3P4UB 4C98A 3NL0A 1ZETA 4IFYB 3BGRA 4AQYF 4LSLA 3SQGA 1TAUA 4CRJA 3SQOP 2O67A 4K0KJ 3W1YC 4DL7A 2DO0A 5I42B 4TQSA 4OJHA 1DQ8A 3P6YC 2OIHA 2E29A 4CO1A 4ED7A 2VBWA 2W7PA 4NX9A 2FLPA 3KLEA 3OFEA 4DS4A 2K1RB 3HFVA 2E5LJ 1J5OB 1SIWB 4LUBA 4TXSA 4YR2A 3A1YG 2AU0A 1BQMB 3C19A 4IO1A 4CH1A 3SSQA 4K4VA 4B3MF 1X4AA 2J9EA 2VA3A 2E5IA 3AA8A 1SKUB 1VFJA 2Z4PA 1Q8LA 1MU2B 3GYGA 3LANA 3I32A 3IP0A 5C7PA 1RAJA 1BXNA 3JSBA 2O66A 3AH6A 2NZ4A 1ZZFA 5C24A 3DXSX 2IIHA 1RAIB 1VQKS 1TK8A 4ZVQB 4X4OA 2A3JA 3NGTA 1BQXA 1N36J 2UUCF 5AE3A 3J7A1 5ETSA 2J76E 3Q23A 2DNRA 1WUUA 2H5IB 5G0RB 1RCXB 4L76A 5F9LA 1S7IA 3BKFA 5IZHA 2M4MA 3MR6A 2AKWB 1JLEB 3B82A 3MEEA 3CIZA 1RT4A 5E3RA 1GFWB 2ZJPQ 3DOMA 4PR6A 3KMQA 2DHXA 1VIXA 3DRSB 4BC9A 3GSIA 4JI0F 1N56A 3W60A 1QAXA 5KOWA 1R6YA 1EQ0A 2MQLA 8ATCB 1DAXA 2VPZB 2CNLB 4ELVA 3ISZA 3IFEA 2L3MA 3M1VA 4FXDA 2RRAA 3VVTA 1FERA 2C2OB 1NK0A 1RT1B 2QA2A 5J1NA 1FFWB 1XIQA 4I6AA 1U48A 2V67A 1SL1A 3EPIA 2BRLA 4PYDA 2BKNA 4LF2A 3IGVA 3BJYA 5HO4A 3H4BA 2PMWA 4PZVA 2GIFA 1Q79A 2OPRA 2EWHA 3S1TA 1OY9A 2EFQA 1X0PA 4F0HA 4Y00A 4ZN1A 3I56S 4CWBA 5C2GA 2J9DA 1W2BR 5GMDA 3W2VB 2POKA 4ZK7M 4NLYA 2DH9A 1OQ3A 2XMWA 2HNZA 1HNXJ 1H74A 3AD9C 3NMAA 2BQRA 5J2QA 3GYXB 5BYQA 5J1EA 1RXOB 3GV7B 1RAOA 2OD6A 4I64A 2VBZA 4G1QB 4RBVA 2DNHA 3PW0A 5F8NA 2YNGA 2B5JB 3LA0A 4HACB 2J0SD 2ZD1B 3D1OA 2HWTA 2NREA 3CULA 4J9PA 3DLHA 1BWVA 3TEGA 2AEMA 1YK9A 4DS5A 2E7XA 2XMJA 1JLBA 1J5EF 1GMWA 2AV5A 2F4VJ 3PYEA 2HZCA 2KN4A 2P9GA 2AX0A 3HXMA 3UCZP 4DN0A 5KFRA 2AEJA 4ZPBA 1WD6A 1N4LA 1N5YA 2HNYA 3BGLA 2CFXA 3CJRA 2I5JA 3J7YU 5FLXY 2DBBA 1IUJA 1DTQB 1VC6A 2MHNA 4ILMA 5IM0B 5KG6A 3WX4A 1WSRA 1FESA 4NI2B 2RF2B 1IQZA 3DKDA 4KRWA 5L1IA 1TVRA 1AZSB 3G96A 2W7AA 3EVMA 1S49A 2XO7A 3DU6A 1K1SA 2A2DA 2SXLA 2AYEA 1URNA 1M5HA 2XMMA 2M70A 1YJWS 3TUZC 4F4KA 1U09A 4M5DB 2YNIB 5F8HA 3W8GA 4DV1J 2PEHA 2KXNB 4UT4A 3TVKA 4AE5A 3ONQA 4RUBA 1FDDA 4UZBA 2OAUA 4RLEA 5CAAA 3QFWA 4Z7CA 4DV4F 2XYGB 3MF5A 4K4WA 1WTBA 4U67Q 1YBTA 2GHVC 4QU6A 3M05A 4QQBA 2ASYA 4X65F 3H42A 3AOAA 5AXNA 3DDKA 4H4KC 3TANA 4OI2A 5E41A 1JXVA 1UVMA 3KK3B 3KYLA 2HHVA 2BW2A 3FC9A 2AHOB 3NS5A 3CCUS 2G9OA 3TI0A 2Y1IA 4A8QA 2J8AA 1UMJA 1NSPA 4OZ1A 1S6QB 2F9DA 3MCSA 1YRUA 1G2EA 3T1AA 2GZOA 3R7NB 2AP6A 4Y2AA 2V50A 1ACMB 2X1FA 4B9LA 4OI1A 5IXUA 2ZWOA 1RTIA 4A8SA 2B0GA 1E6VB 1V3ZA 2BM0A 2OPPB 2PIIA 3V4IA 3R5JB 1YIJS 5B0AA 3Q2SC 2M0GB 4O4GA 3M7VA 3DRYA 4ECQA 4K4TA 4KKOB 3RUBL 3ZZTA 3FRYA 3GJSB 1CJKB 3ZZ0A 2JJ4D 2Y0BB 3TAQA 3LQVA 1XMOJ 2W2OP 2OGUA 4IH6A 4NCAA 2HHQA 2E5LF 5IT4A 1TL5A 4U6PA 2QMWA 5HP1A 1FA0A 4RW7A 1Q78A 2L08A 2WONA 1O51A 2KG1A 5THWA 2ASDA 4LMZA 3ISNC 3R27A 5KFNA 1CVJA 4M8LA 3VZHA 4ICLB 3LGHA 2AJFE 1B0VA 1KBRA 3D1QA 2XMKA 4FVMA 2FLNA 1RWPB 3OPKA 2G0JA 3MAHA 1S1UB 1MNEA 3HCXA 1YLXA 4FBUA 1IKYB 1B70B 2GNKA 3DHXA 4KGZB 2FLOA 1N36F 4FF3A 3HLUA 4PWUA 4DL5A 5G4DA 3MCNA 2CZ4A 2E5HA 2GFFA 4P2MA 2WRMA 4QIVA 1DQ9A 1S9GA 3NRBA 1VQ7S 3DLGA 2FY8A 1N88A 1UETA 1FHTA 5E5NA 4I2PB 1QAJA 4X62J 1WHWA 2E44A 3C14A 4DR6J 1TUGB 2YQ1A 3LW5C 3W61A 1HHQA 1CLFA 4I67A 1U26A 3T1YJ 1V6HA 1A9NB 1LK7A 1U1QA 2PEBA 2BANA 5C42B 2P2CB 2XLKA 1WC1A 3VR1A 3ZFVA 1N0VC 4KGKA 1IKXA 1T9WA 4URSA 1MG7A 1T95A 1HWUA 4D3HA 3BGRB 4EGLA 4JB8B 4LSLB 2V8GA 3SQGB 1HW8A 1T05A 2B6AA 4QJVA 1ROFA 2CJXB 5ETNA 3IWLA 1K44A 1MMLA 1Q81T 1ZM3A 3GE9A 5BR8J 3KLEB 1JLGA 5K8PA 1UPMB 2Y8YA 1FT8A 4KHMA 3K5MA 2UXDJ 3X1LB 4AUKA 4DI6A 3DLEB 4ZCIA 1NZ8A 1Q86T 3OXFA 4N77A 2DJWA 2QE5A 2MKHA 2CRLA 2VG6A 4YP3A 1EIYB 3QAEA 3PHTA 1HNXF 3J7Z5 2C3YA 5IQQA 3OTEA 5KG4A 3BR9A 1FKPA 2DNZA 4WYWA 4ES2A 2P6TA 2MQPA 4ZPDA 1K47A 4C7QA 3PO5A 5C24B 2V4RA 4UQTA 4FS2A 2ZWPA 4NLQA 3JB9k 4OX7A 3ZTPA 1M5PC 4MH8A 2ZOFA 2RKIA 2OTJS 3KLGB 4NCBA 4QWBA 1AUSL 1S72S 2BE2A 4NLPA 4DL6A 1N5QA 3MEEB 3IXQA 4RZRA 5RUBA 1N8RT 2ZHBA 3NXZA 1QUVA 3TZYA 2AYGA 4CM2A 2EKNA 3OJSA 3D66A 3HVWA 2V8VA 4JI4F 1NLKL 4J9LA 4WWSA 2LP4A 3J7AN 3C3LA 3M1VB 4EEYA 2JL9A 3ITHA 3GIIA 1F2HA 1X9MA 4UF4A 2MHEA 1WHXA 3SZ2A 2X3DA 1B64A 1U6ZA 3CJ2A 4IH5A 2JWNA 3UWTA 1HIYA 1M1GA 1HNVA 3TZZA 1HD1A 2XCAA 3AD7C 4J9NA 1CSJA 4DPWA 2NR0A 4DV1F 2GJFA 2UXBJ 3KUEA 1U1MA 4OZ5A 1CEZA 3R5CA 1KQFB 3CCWA 3MM7A 5KT5A 1LW0B 1B3TA 3TA2A 1YRTA 3EDQB 1YZ7A 3LO3A 3QMQA 2JEIA 1JNRB 3QT7A 2V4QA 2HNZB 2RIJA 3GQCA 3UR0A 5J1EB 1OMSA 3VTIA 3TJ8A 3PVXA 3AB2B 2FY1A 2OPQA 2V94A 4DR7J 2YNGB 2VONA 3A13A 1TU0B 1TMMA 4RNFA 3VAMA 1PJ7A 4C4WA 3K7RA 4LIWA 4DL0C 3H5XA 4DQRA 2AGQA 4ANDA 1UAWA 1YSJA 2R8JA 2HNDA 4GKJJ 1IR0A 2A1BA 2J6UA 1NKBA 1RHMB 4TU8A 2QLXA 3JTOA 3NP5A 4DV6F 2IA0A 2NXNA 4OYMA 1N5YB 1ULRA 3M2RA 3H2VE 5L1KA 2Z58B 3M9MB 2F7VA 4QWEA 4LSZB 3CCQS 5EWGA 3VGUA 5IS2A 3PV8A 3OL8A 3BPDA 3KUGA 4JV0A 2CIMA 3RYLA 4OYIA 1FXDA 3P3DA 3DN9A 3DRPA 5ADZA 1H73A 1OPZA 2MGZB 1GXLA 2X7IA 5D3GB 4BCAA 2MJNA 1EETA 1RP5A 3I82A 4WJBA 4BBYA 3QYYA 4HTIA 3NNCA 4EZ6A 4K4UA 1KR4A 1M90T 1XMOF 3CB4A 4NYOA 4FXVA 2LQ5A 4MYUA 2F5GA 3JQJA 4NLUA 2H1YA 5A8WA 3NMRA 3AB4B 2RAQA 1MN9A 3HK2A 2R2RA 2F40A 5A2QU 1VLYA 4Y0FA 1TUVA 2B4VA 4KYZA 1A0OB 4TY8A 4WKRA 2LQBA 1NSQA 2HHWA 4OHWA 2NSCA 2J8SA 3EGNA 3N0VA 3MUVP 5FJ4A 1UJ4A 3MUTP 4Q2MA 2CNOB 3DGVA 1KD1T 3R3TA 1KQKA 1CS4A 3MGJA 2BYCA 1JLCA 4ETZA 3JXOA 4I7FB 2IRUA 4S0MA 2IBKA 2RU9A 2FLLA 4ENOA 1CJVA 4UUXA 5J1PA 3MCOA 2RS2A 4Q0BA 2YWHA 2IY5B 4FYVB 2B4OA 3VALA 5JVGQ 2V2VA 5IOLA 4MKVA 2FVCA 3BBFA 3UD4P 5KFGA 3FBBA 5E3PA 3BB5A 4X62F 1M5SA 1S1VA 3RB6A 1D0EA 4DR6F 1PAUB 1RE1B 2V4JB 3T1HJ 2H48B 1F2GA 3P45B 1N6QB 3QQCD 3T1YF 1RADB 3ZZPA 3OHAA 2YKQA 1X4DA 2NSBA 2ZNZA 4Y28C 1JKHA 5ETOA 5B7WA 2VIHA 1RTIB 4NCGB
chains in the Genus database with same CATH topology
1HHQA 4FKXA 3FBCA 4FKYA 2VU5A 1LWXA 1NB2A 1F6TA 1JXVA 3EVOA 3VGVA 1NSQA 2BEFA 3PJ9A 4DZ6A 3L7UA 1NPKA 1B4SA 1NHKL 1HIYA 3ENAA 3FC9A 1UCNA 3DKDA 2DYAA 2DXFA 3GP9A 3ZTPA 3EVMA 3BH7B 3ZTOA 3EMTA 3BBBA 1S57A 5CABA 1BUXA 4WBFA 4S0MA 4DUTA 1NUEA 1W7WA 3ZTQA 2ZUAA 3EICA 3VGUA 4ENOA 1S59A 3VVUA 1NSPA 1U8WA 1NCLA 3FCVA 4UOFA 3BBCA 2AZ1A 4F4AA 1K44A 1PAEX 3Q86A 1EHWA 4KPCA 3WX8A 3VGSA 3EM1A 4CP5A 4UOGA 2DY9A 3VVTA 1HLWA 2B8QA 5IOLA 1NDPA 3BBFA 3JS9A 1NDKA 3Q8YA 4EK2A 3GPAA 4UOHA 4C6AA 3FBFA 1XIQA 1S5ZA 3B6BA 3Q89A 3ZTSA 5C7PA 1WKJA 3FBBA 2HVEA 5CAAA 2B8PA 3EVWA 1WKLA 2CWKA 1B99A 3ETMA 2HVDA 4DI6A 1NDCA 1KDNA 5BXIA 3PRVA 1F3FA 1NLKL 3Q8UA 3ZTRA 3NGRA 3MPDA 3ELHA 1BHNA 2HURA 4ANCA 1NDLA 2NCKL 3NGUA 3NGTA 3NGSA 2DXEA 3Q83A 4W98A 1MN9A 1MN7A 3Q8VA 1PKUA 1ZS6A 3FCWA 4F36A 2AZ3A 1VYAA 4ANEA 3EE3A 4ANDA 4HR2A 1WKKA 1BE4A 3FKBA 3R9LA 3EJMA 3BH6B 1LEOA 4O0NA 1XQIA 2BX6A 2DXDA 3FBEA 3G2XA 3B54A 3DDIA 3VGTA 1NSKL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HHQ A;  4FKX A;  3FBC A;  4FKY A;  2VU5 A;  1LWX A;  1NB2 A;  1F6T A;  1JXV A;  3EVO A;  3VGV A;  1NSQ A;  2BEF A;  3PJ9 A;  4DZ6 A;  3L7U A;  1NPK A;  1B4S A;  1NHK L;  1HIY A;  3ENA A;  3FC9 A;  1UCN A;  3DKD A;  2DYA A;  2DXF A;  3GP9 A;  3ZTP A;  3EVM A;  3BH7 B;  3ZTO A;  3EMT A;  3BBB A;  1S57 A;  5CAB A;  1BUX A;  4WBF A;  4S0M A;  4DUT A;  1NUE A;  1W7W A;  3ZTQ A;  2ZUA A;  3EIC A;  3VGU A;  4ENO A;  1S59 A;  3VVU A;  1NSP A;  1U8W A;  1NCL A;  3FCV A;  4UOF A;  3BBC A;  2AZ1 A;  4F4A A;  1K44 A;  1PAE X;  3Q86 A;  1EHW A;  4KPC A;  3WX8 A;  3VGS A;  3EM1 A;  4CP5 A;  4UOG A;  2DY9 A;  3VVT A;  1HLW A;  2B8Q A;  5IOL A;  1NDP A;  3BBF A;  3JS9 A;  1NDK A;  3Q8Y A;  4EK2 A;  3GPA A;  4UOH A;  4C6A A;  3FBF A;  1XIQ A;  1S5Z A;  3B6B A;  3Q89 A;  3ZTS A;  5C7P A;  1WKJ A;  3FBB A;  2HVE A;  5CAA A;  2B8P A;  3EVW A;  1WKL A;  2CWK A;  1B99 A;  3ETM A;  2HVD A;  4DI6 A;  1NDC A;  1KDN A;  5BXI A;  3PRV A;  1F3F A;  1NLK L;  3Q8U A;  3ZTR A;  3NGR A;  3MPD A;  3ELH A;  1BHN A;  2HUR A;  4ANC A;  1NDL A;  2NCK L;  3NGU A;  3NGT A;  3NGS A;  2DXE A;  3Q83 A;  4W98 A;  1MN9 A;  1MN7 A;  3Q8V A;  1PKU A;  1ZS6 A;  3FCW A;  4F36 A;  2AZ3 A;  1VYA A;  4ANE A;  3EE3 A;  4AND A;  4HR2 A;  1WKK A;  1BE4 A;  3FKB A;  3R9L A;  3EJM A;  3BH6 B;  1LEO A;  4O0N A;  1XQI A;  2BX6 A;  2DXD A;  3FBE A;  3G2X A;  3B54 A;  3DDI A;  3VGT A;  1NSK L; 
