4UOFA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with dadp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
b'MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
molecule tags Transferase
source organism Litopenaeus vannamei
publication title Structure of Nucleoside Diphosphate Kinase from the Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
total genus 47
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uofA00
1UCNA 1KDNA 3G2XA 5IOLA 1NPKA 1NDPA 4C6AA 3EVOA 3BBCA 1S57A 1NB2A 1W7WA 1B4SA 4EK2A 2B8PA 4WBFA 3GPAA 1MN9A 3DKDA 4DI6A 4CP5A 1LWXA 3PRVA 4ANDA 2HVEA 1BUXA 1F3FA 1S5ZA 3VGTA 4FKXA 3BBBA 4UOGA 3VGVA 2NCKL 1NLKL 3DDIA 1ZS6A 3VGSA 4FKYA 3ELHA 3FBFA 3EE3A 4DZ6A 2DXEA 1NCLA 1BE4A 4S0MA 4HR2A 4W98A 3VVUA 4ANCA 3EVMA 4UOHA 3ZTPA 1XQIA 1VYAA 1NSQA 2ZUAA 3ZTSA 3ETMA 1NSKL 3Q8VA 1WKJA 1BHNA 3FBEA 3B6BA 2B8QA 1U8WA 1NDLA 3EMTA 3FBBA 3JS9A 2AZ1A 3BH7B 3EVWA 2HURA 5C7PA 1WKLA 1WKKA 5CAAA 1F6TA 1K44A 1MN7A 3Q89A 4ENOA 2HVDA 3WX8A 1NSPA 3FBCA 3ENAA 3B54A 2CWKA 3R9LA 3ZTRA 1S59A 3ZTQA 2DXFA 1HHQA 1EHWA 1JXVA 1XIQA 1NDKA 4KPCA 1B99A 3FCVA 4UOFA 4F4AA 4O0NA 1LEOA 1PAEX 3L7UA 3BH6B 3PJ9A 2VU5A 1HIYA 5CABA 3EICA 3NGUA 1NUEA 1HLWA 3EM1A 3Q8UA 3Q86A 3VGUA 3NGTA 4F36A 3FC9A 4ANEA 2DXDA 3GP9A 3MPDA 2DY9A 3EJMA 2BEFA 1PKUA 2BX6A 3FCWA 2DYAA 3FKBA 3NGSA 3Q83A 4DUTA 1NHKL 3ZTOA 3VVTA 2AZ3A 3NGRA 1NDCA 3Q8YA 5BXIA 3BBFA
chains in the Genus database with same CATH superfamily
3G2XA 1Z4UA 3HVRA 2ZH7A 1TAQA 4KIAA 3FK4A 2CZ4A 3FMBA 2B5JB 1DARA 2NSBA 3I9ZA 4WIQA 4LRDA 3DU5A 5HI7A 1FWKA 2Z2YB 4F26A 1HQUB 5DG7A 2VV5A 4NA1A 3THPA 3U1NA 2CJQA 2A6MA 2CNLB 4LF2A 4OYAA 4ZP6A 1R8AA 2JRSA 3AQPA 4CYUB 4XPCA 2DHXA 2YKAA 4NYPA 1WC0A 2NUHA 1MROB 4USKA 4USVA 2W24A 5FD1A 4A8OA 4M5DB 4C11A 4ER8A 2GAHC 5FDLA 4R8UB 1U6FA 2BW2A 4FYDA 4KT0C 4DX7A 2KXNB 5I3UA 2ZBCA 2BXJA 4DL0C 1U48A 2KT5A 2UUTA 4TYAA 2OLWA 2Y1JA 3EE3A 2V50A 3DCAA 3POTA 2IM1A 3UE2A 4AQYF 4IQMA 3BF4A 3KJQB 4USJC 4Y2IA 3UQSA 4EBDA 2F8MA 4BDPA 1NCLA 1PSDA 4FYXB 2WK4A 1SPBP 1U25A 2IAJA 4HHJA 4WE1A 3HKZD 4IH6A 3IWXA 4OX8A 1U2CA 1TKZA 3ZTPA 2HQCA 4CT8A 4RW8A 2EFNA 2HQGA 5F3TA 4HHHA 4FF4A 3PR5B 2M70A 4FP9A 2R2SA 2MB0B 1FI4A 2CPFA 3Q23A 1RT6B 3CJRA 1A0OB 1U8WA 1XERA 3RBXA 5JUMA 3V6KA 1GH8A 3IRXB 2BMBA 4YY3F 1Q95G 1EQMA 3TARA 3MEEB 2YNIA 2YPZA 4Y2KA 2HNZA 5HK4A 5GAEI 2HURA 4DPUA 1HNWJ 2E9ZA 1JLFB 2QTWA 2YKMB 1JLQB 2D74B 2W1BA 3Q2SC 4U95A 4ZITA 4R0EA 2WVFA 2AGPA 4QPXA 1VR6A 3C16B 1VJWA 2MJNA 2P9EA 3QFWA 3ZNUA 4MIBA 2MQOA 4K4XA 2ZBRA 1TK0A 5IM0B 1XTZA 5E3AA 3W3SA 5KFBA 4F02A 1U45A 4ENOA 1EB0A 3I32A 2G2YA 1NH7A 1KOOA 1S1VB 2H51B 3F41A 1I5OB 1IBLF 1U7LA 3L4BC 4DUZF 3SV3A 2V9WA 2DXFA 2UV8G 4N77A 2RRBA 2H4WB 4OZ5A 4DPTA 3IRWP 4HYKA 1FVSA 5CHCB 4GC6A 3U7JA 1UZHA 3MM5B 1TL7B 3K58A 1CULB 3P5BP 1Q7YT 1RWPB 2MHEA 4V19X 2RF2B 5B0GA 3CCRS 1GK8A 4ZJLA 3ETOA 1S6PB 3DOMA 2MZTA 1QLNA 2ZHAA 1U24A 4IRCA 3UFCX 1KVKA 4TYBA 2W2PP 4DUZJ 3EICA 1JKHA 4M63A 1JIHA 3OTOJ 4ZOSA 2KFNA 1KOHA 3BGOP 3QAUA 1R8HA 1XBWA 4KGZB 2OPQA 2CQGA 4F36A 5B09A 5IWAF 4LFCJ 2VJUA 5CD4A 1BWVA 2Y1LB 5I42B 2B6AB 4I6AA 5HP1B 3IR5B 1IXKA 1TUVA 5IZHA 1Q5VA 3P96A 4HT7A 4ZHRB 3J81j 2ZZNA 3QZ8A 2CQHA 4OL8A 3GYNA 4ZVQB 4WIIA 3M9NB 3NCPA 4RNOA 2AJFE 2IJFA 2LYVA 1HI1A 3MUTP 1GXTA 3VWSA 1V5IB 3C15A 2RNEA 1YBTA 4PEOA 1VIOA 3MPUB 3MPVA 2IVYA 3M1VA 1RWXB 2OH2A 3C2PA 1U1LA 3IS9B 1SQEA 1YK9A 3LAMA 4P7VA 4URQU 4UY85 1EJ7L 1SUQB 2MTLA 2I38A 3MEEA 3M8RA 2KXFA 1RYSA 2IMWP 2XGPA 4IUFA 1JB0C 1T8EA 2R7OA 3PDNA 1VQ8S 4CO2A 2WVEA 4JV5F 2ZH9A 3DYAB 1NKEA 2BE2B 1XMQF 3WBZA 4UT4A 5LL6d 4NOHA 2VG6A 5E3RA 4DI6A 5A2QY 2C2DA 1JX4A 2F4VF 3SQGA 5AE1A 4PQUA 4DR7F 4LF1A 5HBMB 3RBEA 4B3MF 4IQXA 2AF6A 3M8WA 2PE8A 2FY1A 5GVQA 5GAGU 2HGLA 3P45B 3EPGA 3GMGA 2YQ3A 5E7OB 4AL6A 4LFBJ 1N5YA 3FVYA 1H3DA 4LSNB 1OPIA 3ZXWA 2YH0A 4QWCA 4YFUA 4R25A 4LR8A 5FLXU 1HBOA 2HGMA 1KWMA 3RBDA 1S72S 1Q8LA 3DLGA 2A6OA 4ZPCA 4EI2A 3M32A 5ETRA 2GMJA 2XZTB 4KE5A 3HKWA 2AYBA 3HDSA 1UWBB 2FVCA 4V1Ak 3F44A 4DV4J 2BM0A 1LFPA 2DRBA 2NUUG 1BQMB 1B70B 3TA1A 4ED6A 1SC4B 2DEIA 3TX8A 3JXOA 3K8VA 2FGCA 5KT3A 4DWIA 1QAIA 3KJVA 3T1YJ 2FPHX 4C8MA 4B02A 5B0DA 2R3VA 4B9NA 4G1QB 5HMXA 3UCZP 4LRBA 4LQ9A 3DOKB 2DKOB 1VQ4S 1RU1A 3FDSA 4EMDA 2QFIA 4HEA9 2W9CA 3G71S 1BMQB 2RKIB 2H4YB 1Y9OA 3IM8A 1U1NA 2WONA 2VPXB 4N47A 4LF9J 4ERDA 4X65J 1MU2A 3S01A 4B08A 2QL9B 4KH1B 2CQ1A 2K1RA 4OHYA 1L5UA 4M5JA 2HZAA 3KYLA 4F8RA 4OI4A 2BZ2A 2C2OB 4QIGA 2R2TA 2WB1D 3OTCA 3K2YA 4OJ3A 1GTHA 2V2ZA 3ILLA 2IAJB 3MD3A 3N6LA 2HNYB 3EWGA 5KG5A 4TU8A 1DURA 1QUVA 2RDDA 2B4OA 1VMBA 1XIQA 2LCWA 5HQMA 3M8QB 4CT9A 2GQ2A 1GT8A 1F5CA 2F5GA 4ICLA 4P72A 3W7BA 3DRSB 3DLKA 2OEKA 4JB8B 4DV6F 3TAPA 2OTLS 1QAYA 4F50A 1VS3A 3S6EA 3H90A 3CDBA 1V3ZA 4GO7X 1AXQA 4IG3A 3HT3A 3N0VA 1D9DA 3PRBA 2VU5A 2UVWA 1HWIA 5CABA 4X4UA 3A8IA 3IO1A 3K17A 2EWHA 4K4TA 3QJJA 4XPEA 4WFNQ 4OZLA 1HPZA 1DY3A 1FDAA 1R31A 3GIRA 1HNZJ 2LMIA 1WC3A 3BSCA 2DO4A 5BYQA 5KFOA 5D77A 4UZBA 1JK9B 1S4FA 4E8UA 2OSRA 4FF3A 2L08A 2RB7A 5L1JA 4KAIA 3R5AA 4I7FA 3OL6A 4M5HA 1RTZA 2HPUA 2HFZA 2ZKTA 3A4TA 3NKYA 1UMJA 3RGIA 3HHLC 4TU7A 