#chains in the Genus database with same CATH topology
 4O3O A;  4WTY A;  4O3R A;  2RHS B;  3W2W B;  2HVI A;  3BYP A;  3V4I B;  1IBK J;  4Q43 A;  3DRX A;  5ETM A;  3AJD A;  3AQO A;  3LAL A;  2YWG A;  4O4G B;  2NXJ A;  1B0P A;  4JOU A;  4X2B A;  1RAG B;  2Z0G A;  1JJH A;  2GV1 A;  5BR8 F;  1H0H B;  1S59 A;  3EGV A;  4YME A;  4IDK A;  2NLW A;  3A8E A;  2MKS A;  2HG4 A;  5DDQ C;  2HQG A;  5HP1 B;  1REG X;  3VF0 B;  2CPF A;  4RW7 B;  1ZH5 A;  1UWB B;  2OD4 A;  3L7O A;  3IR7 B;  3QZ7 A;  1Y3K A;  4LF1 A;  4RNO A;  2D69 A;  3NNA A;  1NPR A;  3BO2 A;  3I31 A;  4BS2 A;  2GVD A;  1RT3 B;  2CWK A;  2HQI A;  4P2F A;  5L9X A;  1HD0 A;  1MMD A;  2MZJ A;  3ELH A;  3OBI A;  3SEO A;  3PRB A;  1ZTW A;  1PYT A;  4A8K A;  1RJJ A;  4HDG A;  4YY3 J;  5DQG A;  2YKP A;  3M6U A;  4OZJ A;  1AB8 A;  4HH1 A;  1X5T A;  1FNM A;  4LSN A;  1RTH A;  2CQP A;  2DTJ A;  4OFZ A;  3KK2 B;  3R6L B;  3TA1 A;  4DZ6 A;  1NPK A;  1GX5 A;  2DNO A;  3PM9 A;  4C2M A;  3SXL A;  4D3G A;  3BSA A;  5IC4 B;  1ZAV A;  2KM8 C;  3DLG B;  4LF9 J;  4OI6 A;  3I6P A;  4QIF A;  2W25 A;  3M2U A;  4K4Z A;  1FXR A;  3SSS A;  5DDO C;  1WG5 A;  2CJQ A;  3FGV A;  4WFY A;  5GAG U;  1LW2 A;  3C14 B;  3KLF B;  2QLB B;  2IBO A;  2GX8 A;  3QJL A;  1CUL B;  1T94 A;  3FZ2 A;  2O3D A;  5KTQ A;  3UD3 P;  3W64 A;  5FDL A;  3H7H B;  1UP1 A;  3P49 B;  4K2X A;  2BAN B;  4UQG A;  2HZA A;  2RB7 A;  3UI3 A;  1F5C A;  1LWF A;  2MLX A;  5F8J A;  2JRS A;  1OYD A;  4WFA Q;  4RNM A;  2R7W A;  3SDE B;  4DR2 J;  3PYD A;  4IO9 Q;  1UFW A;  4YEA A;  2HGN A;  1T05 B;  3V6H A;  2FHK A;  2CPI A;  1RKJ A;  2KFZ A;  2M9K A;  2LXI A;  4KB7 A;  2R2T A;  3D6T B;  2GCF A;  4ZVH A;  1TKZ A;  4NWB A;  4KTQ A;  1MN7 A;  1RT5 B;  1VRU B;  3MM6 A;  1UPP A;  3BM7 A;  4DSK A;  4OX6 A;  4OYW A;  1JLF B;  3QT8 A;  1RT7 B;  1JLG B;  4RW6 A;  4F4Y A;  3CME S;  9ATC B;  4QWA A;  4OHZ A;  1DZ5 A;  1CBK A;  1H7W A;  2VDH A;  2AF6 A;  1WDT A;  2BR0 A;  3M6V A;  2VG6 B;  3EPG A;  4GO5 X;  3OQ2 A;  1URR A;  4ATN A;  2VPY B;  3RBD A;  1VBX A;  3K5P A;  3ZNU A;  4DR7 F;  1XEZ A;  4FVC A;  3D2W A;  4PG6 A;  1S0N A;  1U6B A;  3V6J A;  2EFO A;  1O0P A;  4XIU A;  3IO1 A;  2IVY A;  1LQ9 A;  3C15 A;  4GKJ F;  4Q45 A;  2QSW A;  4R5P A;  3W9J A;  2DHA A;  5LSL A;  1SH0 A;  2BE2 B;  1RTJ A;  1FNO A;  4TVA B;  3PAC A;  1IKW A;  2AZ3 A;  3AA9 A;  3H20 A;  2ACM A;  1CJU A;  4OLP A;  2HLT A;  4TN2 A;  3T6J A;  4DCP B;  5ETQ A;  1YQH A;  3L9Z A;  1APS A;  4ZIW A;  5A0Y A;  3PO4 A;  1QSL A;  1FJC A;  2BEF A;  4F50 A;  4GO7 X;  3GCX P;  4WP8 A;  2LFV A;  1OY8 A;  3CJK A;  3R1H A;  1C1C A;  2WVB A;  1J27 A;  2GHW A;  4NRT A;  1DUR A;  3VHQ A;  1WEL A;  2ZVS A;  5CYQ B;  4PUO B;  2IA6 A;  3KLI B;  4EMD A;  5H1S V;  3A12 A;  2DB1 A;  5C25 A;  3GB0 A;  1VGY A;  2IRX A;  5A2Q Y;  2QLJ B;  2IPO B;  1Q16 B;  3I55 S;  5HRO B;  2V6A A;  3H0P A;  4KGM A;  5AXM A;  4U95 A;  2UUT A;  2HVE A;  3KFW X;  3H25 A;  1O6X A;  4K2J A;  5B0F A;  4F4Z A;  5F8L A;  1NJI T;  2HAI A;  3QO9 A;  5E7O B;  4NEZ A;  3D28 A;  3MM7 B;  2BDP A;  1T7P A;  4DSE A;  1VQN S;  4O3P A;  1U1L A;  2DR8 A;  4J9M A;  2XY5 A;  1YJT A;  1TL3 B;  4WCE Q;  1FFG B;  2JFK A;  4FDF A;  3D3B J;  3IAM 9;  4YR0 A;  1RK8 A;  1QVG R;  1KTV A;  2IM2 A;  2OSQ A;  4DF4 A;  5HQM A;  3R5B A;  1SL0 A;  1R0A A;  4DQI A;  4ZKA A;  2OMO A;  1SIZ A;  2HMI A;  3F41 A;  2HND B;  3FUY A;  4Q5V A;  3BDE A;  3HJV A;  3KNG A;  3LUY A;  2D1C A;  3K2Y A;  1VQY A;  5KFE A;  3TUP A;  1GTE A;  3KJV A;  3T1H F;  4IR9 A;  1RTD A;  4AT1 B;  1T9U A;  2MLY A;  4MKA A;  1UZH A;  2YWF A;  3M2R B;  4RKU C;  2VPX B;  2I38 A;  2K3I A;  4IG3 A;  2Q3P A;  3DXB A;  4WE1 A;  3AT1 B;  4P2X A;  2XHW A;  3HO1 A;  3NGR A;  3KKF A;  2B43 A;  4OYZ A;  1ZAW A;  3H98 A;  2KH9 A;  3CC2 S;  3K8W A;  3SFU A;  3T6B A;  4NYZ A;  1U49 A;  5HMX A;  1IBK F;  3R5G A;  2K7J A;  4NZ7 A;  3MTJ A;  2AWZ A;  5ETT A;  2WOM B;  2K2P A;  1ZPV A;  2HHH J;  2GMH A;  4NL5 A;  4N8N A;  5A8W B;  5HI7 A;  1FF2 A;  4DPX A;  4ZLL A;  2VV5 A;  3DOL A;  5HAO A;  1XJW B;  3T19 A;  3SCL E;  1Q95 G;  3VVU A;  2RQK A;  2W9B A;  4IKA A;  4TY8 B;  2QFJ A;  1MMN A;  2ZDO A;  5AJ3 J;  3WX8 A;  4C8K A;  2WVD A;  1L3T A;  2DVI A;  2K8G A;  4OZL A;  4AL6 A;  1IBM J;  1WG1 A;  4ECX A;  3FBF A;  4G6V B;  1CS4 B;  1Q8B A;  1PJ5 A;  4YY3 F;  4X64 F;  1XC9 A;  2IM0 A;  4L75 A;  4DSF A;  5A6W A;  4NLV A;  1R8H A;  4I6W A;  1CJV B;  1F5A A;  3I0S A;  2XNQ A;  1NK6 A;  3I4H X;  1SKR A;  2W2M P;  2HYI B;  1V5V A;  3EYZ A;  1VRT A;  1FI4 A;  1AW0 A;  1NHU A;  2B51 A;  4LF9 F;  3HHD A;  1X5O A;  7AT1 B;  3FBC A;  4Y2I A;  1X7V A;  3BPS P;  4ID5 A;  2DY1 A;  1SC1 B;  1S1V B;  2HQC A;  2VQF J;  1KFS A;  5LMN J;  3C2P A;  1RAB B;  1FNX H;  1XK8 A;  5H9F J;  3NWG A;  1IJF B;  2PC6 A;  5K20 B;  1XN9 A;  1WDD A;  4U9R A;  2JVO A;  4GRS A;  1JKH B;  1V9O A;  2AX1 A;  4IOC Q;  4DV3 F;  3UN5 A;  3QGH A;  3G8Q A;  5T7L A;  4DR2 F;  3CJ8 A;  2FJA B;  4LR9 A;  3M32 A;  4RUH A;  2OPS A;  3CO9 A;  1TR0 A;  4EK2 A;  3R7B B;  2ZBQ A;  4YDD B;  2KTQ A;  2VUG A;  1F60 B;  2XY7 A;  4OYX A;  2IJR A;  1VQ8 S;  1UFL A;  1WOO A;  2OP5 A;  4OZ2 A;  2ZVI A;  4FN5 A;  4P10 A;  3QLH A;  1GXU A;  2HHP A;  1VCT A;  2VAS A;  4XPC A;  1JNZ B;  4DJB A;  3W8P A;  4Q8E A;  2ERR A;  1BE4 A;  2IHR 1;  2VOO A;  1V3R A;  3G2X A;  1T8E A;  3MXH P;  5DGA A;  4ZHR A;  4IRK A;  1RT6 B;  1GMV A;  3NAH A;  1RWX B;  2GVD B;  3NS6 A;  2W4P A;  5E3Q A;  1LFP A;  2A6M A;  1FJE B;  1VI7 A;  2DEJ A;  2CQ3 A;  2HFZ A;  1UVI A;  2J6S A;  1CJT A;  2XB2 D;  3PCO B;  4HH0 A;  3SV3 A;  1OO0 B;  1GNK A;  3J80 U;  3GTY X;  3H2L A;  2HS3 A;  2AW0 A;  2KG0 A;  4H4K A;  3HVT A;  4LSN B;  1RTH B;  2MQ8 A;  4DFM A;  4ZPA A;  3DOK B;  4ZLJ A;  2F65 A;  5CXT A;  2C42 A;  3AOB A;  3HMJ G;  5ITH A;  3U1N A;  3MMC B;  3BGU A;  1M1H A;  1S6P B;  2BA9 A;  1Y5L B;  1HBM A;  3M2U B;  4EZ9 A;  5KG1 A;  2Z57 B;  3EXC X;  2EPI A;  2DHH A;  1BHN A;  2VQE J;  1X8D A;  2W4C A;  3DMJ A;  2DXE A;  2QIF A;  3CD5 A;  5CZV A;  4MT1 A;  3M2V A;  2VFV A;  5FDL B;  2UUA F;  5LT5 A;  3OFF A;  4QW8 A;  1FRH A;  1H72 C;  2MY7 A;  5KFF A;  4BDP A;  2MXY A;  4ED4 A;  4RPF A;  4J90 A;  2FTR A;  5GMK a;  1RDR A;  2DIU A;  3HPO A;  4O44 B;  2IYG A;  3NAI A;  1VLO A;  4EO6 A;  1SXL A;  3MM6 B;  4OYO A;  2IYI A;  4C8M A;  2KFN A;  3LP1 A;  2D3U A;  3TW0 A;  2Q66 A;  2KZM A;  5KFK A;  2RRB A;  4WPA A;  4DX8 H;  3PX6 A;  1HR0 J;  3R7S B;  4CTA A;  3RW6 A;  2IFX A;  4DXL A;  2FVR A;  3TJA A;  3DLK A;  4LRC A;  4F3Q A;  4CLP A;  3Q83 A;  3MD1 A;  3EE3 A;  4B9S A;  4YB7 A;  4N56 A;  1VQM S;  5L9N A;  3I9V 9;  2PI5 A;  2CG8 A;  1Y00 A;  3L7U A;  1X31 C;  4NRU A;  3BO4 A;  3VAF A;  2AJQ A;  2JLG A;  5DG8 A;  4LJM A;  4R5P B;  3IA0 A;  3I9Z A;  3DRR B;  2C2Z B;  2BKO A;  1IKW B;  4TYB A;  3MDF A;  5A8K A;  1CJU B;  4JP8 A;  2ZH2 A;  3OLB A;  2DIS A;  4UTG A;  2HBZ B;  2XS5 A;  1CQN A;  3CXC R;  3KJQ B;  5B0G A;  1FTC A;  5D6G A;  1F3V A;  2PDA A;  5A0Y B;  1NND A;  3VGS A;  2QL5 B;  1R0C B;  1W26 A;  1C1C B;  1C0T B;  2CPZ A;  2QX0 A;  1EP4 A;  5JJB A;  4NYP A;  3I5C A;  2HRU A;  3QSY B;  4QYZ J;  4UZC A;  3M8P B;  3MPD A;  1QY7 A;  1NK8 A;  1X4F A;  3M8Y A;  3DC2 A;  2HHH F;  2N7C A;  5C25 B;  2BJ9 A;  3H90 A;  1Y11 A;  4WP9 A;  2N82 B;  4I4B A;  2VF3 A;  4CH0 S;  1YJV A;  2H4Y B;  1AXQ A;  1NB2 A;  2EI5 A;  2R7T A;  2Q6B A;  3QO9 B;  2YKM A;  7FDR A;  3HHK A;  1TEL A;  3DGP A;  5GAE I;  2HFV A;  5AJ3 F;  1HHT P;  1S57 A;  4NLX A;  4LF8 J;  3CIM A;  2CQ2 A;  1NSA A;  1IBM F;  4IG0 A;  1WG4 A;  1FRI A;  1S97 A;  1DTT A;  5HQ8 A;  4WU2 A;  4ZS6 A;  1Z2L A;  2XYH B;  3E3X A;  2MB0 B;  2AGO A;  1WKJ A;  2XI3 A;  3IS9 A;  2XS7 A;  1WKL A;  1WC5 A;  2LQ8 A;  4CYU A;  2HMI B;  1IM6 A;  2DKO B;  2VQF F;  5LMN F;  4TYA A;  3KJV B;  1K0V A;  1A6L A;  3CJ0 A;  2UP1 A;  2XSJ B;  2ABY A;  4CLT A;  3RB4 A;  4IQM A;  3FQK A;  3C6U A;  1D9D A;  2GQQ A;  3GFZ A;  1FD2 A;  1RLD A;  1SI9 A;  2G2Z A;  4MK9 A;  2O01 C;  3GCW P;  4MKY A;  2M8D B;  4JI1 F;  2A0F B;  3IR6 B;  2W8L A;  1SUQ A;  2L9W A;  2YKO A;  4IG3 B;  1NJW A;  1S1W A;  1NJZ A;  4N47 A;  3MAA B;  3UVJ A;  1UA0 A;  5HBM B;  2YY3 A;  4DZD A;  5HJY A;  4GKK J;  4GMK A;  1ARO P;  4JYA J;  5F8I A;  4CO4 A;  2XZW A;  2HKE A;  2MKI A;  1HBN A;  5D78 A;  3V2U C;  2UXC J;  4AL7 A;  3EIC A;  4NLG A;  2QFI A;  2GC8 A;  3KHH A;  4B3T J;  2HBQ B;  2FZC B;  2E5J A;  3RR8 A;  4BLG A;  2R7V A;  5CCL A;  3CCE S;  1BQN A;  1BGX T;  2XBP A;  3HD2 A;  3GPA A;  3D67 A;  4ES3 A;  5A8R A;  3A8I A;  3CC4 S;  4RW4 B;  2OKQ A;  2VD3 A;  1ICE B;  3POT B;  2IJF A;  4J9U E;  3MUM P;  2R7X A;  3IG1 A;  3DOL B;  2ZBC A;  2RS8 A;  4ILL A;  4LF7 J;  3MEK A;  1Q7L B;  2W9B B;  3MEC A;  4EO8 A;  4X66 J;  2E5G A;  1HMV A;  2WSC C;  3WZ0 A;  3QRP A;  2MQN A;  1SV5 A;  3EJM A;  4YDX A;  2O1P A;  5J2P A;  3LF0 A;  3J80 Y;  1JWW A;  1QAY A;  4JI8 J;  3NGK A;  2W2Q P;  4L6V 3;  4PAB A;  1HNI A;  4DV7 J;  2XI2 A;  1WEX A;  1KN6 A;  3GWC A;  1HWJ A;  2VKZ G;  4G65 A;  1SH2 A;  4XPE A;  5IC6 B;  3DYA A;  1Q8I A;  1RQ0 A;  1KWM A;  2JDJ A;  1VRT B;  2G2Y A;  3JTN A;  3MED A;  4GVB A;  2ZJQ Q;  3RBE A;  1I3O B;  4A8W A;  3CCS S;  4ID5 B;  3RRK A;  3D6F B;  4PPD A;  1JLQ A;  4NOH A;  1H2U X;  2VQE F;  4P7V A;  3Q89 A;  3T9Z A;  2BE9 B;  2C2N A;  1OYE A;  1NRK A;  4CCH A;  3PHE A;  3DNC A;  3IWX A;  1NPP A;  2ADC A;  2L48 A;  5AXL A;  4WK3 A;  4ZVU B;  5LXR A;  3QJP A;  3LAM A;  5T7L B;  1LWE B;  4I1T A;  3AQP A;  3M32 B;  2M8H A;  1F9E B;  2EC2 A;  2BVZ A;  2E7V A;  3TQE A;  5GAE U;  1VQS A;  4EYI B;  1EAY C;  3WIU A;  4QBU A;  1Y3J A;  3O2I A;  5L46 A;  2RH3 A;  1S9E A;  2CQG A;  4YB1 P;  1RB0 A;  1VK3 A;  3QLH B;  4NML A;  2EG1 A;  4IUF A;  3BH7 B;  4NAS A;  1UZD A;  1TFW A;  1PYO B;  1FE0 A;  1ZTT A;  1NO8 A;  3V5R A;  4ED5 A;  3OL7 A;  1WI6 A;  4R8U B;  5DDP C;  2KYX A;  3C8Y A;  3GR0 A;  2W24 A;  3CMQ A;  3UQS A;  2OHD A;  1RHK B;  5CA5 A;  2AGP A;  4WXO A;  5KT7 A;  4DUZ J;  5KFL A;  1GMU A;  4OX8 A;  3JYT A;  1CJT B;  4QZV B;  3GIL A;  1KOO A;  5HLF A;  1P6T A;  2IRY A;  5I3U A;  1FWL A;  1PBU A;  5HK4 A;  3T5K A;  3BQ0 A;  2XGP A;  2QGF B;  3D1H A;  2B7C B;  1RA6 A;  3LWM A;  3G82 B;  1VRQ C;  4NZ0 A;  1VQ9 S;  4CLW A;  3DM2 A;  5HMZ A;  1HBM B;  2FVS A;  1QVF R;  3RZA A;  4F3M A;  4UST A;  2UVU A;  1H6K X;  4B9N A;  3DMJ B;  2D9O A;  2HPU A;  2WTF A;  4BC7 A;  1WOP A;  2UU9 J;  2JC0 A;  5CAB A;  2FVP A;  1AFI A;  3TQ1 A;  4A47 A;  4FF2 A;  4B3O A;  1K8A T;  2JNJ A;  4WP3 A;  5D0G A;  3PNI A;  4ZPW R;  1R8C A;  5J2M A;  2QZ8 A;  3R5D A;  4I68 A;  3QJJ A;  2JEG A;  4LIR A;  1ZA2 B;  2KO1 A;  3KDO A;  2YQ3 A;  3MR3 A;  4NLO A;  4KR0 B;  3ETM A;  1RAC B;  2HRY A;  1U0H A;  4X4N A;  2XMA A;  2CAD A;  1RTZ A;  1RSC A;  1XER A;  1X4B A;  4PXC A;  2DCU B;  4MAK A;  3FEX B;  5L1L A;  3CED A;  1FEE A;  1U2F A;  1PKU A;  2B4U A;  3MMB A;  2VOD A;  1LK5 A;  4FYW B;  2B9X A;  3PIO Q;  2ZH3 A;  1XQI A;  4KQZ A;  4Y3C A;  2AYB A;  3ZXW A;  4UY8 T;  4LF8 F;  3L09 A;  1FCA A;  2J5A A;  4MIW A;  4PQU A;  1PYS B;  5KFD A;  4CTA B;  2AJ0 A;  2IM1 A;  3D3C J;  4F4W A;  3SSR A;  1KQG B;  3RB0 A;  4ZLP A;  3TX8 A;  2PT0 A;  4CIO A;  3TAM B;  4ZJQ A;  6FD1 A;  1HBO B;  1QDU B;  4XAK A;  1YX2 A;  1S79 A;  2HQD A;  1LXN A;  3K89 A;  3UW1 A;  2H51 B;  1G7C B;  4X84 A;  1B7F A;  3B4M A;  1UVN A;  2DGO A;  4NZ6 A;  4QOT A;  3D9B A;  2XC9 A;  4C9D A;  4JI6 J;  1CG2 A;  1EAR A;  3QAU A;  2DNK A;  4P73 A;  1ZOT A;  2F3J A;  2IM3 A;  1XNQ J;  4P71 A;  3HHL A;  1WEZ A;  1HQE A;  3FJ2 A;  4JV1 A;  3ZZZ A;  2BOP A;  2HUR A;  3HX9 A;  4B02 A;  2FHM A;  4ELU A;  3K0J A;  1P27 B;  4KFB A;  3J7Y I;  2FZG B;  1FKO A;  3V81 B;  1DLO A;  3HD1 A;  2W9C A;  2MZ1 A;  4W92 B;  4KAI A;  4U8Y A;  5ETV A;  4GKK F;  4IFV A;  1IXK A;  4JYA F;  1WJ9 A;  5EX3 A;  5CZX A;  5GVQ A;  2D74 B;  2UXC F;  3HDS A;  3UCU P;  3EGZ A;  4B3T F;  2EFN A;  2CPH A;  4DPO A;  4CNY A;  3OR1 A;  2ALZ A;  1U24 A;  4ZVT B;  4IRC A;  4M5N A;  5KG3 A;  3RU0 A;  2VBX A;  4P75 A;  2YH0 A;  1KVI A;  3OJU A;  1JJ2 R;  4R0E A;  3P5T L;  1VBZ A;  1HFE L;  1T02 A;  3O3L A;  3PYG A;  1C0U A;  2HHT A;  4LF7 F;  4TLQ A;  3UN3 A;  5K9F A;  3QRQ A;  4RNN A;  2YKM B;  1IQT A;  1S5Z A;  4NPO A;  4X66 F;  1FRJ A;  3MM5 A;  4PCQ A;  4ECS A;  2KRB A;  5L1J A;  4V19 X;  1Q0N A;  3THT A;  3HKZ D;  3MPV A;  3MM9 A;  2CQB A;  4ZVG A;  2F1F A;  4IG0 B;  3T9N A;  2BM1 A;  2ZIT A;  2L41 A;  2M5Y A;  3UE2 A;  4DV7 F;  2QEX S;  3QGI A;  5D4P A;  2J0W A;  1PG5 B;  1SPB P;  1YJN S;  5JMN A;  4PXD A;  1J2V A;  5AXK A;  4Z37 A;  4A46 A;  4ZCM A;  5EX0 A;  1S4F A;  2QMX A;  1N32 J;  5KFQ A;  3Q8R B;  3E51 A;  2NS1 B;  3KNA A;  1BY9 A;  2E1C A;  5KT6 A;  3PEH A;  1AA1 B;  4DUY J;  4B3S J;  3JQM A;  4P7T A;  4M5I A;  4KO0 A;  1SUQ B;  4Y34 A;  3RGI A;  4C3M A;  3PIP Q;  1S1W B;  4ZA1 A;  2O5D A;  1RAA B;  4V1A k;  2E1M C;  2M2B A;  3UVJ B;  4HDH A;  2H5E A;  3FMW A;  4I69 A;  1U7L A;  3K17 A;  5HMW A;  3EZO A;  3CCZ A;  1HBN B;  2DHS A;  3V6K A;  2QYG A;  