1XR5A 1K0VA 2ROPA 1S9GA 1X5OA 2VFTA 2OPPA 3BYPA 5T41A 2NQPA 2GVDA 1FDNA 1RBLA 2LDYA 4LFCF 2N3OA 1XN9A 2J9EA 2XWXA 3K5PA 1TK5A 1VIXA 1RBOB 5E0OA 4ZKAA 2VOPA 4U6PA 4OYXA 4LF5J 1R43A 3FSYA 4PRFA 4DSEA 1RTHB 3QZ7A 1KDNA 1T7PA 2KJWA 4IOBA 1KFDA 2H1YA 1RTJA 3MGJA 3TUIC 3MM8A 3EVOA 3PO5A 3IR6B 2DRAA 3G6YA 1T0TV 1KVIA 3QIDA 2K7KA 3W1YC 1RABB 3W9HA 2KG1A 3BO2A 1UVNA 4DR6F 4Y3CA 1M1KT 1JXEA 1UVLA 2BJ3A 4ZCIA 4Q43A 1CG2A 2YNHA 2A1BA 2DH8A 3N5FA 2ZC3A 4DPWA 2KDOA 1N6QB 3PKMA 4QPTA 2O3DA 4J9PA 3RAXA 3V81B 1JXLA 2BDPA 4HTJA 2JEGA 3LALA 2Z56B 3W65A 2PEHA 4U7CA 1SJ1A 3CE8A 2DEJA 2HWIA 4L6V3 2JOQA 5G4DA 3D9BA 1RHMB 1TL5A 3O6QA 3K5OA 1TP7A 1RWKB 3TA0A 2GVDB 4LBHA 3T1AA 1DAXA 4K0KF 4N8NA 4ECQA 2HHPA 1QE1A 4F0KA 1I6JA 4FXVA 4S0MA 3LW5C 2Q43A 3AD9C 3NS7B 4NASA 5E3PA 1AFIA 2M8HA 1RB0A 3GTYX 1CVJA 4U96A 2VICA 3PO4A 1RT1A 1CSJA 3O1LA 4DMZA 3NL0A 1YSJA 3VAKA 1QY7A 2YWGA 4DOZA 3GJRB 1R3NA 2FJDB 1ZH5A 4DR6J 4DQIA 4PWDB 1IJEB 1HKAA 2JX2A 2MZJA 4BHQA 3GJTB 2IRXA 3HD1A 5HVFA 4CLLA 4RW7A 5KFFA 3J81U 2RRAA 2I2YA 1CQNA 1Y0HA 5DS7A 4TU9A 1LKZA 3BR8A 1ZTTA 1J5OB 1M5VC 5C24A 3GQCA 2QA4G 4W90B 1FD8A 4USWA 1C1CB 2ROGA 4ZPWR 1WKKA 4M5KA 4NLPA 4DR2F 2B7BB 1J5EF 3H5XA 3K8WA 4NCGB 5HATA 2R9LA 4KHPJ 2A3JA 1TV6A 4KSEB 4DG1B 1VQ6S 2J6SA 5ADZA 1WTBA 2JFKA 2OKQA 2UVRA 4ETXA 2ZZTA 3NP5A 1K1QA 5HMWA 3D2WA 3BQ0A 3PW5A 2B56A 1F5AA 3P3DA 4KHMA 5DQHA 2A2DA 2RVJA 2E9TA 3AJDA 3BKFA 3RR8A 1LXNA 5SUHA 1VRUA 1NO8A 2NSCA 3D1HA 2AKWB 2RQ4A 1BQXA 3PKYA 2QEXS 4DR5J 3TW0A 5KFWA 3JSMA 4HDHA 5F8NA 1LW2A 3L7UA 2IMOA 4LR9A 2W9CB 4ILRA 2VH7A 3J80U 3MCMA 4K50A 1X9SA 2VDHA 2UUAJ 2FLPA 2M52A 4FYVB 3KK2A 3BGLA 6FDRA 2POKA 3PX6A 1GMWA 3R7BB 3FQLA 1S7IA 2OIHA 3VGUA 3D67A 1D9AA 1KP6A 1Y5LB 2AW0A 4WKRA 5KFHA 2FLOA 4CWBA 5ETSA 1HBUB 1RTDA 4OX9F 3UD4P 1R6YA 2W7AA 3T5LA 1HHTP 5KG3A 2DY9A 3EJMA 3EDRB 3IG1B 4NI2A 1LWFA 1RT2B 2DR6A 2QGFB 4NLVA 2DH7A 3TO8A 1SUQA 2IFXA 4M94A 1NNDA 2UXDF 4C4WA 2XYGB 4MFBB 5D4LA 3SBMA 2DRDA 4DDFA 2W9BB 2FZGB 1NPRA 2NXJA 2RHSB 4UQGA 2E5GA 3KK3A 2UU9J 3UNYA 4IH7A 2VPWB 1RHKB 3RJMB 2BJEA 3Q8YA 4BCAA 5KTQA 2J5AA 2R7TA 3TANA 3O44A 2YX4A 3BBFA 3JAMY 4I6WA 3KK2B 1SC1B 2BVZA 2PT0A 1TUWA 2ZBPA 5BJRA 4DSFA 2FD2A 3Q2TC 5A8WA 4I6YA 3VZHA 3G9CA 3G82B 4DFKA 3OV7A 1URNA 3J7Z5 4EYHB 1KONA 1NB2A 1O51A 2X7IA 4YDDB 1H38A 1UAWA 2M8DB 1T02A 2BRLA 2LXIA 3PJWA 2MQ8A 2HLUA 4WU3A 4USMA 3LWMA 4KKOB 4DL6A 1S76D 3KK3B 3DLEA 1OY6A 4YP3A 1CJUB 4IRKA 1CQMA 2OPRB 3LQVA 4B9VA 4HH1A 4ZIVA 4UF4A 4Z37A 4ELVA 4F2SA 3ZZPA 4DV7J 4LF8F 4N8OA 1JJHA 2MQLA 1HWJA 3A12A 6FD1A 4R8UA 3WIVA 3AB4B 3M30B 2J76E 2VODA 3ZZUA 2JSXA 1O0PA 1MWZA 2DITA 2YKNA 4YB6A 4DL3A 2ALYB 4NXMJ 3LA0A 2OHDA 2VHGA 3RTVA 1S1WA 2EPIA 1IBKF 5CYMA 4IFVA 3ZZTA 3NNAA 3H5SA 4ED2A 4ZVTB 1X4DA 1J5OA 3EVMA 1SIZA 4FS1A 1WG5A 2CJYB 1AFJA 2H54B 3DDNA 2KKHA 4NA2A 1FNMA 3BGUA 5EHHA 3EYZA 3MM6B 2FJWA 4QU7A 2KTQA 2VQEJ 4X62J 1WTFA 2V69A 2VDIA 5A6WA 2E5LF 2ZNYA 1RP5A 2KT2A 3I82A 2MLZA 3J7YU 3V81A 1XMOJ 1RTIA 2QE5A 2X1AA 5D8HB 3BH7B 3SFGA 1VQOS 3M7VA 3BKTA 3Q8RB 1AA1B 5C7PA 4X64J 1W26A 3OQ2A 3AA9A 1OIAA 1TKTB 4C0OC 1W25A 3JQMA 1SKSA 1S6PA 3DOMB 4ED0A 2R7VA 3QGHA 4LQ3A 2HIQA 3EZ5A 2ZH6A 5DGBA 4J9MA 3V6JA 5HROA 4Q2MA 1SJFA 2CQDA 3PX4A 1Q79A 2FYXA 2YKNB 2UV8A 2W7PA 3SSSA 1YJRA 1YQHA 1NSPA 3I87A 2AX0A 1KQFB 3DLJA 2ZE2B 3B54A 4LBPA 5C5JA 3R5GA 2Q6CA 4OX9J 1FRIA 1HL6A 1CS4B 2EFQA 2HS0A 4MKAA 5IM0A 1AUDA 4RWXA 1YRTA 2L9WA 2KM8B 1UKUA 3M8PB 4OJ1A 1WI8A 3DLEB 2HVIA 4GVLA 2RJZA 3KFWX 1Q4RA 2FGOA 2NYIA 4OV6A 1HIYA 4ILLA 2P5VA 1VOMA 5KFYA 4DR3J 3HHNB 3AY0A 2MZQA 5IQQA 4LUBA 2Y8YA 4C0HA 2VG7B 2VASA 1VK8A 2K1RB 4P10A 4QYRA 3T19A 3T9NA 2DGVA 3M2VA 2CJXB 2Y3YA 1HW8A 3C14A 4RPFA 4RO0A 3JAMU 3EPIA 2DNPA 3V4MA 3SDEB 4X66J 2K2PA 4F0HA 3TI0A 2JHEA 4MMOA 4MKVA 1UEKA 4Q45A 1YJWS 1F9HA 5KT2A 3CJQA 2C2MB 1FKAF 1N5VA 4LF6J 4FF2A 1OYDA 3TZWA 1VQSA 2XNRA 3LP0A 3N5BA 2XSJB 2QMUB 2BEFA 3FKBA 3JQKA 2QYGA 2FHJA 3NGSA 4W4MA 3G8TA 1VRUB 3CCES 3OR2A 1VQYA 2L3MA 4Y00A 1WELA 4O3NA 4PYDA 3HXMA 1IR1A 1AW0A 1DLOB 3TJ8A 1TFWA 2VIHA 3R5BA 2DGUA 2ZH8A 3ET6A 3D1OA 4DCJB 1LOUA 2N82B 2J8AA 1XMOF 3NBPB 2ABYA 2XMJA 1BQNA 5F8IA 2DPJA 3RB4A 5HVGA 2MQPA 1PYOB 1UJ4A 4O3OA 4ZLJA 2D3UA 1X9WA 2MQMA 1DBDA 3QT6A 2PFFB 3CCQS 2DISA 2DTJA 4RW4B 1WOOA 5J1PA 1DFDA 3V5RA 1N5TA 1FTRA 2KN4A 3C6TA 5KG7A 3PACA 4FKXA 2VL1A 4HLBA 1WNEA 3U1MA 2CQ4A 3O2IA 3GV8B 1SJQA 3OLAA 1N52B 2VG6B 2C1EB 4PQUB 2AEJA 3V4IA 1TKDA 4NXNJ 5FLXY 1MSWD 3BPDA 2E1CA 1IBCB 3BN4A 1F9EB 1C2PA 4KGMA 4QWDA 5ETQA 1RU2A 3OJUA 2MZ1A 5DLGA 2DXEA 1YRUA 2Z0GA 1RLCL 4C3MA 5DDPC 4ZK7M 1UP1A 1PGZA 1N48A 1XEZA 4KBIA 1RHQB 1UJ5A 2GMLA 1FHTA 1S48A 2GGPB 1QTMA 2VFVA 5DZ6A 4ANCA 5A2QU 3QSYB 1VQMS 2FJBB 3I0RB 3KK1A 3CUNA 5M2UA 4UOHA 3EGZA 1QD1A 1HR0J 2R7SA 2XTJP 2ZH2A 3HHLA 3SYZA 3X1LB 2OTJS 2JVOA 3DLKB 5HSPA 1JMTA 1BHNA 1HNIA 1CJKB 1C0TB 1REVB 2B8QA 3I56S 5DGAA 2MKKA 2EBGA 3DOLB 3HLUA 1K8AT 3OFHA 4DQQA 2DNYA 3T1HF 1KVJA 5G0RB 5AXLA 4YN3B 2XG8A 3MM9B 1K9MT 2KZMA 5K14B 4FXDA 4PG5A 2WOMA 4NZ0A 1Q78A 4L75A 4P2SA 3H5YA 2DNZA 5DLFA 4DSJA 3C66A 1TL4A 4ED4A 4LF5F 1YI2S 2K8GA 2RDJA 1RACB 1F9FA 2CQCA 3P5TL 