1YG0 A;  4ALZ A;  4NA3 A;  2C3P A;  5GME A;  1TZ0 A;  2CQ4 A;  1Q53 A;  3GJQ B;  2B9Y A;  2Y3Y A;  3HVA A;  4F2R A;  2PA8 D;  4YFU A;  1HAR A;  1BQN B;  3D6H B;  2DXD A;  4H4M A;  5KFM A;  5A8R B;  2D41 A;  1OSD A;  1H2T Z;  3CPW R;  3IG1 B;  2R7Q A;  2PE8 A;  3UFC X;  1DRZ A;  2Z2M A;  4TQR A;  1HNZ J;  3MEC B;  3CMA S;  3HUL A;  4E8U A;  2MST A;  3BSN A;  3K59 A;  4WBF A;  2DGX A;  5I3P A;  5F0W A;  1SV5 B;  2A6O A;  4DUZ F;  4MTP A;  2NUH A;  4C8N A;  1HBU B;  4LR8 A;  2OJ3 A;  1HNI B;  1G3O A;  2ROP A;  3VAK A;  3UDE A;  1NH7 A;  4M5L A;  1CPZ A;  1R27 B;  1KOH A;  1FKA F;  3DYA B;  1XBW A;  1S76 D;  1LWC B;  4J7C A;  5GAH U;  1YZ6 A;  2NXU A;  3T41 A;  3MED B;  5DET A;  1NDL A;  4GVB B;  2GVZ A;  5B0E A;  2OO4 A;  3ENW A;  5DGB A;  1Y5N B;  1R8A A;  1NEE A;  3M8Q B;  3GJR B;  2UU9 F;  5MAO A;  4WXW A;  5HVF A;  3JQK A;  4CLY A;  2M3D A;  1QSY A;  1TL7 A;  4N76 A;  4PYA A;  1FXL A;  2XEX A;  1KNZ A;  2ZJR Q;  4HYK A;  2BZ2 A;  1GMW D;  1TV6 A;  2PFF B;  1WC6 A;  5H9E J;  3O6Q A;  1U8W A;  1QAI A;  2QG9 B;  2GGP B;  1RBA A;  1SVD A;  5T41 A;  3Q8S B;  3BBC A;  3Q8P B;  1ZA1 B;  4IYQ A;  2X1A A;  4RW8 B;  2I6W A;  2R2S A;  5E3A A;  3LGN A;  4DR5 F;  1ZBT A;  5J2N A;  3MM8 A;  1YJ9 S;  2V0N A;  3G6V A;  1S1X B;  5IV3 A;  3BDP A;  3WHI A;  1R89 A;  5KAK A;  2XO6 A;  3Q24 A;  5I42 A;  4A8M P;  2V2K A;  3WDO A;  3WC0 A;  4LF6 J;  2ZUG A;  2GAG C;  3LP0 B;  3N5B A;  4XDD A;  2E66 A;  4ELT A;  2BBE A;  3G71 S;  3HI9 A;  2K1R A;  1WI8 A;  3JYT B;  3K57 A;  2MMY A;  1RAE B;  1J5O A;  2Y8W A;  1RZM A;  1S1T A;  4KHP J;  3KK1 A;  2YKN A;  6AT1 B;  1BQM A;  2CPJ A;  4B08 A;  5I3U B;  2ZKU A;  3D0G E;  4JI6 F;  1NAQ A;  1RT2 A;  5E2Q A;  2VA2 A;  3AHP A;  1MU2 A;  2YNH A;  4C8O A;  3IRW P;  3BZQ A;  3BYR A;  1GQE A;  1XNQ F;  4K0K F;  3DM2 B;  3TRG A;  3NG8 A;  3P96 A;  2KT3 A;  3LGM A;  1S7H A;  5KFU A;  4OI0 A;  2Q79 A;  2B8P A;  3LP2 B;  2CQD A;  5HMY A;  2CAJ A;  2W9A A;  3FQL A;  1EKS A;  3PYF A;  2FJW A;  2Y9H A;  4B3O B;  5G0R A;  2QJ3 A;  1SQE A;  2DNN A;  1UWA A;  4H4O B;  1N33 J;  4DQP A;  4HR2 A;  2Q1L A;  3W63 A;  2EK1 A;  5J2M B;  4DF8 A;  1JLE A;  3CDW A;  4X4T A;  2VJU A;  1IBC B;  2MZS A;  3CDB A;  5DZ6 A;  3DRS A;  3HHE A;  1RHJ B;  1N5V A;  2LCW A;  4PXB A;  2PI4 A;  2EEY A;  2D3Z A;  2R7S A;  2AT1 B;  4J37 A;  3BBB A;  3PX0 A;  3KWM A;  4FYD A;  3MMB B;  1W7W A;  3AD8 C;  1GTH A;  2JLE A;  1X4G A;  2R7O A;  2YBV A;  2XLI A;  1KVJ A;  1ELO A;  1KC8 T;  5D8H B;  3ET6 B;  3NS7 B;  1R3N A;  2DY9 A;  4PQU B;  2CVE A;  4L72 B;  3N6L A;  3CE8 A;  1H38 A;  4DG1 B;  1LV5 A;  3S8S A;  2FHJ A;  7FD1 A;  3FZB A;  3OHB A;  4Y2C A;  1UEU A;  3KUH A;  3WBZ A;  5AT1 B;  1IVZ A;  1FK9 A;  3SYZ A;  3MUR P;  3OTB A;  4DPT A;  1FTR A;  3W2V A;  2KU7 A;  1DY3 A;  3U27 A;  2KJV A;  3D54 A;  3EZU A;  3PDN A;  2IDE A;  1TTH B;  4UOC A;  4BHQ A;  4FNH A;  2LMI A;  4G1Q A;  2CPD A;  1RHQ B;  2DNG A;  2DD8 S;  4A8F A;  2LKZ A;  4DUY F;  3HHL B;  4B3S F;  1S6U A;  2H54 B;  1RYR A;  1C4C A;  2ZD1 A;  2C3U A;  5HAN A;  4YB5 A;  5F8M A;  1DAR A;  5KFO A;  1VQ4 S;  3F44 A;  3WIV A;  3F0N A;  2HZV A;  2ALY B;  2ZH9 A;  2X3G A;  4IFV B;  4P72 A;  4AYB D;  3A4T A;  2IC3 A;  3H8Y A;  2WCX A;  2YX7 A;  1RI7 A;  4NEY A;  4N41 A;  3TO8 A;  3EVW A;  4R25 A;  2VPW B;  2HVD A;  4WYL A;  4M5J A;  2XQC A;  2CQH A;  1PC5 A;  3PZP A;  2D3O R;  3IBW A;  3PJX A;  4OYP A;  3VWS A;  1HNZ F;  2CJ9 A;  2AJ2 A;  4B9T A;  4TNO A;  3MM5 B;  5U47 A;  2XG8 A;  1HI1 A;  1TFY A;  2MJU A;  3Q2T C;  2F4V F;  5EGY A;  1ITP A;  2XM3 A;  2C2M B;  1T11 A;  3BR8 A;  3HT0 A;  4A8X A;  4QU7 A;  3OL6 A;  5LJ3 Y;  5A6P A;  4QR0 A;  1RT4 B;  2YNI A;  3GV5 B;  3DOM B;  3C6T A;  2IVF B;  2WBM A;  2HBR B;  3UDC A;  3TYT A;  2KL8 A;  4FPR A;  4PPZ A;  1U6F A;  2U2F A;  4ECT A;  4NLW A;  1AUD A;  4J9Q A;  3NGD A;  1JJC B;  1VC0 A;  1T9T A;  2BW7 A;  3I96 A;  3R97 A;  4DL3 A;  4OQJ A;  2JX2 A;  2XHC A;  3HSJ A;  3C16 A;  4ZCL A;  2A10 A;  4HLB A;  2B9W A;  1U25 A;  3CJT A;  2DR7 A;  3OR2 A;  4KO0 B;  4U96 A;  2B56 A;  4CH7 A;  2OPR B;  1VS3 A;  1R6V A;  1DBD A;  2GO9 A;  1NHK L;  4DR4 J;  2QTW A;  3S7R A;  1FRK A;  3M4X A;  3JAM U;  4QWC A;  1S6Q A;  2FD2 A;  5CH7 B;  5KT4 A;  5J2Q B;  4KT0 C;  2HIQ A;  3TNV A;  3QT6 A;  1N34 J;  2VC0 A;  4EFA C;  1WF2 A;  4IOA Q;  2H9Z A;  3CJS A;  1E6V A;  3H5U A;  2JH3 A;  4QWD A;  2OPP A;  3AOC A;  2DNL A;  1S6O A;  2ASL A;  1JMT A;  4EUV A;  5DDR C;  2BJ8 A;  1NME B;  2APO A;  4LF6 F;  1T9X A;  3T5J A;  1JLB B;  4PRF A;  3G8S A;  4W90 B;  1D9A A;  4ANC A;  5DM7 Q;  1FO1 A;  1CJK A;  1SJ3 P;  4J9K A;  5EHH A;  1U8S A;  1FRX A;  4MYT A;  1GH8 A;  4O23 A;  1LEO A;  2HNY B;  2VBY A;  4TLR A;  2QL9 B;  4JV5 J;  1Q8K A;  2ZOM A;  2I5J B;  2OLW A;  1KKH A;  2P9C A;  3DLB A;  1B4S A;  2HS0 A;  1EQM A;  2IMO A;  3VAI A;  3D6M B;  3X3U A;  3QWU A;  3JSM A;  4QIW D;  4X4S A;  1KON A;  2W7O A;  2WAQ D;  4ZOS A;  2GVZ B;  4K4Y A;  2XMT A;  3L4B C;  1S1U A;  2I8E A;  4Q2L A;  1XWL A;  5GAG I;  4I6Y A;  2M7S A;  4O3Q A;  3HFK A;  1TVR B;  2V8D A;  1IKY A;  3OV7 A;  2KKH A;  1WAC A;  4DV2 J;  2F8E X;  1NZA A;  2YWK A;  2HK2 A;  5GAD U;  2B8Q A;  2KYZ A;  1M1K T;  4O4R A;  1TL7 B;  2ZBP A;  2XZD B;  3G9C A;  2HVZ A;  2C1E B;  1N33 F;  4ZCK A;  3ILI A;  4MJK A;  3AXM A;  2AJ4 A;  2NZC A;  3PRV A;  1N52 B;  4CLU A;  1NKE A;  3FEZ A;  2R8I A;  2B4P A;  2RUS A;  4ED2 A;  2RML A;  3TUI C;  2P6S A;  2DEI A;  2UUB J;  2BX6 A;  5C42 A;  2GW8 A;  3D7S B;  4KBI A;  1QE1 A;  3AAW B;  2W8K A;  4KH1 B;  1HHS A;  2NXC A;  4WTO B;  2EW9 A;  4XTT A;  4PG4 A;  2NPF A;  3OL9 A;  1ZZN A;  4RBT A;  4KV8 A;  1N0U A;  3ILO A;  5F9N A;  2ZUA A;  4PG8 A;  2NQP A;  2CXE A;  3M6X A;  2YXL A;  1SC3 B;  1G1X A;  4FS1 A;  5L38 A;  3OFH A;  4ZP9 A;  2ADB A;  3THV A;  1GX6 A;  3DLE A;  1C4A A;  1S1T B;  3UDL A;  2R7U A;  3KK1 B;  2YKN B;  3RRH A;  3B6B A;  3CJQ A;  1UW9 A;  3QBC A;  1HA1 A;  4ECR A;  4FF4 A;  1IJE B;  3NLC A;  4M94 A;  3DU5 A;  4DMZ A;  2U1A A;  1I94 J;  3VAJ A;  4JI3 J;  3ZTR A;  3TOQ A;  3N5F A;  1RT2 B;  2J7U A;  1RHR B;  3CD0 A;  2YNH B;  2NCK L;  3ZC4 A;  4LT6 A;  4W98 A;  4ED8 A;  1UEK A;  4XK8 C;  1TQL A;  1VYA A;  1FJG J;  2IDL A;  3CDU A;  1CC8 A;  4TKT A;  4DV5 J;  2L9N A;  2BJD A;  2HHS A;  2XYP B;  2VG7 A;  3CCT A;  2MZR A;  5IFM A;  1F0X A;  3OXG A;  4DL4 A;  2RSQ A;  5T14 A;  3ENA A;  4C11 A;  3UN2 A;  1UCN A;  5KFX A;  2UXD F;  1M0S A;  2EC0 A;  3KLG A;  1WEY A;  4C97 A;  2GHP A;  1Y7P A;  1Y4Z B;  1MSW D;  4WU3 A;  2K06 A;  2GAH C;  2WON B;  2VKR A;  1O8B A;  3FDS A;  4YR3 A;  1IR2 A;  2OUG A;  3I87 A;  2CPY A;  3JSY A;  1PAE X;  4CP5 A;  4WII A;  3ZZO A;  1IWA A;  4IQX A;  1QTN B;  3CTR A;  1QSS A;  1Z2Z A;  2LQ9 A;  2YPZ A;  3RG6 A;  1HNW J;  4DSJ A;  1Q82 T;  3OSN A;  3DCA A;  4DHV A;  2AYM A;  2COL A;  4WIQ A;  4DR1 J;  4QYR A;  4PG5 A;  2X1G A;  3CCJ S;  3OVA A;  4BWJ A;  3JSR A;  3HF5 A;  1S9G B;  2DGV A;  1IWG A;  3KDN A;  4Y2M A;  3VGT A;  3O44 A;  5DG9 A;  3OSP A;  1X0F A;  4ID8 A;  4YUD A;  1YIT S;  4KC5 A;  2RIL A;  4DFP A;  2XNR A;  1FK9 B;  2RDJ A;  3QSI A;  4DX7 A;  3OVB A;  3SI8 A;  2X1B A;  1LW0 A;  2LA6 A;  4DCJ B;  2KVI A;  5D0R A;  1IKX B;  2PFD A;  4HTJ A;  5KT2 A;  5AE2 A;  4FXW A;  4AXJ A;  5B0C A;  1VK8 A;  2B6A B;  2HS4 A;  4RWW A;  2UVW A;  2MSS A;  4OJG A;  5KG0 A;  3Q22 A;  1NH8 A;  3JAM Y;  2UXB F;  2GIQ A;  3OUY A;  4ZVR B;  2FB0 A;  2LXU A;  4A8Y A;  2YPY A;  1JXE A;  4DR4 F;  2RDI A;  1SC4 B;  3E8O A;  2IC3 B;  2RJZ A;  4B9M A;  1W25 A;  2PMZ D;  5DM6 Q;  4Y65 A;  3CW2 C;  3ENQ A;  2C28 A;  4NLT A;  4ILR A;  5FD1 A;  2DT9 A;  3PTW A;  1FKP B;  1UEV A;  5CQG A;  3PR5 B;  3OLA A;  3KHL A;  3MR2 A;  1N34 F;  1UL3 A;  1XR7 A;  4PAA A;  5M2R A;  5DO2 A;  3IRX A;  3BSC A;  4JI4 J;  1KTQ A;  3GG0 A;  3GIR A;  2X51 A;  1N5T A;  3CVK A;  3M8R A;  4WK1 A;  4USU A;  2BUN A;  2E7W A;  2MGZ A;  1L5U A;  4USW A;  2FVQ A;  5D3G A;  2GML A;  4F4A A;  1HI0 P;  4LFB J;  4QR2 A;  1UFK A;  2RKI B;  4RBU A;  2YTC A;  3CWJ A;  3CD6 S;  2IAJ A;  1ZM9 A;  1U45 A;  5LJ5 Y;  4LF5 J;  3QRR A;  3R1L A;  3R2D J;  1S4E A;  4USM A;  5KFT A;  4RL1 A;  2F63 A;  5IV4 A;  3ULH A;  3PKY A;  3EX7 B;  2MDA A;  4JV5 F;  1UW4 A;  3C6T B;  3BSO A;  3CCR S;  4M63 A;  2FJX A;  3LTO A;  4DEZ A;  4DV0 J;  1VHF A;  3O5T B;  1WHY A;  3NWR A;  4L3K A;  1H7X A;  5IQ6 A;  2WZ1 A;  3E01 A;  4DL2 A;  3ITH B;  1Z1Z A;  3H2U B;  1WOS A;  4DU7 A;  4I7F A;  4DOZ A;  3OD2 A;  2P8I A;  2DYA A;  3I5A A;  4DV2 F;  4O3N A;  2HEK A;  3C16 B;  2FJB B;  2W4D A;  2XS2 A;  2MYF A;  3O1L A;  2J9D E;  3H59 A;  4CLF A;  4B9U A;  4WF9 Q;  4GVL A;  3OR2 B;  4F0K A;  2YQ0 A;  1HNV B;  4NLR A;  3M30 A;  4LRE A;  3US5 A;  1JQG A;  1NCL A;  3N01 A;  3A3O B;  2CA9 A;  2WK4 A;  4G3I A;  1EHW A;  2VFT A;  3NCR A;  2ZBR A;  2MZT A;  4B3R J;  2HW3 A;  4LBI A;  5D0H A;  1S12 A;  2OFH X;  2V4J A;  4NLS A;  2HK3 A;  1F5B A;  1N6Q A;  3IM8 A;  4DV6 J;  5KFA A;  2UUB F;  1S0V A;  3W7B A;  2G0C A;  2D7S A;  1TK5 A;  3F56 A;  1NBE B;  2OPQ B;  2XCP A;  1U1K A;  4NCG A;  3UCG A;  1YGY A;  4ANE A;  3BN4 A;  1WKK A;  3W2W A;  3KOA A;  5CHC B;  2RVJ A;  2V9W A;  2HHU A;  5JXS A;  2C3M A;  4OZ0 A;  3IBF B;  1R8P A;  4UY8 5;  1TL4 A;  2DXF A;  3MOZ A;  4GC7 A;  3CT9 A;  4USK A;  1R8B A;  1RU2 A;  2E1A A;  5A76 A;  3HHN B;  2DNM A;  3TVY A;  3I0R A;  2DR5 A;  4OLO A;  2BE7 D;  2HFU A;  3H4D A;  2CG4 A;  3L7P A;  2VJV A;  1X4H A;  4HEA 9;  2DCL A;  1UWB A;  2BOA A;  4AFF A;  4USV A;  1I94 F;  2KDO A;  1H98 A;  3CJ3 A;  4UOG A;  4JI3 F;  1RT3 A;  4RW9 A;  5DJB A;  4OIX A;  3QZ8 A;  1NKC A;  5K14 A;  3JSM B;  2ZH4 A;  1S77 D;  1MWZ A;  1CQM A;  3DRP B;  2ATL A;  4Z2X A;  1FJG F;  1VBK A;  1ZYQ A;  3CNQ P;  4DV5 F;  1FVS A;  3O8W A;  1RWW B;  4HT5 A;  5HJX A;  1SQF A;  2RT3 A;  3CC7 S;  2XWY A;  1VQ5 S;  2HWI A;  1EET B;  1OWX A;  4ED0 A;  2UZA A;  3K5O A;  4PWD A;  5KFP A;  3KXD A;  1LKZ A;  3KK2 A;  4J91 A;  1XMB A;  4K5S A;  5C2C A;  2BRK A;  1SQG A;  4Y2K A;  5B0D A;  2R8K A;  4U7U K;  8AT1 B;  3RAX A;  5KFI A;  1YJU A;  3SCJ E;  2H5J B;  2LDI A;  2DK2 A;  4PEO A;  1V3S A;  2RE1 A;  2GO8 A;  2C22 A;  3KLF A;  1UJ6 A;  2QO3 A;  1YJR A;  2CQ0 A;  2KFY A;  3BO3 A;  3J81 U;  1CUL A;  2Z2Z A;  3AOD A;  4L73 A;  2AQ4 A;  1WTF A;  3W5X A;  2UV8 A;  4ED3 A;  3RBZ A;  2ZE2 A;  1HNW F;  1JLC B;  3FCV A;  3P5B P;  1QE1 B;  4N5S A;  3KHG A;  3FFI A;  4G1I A;  3DFE A;  2DH7 A;  3SCI E;  1TKT A;  5HN0 A;  2CDQ A;  3SDE A;  4DR1 F;  4AD6 A;  3OTC A;  4Q0B B;  4ZIV A;  5E33 A;  2BQU A;  1XMQ J;  3V6D A;  1Y0H A;  2G1H A;  3R6G B;  4M1K A;  1RT5 A;  2ZZT A;  4KV8 B;  1QUP A;  1VRU A;  4KSE B;  1F3F A;  4WFX A;  4HHJ A;  5D4N A;  2K7K A;  5D4O A;  5LMU J;  3FVY A;  4LRF A;  4OZ3 A;  1WF1 A;  1JLF A;  1RT7 A;  2FJV A;  2FYX A;  1JIH A;  3HZE A;  2A18 A;  3D68 A;  1KRP A;  1I6J A;  3MCM A;  2OEJ A;  2VL1 A;  3I4P A;  4CZC A;  2HVH A;  2KB2 A;  1RKI A;  4FBT A;  1F6T A;  4ZPT R;  4M5M A;  1D1U A;  1VBY A;  4J9R A;  4JUZ A;  4JI7 J;  3ILJ A;  1FX4 A;  3VZI A;  4QIG A;  3KLV A;  1U4B A;  4M5K A;  3BN7 A;  4E0D A;  1E6Y A;  3SCK E;  3TX0 A;  2ZOG A;  2W2P P;  1R7I A;  5AE1 A;  1U1R A;  2N7Y A;  4RWX A;  2VG7 B;  2LEC A;  2HGL A;  5HQL A;  2ZZM A;  2JLF A;  3Q86 A;  4KPC A;  1KVK A;  2QMU B;  2VFR A;  3BGO P;  2MKJ A;  4IDK B;  4C11 B;  1N48 A;  2MZQ A;  4HVZ A;  5DG7 A;  4O3S A;  4DCO B;  4JBC A;  2HWH A;  3EWG A;  2FGO A;  2WB1 D;  1UVJ A;  4HI1 A;  1G4C A;  2MKY A;  1NDC A;  1NJY A;  4ZP7 A;  2E1R A;  4CLK A;  2Y0S D;  3ADA C;  1VJQ A;  1B7Y B;  2I0X A;  2VOP A;  4ZLN A;  4YQW A;  1Y9O A;  1X5P A;  1Q5V A;  3TZX A;  3TAP A;  2ZH5 A;  4K5R A;  1LWX A;  1QLN A;  1MWQ A;  3R8Y A;  3S01 A;  2AMC B;  4TY9 A;  3RB3 A;  2OH2 A;  4OHX A;  5CYQ A;  3OTD A;  4PUO A;  3KLI A;  4LRB A;  1SJQ A;  4RO0 A;  3M8S A;  1D09 B;  2IMW P;  2W01 A;  4LFB F;  2LEB A;  2EK6 A;  4C0O C;  2ROG A;  2J0X A;  3MPU B;  2YVS A;  3LAK A;  1KFD A;  4DUT A;  4LF5 F;  5HRO A;  3NBP A;  2CYY A;  3TAR A;  2WB4 A;  2V2Z A;  2RU3 A;  1LW2 B;  1NDP A;  1FVQ A;  2HFN A;  4DLE A;  3MFH A;  2C2D A;  4DV0 F;  4DSI A;  4A8O A;  3DLJ A;  4FZV A;  5BXI A;  1VDH A;  1FRM A;  3FSX A;  3MWB A;  3G6Y A;  1LWF B;  4F3O A;  3W62 A;  2FHO B;  3SV4 A;  4KY3 A;  1FX2 A;  1K73 T;  4OL8 A;  1TL3 A;  2JEJ A;  2OML A;  3AFG A;  5IT9 U;  1ZS6 A;  1RUS A;  3FCW A;  1HQ2 A;  1UTA A;  2HAF A;  1I5O B;  4P6Q A;  1DHM A;  2HIY A;  4X4Q A;  1QD1 A;  3RRG A;  4YOE A;  2RRN A;  1YTY A;  1TKZ B;  1FD8 A;  4KHR A;  5KFZ A;  4DPU A;  1R0B G;  3U02 A;  1TAQ A;  2BXJ A;  2IVM A;  3TVZ A;  2KXH A;  3AJ1 A;  3HJF A;  3HZG A;  4LF4 J;  1OQ6 A;  4OV6 A;  4JI2 J;  4F67 A;  4RW6 B;  1SCJ B;  1RCO B;  2W2N P;  3OUY B;  4QPT A;  4ZVF A;  4B3R F;  1FDN A;  2WVF A;  2ZBI A;  1T03 A;  4USI A;  1EKR A;  3W66 A;  2MEW A;  3AY0 A;  4P74 A;  3T5H A;  3PEJ A;  1RHU B;  1WOR A;  3W5Y A;  1HLW A;  3Q8Y A;  3K58 A;  1KSP A;  4ZVS B;  3KHR A;  3RTV A;  2GQ2 A;  3IRX B;  4M95 A;  2GQC A;  2I9S A;  5F3T A;  5H9F K;  1FEH A;  2VC1 A;  5I4M A;  1RBL A;  6FDR A;  1UKU A;  3LWL A;  4ZIT A;  1S10 A;  3C15 B;  5BJR A;  3U1L A;  2WOM A;  1SL2 A;  4DX5 A;  3RW7 A;  1LNQ A;  2IAJ B;  1MRO A;  3S6E A;  4K50 A;  1RTJ B;  4FKX A;  2VH7 A;  2FDN A;  2KHD A;  3CF5 Q;  2AD9 A;  4LRA A;  1RWN B;  1TL1 A;  1SBR A;  2YWW A;  2ZDP A;  1GT8 A;  2MKC A;  3LH2 S;  3GU0 A;  2MLZ A;  2ATC B;  2QRR A;  2FPH X;  3CUN A;  1FDA A;  5LSO A;  3CJK B;  5M2P A;  3ISN D;  4ZPV R;  1SB6 A;  4EBC A;  1KHW A;  3E01 B;  1M5K C;  2FQQ B;  3JS9 A;  5KFH A;  2F8M A;  4MMO A;  1SKW A;  3RJM B;  1N54 B;  3L95 X;  2BQ3 A;  2JEF A;  3G4S S;  5D4L A;  3VAG A;  3HFZ B;  5KFC A;  2XSF A;  3MR7 A;  4ECY A;  3M30 B;  1RWK B;  3THP A;  4IRD A;  4IR1 A;  3MTK A;  2FJE B;  3J81 Y;  2RDD A;  5DZ7 A;  4AL5 A;  2MPU A;  3TA0 A;  1L3K A;  2MY8 A;  4DDF A;  2QA4 G;  4ZPC A;  2E9R X;  1KEK A;  4DFK A;  1HYS A;  2ZZN A;  2UV8 G;  3PJ9 A;  