4UY8T 3MXHP 1GX5A 2QL5B 3OVSA 3LTOA 1RK8A 1CJTB 1HBNB 2AD9A 4EO8A 3L7PA 3Q89A 4FS2A 3CCJS 2BANB 3PJXA 3MM6A 4OHZA 2H5JB 3AJ2A 3D3BJ 2HVDA 2ZJRQ 5HLFA 4KYZA 2LKZA 5A76A 1OMSA 3CJ0A 1I1GA 1JLGA 4TQRA 3MEKA 4X4QA 3TUJC 2C3PA 3K5NA 1HBMB 3K59A 2M5YA 1H98A 2C3UA 3OVAA 2KYZA 3JB9k 1B99A 1KKHA 2CUYA 2QX0A 2GQCA 4NEZA 3HFKA 5KFIA 5A8RB 3UD3P 2B9EA 1TFYA 3J7AN 3CMAS 4QWAA 2MKHA 4DPYA 2CPHA 2AJ0A 3OBIA 4QCLA 4FNHA 1O8BA 3C14B 1R8CA 2B4PA 2GJ2A 3IMQJ 5HANA 2WBRA 4DN0A 7FD1A 2O01C 3PY8A 9RUBA 4NWBA 1WACA 2ZOMA 4BLGA 5DG8A 3CEDA 3SI8A 2HFVA 4CLFA 3N01A 3EGVA 3PNIA 2PMHA 3MM8B 2IBKA 2PI5A 5GAHI 2CNOB 4CLZA 3OFEA 2SXLA 4JV0A 4ECVA 1JJCB 2D9PA 3KHRA 1P6TA 3CULA 4H4KA 5A6PA 1YRXA 3EXYA 4X4RA 2HQIA 5JVHQ 2XYPB 5KFVA 4DR3F 2GO9A 2HBYB 3DRRB 4DR2J 3MD1A 2BM1A 3O5TB 4RJVA 3TQEA 3G4SS 4URGA 3T1HJ 3PXGa 3H8YA 4B3OB 2UXDJ 3SSQA 1ZBTA 5KG1A 3DFEA 5HQ8A 2YH1A 1DHMA 2V2KA 3HVWA 1SJ4P 3KMQA 1PJ7A 3NAIA 1TVRB 3ENVA 3GJQB 3DYAA 1FWPA 4J9UE 3G87A 4P74A 3N6NA 4AE5A 1KD1T 4C8LA 3KLFB 1AUSL 1VQPS 2V5HG 4TY9A 4X4TA 4YHHF 2VOOA 3QRPA 2JC0A 3UDLA 4HL9A 1YZ6A 2W4CA 3C16A 4KGKA 4RW9A 1JJ4A 1KFSA 5I3UB 5JVGQ 4DUYF 4X84A 4USIA 5AXNA 5T14A 3R1LA 4ANDA 3KTQA 4A47A 3P49B 1C1BA 1TL1B 4Q0BB 1BUXA 4OYBA 2F3JA 4J37A 2DR9A 2BYCA 3PCOB 2QMXA 1RT5A 3UR3C 3K89A 5DQGA 2AGQA 1YITS 3BM7A 4ED3A 3ZZ0A 1X4FA 4DL5A 2JDJA 4ZPAA 3VAGA 1LK7A 2I6WA 3OFFA 2QFJA 2E7VA 4IG0A 3KHLA 1Q7LB 4WFZA 1QVFR 2YTCA 3RG6A 2F63A 3VCDA 1C4CA 2MKCA 1OS5A 4EWTA 1FVQA 4USTA 3HFVA 2JJ4D 2FHJD 4DV1F 3BKUA 3M2RA 4C2MA 4P75A 4ZLNA 4O0IA 2AX1A 2XMMA 1XC9A 5KFLA 2DNQA 4HR2A 2ZHOA 3DLGB 2FHMA 4RNHA 4MK9A 2EC2A 3P8BB 1P27B 1R0BG 4WTYA 4AXIA 5L9XA 2D69A 3IRXA 5EWFA 1RAHB 2Q6BA 2ZITA 3UVJA 3HZEA 1IBLJ 2HHUA 2XNQA 4JI8F 2EFVA 1QSSA 3A3NB 3C6UA 3DRYA 4ECSA 5L9NA 1NDLA 2KXHA 4PG7A 1PIEA 1Y7PA 3B78A 3WQPA 4FVCA 4WK3A 2KVIA 4JI7J 1MROA 3BR9A 3MUMP 4L3NA 5J2NB 1YJTA 2Z2MA 1WKLA 1S1VA 2GHVC 3MPYA 3HT0A 1NXIA 4FPIA 4P6QA 2MGZA 4J9RA 4O3RA 1B0TA 4OZ2A 3LPYA 3HZGA 2KRBA 3SIPB 2PEBA 4FXWA 3SMZA 5KFZA 1O5JA 5CYJA 4GVBB 4LSZB 4JI4F 2FY8A 1IQZA 1JLEA 4MYTA 4ZPTR 1NMEB 2YQ0A 3WX4A 1WC6A 4F0MA 5SZTA 1S1TB 3TUZC 3ENAA 4KRWA 2CVIA 4MFBA 2JLEA 1S59A 5D4NA 3NLCA 5KFQA 2FZCB 1Q86T 2P8IA 1M5KC 1JXVA 1ZAWA 1LWFB 1RT2A 2DGWA 4DR4F 2R42A 4L76A 3HJFA 1QE1B 2B7CB 3LO3A 2DK2A 2MZRA 2NXUA 4UOFA 4RU9A 2MGZB 3OJSA 3K57A 3R5DA 4U67Q 2YWWA 1EKRA 3QIPB 4I68A 2RQMA 4UZCA 4B9UA 4XIUA 1GQEA 3LWLA 2UUCF 1GFWB 3FSXA 4ZVUB 1DQAA 4LRCA 2V4JA 3KLIA 4M5LA 4HI2A 3MM9A 4OZ3A 3R97A 4JI0F 1JLAB 1OQ6A 1E6YB 1BGXT 1F2HA 2XULA 3Q8UA 5A8WB 3CO0P 4AYBD 4EBCA 3IC1A 3R1HA 3OXLA 1EIYB 4EFAC 2LXUA 1M5HA 3W2VA 3HM9A 2XI2A 3GP9A 1FTCA 2G2OA 1F3VA 2BOAA 4O4GB 5F0WA 3ISNC 1FXRA 1TU0B 5ITHA 5GMDA 1JLEB 1LK5A 2CADA 5A0YA 2GGPA 3NG8A 2XY5A 2ATLA 4X65F 5KOWA 4DS4A 4B3SJ 2B9XA 1FJGF 1T94A 1ZOTA 3I5CA 3OTDA 4JOUA 5D0HA 3MECB 1RTHA 3A3PB 3WIUA 2BR0A 1AYEA 2VF3A 3GLJA 3QMQA 4DSLA 2HHSA 4Q44A 2WSCC 2XO6A 2ZC4A 3GFXA 1RADB 4LJMA 2ZWPA 2IJRA 5KFTA 3R3TA 4EBEA 2OELA 2ADBA 4C97A 3KUEA 4I64A 3AODA 5IC4B 2O5DA 4LSLA 1J2VA 2V0NA 4F4WA 3MMAB 4CIOA 3HVTA 4MH8A 2RUGA 4IO9Q 1XNQF 1B4SA 4EK2A 2UVVA 3B8HA 1VC0A 4C8YA 3OXFA 1EETA 1OY8A 2MQNA 1FFGB 3EUNA 3UN2A 3M8SA 2BANA 4ID5B 5CH7B 2QC3A 3VGTA 2VG5A 1RT6A 4DV2J 1CJTA 1HBNA 3D28A 3RB3A 1B7YB 1SJ3P 1K73T 2ZHBA 2ZH4A 2K3KA 2LVWA 4YOEA 2XMTA 2YNFB 2I5JB 3FUYA 2EFGA 4ID8A 1IR0A 3W64A 1NK6A 4NLXA 3SCJE 1WEYA 2KG0A 1FFSB 2FJEB 1LNQA 2HSEB 1PBUA 3US5A 5DDRC 1UA1A 4ZVEA 4C8OA 2HVHA 4M5GA 2EI5A 1VISA 2HNDB 1PG5B 3FBFA 3SCKE 5IV4A 3J7YI 1YDLA 2OD4A 2D3O1 3HK2A 1C0TA 1REVA 2HWHA 4UQTA 3PIPQ 4DV6J 3OR2B 1VLYA 3R2CJ 1IWGA 5LMUJ 1TL1A 2PI4A 2ZD1A 1XQIA 5BR8J 3MZIA 1T05A 3LOUA 5HROB 4JBCA 4OX6A 3HHEA 4QJVA 4OYPA 1CC8A 1YJ7A 4AXJA 2MHNA 3FNNA 4YB1P 3HX9A 3RRKA 2J0XA 1Q5YA 4O44B 4OI3A 2QLXA 2E7XA 4PXBA 3TZZA 1LV5A 1F5BA 1AT1B 3EZOA 1X4EA 3CVKA 3FBBA 3GWCA 2F9DA 5ETOA 1RAGB 2GJFA 2C2KB 5KT5A 4DV2F 2UUBF 3EVWA 2DCUB 1CC7A 2ASJA 2HEKA 2F4FA 1U0HA 5K8PA 1ZYQA 2V8GA 4KFBA 4OJHA 2CYYA 3U27A 1KQSR 5E41A 2OUGA 4RW6B 2W25A 2GC8A 3PEHA 3T6JA 2OO4A 4YR3A 1VK3A 1JJ2R 4M95A 3H59A 4E2FB 3KHGA 1SV5A 3IGNA 1JNRB 2RT3A 2ZH3A 1N34F 2XQCA 3CCMS 4RZRA 1UZDA 2ZH5A 1RT7A 3KUGA 1IKXA 1X4CA 1YBUA 2YWHA 2HG4A 3NGKA 5DDOC 4J91A 3H40A 3VALA 4Q8EA 4ZPVR 4GO5X 1PYTA 4HDGA 1G2EA 1QTNB 4XDCA 4BBYA 2J9DE 4LRFA 1NDKA 4OMFG 3RU0A 1HI0P 3DGPA 2N4CA 3KLEB 1YIJS 4JP8A 1R6VA 1SQGA 2MQQA 3PIOQ 4U7UD 3MAAA 3AAWB 3CJ2A 1LEOA 3ET6B 5HL7Q 5AT1B 5JJBA 2EK6A 2CJBA 4ELTA 2CPIA 3PX0A 3V2UC 4LF6F 4PUOB 3ILOA 3PEJA 3RBZA 5LJ3Y 4RKUC 5E3QA 3OTBA 1K1SA 2YWFA 1RWOB 2XM3A 3FSIA 2QLBB 4OZJA 4IFYB 2Y1IA 4K4ZA 1KNZA 4QYZJ 1ZA1B 1N8RT 2BJ8A 3TAQA 1X9MA 2VONA 3IA0A 1VQKS 4M5NA 4K59A 2B3TB 3LGMA 4RNMA 4K8RA 2V6AA 3OUYA 2CZVC 3A8KA 4M5MA 3TVYA 1X8DA 3GFYA 1YHQS 4DHVA 4DR1J 3HSDA 2MLYA 1CBKA 1HNVA 4KV8A 3NY0A 3ILJA 5M2PA 2E29A 3CD0A 3IBFB 2VKZG 3QGIA 3OL7A 4NYOA 1UWAA 2EXUA 2E1AA 3ZO7A 3CDUA 2QSFA 4WYWA 2IA0A 2R8IA 4TY8A 2XLJA 3UDVA 1UA0A 1R0AA 1IBKJ 1FA0A 2ACMA 1RWUA 4Y2AA 3BS9A 4NEYA 1T11A 2KT3A 2CNNB 2VFUA 4JI7F 4PUOA 4RBUA 5IC6B 3NRBA 3D6FB 2V8PA 