3IM9 A;  3TUJ C;  3CD7 A;  4C0B A;  2BAB A;  1G6B A;  2ZEJ A;  4DQS A;  5K5M A;  1TKD A;  3U7J A;  2NXE A;  5F41 A;  1Q1K A;  2CZ9 A;  4YS2 A;  4H54 A;  3ZTQ A;  8RUC A;  1YKW A;  3PFE A;  4LFA J;  1NK7 A;  3QIP A;  1XMQ F;  4LFC J;  1Z4U A;  1R0A B;  3OVS A;  1WNE A;  3MEG A;  2CDR B;  5LMU F;  3CCM S;  2WBR A;  3VCD A;  3ZTS A;  1C1B A;  4TU9 A;  1TK0 A;  3GLJ A;  2JSX A;  2DNY A;  4I0W A;  1RTD B;  3I0R B;  1YI2 S;  4DPY A;  3GSD A;  3R2C J;  1W2I A;  2VFS A;  3PW5 A;  1OPI A;  4F25 A;  2DR6 A;  4WE1 B;  1RT6 A;  4JI7 F;  3W9H A;  4RW9 B;  1K9M T;  4O0N A;  5K14 B;  1QJH A;  4U7C A;  2V5H G;  1X4E A;  3PRD A;  4X64 J;  1S0M A;  2P9E A;  4J9S A;  4PWD B;  5CCM A;  1RLC L;  1U2C A;  2M52 A;  4K59 A;  1BUX A;  2QV6 A;  3HSG A;  3DOK A;  2RNE A;  1CC7 A;  3D0I E;  2YH1 A;  2GMJ A;  4XO0 A;  4FPI A;  4F4X A;  3LOU A;  3MMC A;  5CD4 H;  3HHL C;  1S6P A;  1KHV A;  4C6A A;  3N79 A;  2JOQ A;  4J9O A;  5MLC V;  3M8W A;  1VIS A;  4F2S A;  4CT8 A;  3H40 A;  4K8R A;  1QM9 A;  3SBM A;  2ZHA A;  1U2R A;  2ZE2 B;  3MAQ A;  1Q7Y T;  4RR5 A;  4EYH B;  4LR7 A;  4PQA A;  2I2Y A;  1JK9 B;  3BS9 A;  4CDI A;  4DV3 J;  1WC4 A;  4M5G A;  3FFI B;  2RQ4 A;  4WFZ A;  4ECV A;  1KLN A;  1TKT B;  3I0S B;  2DNP A;  1SJ1 A;  2OI2 A;  1P9Q C;  3DDI A;  1NB7 A;  3K8V A;  2VG5 A;  4O44 A;  4FKY A;  2DGW A;  2VU5 A;  1H3D A;  2WHO A;  3V6D B;  3MFI A;  3NCQ A;  5C5J A;  1HWI A;  3W5Z A;  1OY6 A;  2F8H A;  5JUM A;  4J9V A;  2RQM A;  3KTQ A;  3BKT A;  1BWE A;  3ICL A;  3GIM A;  3MPW A;  2N4C A;  2Z30 B;  3J81 j;  4QYZ K;  1S0O A;  3KJF B;  1NUE A;  1HQU A;  2V69 A;  2EBE A;  2RQC A;  1K1Q A;  2DO4 A;  5CD4 A;  5KFS A;  2BV3 A;  5IT9 Y;  1PO6 A;  2UVV A;  4ETX A;  2Z56 B;  1VQP S;  3DDN A;  1YRX A;  1D9F A;  3KLH A;  2DH8 A;  2NYH A;  2HFS A;  3GG1 A;  2OPS B;  4WKY A;  1OJ4 A;  1E6Y B;  4YHH J;  3B78 A;  4ES1 A;  1FRL A;  4BWM A;  5DRK A;  1RYS A;  2ZH7 A;  4LF4 F;  1AT1 B;  4JI2 F;  2G0I A;  3BH6 B;  3FBE A;  2DIV A;  2EFV A;  3G87 A;  2CVI A;  3W65 A;  4IH7 A;  3G6X A;  4CLZ A;  1RGV A;  2P5V A;  3MZI A;  1M5V C;  3DRR A;  3IR5 B;  5F3Z A;  1HR0 F;  2FZK B;  3QWP A;  4ZHR B;  4JV2 A;  3D5M A;  2LYV A;  2QN6 B;  2HGM A;  3QAT A;  2NUU G;  1FFS B;  2MKK A;  3KG4 A;  3OTO J;  3UNG C;  1PJ6 A;  3PR4 A;  3A8J A;  3K5N A;  1BD6 A;  3NEK A;  3PFO A;  4V19 J;  2FC8 A;  3HKW A;  3UR3 C;  3OT9 A;  4FYX B;  2UUA J;  2DGT A;  1C0T A;  1TKX A;  3EM1 A;  3UNY A;  5DLG A;  3M8P A;  3HVT B;  1L3V A;  2QA4 S;  5HVG A;  3UDV A;  2R8H A;  3Q8U A;  4KGX B;  2FGC A;  2VZ9 A;  1VC5 A;  3LPE A;  3NBP B;  3NGU A;  1U02 A;  1C2P A;  2ACY A;  3Q0A A;  2CJB A;  2DGU A;  1U47 A;  4LBP A;  1S48 A;  2GIR A;  3UPF A;  1KLM A;  4X4V A;  3M9N B;  1PC4 A;  1M5O C;  2J6T A;  3M2V B;  3M6W A;  3E2E A;  2DGS A;  2N3O A;  3CCV S;  1LFW A;  2QLW A;  5EWF A;  3QT5 A;  3CDA A;  1SJ4 P;  4ECW A;  3PW7 A;  1VJW A;  4X4P A;  4DQQ A;  1RWU A;  3ETO A;  2Y1R I;  4O0I A;  2PA3 A;  4LBH A;  4NE9 C;  5KFW A;  2ZFH A;  3QID A;  4ZJO A;  4K4S A;  1KP6 A;  2ILZ A;  4KE5 A;  2AEF A;  2BMB A;  4AXI A;  3FSY A;  1NHV A;  3LP1 B;  4RX6 A;  5KFY A;  3W9I A;  2B3T B;  5EN1 A;  2JZ5 A;  1T0T V;  3MMJ A;  1T03 B;  5DQH A;  3UD5 A;  3GFY A;  5IWA J;  2XSJ A;  3QPI A;  2ILY A;  1JXL A;  1XNR J;  4J5O A;  3FRZ A;  1JB0 C;  3L3C A;  2ZC4 A;  2ZM6 J;  2VDI A;  1D3W A;  3DLK B;  2N3L A;  4U7U D;  4CO0 A;  1SH3 A;  4RUA A;  1YJ7 A;  3MAA A;  3NOG A;  2V9K A;  5HBM A;  2KXF A;  3SFG A;  1F9H A;  2Y1J A;  2CZV C;  4LFA F;  2KRR A;  2LA4 A;  5DLF A;  4LFC F;  2XWX A;  2J9C A;  2G2O A;  2MTL A;  1REV A;  1D8Z A;  2EXU A;  4ERD A;  5LL6 d;  1VHI A;  3TZW A;  2XGQ A;  1MRO B;  1VQ6 S;  2OFG X;  1TMJ A;  4NXM J;  4OI4 A;  4NXN J;  3R5A A;  1TP7 A;  2CWX A;  4RW4 A;  1B0T A;  3POT A;  3EGW B;  5A8K B;  4ZVP B;  2HQ3 A;  5K8M A;  1L3U A;  1TL1 B;  3FCH A;  1JX4 A;  1RU1 A;  3FEY B;  4JI5 J;  2YWE A;  2J7W A;  4I2Q A;  3BQ1 A;  3ZZY A;  4DSL A;  3OW2 R;  5GAH I;  2PSZ A;  4K7Q A;  1ZM4 A;  4URQ U;  5K8N A;  1EP4 B;  2ZH8 A;  1EJ7 L;  5K8O A;  4CO5 A;  4B9V A;  1RWM B;  2OEL A;  2XMU A;  2CKW A;  4ED6 A;  4HT7 A;  4F7V A;  4KIA A;  5E3C A;  5B0B A;  3EVO A;  4KGV B;  4C8L A;  1N5S A;  5DS7 A;  1F1B B;  2UUW A;  2D9P A;  1OIA A;  2HLU A;  2LLZ A;  3CSK A;  4OJ3 A;  1JLA A;  2C2K B;  4CO2 A;  1ZAX A;  2QT7 A;  2KI2 A;  4KJI A;  4OMF G;  4NA2 A;  2EKY A;  1IM4 A;  5LM7 E;  3DGP B;  3G86 A;  3HHL D;  2G4B A;  3GR1 A;  1WF0 A;  5SZT A;  3GJT B;  3MMA A;  4UOF A;  1HYS B;  5KG7 A;  2ZKT A;  2CNN B;  4JI8 F;  5KG5 A;  3TJ9 A;  4UOH A;  1IKV A;  1GK8 A;  2KVQ E;  1DTT B;  4C48 A;  4NMX A;  4B17 A;  4JI1 J;  2DPI A;  3CJ5 A;  1HPZ A;  4MIB A;  2LVW A;  1PBA A;  1LWE A;  5HVH A;  4ED1 A;  2E9Z A;  4FYY B;  3J7Z T;  2XTJ P;  3IS9 B;  3QIP B;  1KS2 A;  2DGQ A;  2YKA A;  3BKU A;  5ETK A;  2QL7 B;  2LEA A;  3NGS A;  1NJX A;  2Z2L A;  1X9W A;  4I56 A;  3MEG B;  4MIA A;  4CYU B;  1WC0 A;  2GJI A;  2D3O 1;  2OSR A;  2VB6 A;  2RUG A;  1C1B B;  3D0H E;  4P9S A;  5IT0 A;  2E9T A;  1X60 A;  2DRA A;  4F26 A;  4UW2 A;  5B08 A;  4MK7 A;  3C6U B;  3QFH A;  4Q44 A;  3GON A;  4F8R A;  1P8G A;  2LU2 A;  4R8U A;  2YNF A;  4OHY A;  4HL9 A;  3QGP A;  2MQQ A;  5F0U A;  3PW2 A;  2CNK B;  4U8V A;  3T3F A;  5KFB A;  1Q4R A;  3C66 A;  1H2V Z;  2XMV A;  3TWZ A;  2GJ2 A;  3ILL A;  2G1D A;  2QA1 A;  2HFO A;  1YBU A;  4A48 A;  1NK4 A;  4DU8 A;  4YHH F;  5KFJ A;  2LDY A;  1U1O A;  2J0Q D;  2A2C A;  3RR7 A;  4KH0 B;  3B8H A;  1OS5 A;  4C8Y A;  2V2Q A;  1RIS A;  2WVC A;  4OYA A;  3G82 A;  3NNH A;  1YVF A;  2KT2 A;  5LOQ A;  4F36 A;  3HSD A;  4USJ C;  4QIE A;  4WZM A;  4ITS A;  4DWI A;  3B54 A;  1LOU A;  1HMV B;  2BKP A;  4CO3 A;  3OTO F;  5LSR A;  2JC1 A;  2H4W B;  5J2P B;  1FWK A;  1NK5 A;  1HWL A;  3DI6 A;  2BJ3 A;  2KZZ A;  2WSE C;  3N6N A;  4XDC A;  3BEG B;  1R31 A;  1OSC A;  5ETL A;  2VFU A;  2QC3 A;  1FDB A;  4FP9 A;  2WSF C;  3PW4 A;  2B9E A;  1LXJ A;  1NK9 A;  3MOJ B;  3VAH A;  4N7T A;  4MKB A;  2PGC A;  4MFB A;  3U1M A;  2VG5 B;  1IR1 A;  4RNH A;  1EX8 A;  4UUW A;  2R8G A;  1K0T A;  3OFG A;  3EZ5 A;  1X5S A;  2R4F A;  2BJE A;  4YB6 A;  1JLQ B;  2RHQ B;  4FF1 A;  1HI8 A;  3VQT A;  1I51 B;  3TP2 A;  1HQU B;  4OHV A;  1U1P A;  2Y1L B;  4R0J A;  2K3K A;  3PXG a;  5KFV A;  2LU1 A;  4K4X A;  2BAC A;  3GIJ A;  1UA1 A;  1TUW A;  4EBE A;  4A4J A;  1O5J A;  4WZQ A;  3B4D A;  2OEM A;  3KLH B;  2MQM A;  4ZDN A;  1UJ5 A;  2KJW A;  3TAM A;  1U1N A;  1YWX A;  1HBO A;  1S99 A;  3GZ7 A;  4HHH A;  2JHE A;  5CYM A;  2LEP A;  2YX4 A;  2HRT A;  3PJW A;  5SUH A;  5E0O A;  1S9E B;  4HHU A;  4Q8F A;  4OV1 A;  3K5L A;  2HSE B;  4F04 B;  3GV8 B;  4OX9 J;  2RD5 C;  4TU7 A;  1T3N A;  4EWT A;  3BGF A;  4IFY A;  3FNN A;  5IWA F;  2CJY B;  4ZMM A;  2IJN A;  3ZNJ 1;  1XNR F;  1GAO A;  2ZM6 F;  3QNW B;  4X4R A;  3IGN A;  2HQF A;  3PX4 A;  3V81 A;  5BYR A;  4CI0 B;  4QPX A;  1SJF A;  3N4W A;  1SJR A;  1XTZ A;  4LVO P;  1FWP A;  3OXL A;  3CDE A;  4E2F B;  3Q8V