5B0CA 1NHVA 5HJXA 2J9CA 5ETLA 2QV6A 5GADU 2F9JA 2PMZD 3H25A 2DR8A 2R2UA 4U8VA 2V2VA 5J2NA 4ECZA 4ATNA 3TRGA 1GTEA 1PCAA 2NR0A 3PW0A 1VJQA 2IRUA 1MN9A 1ZM4A 1EP4A 3LPEA 1RE1B 2DHSA 3H0PA 3MMCB 3PRVA 2HVEA 2YWKA 4OQJA 4P52A 5ETVA 3MDFA 4JI3F 2BW7A 1V3SA 1FRHA 1U26A 3GG0A 3S1TA 5C25A 2E5LJ 3BBBA 3R5CA 4A8QA 4GKJF 2YKQA 4I67A 2WTFA 3LAKA 2G0CA 3W61A 4DV5F 1NK8A 5JMNA 2DGQA 4BC9A 5B0BA 1KLNA 1YGYA 2Y9HA 5IS2A 3CWJA 3D54A 1KTVA 1RT4A 3VV2B 1JQGA 3L7OA 4DZ6A 4TQSA 3KMSA 3WHIA 4J9VA 5H9EK 1UW9A 1MWYA 2BBEA 1RCXB 2U1AA 3QAEA 3QO9A 1FJEB 2MJUA 3NMAA 1IKYB 4P2FA 1U6ZA 3D0IE 1WG4A 4NZ6A 4CNYA 3VAFA 3G96A 1CPZA 1M1GA 2NPIA 1LWCB 1VYAA 5C25B 3GYXB 4F04B 4NLGA 2GIQA 2YKPA 5CYMB 2LECA 5K20B 2ROEA 3CJ8A 3RAQA 3D6MB 3W60A 3M8YA 2EG1A 2P9CA 4F3MA 3RR7A 5GMEA 5T7LA 1MG7A 1U2FA 5HAOA 5KT4A 3CDWA 3PW7A 4CTAA 4GKJJ 1WI6A 2HLTA 5KFRA 3ISND 2IC3A 3DRXA 3GONA 4OHWA 1TUGB 4WP9A 3W2WB 5DM6Q 4JI1J 4WJBA 3K0JA 3AD8C 3MECA 5DDQC 1PILA 5C42B 4CZCA 5F8GA 1EAYC 2DGSA 1N5SA 1RHUB 4X66F 3BQ1A 2JEIA 5GAGI 1X4HA 1IKWA 2QRRA 3CPWR 2V9KA 1IKVA 2UXCJ 2QO3A 1ACMB 5KFCA 2JEJA 3N9UC 2KM8C 1SB6A 4IR1A 3W5XA 2J7KA 5J2PB 2CWKA 4FVMA 4IG0B 3AXKA 1HNXF 1T9WA 4NMXA 2HGNA 3TQ1A 2WW8A 3IBWA 4UOCA 1Q0NA 4A8KA 2OGUA 1U02A 2BKPA 3DRRA 4AFFA 3HP6A 3GIJA 1PYSB 3QLHA 2R8HA 4A4JA 1S97A 2ZDPA 3POTB 2FIUA 4JYAF 2JWNA 3HULA 3WDOA 3KLGB 4QZVB 3A8EA 2IIHA 4ZN3A 2W2MP 3TZXA 1N0UA 3MOZA 2HMIA 5DQIA 5J2MB 1N33F 4ZVRB 1IUJA 4Y65A 4NLQA 1RTIB 2H65B 4ZP8A 2Q1LA 3JYTB 1ZAXA 3NGUA 1NUEA 4ZVPB 4A8XA 4TNOA 5B08A 5CZXA 1GMVA 3SFUA 1MMNA 3H98A 2HHHF 3IG1A 4NI2B 2W4DA 3W62A 2PGCA 1N56A 2R7XA 5CYQB 4ZIWA 2ZNZA 3CJ3A 3VHQA 4YR2A 3HSGA 3ILIA 4HACB 4OZNA 4WFYA 4OI2A 4WZMA 2HRYA 1B0PA 3F0NA 3ZNJ1 1VBXA 4AL5A 4J9SA 2BX6A 4ZVHA 2EC0A 1WHYA 4TLRA 4CLTA 5EUHA 2XCPA 3M9MB 1QVGR 3OHBA 1DTQB 4HACA 2H5EA 4J7CA 4LF4J 1S1UA 4FYWB 1T9VA 1RTDB 4ZS6A 1SH0A 3NGRA 4F4ZA 3L9ZA 2H5IB 4LBIA 4NA3A 1LW2B 2IPOB 3VAMA 4DV1J 4LMZA 2YVSA 1TMMA 3D0GE 1VRQC 3MEGA 2WZ1A 5BXIA 1NKCA 2QA4S 3DXBA 3L3CA 1S9FA 4Z7YA 3MUVP 4RBTA 4X4NA 4B3RJ 3EGNA 1M90T 3FEZA 3D3CJ 3E01A 5L46A 1Z2ZA 5RUBA 1OWXA 4C8ZA 4HTIA 3OXGA 2ZVSA 2JZ5A 2ZWOA 1HW9A 1MWQA 3IM9A 2CKWA 1FEHA 3NAHA 4KGVB 4KGXB 4WXWA 3IXQA 2C2EA 3W2WA 1U1PA 3GPAA 3S8SA 3OTOF 1HR0F 2J8SA 1FX2A 4C0BA 1S1UB 4O44A 3D0HE 5E33A 4NL5A 5CZVA 1L3SA 2DHGA 2P6SA 1RJJA 2CPXA 1IM6A 2C3OA 3HHLB 4M1KA 4ZA1A 2VJVA 3IN5A 1BLUA 1H73A 3CB4A 4DL7A 4CH7A 4HVZA 2GHPA 1KQKA 2W9BA 4WWSA 1FESA 3GYGA 3TX0A 3UD5A 5JXSA 1APSA 4F4KA 4ES2A 3D6TB 1HWUA 3PYFA 4PPZA 1SV5B 1S79A 2YQ1A 1KLMA 1FK9A 1FXLA 4ZCMA 1T95A 3D5MA 4PABA 4W98A 1S0NA 1SKUB 5KFAA 1VQ7S 2HHHJ 1FE4A 3AHPA 3JTOA 4F25A 1FWLA 3UNGC 5IT9U 3KLHB 2VUGA 1U0HB 2HAIA 2HHQA 2Q3PA 2CJAA 3CJ4A 2YNIB 4CRJA 1T03B 5K14A 3I0SB 2GZOA 1WG1A 3THTA 2ZM6J 1Y11A 3AQOA 2L41A 1F0XA 2QT7A 4WFAQ 5EDWA 4QWEA 3A1YG 4K2XA 5KFJA 4F67A 3PZPA 2OP5A 3UN3A 2Y0BB 3EXCX 1T05B 3HJVA 3N4WA 2MKYA 4YDXA 2J0QD 1NAQA 4G1QA 4RWWA 4NLWA 1GX6A 2HBRB 4WE1B 2FZKB 5CXTA 3FRZA 1Y5NB 1UEUA 4NPOA 5EX3A 1B64A 2MZSA 2ZJQQ 1SH3A 1YVFA 2YWEA 1N6QA 3I55S 1D1UA 1D0EA 1ZM3A 2WRMA 4U9RA 1E6VA 3MMBB 3DMJA 1X5PA 2HIYA 5M2RA 1VQLS 3FBCA 3M2UA 2DIVA 4YB7A 2CAJA 2WSEC 3M9OB 3CIMA 3SSRA 5F8LA 3QT5A 1RBAA 3I6PA 3CF5Q 2G13A 3VAHA 2ZJPQ 1C0UB 3Q22A 1B7FA 4B17A 3NEKA 3MR6A 3HFZB 5L1KA 4EU0A 1X4GA 4Y2MA 1BWEA 1V5VA 4B9SA 1SIWB 3FGVA 2E5HA 3PRDA 2CPYA 3CCSS 1IKXB 1PAEX 3MFHA 1KR4A 3PJ9A 4FN5A 2FVQA 1V3RA 2EVZA 3GJSB 1TTHB 4RW4A 3IAS9 1QSLA 4N76A 1S77D 4J9QA 3MMAA 3QT7A 5B0FA 4LSLB 3MPWA 1WC5A 3QQCD 1LWEA 3GR0A 2MKJA 3DDKA 4DX5A 3PM9A 4ANEA 3KLGA 3B4DA 4IH5A 5D0EA 1BD6A 4ZMMA 1S0MA 2QJ3A 4F2RA 4ECWA 1DLOA 5D6GA 1FDDA 2F4VJ 2HRUA 3FFIB 1H6KX 1HPZB 1HWKA 4TKTA 3G6XA 3UCUP 3KLEA 2DHAA 1NJXA 4PG8A 3KG1A 4NCGA 1ZETA 2KHCA 4WCEQ 1OSCA 2N3LA 5J2MA 2GCFA 4C8KA 2HZVA 4K4WA 2KJVA 5EX0A 5IQ6A 4NLSA 1RA7A 2OJ3A 3SDEA 2Z4PA 2NREA 1NPKA 1NDPA 1QM9A 4XDDA 3M8QA 4UW2A 1NHUA 3FRYA 4ZVOB 1P9YA 5ETNA 3W8PA 3M2VB 3HD2A 4I56A 2HNYA 3F73A 5HP1A 4RUAA 2HQFA 5ETKA 3KNAA 1PJ6A 2BJ9A 3LANA 4JI8J 3HSJA 4L72B 2Z58B 2CQIA 1RT1B 1NJWA 1UW4A 2CJ9A 1VQNS 1JWWA 2OPSB 3H4DA 2XMVA 3HI9A 3J7A1 2F65A 2I8EA 2NS1B 1HNVB 2AEFA 1G6BA 2D1CA 2KVQE 2GV1A 3MURP 3CSKA 1HYSB 1EETB 2WONB 4CLKA 3KG0A 5L38A 3DDIA 5KFMA 4Q8FA 3CJSA 1UVMA 3OT9A 5I3PA 4DLGA 1RKJA 3GV7B 2XS7A 3LP2B 2H3EB 3DOKA 1TR0A 5THWA 2B0GA 4Q5VA 2ZBQA 1ELOA 4HT5A 5LSOA 3G6ES 2O1PA 4I7FB 3DGVA 4K4SA 3PTWA 3RRHA 3THVA 1EQ0A 3NWRA 3I9V9 2BJ7A 3HPOA 3G86A 1JLCA 1OY9A 4FNIA 5A8KB 4JI4J 1S6QB 1TKXA 2LEPA 3H4BA 1M5PC 2XS5A 2UXBF 2ZUAA 1TKTA 4ZCKA 4NLTA 2RHQB 1WHVA 1ZA2B 3ETMA 3MAAB 2UUBJ 2L9NA 1WKJA 4DFPA 1R8BA 2FLLA 1IQTA 1GMWD 3DM2B 1N34J 2PSZA 1RTJB 2PIIA 4L3KA 3M6UA 3BSNA 5B0EA 2HHWA 3PW4A 2JL9A 4OJGA 1U1KA 5J2QB 2HMIB 2YKOA 1TELA 5D0RA 2AIRB 1CLFA 4ICLB 1PC4A 4C3KA 5KT7A 2PA8D 4CLPA 5L39A 1SC6A 4O3PA 2CFXA 1P9QC 1IBMJ 3BSOA 3RAMA 4C3LA 1I3OB 4DV0F 3KKFA 5FIIA 3NXZA 3GV5B 1KRPA 2JLFA 4LF8J 1V9OA 4KJIA 1VFJA 5J2QA 3KLIB 3LGNA 1HNZF 4MK8A 5FJ4A 4H54A 1SQFA 4A8WA 4P2MA 4NX9A 4GMKA 1RT3A 2YNFA 4IRDA 1LW0A 5DM7Q 4I2PB 5EWGA 2UU9F 3KDNA 2HBQB 3C8YA 5LMUF 2IY5B 3KWMA 1FX4A 4PR6A 4F4AA 3PFOA 2OMLA 2RKIA 4X2BA 4G1PA 3SCIE 3TNVA 4NLDA 1Y00A 2BA9A 2HQDA 2LQBA 2V34A 5AXKA 2G4BA 1FRKA 1DJ0A 3CCTA 9ATCB 2ZD1B 1Q8BA 2YKMA 3R6GB 5ETTA 5F9NA 1RCOB 4JV5J 2QG9B 3NOGA 2MPUA 5HO4A 2HNZB 2ILZA 3R7NB 2K06A 5D15A 4FBUA 1XR7A 1HLWA 2RAQA 3OL8A 2B4VA 3D66A 3R7SB 1R7IA 1WORA 4ES3A 4ZHRA 1LW0B 3MOJB 2DXDA 3FCHA 2ZDOA 3MAQA 1EARA 1RT3B 2IM3A 2D9OA 4NLYA 4O23A 5AJ3F 2Z8QA 3Q8QB 1B0VA 5J2PA 1UWBA 3F56A 4DZDA 4IOAQ 5H9FK 2KH9A 2G1DA 2KB2A 3T5JA 1GXUA 2OSQA 4A48A 4IFYA 2DR5A 4KO0A 5KFPA 3BV8A 2WW4A 2RQCA 1T03A 2OFHX 4ID5A 2FJVA 1S7HA 2FUG9 2QLWA 3MCOA 4IDKB 2FQQB 1YTYA 1AROP 2ZZMA 1FJ7A 4WU2A 1NDCA 3W8GA 4Y28C 4CO1A 3KHHA 2IYIA 3KJNB 2FVPA 1IJFB 4LVOP 1C4AA 3EZUA 3U1LA 5HMYA 1RYRA 4OYWA 3NCRA 1JLAA 1WEZA 3TYTA 5K5MA 2E5IA 3MR7A 5MLCV 1UFWA 3DM2A 1SJRA 2CDRB 5HBMA 3GR1A 2XMAA 4JI2J 1T3NA 5D3GA 3CDAA 4R0JA 1FKPA 4CM2A 4B3SF 1FJGJ 1U8SA 1WC1A 3UN5A 2CWXA 2GVZB 2ZBIA 4LR7A 2V8HA 4H4KC 2LQJA 2DBBA 3CD6S 2Y0SD 2GIFA 2G9OA 2HVZA 1GMUA 4MK7A 2YPYA 4CP5A 3RYLA 2RIJA 3IBCB 1DRZA 3JTPA 2L9DA 4BWJA 3GU0A 1H7WA 4YQWA 4CLWA 3LF0A 4KB7A 2ZFHA 1MMLA 4WK1A 2NCKL 2YNGA 3CJTA 3UR0A 3P6YC 1OQ3A 3M1VB 1TK8A 5L1LA 2PDAA 1JLFA 2OEMA 4ZPBA 2CA9A 3UWTA 4NYZA 4OV1A 2E66A 2OPRA 3GSIA 4IDKA 1UL3A 5KOXA 1URRA 2R4FA 5CA5A 4H4OA 4OFZA 1QSYA 3G8SA 1OSDA 3L09A 1N32J 1X5SA 4Q2LA 2XGQA 3DHXA 4OZ0A 1FXDA 5KFXA 1H2UX 3IFEA 3TJ9A 1SKRA 3GIMA 1RWWB 4WXOA 2WOMB 1N88A 2HFUA 1NK5A 3GFHA 1KQGB 4J90A 5IXUA 3BQ2A 1IKVB 3X3UA 4N41A 1WOPA 1CJVB 3CCZA 4ED1A 2DNLA 2N7CA 2CPJA 3B6BA 5EWEA 4QIWD 3DLHA 4X4VA 1JLBA 1N33J 2XWYA 2VBWA 2AZ1A 4OX7A 4ZPDA 2Z57B 3AFGA 4DU7A 3QRQA 1U0SA 4FPRA 1FKOA 2KFZA 2CIMA 4PWDA 3OVBA 4J9NA 1K47A 2VA3A 3ICLA 1BQNB 4ZVGA 5C2GA 3KNGA 5F9LA 2LLZA 2LQ5A 2A2CA 1YJ9S 5T7LB 1Q16B 2ADCA 2P2CB 4DQPA 3C15B 1MNEA 2LEAA 1K44A 3EDQB 4PPDA 3ZFVA 5C2CA 4YUDA 1KEKA 1UVKA 1MN7A 1XJWB 4C98A 3E3XA 3E2EA 1JLCB 1RSCA 3QT8A 4LFAJ 2DNGA 2C28A 2B6AA 3V6DA 2ILYA 4DSIA 5AJ3J 2JFDA 1N36J 2WCXA 4A46A 3IAM9 5F3ZA 2GW8A 1EHWA 4TXSA 2GJIA 2XSJA 4OI1A 4KPCA 5D3GB 4DX6A 4DR4J 2EFOA 3A13A 1ZM2A 2N4DA 1FEEA 2DNMA 3E51A 1XNQJ 5KFDA 2VZ9A 4F7VA 4DFJA 2XMWA 3BGRB 4HI1A 3TA2A 2AJ4A 3MWBA 2NLWA 3TWZA 2KU7A 2XS2A 1NBEB 1ICEB 2Y1RI 3HHLD 2BOPA 1UFKA 7AT1B 3KLFA 4ZN1A 3ZC4A 4DUYJ 2DPIA 5DO2A 5KFGA 2IDEA 1O6XA 1J27A 1NZAA 3FJ2A 4USHA 5CCLA 4QIFA 4RW8B 5DETA 1RA6A 3MFIA 1HARA 3FC9A 4OIXA 2BABA 4MIWA 4AQYJ 2QYCA 5E5NA 1X60A 5J1EB 4B3OA 3NS5A 2LA4A 4CO0A 3MPDA 5F8JA 3QJLA 1T9YA 2COLA 2Q66A 1B3TA 4D3HA 3PR4A 3VR1A 3ULHA 3BJYA 1YJVA 2OI2A 3H7HB 4MKYA 2XCAA 1XWLA 3AH6A 1SXLA 2LDIA 1RT5B 1I94J 4V19J 3HO1A 4JI5F 3CJKA 5KFUA 3ZZOA 4DV5J 1ITPA 4DEZA 2V4JB 3FEYB 1Y5IB 2MY8A 4MYUA 3MR2A 2O66A 2E9RX 2CG4A 7FDRA 1MLAA 5I4MA 1RAFB 4B9LA 1WSVA 2LP4A 5FDLB 3KLVA 3QIPA 2M2BA 2HK3A 4NZ7A 2WB4A 3FFIA 3BO4A 3BEGB 4C6AA 2AU0A 1TAUA 4IO1A 4JI5J 2R8JA 4MJKA 4UTGA 1NZ8A 4QWBA 3H2LA 1GEHA 4BC7A 2M88A 2VPYB 3RUBL 2E44A 2QL7B 3HSZA 4K2JA 4XTTA 5K8MA 4YHHJ 4I0WA 2DR7A 4WBFA 3AOAA 1WF2A 4PXDA 2YNGB 5CQGA 1LWXA 4RL1A 2C3YA 3M8PA 4GVBA 4QU6A 5HQLA 2PN6A 2VBXA 4KHRA 1A6LA 5E3CA 4WFBQ 1ZZNA 1D9FA 5HN0A 3V6DB 4JI3J 3ITHB 2R2RA 1QJHA 2F1FA 1HNIB 2KFYA 1ZS6A 4LF7F 4BS2A 1G3OA 1S1WB 4D3GA 5KG0A 4DQRA 1A7GE 4FKYA 3PW2A 4AUKA 1FKPB 1UJ6A 2V68A 4RUHA 2DH9A 3MEDB 4DX8H 3DGPB 2KO1A 3C3LA 4G1IA 2RS8A 1HI8A 3C6UB 3FZ2A 4M5DA 4DBQA 2M0GB 1W2IA 1RKIA 3DU6A 3W66A 4EUVA 3PFEA 1VC6A 1QAJA 5IT4A 1DTTA 3CD5A 2PO4A 2RUSA 5IV3A 2FVSA 3DMJB 1HWLA 2EEYA 3NNHA 1SC3B 2ZKUA 3LUYA 4H4MB 2IM2A 2ZOGA 1CJUA 2D7SA 2FLNA 3ITHA 2W8LA 4X4PA 1E6YA 2BJDA 2YXLA 5LSRA 2F8HA 3M4XA 5A8RA 2BKOA 2X1FA 3EMTA 3D7SB 3VZIA 4LF4F 1EX8A 3GFZA 4RW6A 1HBMA 3O3LA 3TEHB 4CO3A 1D8YA 3MF5A 1CEZA 3RB0A 4FBTA 3DRPA 3M6XA 5B0AA 3W5YA 1NK9A 5L8RC 2W2NP 3HCXA 1NSAA 4IFVB 4L73A 1VHFA 4LRAA 4GC7A 4A8YA 2VG7A 3E8OA 3CT9A 4ED5A 1YJUA 4N56A 1YZ7A 3DLLQ 1C1BB 2YBVA 3M30A 4OYOA 6AT1B 1UPPA 4X4OA 3MEDA 1FF2A 3V4IB 4OYIA 3T6BA 3VF0B 3OSNA 1HBOB 1A9NB 4P73A 4QR2A 1QUPA 3EGWB 4N7TA 4LSNA 3Q0AA 4OYMA 1RHRB 2C2NA 3NWGA 4ILMA 1PBAA 3JYTA 3IWLA 1FDBA 2MY7A 4KKOA 2GVZA 2AGOA 4NE9C 4PCQA 3UDCA 5J1EA 1P8GA 1LFWA 2D3ZA 2Q79A 3CCWA 2VPZB 3OPKA 1U49A 4F4XA 4FF1A 5IWAJ 5CCMA 5BR8F 4JV1A 1U2RA 3UVJB 3MM7A 3Q86A 4HH0A 2HZCA 3NOCA 4DV3J 5CD4H 3I0SA 5K8OA 4J9LA 2XSFA 4RBVA 4A8MP 2DHHA 1S0OA 5H1SV 1U6BA 3AJ1A 2UVUA 1R0CB 1VHIA 2V4QA 2XO7A 4JI1F 1LWEB 3KJFB 1T3OA 4Q7AA 4ECYA 4CLYA 4DR1F 3BSAA 3MEGB 4DUTA 2AJ2A 1GNKA 4PG4A 1EZZB 2NZCA 4QR1A 4ALZA 4OHVA 1R8PA 4K7QA 1S9EA 3PHTA 2FJAB 1X31C 2RU9A 2F40A 3CCVS 2EKYA 3BB5A 4E98A 3CTRA 1DTQA 5LSLA 4OLPA 1NB7A 4DSKA 1XNRJ 1S6UA 2X51A 3RRGA 4MAKA 3IWNC 2MMYA 1HFEL 2IRYA 2VD3A 2BE7D 3ONQA 4YY3J 2DO0A 3LGHA 2UUWA 3RB6A 2G2ZA 1VCTA 2OEJA 3BBCA 4DXLA 1G7CB 4RLEA 1SL1A 2CDQA 4A8FA 5CYQA 3H20A 4QW8A 1BQMA 2B8PA 3B4MA 4JI6J 2XI3A 3OR1A 1Q82T 1N5QA 2K7JA 4JUZA 5KG4A 2N7YA 2MLXA 3KUHA 4LFAF 2OAUA 2VFSA 3IP0A 3GCWP 1AZSA 4KO0B 2ZE2A 2BJ1A 4ZP9A 1KTQA 3TAMB 3TUPA 2E1MC 3OW2R 1NLKL 5U47A 1WWHA 4K0KJ 4NCAA 2QSWA 2XZWA 5H9FJ 3VGSA 1UPMB 3NS6A 3CC4S 2JEFA 4C9DA 