A;  4CM0 A;  5HLF B;  1TKX B;  1RAF B;  3QGG A;  5EWE A;  1NSK L;  4EI2 A;  2V34 A;  5HL7 Q;  1L3S A;  3DHW C;  4RUC A;  4NXM F;  5B09 A;  4NXN F;  3LPY A;  3AJ2 A;  1PIE A;  3CJ4 A;  3IWN C;  3N28 A;  1KLM B;  4JI5 F;  1VQL S;  1BC6 A;  4N8O A;  2ROE A;  2YX1 A;  2GA7 A;  3MD3 A;  4LQ9 A;  1KQS R;  2AZ1 A;  4CNZ A;  4ZVE A;  2GS8 A;  2UVR A;  1DFD A;  2XZT B;  2L9D A;  2KT5 A;  1SC6 A;  4YN3 B;  3WC2 A;  1MLA A;  1NXI A;  4M5H A;  4LRD A;  4DR3 J;  1A7G E;  3NKY A;  1UVL A;  3IC1 A;  4P52 A;  3DLL Q;  2LXF A;  2CJA A;  3IMQ J;  3N9U C;  4X4U A;  3MHY A;  3KMS A;  2OEK A;  3BRE A;  2B7B B;  4DN9 A;  1IBL J;  2DR9 A;  4OJ1 A;  3IN5 A;  2CQ1 A;  2CUY A;  1U0H B;  2ZNY A;  4ZP8 A;  3GYN A;  4RJV A;  4ZVO B;  3FKB A;  1P1L A;  3KG1 A;  2I1R A;  3H5Y A;  4RU2 A;  3VGV A;  4EU0 A;  2V63 A;  2E1P A;  1RT1 A;  2J7K A;  4AQY J;  3V4M A;  1XR6 A;  4ZJL A;  3GP9 A;  3WQP A;  2EFP A;  1RAH B;  1HKA A;  3EMT A;  1SKS A;  3AXK A;  3HP6 A;  2QSF A;  2V8H A;  4OI3 A;  2FIU A;  2CJK A;  4PWW A;  3HSZ A;  3ZZR A;  3W3S A;  4ECU A;  3T5L A;  1X9S A;  3EUN A;  1N32 F;  4B3M J;  4PKD B;  3M9O B;  1VR6 A;  1REV B;  1HL6 A;  3EDR B;  2HBY B;  5CYJ A;  2VIC A;  1KDN A;  2DRB A;  2QLF B;  4ECZ A;  4E98 A;  4C3K A;  2C3O A;  3HM9 A;  2R7R A;  2KM8 B;  1DJ0 A;  2ZH1 A;  5H9E K;  3ZZU A;  4F02 A;  2B5J A;  5JVH Q;  2ZHO A;  2EG2 A;  1F9F A;  1HQE B;  2PO4 A;  4HAC A;  3CCL S;  2H3E B;  4USH A;  1Y5I B;  4DFJ A;  2HHX A;  2CPE A;  4KFB B;  3ENV A;  1FE4 A;  1FKO B;  4W4M A;  1DLO B;  1VOM A;  2W9C B;  1PIL A;  4I2Q B;  3Q8Q B;  1VMB A;  3I5B A;  3BV8 A;  2UUC J;  2BJ7 A;  4DBQ A;  3BF4 A;  1U0S A;  2FHJ D;  4PXE A;  9RUB A;  1HBU A;  4IOB A;  3RBX A;  3UO0 A;  4WFB Q;  2WVE A;  3OR1 B;  3HVR A;  4NLD A;  4CQ1 A;  4NA1 A;  5GAD I;  3HT3 A;  1RWV B;  1D8Y A;  1ZM2 A;  2ASJ A;  4JI0 J;  3G6E S;  1DTQ A;  4C8Z A;  1LWC A;  4KPY A;  1YBA A;  2Q6C A;  4ZN3 A;  5IM0 A;  1C0U B;  1BLU A;  1JLA B;  3ZO7 A;  4Q7A A;  4F0M A;  4NI2 A;  2RF2 A;  1VIO A;  1EZZ B;  5D77 A;  1AZS A;  3FMB A;  3MPY A;  2DIT A;  3M8Q A;  3MMA B;  3CO0 P;  5D0E A;  3MM9 B;  1XR5 A;  2DPJ A;  5I3Q A;  4C0H A;  3R9L A;  3NY0 A;  2LQJ A;  1IKV B;  4HI2 A;  1EB0 A;  4RU9 A;  3TEH B;  2C2R A;  4M5D A;  1HPZ B;  3P8B B;  4EBD A;  2AJ1 A;  3JTP A;  4Z7Y A;  1WHV A;  3SIP B;  2ZC3 A;  1R43 A;  4L3N A;  4DX6 A;  3MR5 A;  2GGP A;  2PMH A;  1P1T A;  3ZTO A;  5F8G A;  2NPI A;  1P9Y A;  2DRD A;  3A8K A;  4OZN A;  1VQO S;  1T3O A;  4RW8 A;  5HAT A;  1QTM A;  2V8P A;  1Q5Y A;  4OYB A;  4URG A;  2QYC A;  2PN6 A;  5D15 A;  2Q43 A;  4WFN Q;  3BQ2 A;  4LVN P;  4CLS A;  2R3V A;  3PG9 A;  1S1X A;  2FJD B;  4PG7 A;  2WW8 A;  1FJ7 A;  2YNF B;  1ZPW X;  2CPX A;  5EUH A;  3KK3 A;  1PSD A;  1RA7 A;  3GMG A;  2Z2Y B;  4GC6 A;  2F9J A;  2CQI A;  3LP0 A;  2JVR A;  1J5E J;  3A3N B;  3GIK A;  2G13 A;  2PD1 A;  1WWH A;  5L39 A;  4QCL A;  3D4J A;  4L74 A;  3IAS 9;  1S9F A;  3M8Z A;  5HSP A;  1WC3 A;  5EDW A;  2VHG A;  1V5I B;  1UVK A;  1I1G A;  2R2U A;  4H4M B;  3PY8 A;  4OX9 F;  5ETR A;  3N6M A;  2KHC A;  4MK8 A;  1GEH A;  2XLJ A;  4G1P A;  3F73 A;  5FLX U;  1RBO B;  5M2U A;  1IN0 A;  3FK4 A;  2OTL S;  2XY6 A;  3RAQ A;  1HWK A;  1AYE A;  4P2S A;  4KKO A;  1NU4 A;  3H5S A;  2MQO A;  1NDK A;  2EFG A;  3LP2 A;  3DI6 B;  2C2E A;  1T9V A;  3IBC B;  3GFX A;  1HW9 A;  1MWY A;  3GFH A;  4KHP F;  2H65 B;  1Y10 A;  3RAM A;  3KG0 A;  2XUL A;  4H4O A;  2V68 A;  4CLL A;  2ZH6 A;  4CT9 A;  5FII A;  1PGZ A;  4QW9 A;  2W1B A;  1MW7 A;  4MFB B;  2M88 A;  2JFD A;  1YHQ S;  1RWO B;  2AIR B;  2NYI A;  4FNI A;  3VV2 B;  1T9Y A;  4ICL A;  4ZP6 A;  3TR5 A;  5KG2 A;  4DV4 J;  2BJ1 A;  3MI7 X;  1AFJ A;  2R9L A;  2CQC A;  1GXT A;  1PCA A;  3KJN B;  2N4D A;  4DR5 J;  4C3L A;  5L8R C;  2WW4 A;  4X65 J;  3PKM A;  4DLG A;  3NOC A;  3A3P B;  1NM2 A;  4Y6I A;  5LXY A;  2R42 A;  1DQA A;  5KT3 A;  3ET6 A;  1WSV A;  4DR3 F;  5BYS A;  4DG1 A;  1TV6 B;  4LQ3 A;  3EXY A;  2EVZ A;  4I2P A;  1X4C A;  5KOX A;  2DHG A;  3VQS A;  3FSI A;  1IBL F;  1JJ4 A;  5CYM B;  2FUG 9;  4QR1 A;  3NCP A;  1YDL A;  3CGI A;  1B99 A;  2DNQ A;  5DQI A;  4ER8 A;  3SMZ A;  4HKQ A;  3G8T A;  2F4F A;  2EBG A;  5J2N B;  1BMQ B;  3MM8 B;  3C46 A;  5ETP A;  2Z8Q A;  2FC9 A;  3P4U B;  4C98 A;  3NL0 A;  1ZET A;  4IFY B;  3BGR A;  4AQY F;  4LSL A;  3SQG A;  1TAU A;  4CRJ A;  3SQO P;  2O67 A;  4K0K J;  3W1Y C;  4DL7 A;  2DO0 A;  5I42 B;  4TQS A;  4OJH A;  1DQ8 A;  3P6Y C;  2OIH A;  2E29 A;  4CO1 A;  4ED7 A;  2VBW A;  2W7P A;  4NX9 A;  2FLP A;  3KLE A;  3OFE A;  4DS4 A;  2K1R B;  3HFV A;  2E5L J;  1J5O B;  1SIW B;  4LUB A;  4TXS A;  4YR2 A;  3A1Y G;  2AU0 A;  1BQM B;  3C19 A;  4IO1 A;  4CH1 A;  3SSQ A;  4K4V A;  4B3M F;  1X4A A;  2J9E A;  2VA3 A;  2E5I A;  3AA8 A;  1SKU B;  1VFJ A;  2Z4P A;  1Q8L A;  1MU2 B;  3GYG A;  3LAN A;  3I32 A;  3IP0 A;  5C7P A;  1RAJ A;  1BXN A;  3JSB A;  2O66 A;  3AH6 A;  2NZ4 A;  1ZZF A;  5C24 A;  3DXS X;  2IIH A;  1RAI B;  1VQK S;  1TK8 A;  4ZVQ B;  4X4O A;  2A3J A;  3NGT A;  1BQX A;  1N36 J;  2UUC F;  5AE3 A;  3J7A 1;  5ETS A;  2J76 E;  3Q23 A;  2DNR A;  1WUU A;  2H5I B;  5G0R B;  1RCX B;  4L76 A;  5F9L A;  1S7I A;  3BKF A;  5IZH A;  2M4M A;  3MR6 A;  2AKW B;  1JLE B;  3B82 A;  3MEE A;  3CIZ A;  1RT4 A;  5E3R A;  1GFW B;  2ZJP Q;  3DOM A;  4PR6 A;  3KMQ A;  2DHX A;  1VIX A;  3DRS B;  4BC9 A;  3GSI A;  4JI0 F;  1N56 A;  3W60 A;  1QAX A;  5KOW A;  1R6Y A;  1EQ0 A;  2MQL A;  8ATC B;  1DAX A;  2VPZ B;  2CNL B;  4ELV A;  3ISZ A;  3IFE A;  2L3M A;  3M1V A;  4FXD A;  2RRA A;  3VVT A;  1FER A;  2C2O B;  1NK0 A;  1RT1 B;  2QA2 A;  5J1N A;  1FFW B;  1XIQ A;  4I6A A;  1U48 A;  2V67 A;  1SL1 A;  3EPI A;  2BRL A;  4PYD A;  2BKN A;  4LF2 A;  3IGV A;  3BJY A;  5HO4 A;  3H4B A;  2PMW A;  4PZV A;  2GIF A;  1Q79 A;  2OPR A;  2EWH A;  3S1T A;  1OY9 A;  2EFQ A;  1X0P A;  4F0H A;  4Y00 A;  4ZN1 A;  3I56 S;  4CWB A;  5C2G A;  2J9D A;  1W2B R;  5GMD A;  3W2V B;  2POK A;  4ZK7 M;  4NLY A;  2DH9 A;  1OQ3 A;  2XMW A;  2HNZ A;  1HNX J;  1H74 A;  3AD9 C;  3NMA A;  2BQR A;  5J2Q A;  3GYX B;  5BYQ A;  5J1E A;  1RXO B;  3GV7 B;  1RAO A;  2OD6 A;  4I64 A;  2VBZ A;  4G1Q B;  4RBV A;  2DNH A;  3PW0 A;  5F8N A;  2YNG A;  2B5J B;  3LA0 A;  4HAC B;  2J0S D;  2ZD1 B;  3D1O A;  2HWT A;  2NRE A;  3CUL A;  4J9P A;  3DLH A;  1BWV A;  3TEG A;  2AEM A;  1YK9 A;  4DS5 A;  2E7X A;  2XMJ A;  1JLB A;  1J5E F;  1GMW A;  2AV5 A;  2F4V J;  3PYE A;  2HZC A;  2KN4 A;  2P9G A;  2AX0 A;  3HXM A;  3UCZ P;  4DN0 A;  5KFR A;  2AEJ A;  4ZPB A;  1WD6 A;  1N4L A;  1N5Y A;  2HNY A;  3BGL A;  2CFX A;  3CJR A;  2I5J A;  3J7Y U;  5FLX Y;  2DBB A;  1IUJ A;  1DTQ B;  1VC6 A;  2MHN A;  4ILM A;  5IM0 B;  5KG6 A;  3WX4 A;  1WSR A;  1FES A;  4NI2 B;  2RF2 B;  1IQZ A;  3DKD A;  4KRW A;  5L1I A;  1TVR A;  1AZS B;  3G96 A;  2W7A A;  3EVM A;  1S49 A;  2XO7 A;  3DU6 A;  1K1S A;  2A2D A;  2SXL A;  2AYE A;  1URN A;  1M5H A;  2XMM A;  2M70 A;  1YJW S;  3TUZ C;  4F4K A;  1U09 A;  4M5D B;  2YNI B;  5F8H