1NH8A 2CG8A 1ZPWX 3ELHA 3G82A 3QLHB 2NXCA 5G0RA 4ZVFA 3AD7C 4I4BA 2X3GA 1NK7A 4JI0J 2I0XA 4M5IA 1VBYA 4F3OA 2G0IA 3D1QA 8RUCA 1Y4ZB 4B9TA 2V63A 1VGYA 4FDFA 3VAIA 5K8NA 3GIIA 1EP4B 3NGDA 2DNOA 4DV3F 2KHDA 4WYLA 1S1TA 2RQKA 2BV3A 2H48B 4U8YA 1VBZA 1WF1A 1WD6A 4B3MJ 4XK8C 1M5OC 3GG1A 3MTJA 3J81Y 2YNHB 2KZZA 2QMWA 5LXYA 1UVIA 1T9TA 2A18A 1KS2A 4B3RF 3I5AA 2J7UA 2HFOA 2GAGC 4I2PA 1UEVA 4NLUA 3JSYA 4JI2F 1FERA 4I1TA 1HQ2A 2CXEA 2RMLA 3ISZA 2CNKB 4CI0B 2BE9B 3B82A 3TJAA 2WVDA 1FNOA 2GA7A 4DS5A 1YG0A 4PWUA 4DU8A 1IR2A 5BYRA 3MR3A 1GXLA 4KV8B 2OFGX 3ENQA 1KN6A 2WAQD 3OD2A 4K4YA 4CLUA 2V67A 3DN9A 4X4SA 1FD2A 3M6WA 4PZVA 3WX8A 3ZZRA 4DPXA 3HHKA 1OYEA 3CW2C 3R9LA 4ECTA 2M9KA 1DTTB 1P1LA 2OPQB 4NRTA 5I3QA 1Q1KA 3UDEA 1W2BR 2WBMA 3VQTA 2W4PA 5HMZA 3HHDA 4ZP7A 3W9IA 3G8QA 3FCVA 4NLRA 1HNXJ 1NJZA 4KPYA 1SVDA 3CO9A 3BREA 4TN2A 4O0NA 4BWMA 1RAEB 3OR1B 3CCUS 2NZ4A 2P9GA 4EO6A 2EW9A 1VRTA 5DJBA 1X0PA 2CRLA 3HVAA 3MM7B 4DPOA 4LVNP 4DCOB 2ASLA 4ZJQA 1RAOA 1SKWA 2B9WA 4MIAA 1FRJA 1D8ZA 1S49A 5ETPA 4GRSA 1NK0A 1FE0A 3LP0B 2C3MA 4Q0BA 2GX8A 3DHWC 1RI7A 2Z30B 3CMES 1JLGB 1YBAA 2JVRA 5GAHU 3AB2B 5EN1A 5DZ7A 3GILA 4NXNF 3Q8PB 5HLFB 2C22A 1YX2A 4K5RA 3ADAC 1Z1ZA 2Z2ZA 4IR9A 1R89A 1MW7A 1BXNA 2OPSA 2KL8A 1RWMB 1C0UA 2W2OP 3VVTA 4ETZA 1WC4A 2AZ3A 2DNNA 3TZYA 1G4CA 3KLHA 1I94F 2E1RA 3M6VA 4OHXA 3W63A 4MKBA 1KBRA 2DGTA 2KI2A 4WTOB 1UCNA 2ZM6F 3UI3A 2RD5C 4CM0A 5GAEU 4G3IA 2H9ZA 2HFSA 3C6TB 2HAFA 2YX1A 5EGYA 4QYZK 4I2QA 2PMWA 2MDAA 4O4RA 4QOTA 3KXDA 4O3QA 2XEXA 4YB5A 1W7WA 4FZVA 4URSA 2UUAF 2EKNA 2R8KA 2HFNA 2U2FA 3D68A 3QSIA 1X4BA 4LIWA 3DKDA 4ZDNA 3W5ZA 1Y10A 1RHJB 2QA2A 3RZAA 3PV8A 1HQEB 2NPFA 2UXBJ 4NMLA 5MAOA 4DV4F 3JTNA 3FMWA 2ZOFA 3QYYA 2LQ9A 4RW7B 1T9UA 5K9FA 3VGVA 1VQ9S 4ZLLA 3O8WA 4ZVSB 2BQ3A 1V6HA 2GQQA 2XLIA 5LMNF 3CC2S 3OSPA 4UUXA 1HBUA 2F8EX 2UP1A 1XMBA 4PYAA 4QIEA 1U47A 3T1YF 4DLEA 1FO1A 1X5TA 2I5JA 3E01B 4JI6F 2HHVA 4WF9Q 4ED8A 2HWTA 5D4OA 2AJ1A 2K3IA 2QIFA 4USUA 1T9XA 4GKKJ 1BE4A 1DQ8A 2X1GA 3AOCA 3M05A 1ZAVA 3KG4A 3LP2A 4CYUA 2VBZA 1FRMA 1PAUB 2OMOA 3JQJA 2LU2A 2ATCB 1ZPVA 3DXSX 3AOBA 2FC8A 3J80Y 4DCPB 1SL2A 2BACA 4EZ6A 3NCQA 2GIRA 4P9SA 2OPPB 1HYSA 4IKAA 4PKDB 1REGX 3I96A 5AXMA 1XMQJ 3IGVA 2QLFB 1M1HA 1FFWB 3MMJA 1MMDA 2CQ2A 2APOA 2FTRA 2DJWA 5LOQA 2V8DA 3I31A 4Z7CA 4ED7A 1N4LA 2VA2A 4EZ9A 4JV2A 4LFBF 3D6HB 4P71A 2OD6A 4AT1B 2ASYA 1HA1A 3L95X 3UW1A 1WHXA 4EYIB 4TLQA 3T5HA 3V6HA 3GB0A 4H4MA 2AQ4A 2HHTA 3M2UB 3VAJA 5H9EJ 1KLMB 2AYGA 4KY3A 1E6VB 1OJ4A 3MMBA 5CAAA 1U1MA 2IM0A 4PAAA 1H7XA 5F41A 1U1QA 1NK4A 1CS4A 2YX7A 5F8HA 3QJPA 1VI7A 2FDNA 4G65A 1RZMA 1RAAB 4XAKA 4CO4A 2AYMA 3R27A 5F0UA 1NPPA 5DRKA 3QGPA 1TQLA 1YJNS 5D0GA 4DL4A 4RX6A 1C1CA 3W2VB 2QA1A 2NYHA 1BY9A 2J7WA 2B43A 3CJKB 3DRSA 4NXMF 3ZZYA 1LXJA 2DT9A 3OTEA 2CQBA 3CJ5A 2LXFA 5ETMA 1BC6A 3TVKA 2HS3A 5IT0A 3T3FA 2XLKA 1NKBA 3BDEA 2HBZB 1HD1A 1PJ5A 5LT5A 2P6TA 4K5SA 1WHWA 2W2QP 5D78A 4RNFA 4LF7J 2E5JA 1NRKA 4TY8B 3PHEA 2RS2A 2AMCB 2RILA 4AD6A 1UTAA 4JYAJ 3QWPA 3N28A 5IT9Y 4YMEA 2CPEA 2BRKA 3C19A 3CGIA 2AP6A 1R27B 4DFMA 2CZ9A 4PG6A 2MYFA 3EM1A 3FQKA 3TOQA 3QRRA 2IYGA 5GMKa 1NEEA 1N0VC 2MKIA 4B3TJ 3OL9A 4J9OA 3NMRA 2MSSA 2CVEA 4ZCLA 3DI6B 3HVTB 1FT8A 2A0FB 4CTAB 2E7WA 1XNRF 1RGVA 3AXMA 4CDIA 2QN6B 1OO0B 3R6LB 1WDDA 4ECUA 3FCWA 1PC5A 2DYAA 1L3UA 2RH3A 1X4AA 4DF4A 3Q83A 4C7QA 3DNCA 1UVJA 2HHXA 2LU1A 3W9JA 4W92B 3ZTOA 3QATA 2EG2A 3R5JB 4KH0B 1KHWA 2V4RA 3CIZA 4CH0S 4CO5A 1Y3KA 3GCXP 1RAJA 1SCJB 2VC0A 2UZAA 2CQ3A 1SI9A 2C42A 1P1TA 3TP2A 1VLOA 3I5BA 2ALZA 5AE2A 1RUSA 5LM7E 1WDTA 2F7VA 2VBYA 3GIKA 1JLQA 2EBEA 4RU2A 4QBUA 4GKKF 1KSPA 1S57A 1Z2LA 1MU2B 4DL2A 2MEWA 4I69A 4Y0FA 4F3QA 2MXYA 3UO0A 1JLBB 1YLXA 1SBRA 4R5PB 2IJNA 2FHOB 2G1HA 5E2QA 1F3FA 1CJVA 1IVZA 1ZM9A 1F2GA 4Y6IA 2CJKA 3SZ2A 4EEYA 1L3TA 4KR0B 3IR7B 1UETA 4IOCQ 2IBOA 3DC2A 2VQFJ 2W7OA 2LFVA 2FJXA 4A8SA 3JSBA 4QIVA 2HK2A 3K5MA 5KFSA 5GADI 4ECRA 1RLDA 2ZVIA 2ZUGA 3OLBA 4DJBA 2ZH1A 2IDLA 5C42A 5DG9A 5KFEA 3ENWA 4J5OA 4U7UK 2D3OR 4L74A 1NM2A 2FHKA 2V2QA 3K7RA 2GMHA 3H2UB 3PYGA 3SEOA 3VVUA 1HQEA 2PC6A 5HVHA 1L3VA 4O3SA 3WC0A 3WC2A 4QQBA 4C8NA 1ULRA 3K5LA 3CXCR 1G1XA 3P4UB 5KFNA 2XB2D 4NLOA 4KHPF 1NSKL 4DN9A 2WVBA 2GS8A 3TEGA 1I51B 3FBEA 4Y2CA 3RW7A 1N5YB 3UPFA 3RW6A 1RDRA 1S12A 4LIRA 1LWCA 1WOSA 2XMKA 3JS9A 3MHYA 3SCLE 4R5PA 3T9ZA 4CLSA 1SL0A 1D3WA 1HQUA 2ASDA 1M0SA 1TKZB 1RQ0A 3MCSA 3JSMB 4RR5A 1U1RA 2B51A 3GZ7A 4IYQA 2B9YA 2LA6A 3Q24A 1M5SA 3M32B 4J9KA 1X0FA 4PWWA 1WJ9A 2BUNA 4QR0A 3PVXA 3I4PA 1S4EA 3H42A 2PFDA 1FK9B 2CPZA 2Z2LA 2J6TA 2DY1A 4RUCA 3Q8SB 3D4JA 4WKYA 2J6UA 3J7ZT 2M4MA 1S6QA 1TKXB 2IC3B 4ES1A 2AV5A 2XHWA 5A8KA 5BYSA 3IS9A 2IA6A 3ZTRA 1H72C 3ZTQA 2VQEF 1TMJA 1TL3B 3QFHA 5D4PA 1WSRA 4RNNA 4YR0A 4LF9F 3VQSA 1TZ0A 4XO0A 1WEXA 3MAHA 3KJVB 1LQ9A 1OPZA 2DB1A 3CD7A 1FCAA 2BE2A 2DVIA 5C24B 1ROFA 3DI6A 4PXCA 1S9EB 2R7RA 1ZTWA 4DR7J 5I42A 4K4VA 1SH2A 2XC9A 1VQ5S 3FEXB 2DGXA 2B5JA 3BZQA 4PXEA 1R0AB 5LMNJ 1Q8KA 1EKSA 3SV4A 2JNJA 3BDPA 4P7TA 4RW9B 3A8JA 1U1OA 4NCBA 2EK1A 3U02A 2PD1A 2YY3A 2I1RA 4B9MA 3CCLS 2BQRA 1S0VA 4HKQA 1PKUA 4WP8A 3CDEA 2UXCF 2HKEA 1TL7A 3OFGA 2JC1A 1U09A 1XR6A 4P2XA 1RWNB 4B3TF 3DLBA 1D09B 2R7QA 3WZ0A 2BQUA 2CQ0A 3KDOA 4IG3B 5KG2A 2DNHA 3HF5A 5LJ5Y 3TAMA 3EX7B 4CQ1A 2M3DA 4NRUA 2AJQA 4ELUA 3MCNA 4TVAB 5IOLA 2KRRA 1JKHB 4ZJOA 2DNRA 3HMJG 3UCGA 5IFMA 4CCHA 1H2TZ 2M7SA 2QZ8A 4OLOA 4DQSA 1FJCA 4DF8A 2ACYA 3AA8A 3M8ZA 3AT1B 1IM4A 4DV7F 2FVRA 2V94A 2AT1B 2CPDA 3I0RA 3KK1B 1DZ5A 1CULA 2RSQA 3I4HX 2E1PA 4KFBB 1S99A 2XY6A 5KFKA 1K0TA 1RISA 1S5ZA 5A0YB 4CH1A 2DNKA 2IHR1 5KG6A 1HMVA 2A10A 2DIUA 4UOGA 1H2VZ 2AWZA 4MT1A 5J1NA 2NXNA 3DRPB 1RT7B 3BN7A 4M8LA 3QBCA 3SXLA 2XMUA 1VBKA 3PYEA 1IKYA 1QAXA 4WFXA 3S7RA 3TVZA 3BO3A 2HW3A 2XY7A 4OZ1A 3JSRA 1KHVA 2HS4A 2ERRA 4E0DA 3FZBA 1AZSB 2WHOA 2DCLA 2R7WA 1IKWB 1RT4B 1XK8A 4KTQA 2X3DA 5AE3A 4X64F 2G0JA 2JLGA 2VQFF 3TR5A 2VC1A 4KC5A 4YEAA 2HYIB 4DR5F 3PG9A 4OYZA 3R2DJ 2XHCA 2LEBA 1NSQA 1NU4A 1IWAA 1HMVB 4PQAA 4Y34A 3ZTSA 4KQZA 4N5SA 3GSDA 5L1IA 2FB0A 4F4YA 1DQ9A 2RF2A 3Q8VA 2VB6A 3MI7X 4LREA 2AHOB 2VFRA 2PA3A 2X1BA 2XYHB 3M2RB 3N6MA 3MM5A 3NBPA 1TV6B 2HQ3A 4DG1A 3OHAA 1HHSA 2R8GA 4CNZA 2JH3A 2KYXA 2IVFB 2RU3A 2BKNA 2VG5B 8ATCB 3BPSP 1RXOB 3VTIA 2RRNA 3QGGA 2VKRA 3T41A 5KT6A 4QW9A 4AL7A 4RUBA 1FNXH 3KOAA 1H0HB 2DD8S 3BGFA 2R7UA 2O67A 1F6TA 1JNZB 1CJKA 1YWXA 2RDIA 1RAIB 3G6VA 2J0WA 1Q8IA 1S9GB 3BYRA 3N79A 3ZZZA 4G6VB 1VC5A 3SQGB 4DV0J 4EGLA 3QO9B 4FYYB 1UFLA 2J9DA 2I9SA 2FC9A 3NNCA 2ZEJA 4YS2A 4C11B 4HHUA 2Y8WA 1FRLA 1HHQA 1S1XB 2GNKA 1NJIT 4K4UA 1X7VA 3CC7S 1S10A 2V8VA 2XBPA 5F8MA 1N36F 2HRTA 2UUCJ 2MSTA 1HNWF 2CQPA 3CMQA 1F1BB 1TVRA 1Y3JA 4MTPA 5KAKA 4X62F 2IVMA 3LP1B 1NJYA 1KC8T 4OI6A 5HJYA 3OUYB 2EFPA 3BH6B 2LQ8A 2AEMA 1QDUB 2D41A 3MMCA 3C46A 3LH2S 1U4BA 2GO8A 4O4GA 8AT1B 2MKSA 2L48A 1F60B 1FKOB 1ZZFA 3PYDA 1H74A 2W9AA 4ECXA 3T5KA 4OI0A 2AYEA 4ZLPA 4LT6A 4ITSA 1J5EJ 2XZDB 3DOLA 2B4UA 3QWUA 4I2QB 1IN0A 3NGTA 4WPAA 2HNDA 2NXEA 2RE1A 1VRTB 3A3OB 1HD0A 1IBMF 3H2VE 3SQOP 4WZQA 4C48A 2C2ZB 1VDHA 1FRXA 3CNQP 1AB8A 1WF0A 1L3KA 4WP3A 3MR5A 1TL3A 1Q53A 2GHWA 3LP1A 3R8YA 5B7WA 1WUUA 2J0SD 2W01A 4H4OB 5LXRA 4Z2XA 2WSFC 2QLJB 3QPIA 1Q81T 1S6OA 3H5UA 3MTKA 1NHKL 1S1XA 1PO6A 1YKWA 3QNWB 2DGOA 3BGRA 4UUWA 1N32F 2C2RA 1GAOA 1RWVB 3GE9A 2WVCA 2GFFA 1N54B 2W8KA
chains in the Genus database with same CATH topology
1UCNA 1KDNA 3G2XA 5IOLA 1NPKA 1NDPA 4C6AA 3EVOA 3BBCA 1S57A 1NB2A 1W7WA 1B4SA 4EK2A 2B8PA 4WBFA 3GPAA 1MN9A 3DKDA 4DI6A 4CP5A 1LWXA 3PRVA 4ANDA 2HVEA 1BUXA 1F3FA 1S5ZA 3VGTA 4FKXA 3BBBA 4UOGA 3VGVA 2NCKL 1NLKL 3DDIA 1ZS6A 3VGSA 4FKYA 3ELHA 3FBFA 3EE3A 4DZ6A 2DXEA 1NCLA 1BE4A 4S0MA 4HR2A 4W98A 3VVUA 4ANCA 3EVMA 4UOHA 3ZTPA 1XQIA 1VYAA 1NSQA 2ZUAA 3ZTSA 3ETMA 1NSKL 3Q8VA 1WKJA 1BHNA 3FBEA 3B6BA 2B8QA 1U8WA 1NDLA 3EMTA 3FBBA 3JS9A 2AZ1A 3BH7B 3EVWA 2HURA 5C7PA 1WKLA 1WKKA 5CAAA 1F6TA 1K44A 1MN7A 3Q89A 4ENOA 2HVDA 3WX8A 1NSPA 3FBCA 3ENAA 3B54A 2CWKA 3R9LA 3ZTRA 1S59A 3ZTQA 2DXFA 1HHQA 1EHWA 1JXVA 1XIQA 1NDKA 4KPCA 1B99A 3FCVA 4UOFA 4F4AA 4O0NA 1LEOA 1PAEX 3L7UA 3BH6B 3PJ9A 2VU5A 1HIYA 5CABA 3EICA 3NGUA 1NUEA 1HLWA 3EM1A 3Q8UA 3Q86A 3VGUA 3NGTA 4F36A 3FC9A 4ANEA 2DXDA 3GP9A 3MPDA 2DY9A 3EJMA 2BEFA 1PKUA 2BX6A 3FCWA 2DYAA 3FKBA 3NGSA 3Q83A 4DUTA 1NHKL 3ZTOA 3VVTA 2AZ3A 3NGRA 1NDCA 3Q8YA 5BXIA 3BBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UCN A;  1KDN A;  3G2X A;  5IOL A;  1NPK A;  1NDP A;  4C6A A;  3EVO A;  3BBC A;  1S57 A;  1NB2 A;  1W7W A;  1B4S A;  4EK2 A;  2B8P A;  4WBF A;  3GPA A;  1MN9 A;  3DKD A;  4DI6 A;  4CP5 A;  1LWX A;  3PRV A;  4AND A;  2HVE A;  1BUX A;  1F3F A;  1S5Z A;  3VGT A;  4FKX A;  3BBB A;  4UOG A;  3VGV A;  2NCK L;  1NLK L;  3DDI A;  1ZS6 A;  3VGS A;  4FKY A;  3ELH A;  3FBF A;  3EE3 A;  4DZ6 A;  2DXE A;  1NCL A;  1BE4 A;  4S0M A;  4HR2 A;  4W98 A;  3VVU A;  4ANC A;  3EVM A;  4UOH A;  3ZTP A;  1XQI A;  1VYA A;  1NSQ A;  2ZUA A;  3ZTS A;  3ETM A;  1NSK L;  3Q8V A;  1WKJ A;  1BHN A;  3FBE A;  3B6B A;  2B8Q A;  1U8W A;  1NDL A;  3EMT A;  3FBB A;  3JS9 A;  2AZ1 A;  3BH7 B;  3EVW A;  2HUR A;  5C7P A;  1WKL A;  1WKK A;  5CAA A;  1F6T A;  1K44 A;  1MN7 A;  3Q89 A;  4ENO A;  2HVD A;  3WX8 A;  1NSP A;  3FBC A;  3ENA A;  3B54 A;  2CWK A;  3R9L A;  3ZTR A;  1S59 A;  3ZTQ A;  2DXF A;  1HHQ A;  1EHW A;  1JXV A;  1XIQ A;  1NDK A;  4KPC A;  1B99 A;  3FCV A;  4UOF A;  4F4A A;  4O0N A;  1LEO A;  1PAE X;  3L7U A;  3BH6 B;  3PJ9 A;  2VU5 A;  1HIY A;  5CAB A;  3EIC A;  3NGU A;  1NUE A;  1HLW A;  3EM1 A;  3Q8U A;  3Q86 A;  3VGU A;  3NGT A;  4F36 A;  3FC9 A;  4ANE A;  2DXD A;  3GP9 A;  3MPD A;  2DY9 A;  3EJM A;  2BEF A;  1PKU A;  2BX6 A;  3FCW A;  2DYA A;  3FKB A;  3NGS A;  3Q83 A;  4DUT A;  1NHK L;  3ZTO A;  3VVT A;  2AZ3 A;  3NGR A;  1NDC A;  3Q8Y A;  5BXI A;  3BBF A; 
#chains in the Genus database with same CATH topology