A;  3W8G A;  4DV1 J;  2PEH A;  2KXN B;  4UT4 A;  3TVK A;  4AE5 A;  3ONQ A;  4RUB A;  1FDD A;  4UZB A;  2OAU A;  4RLE A;  5CAA A;  3QFW A;  4Z7C A;  4DV4 F;  2XYG B;  3MF5 A;  4K4W A;  1WTB A;  4U67 Q;  1YBT A;  2GHV C;  4QU6 A;  3M05 A;  4QQB A;  2ASY A;  4X65 F;  3H42 A;  3AOA A;  5AXN A;  3DDK A;  4H4K C;  3TAN A;  4OI2 A;  5E41 A;  1JXV A;  1UVM A;  3KK3 B;  3KYL A;  2HHV A;  2BW2 A;  3FC9 A;  2AHO B;  3NS5 A;  3CCU S;  2G9O A;  3TI0 A;  2Y1I A;  4A8Q A;  2J8A A;  1UMJ A;  1NSP A;  4OZ1 A;  1S6Q B;  2F9D A;  3MCS A;  1YRU A;  1G2E A;  3T1A A;  2GZO A;  3R7N B;  2AP6 A;  4Y2A A;  2V50 A;  1ACM B;  2X1F A;  4B9L A;  4OI1 A;  5IXU A;  2ZWO A;  1RTI A;  4A8S A;  2B0G A;  1E6V B;  1V3Z A;  2BM0 A;  2OPP B;  2PII A;  3V4I A;  3R5J B;  1YIJ S;  5B0A A;  3Q2S C;  2M0G B;  4O4G A;  3M7V A;  3DRY A;  4ECQ A;  4K4T A;  4KKO B;  3RUB L;  3ZZT A;  3FRY A;  3GJS B;  1CJK B;  3ZZ0 A;  2JJ4 D;  2Y0B B;  3TAQ A;  3LQV A;  1XMO J;  2W2O P;  2OGU A;  4IH6 A;  4NCA A;  2HHQ A;  2E5L F;  5IT4 A;  1TL5 A;  4U6P A;  2QMW A;  5HP1 A;  1FA0 A;  4RW7 A;  1Q78 A;  2L08 A;  2WON A;  1O51 A;  2KG1 A;  5THW A;  2ASD A;  4LMZ A;  3ISN C;  3R27 A;  5KFN A;  1CVJ A;  4M8L A;  3VZH A;  4ICL B;  3LGH A;  2AJF E;  1B0V A;  1KBR A;  3D1Q A;  2XMK A;  4FVM A;  2FLN A;  1RWP B;  3OPK A;  2G0J A;  3MAH A;  1S1U B;  1MNE A;  3HCX A;  1YLX A;  4FBU A;  1IKY B;  1B70 B;  2GNK A;  3DHX A;  4KGZ B;  2FLO A;  1N36 F;  4FF3 A;  3HLU A;  4PWU A;  4DL5 A;  5G4D A;  3MCN A;  2CZ4 A;  2E5H A;  2GFF A;  4P2M A;  2WRM A;  4QIV A;  1DQ9 A;  1S9G A;  3NRB A;  1VQ7 S;  3DLG A;  2FY8 A;  1N88 A;  1UET A;  1FHT A;  5E5N A;  4I2P B;  1QAJ A;  4X62 J;  1WHW A;  2E44 A;  3C14 A;  4DR6 J;  1TUG B;  2YQ1 A;  3LW5 C;  3W61 A;  1HHQ A;  1CLF A;  4I67 A;  1U26 A;  3T1Y J;  1V6H A;  1A9N B;  1LK7 A;  1U1Q A;  2PEB A;  2BAN A;  5C42 B;  2P2C B;  2XLK A;  1WC1 A;  3VR1 A;  3ZFV A;  1N0V C;  4KGK A;  1IKX A;  1T9W A;  4URS A;  1MG7 A;  1T95 A;  1HWU A;  4D3H A;  3BGR B;  4EGL A;  4JB8 B;  4LSL B;  2V8G A;  3SQG B;  1HW8 A;  1T05 A;  2B6A A;  4QJV A;  1ROF A;  2CJX B;  5ETN A;  3IWL A;  1K44 A;  1MML A;  1Q81 T;  1ZM3 A;  3GE9 A;  5BR8 J;  3KLE B;  1JLG A;  5K8P A;  1UPM B;  2Y8Y A;  1FT8 A;  4KHM A;  3K5M A;  2UXD J;  3X1L B;  4AUK A;  4DI6 A;  3DLE B;  4ZCI A;  1NZ8 A;  1Q86 T;  3OXF A;  4N77 A;  2DJW A;  2QE5 A;  2MKH A;  2CRL A;  2VG6 A;  4YP3 A;  1EIY B;  3QAE A;  3PHT A;  1HNX F;  3J7Z 5;  2C3Y A;  5IQQ A;  3OTE A;  5KG4 A;  3BR9 A;  1FKP A;  2DNZ A;  4WYW A;  4ES2 A;  2P6T A;  2MQP A;  4ZPD A;  1K47 A;  4C7Q A;  3PO5 A;  5C24 B;  2V4R A;  4UQT A;  4FS2 A;  2ZWP A;  4NLQ A;  3JB9 k;  4OX7 A;  3ZTP A;  1M5P C;  4MH8 A;  2ZOF A;  2RKI A;  2OTJ S;  3KLG B;  4NCB A;  4QWB A;  1AUS L;  1S72 S;  2BE2 A;  4NLP A;  4DL6 A;  1N5Q A;  3MEE B;  3IXQ A;  4RZR A;  5RUB A;  1N8R T;  2ZHB A;  3NXZ A;  1QUV A;  3TZY A;  2AYG A;  4CM2 A;  2EKN A;  3OJS A;  3D66 A;  3HVW A;  2V8V A;  4JI4 F;  1NLK L;  4J9L A;  4WWS A;  2LP4 A;  3J7A N;  3C3L A;  3M1V B;  4EEY A;  2JL9 A;  3ITH A;  3GII A;  1F2H A;  1X9M A;  4UF4 A;  2MHE A;  1WHX A;  3SZ2 A;  2X3D A;  1B64 A;  1U6Z A;  3CJ2 A;  4IH5 A;  2JWN A;  3UWT A;  1HIY A;  1M1G A;  1HNV A;  3TZZ A;  1HD1 A;  2XCA A;  3AD7 C;  4J9N A;  1CSJ A;  4DPW A;  2NR0 A;  4DV1 F;  2GJF A;  2UXB J;  3KUE A;  1U1M A;  4OZ5 A;  1CEZ A;  3R5C A;  1KQF B;  3CCW A;  3MM7 A;  5KT5 A;  1LW0 B;  1B3T A;  3TA2 A;  1YRT A;  3EDQ B;  1YZ7 A;  3LO3 A;  3QMQ A;  2JEI A;  1JNR B;  3QT7 A;  2V4Q A;  2HNZ B;  2RIJ A;  3GQC A;  3UR0 A;  5J1E B;  1OMS A;  3VTI A;  3TJ8 A;  3PVX A;  3AB2 B;  2FY1 A;  2OPQ A;  2V94 A;  4DR7 J;  2YNG B;  2VON A;  3A13 A;  1TU0 B;  1TMM A;  4RNF A;  3VAM A;  1PJ7 A;  4C4W A;  3K7R A;  4LIW A;  4DL0 C;  3H5X A;  4DQR A;  2AGQ A;  4AND A;  1UAW A;  1YSJ A;  2R8J A;  2HND A;  4GKJ J;  1IR0 A;  2A1B A;  2J6U A;  1NKB A;  1RHM B;  4TU8 A;  2QLX A;  3JTO A;  3NP5 A;  4DV6 F;  2IA0 A;  2NXN A;  4OYM A;  1N5Y B;  1ULR A;  3M2R A;  3H2V E;  5L1K A;  2Z58 B;  3M9M B;  2F7V A;  4QWE A;  4LSZ B;  3CCQ S;  5EWG A;  3VGU A;  5IS2 A;  3PV8 A;  3OL8 A;  3BPD A;  3KUG A;  4JV0 A;  2CIM A;  3RYL A;  4OYI A;  1FXD A;  3P3D A;  3DN9 A;  3DRP A;  5ADZ A;  1H73 A;  1OPZ A;  2MGZ B;  1GXL A;  2X7I A;  5D3G B;  4BCA A;  2MJN A;  1EET A;  1RP5 A;  3I82 A;  4WJB A;  4BBY A;  3QYY A;  4HTI A;  3NNC A;  4EZ6 A;  4K4U A;  1KR4 A;  1M90 T;  1XMO F;  3CB4 A;  4NYO A;  4FXV A;  2LQ5 A;  4MYU A;  2F5G A;  3JQJ A;  4NLU A;  2H1Y A;  5A8W A;  3NMR A;  3AB4 B;  2RAQ A;  1MN9 A;  3HK2 A;  2R2R A;  2F40 A;  5A2Q U;  1VLY A;  4Y0F A;  1TUV A;  2B4V A;  4KYZ A;  1A0O B;  4TY8 A;  4WKR A;  2LQB A;  1NSQ A;  2HHW A;  4OHW A;  2NSC A;  2J8S A;  3EGN A;  3N0V A;  3MUV P;  5FJ4 A;  1UJ4 A;  3MUT P;  4Q2M A;  2CNO B;  3DGV A;  1KD1 T;  3R3T A;  1KQK A;  1CS4 A;  3MGJ A;  2BYC A;  1JLC A;  4ETZ A;  3JXO A;  4I7F B;  2IRU A;  4S0M A;  2IBK A;  2RU9 A;  2FLL A;  4ENO A;  1CJV A;  4UUX A;  5J1P A;  3MCO A;  2RS2 A;  4Q0B A;  2YWH A;  2IY5 B;  4FYV B;  2B4O A;  3VAL A;  5JVG Q;  2V2V A;  5IOL A;  4MKV A;  2FVC A;  3BBF A;  3UD4 P;  5KFG A;  3FBB A;  5E3P A;  3BB5 A;  4X62 F;  1M5S A;  1S1V A;  3RB6 A;  1D0E A;  4DR6 F;  1PAU B;  1RE1 B;  2V4J B;  3T1H J;  2H48 B;  1F2G A;  3P45 B;  1N6Q B;  3QQC D;  3T1Y F;  1RAD B;  3ZZP A;  3OHA A;  2YKQ A;  1X4D A;  2NSB A;  2ZNZ A;  4Y28 C;  1JKH A;  5ETO A;  5B7W A;  2VIH A;  1RTI B;  4NCG B; 
#chains in the Genus database with same CATH homology
 1HHQ A;  4FKX A;  3FBC A;  4FKY A;  2VU5 A;  1LWX A;  1NB2 A;  1F6T A;  1JXV A;  3EVO A;  3VGV A;  1NSQ A;  2BEF A;  3PJ9 A;  4DZ6 A;  3L7U A;  1NPK A;  1B4S A;  1NHK L;  1HIY A;  3ENA A;  3FC9 A;  1UCN A;  3DKD A;  2DYA A;  2DXF A;  3GP9 A;  3ZTP A;  3EVM A;  3BH7 B;  3ZTO A;  3EMT A;  3BBB A;  1S57 A;  5CAB A;  1BUX A;  4WBF A;  4S0M A;  4DUT A;  1NUE A;  1W7W A;  3ZTQ A;  2ZUA A;  3EIC A;  3VGU A;  4ENO A;  1S59 A;  3VVU A;  1NSP A;  1U8W A;  1NCL A;  3FCV A;  4UOF A;  3BBC A;  2AZ1 A;  4F4A A;  1K44 A;  1PAE X;  3Q86 A;  1EHW A;  4KPC A;  3WX8 A;  3VGS A;  3EM1 A;  4CP5 A;  4UOG A;  2DY9 A;  3VVT A;  1HLW A;  2B8Q A;  5IOL A;  1NDP A;  3BBF A;  3JS9 A;  1NDK A;  3Q8Y A;  4EK2 A;  3GPA A;  4UOH A;  4C6A A;  3FBF A;  1XIQ A;  1S5Z A;  3B6B A;  3Q89 A;  3ZTS A;  5C7P A;  1WKJ A;  3FBB A;  2HVE A;  5CAA A;  2B8P A;  3EVW A;  1WKL A;  2CWK A;  1B99 A;  3ETM A;  2HVD A;  4DI6 A;  1NDC A;  1KDN A;  5BXI A;  3PRV A;  1F3F A;  1NLK L;  3Q8U A;  3ZTR A;  3NGR A;  3MPD A;  3ELH A;  1BHN A;  2HUR A;  4ANC A;  1NDL A;  2NCK L;  3NGU A;  3NGT A;  3NGS A;  2DXE A;  3Q83 A;  4W98 A;  1MN9 A;  1MN7 A;  3Q8V A;  1PKU A;  1ZS6 A;  3FCW A;  4F36 A;  2AZ3 A;  1VYA A;  4ANE A;  3EE3 A;  4AND A;  4HR2 A;  1WKK A;  1BE4 A;  3FKB A;  3R9L A;  3EJM A;  3BH6 B;  1LEO A;  4O0N A;  1XQI A;  2BX6 A;  2DXD A;  3FBE A;  3G2X A;  3B54 A;  3DDI A;  3VGT A;  1NSK L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...