 3G2X A;  1Z4U A;  3HVR A;  2ZH7 A;  1TAQ A;  4KIA A;  3FK4 A;  2CZ4 A;  3FMB A;  2B5J B;  1DAR A;  2NSB A;  3I9Z A;  4WIQ A;  4LRD A;  3DU5 A;  5HI7 A;  1FWK A;  2Z2Y B;  4F26 A;  1HQU B;  5DG7 A;  2VV5 A;  4NA1 A;  3THP A;  3U1N A;  2CJQ A;  2A6M A;  2CNL B;  4LF2 A;  4OYA A;  4ZP6 A;  1R8A A;  2JRS A;  3AQP A;  4CYU B;  4XPC A;  2DHX A;  2YKA A;  4NYP A;  1WC0 A;  2NUH A;  1MRO B;  4USK A;  4USV A;  2W24 A;  5FD1 A;  4A8O A;  4M5D B;  4C11 A;  4ER8 A;  2GAH C;  5FDL A;  4R8U B;  1U6F A;  2BW2 A;  4FYD A;  4KT0 C;  4DX7 A;  2KXN B;  5I3U A;  2ZBC A;  2BXJ A;  4DL0 C;  1U48 A;  2KT5 A;  2UUT A;  4TYA A;  2OLW A;  2Y1J A;  3EE3 A;  2V50 A;  3DCA A;  3POT A;  2IM1 A;  3UE2 A;  4AQY F;  4IQM A;  3BF4 A;  3KJQ B;  4USJ C;  4Y2I A;  3UQS A;  4EBD A;  2F8M A;  4BDP A;  1NCL A;  1PSD A;  4FYX B;  2WK4 A;  1SPB P;  1U25 A;  2IAJ A;  4HHJ A;  4WE1 A;  3HKZ D;  4IH6 A;  3IWX A;  4OX8 A;  1U2C A;  1TKZ A;  3ZTP A;  2HQC A;  4CT8 A;  4RW8 A;  2EFN A;  2HQG A;  5F3T A;  4HHH A;  4FF4 A;  3PR5 B;  2M70 A;  4FP9 A;  2R2S A;  2MB0 B;  1FI4 A;  2CPF A;  3Q23 A;  1RT6 B;  3CJR A;  1A0O B;  1U8W A;  1XER A;  3RBX A;  5JUM A;  3V6K A;  1GH8 A;  3IRX B;  2BMB A;  4YY3 F;  1Q95 G;  1EQM A;  3TAR A;  3MEE B;  2YNI A;  2YPZ A;  4Y2K A;  2HNZ A;  5HK4 A;  5GAE I;  2HUR A;  4DPU A;  1HNW J;  2E9Z A;  1JLF B;  2QTW A;  2YKM B;  1JLQ B;  2D74 B;  2W1B A;  3Q2S C;  4U95 A;  4ZIT A;  4R0E A;  2WVF A;  2AGP A;  4QPX A;  1VR6 A;  3C16 B;  1VJW A;  2MJN A;  2P9E A;  3QFW A;  3ZNU A;  4MIB A;  2MQO A;  4K4X A;  2ZBR A;  1TK0 A;  5IM0 B;  1XTZ A;  5E3A A;  3W3S A;  5KFB A;  4F02 A;  1U45 A;  4ENO A;  1EB0 A;  3I32 A;  2G2Y A;  1NH7 A;  1KOO A;  1S1V B;  2H51 B;  3F41 A;  1I5O B;  1IBL F;  1U7L A;  3L4B C;  4DUZ F;  3SV3 A;  2V9W A;  2DXF A;  2UV8 G;  4N77 A;  2RRB A;  2H4W B;  4OZ5 A;  4DPT A;  3IRW P;  4HYK A;  1FVS A;  5CHC B;  4GC6 A;  3U7J A;  1UZH A;  3MM5 B;  1TL7 B;  3K58 A;  1CUL B;  3P5B P;  1Q7Y T;  1RWP B;  2MHE A;  4V19 X;  2RF2 B;  5B0G A;  3CCR S;  1GK8 A;  4ZJL A;  3ETO A;  1S6P B;  3DOM A;  2MZT A;  1QLN A;  2ZHA A;  1U24 A;  4IRC A;  3UFC X;  1KVK A;  4TYB A;  2W2P P;  4DUZ J;  3EIC A;  1JKH A;  4M63 A;  1JIH A;  3OTO J;  4ZOS A;  2KFN A;  1KOH A;  3BGO P;  3QAU A;  1R8H A;  1XBW A;  4KGZ B;  2OPQ A;  2CQG A;  4F36 A;  5B09 A;  5IWA F;  4LFC J;  2VJU A;  5CD4 A;  1BWV A;  2Y1L B;  5I42 B;  2B6A B;  4I6A A;  5HP1 B;  3IR5 B;  1IXK A;  1TUV A;  5IZH A;  1Q5V A;  3P96 A;  4HT7 A;  4ZHR B;  3J81 j;  2ZZN A;  3QZ8 A;  2CQH A;  4OL8 A;  3GYN A;  4ZVQ B;  4WII A;  3M9N B;  3NCP A;  4RNO A;  2AJF E;  2IJF A;  2LYV A;  1HI1 A;  3MUT P;  1GXT A;  3VWS A;  1V5I B;  3C15 A;  2RNE A;  1YBT A;  4PEO A;  1VIO A;  3MPU B;  3MPV A;  2IVY A;  3M1V A;  1RWX B;  2OH2 A;  3C2P A;  1U1L A;  3IS9 B;  1SQE A;  1YK9 A;  3LAM A;  4P7V A;  4URQ U;  4UY8 5;  1EJ7 L;  1SUQ B;  2MTL A;  2I38 A;  3MEE A;  3M8R A;  2KXF A;  1RYS A;  2IMW P;  2XGP A;  4IUF A;  1JB0 C;  1T8E A;  2R7O A;  3PDN A;  1VQ8 S;  4CO2 A;  2WVE A;  4JV5 F;  2ZH9 A;  3DYA B;  1NKE A;  2BE2 B;  1XMQ F;  3WBZ A;  4UT4 A;  5LL6 d;  4NOH A;  2VG6 A;  5E3R A;  4DI6 A;  5A2Q Y;  2C2D A;  1JX4 A;  2F4V F;  3SQG A;  5AE1 A;  4PQU A;  4DR7 F;  4LF1 A;  5HBM B;  3RBE A;  4B3M F;  4IQX A;  2AF6 A;  3M8W A;  2PE8 A;  2FY1 A;  5GVQ A;  5GAG U;  2HGL A;  3P45 B;  3EPG A;  3GMG A;  2YQ3 A;  5E7O B;  4AL6 A;  4LFB J;  1N5Y A;  3FVY A;  1H3D A;  4LSN B;  1OPI A;  3ZXW A;  2YH0 A;  4QWC A;  4YFU A;  4R25 A;  4LR8 A;  5FLX U;  1HBO A;  2HGM A;  1KWM A;  3RBD A;  1S72 S;  1Q8L A;  3DLG A;  2A6O A;  4ZPC A;  4EI2 A;  3M32 A;  5ETR A;  2GMJ A;  2XZT B;  4KE5 A;  3HKW A;  2AYB A;  3HDS A;  1UWB B;  2FVC A;  4V1A k;  3F44 A;  4DV4 J;  2BM0 A;  1LFP A;  2DRB A;  2NUU G;  1BQM B;  1B70 B;  3TA1 A;  4ED6 A;  1SC4 B;  2DEI A;  3TX8 A;  3JXO A;  3K8V A;  2FGC A;  5KT3 A;  4DWI A;  1QAI A;  3KJV A;  3T1Y J;  2FPH X;  4C8M A;  4B02 A;  5B0D A;  2R3V A;  4B9N A;  4G1Q B;  5HMX A;  3UCZ P;  4LRB A;  4LQ9 A;  3DOK B;  2DKO B;  1VQ4 S;  1RU1 A;  3FDS A;  4EMD A;  2QFI A;  4HEA 9;  2W9C A;  3G71 S;  1BMQ B;  2RKI B;  2H4Y B;  1Y9O A;  3IM8 A;  1U1N A;  2WON A;  2VPX B;  4N47 A;  4LF9 J;  4ERD A;  4X65 J;  1MU2 A;  3S01 A;  4B08 A;  2QL9 B;  4KH1 B;  2CQ1 A;  2K1R A;  4OHY A;  1L5U A;  4M5J A;  2HZA A;  3KYL A;  4F8R A;  4OI4 A;  2BZ2 A;  2C2O B;  4QIG A;  2R2T A;  2WB1 D;  3OTC A;  3K2Y A;  4OJ3 A;  1GTH A;  2V2Z A;  3ILL A;  2IAJ B;  3MD3 A;  3N6L A;  2HNY B;  3EWG A;  5KG5 A;  4TU8 A;  1DUR A;  1QUV A;  2RDD A;  2B4O A;  1VMB A;  1XIQ A;  2LCW A;  5HQM A;  3M8Q B;  4CT9 A;  2GQ2 A;  1GT8 A;  1F5C A;  2F5G A;  4ICL A;  4P72 A;  3W7B A;  3DRS B;  3DLK A;  2OEK A;  4JB8 B;  4DV6 F;  3TAP A;  2OTL S;  1QAY A;  4F50 A;  1VS3 A;  3S6E A;  3H90 A;  3CDB A;  1V3Z A;  4GO7 X;  1AXQ A;  4IG3 A;  3HT3 A;  3N0V A;  1D9D A;  3PRB A;  2VU5 A;  2UVW A;  1HWI A;  5CAB A;  4X4U A;  3A8I A;  3IO1 A;  3K17 A;  2EWH A;  4K4T A;  3QJJ A;  4XPE A;  4WFN Q;  4OZL A;  1HPZ A;  1DY3 A;  1FDA A;  1R31 A;  3GIR A;  1HNZ J;  2LMI A;  1WC3 A;  3BSC A;  2DO4 A;  5BYQ A;  5KFO A;  5D77 A;  4UZB A;  1JK9 B;  1S4F A;  4E8U A;  2OSR A;  4FF3 A;  2L08 A;  2RB7 A;  5L1J A;  4KAI A;  3R5A A;  4I7F A;  3OL6 A;  4M5H A;  1RTZ A;  2HPU A;  2HFZ A;  2ZKT A;  3A4T A;  3NKY A;  1UMJ A;  3RGI A;  3HHL C;  4TU7 A;  1XR5 A;  1K0V A;  2ROP A;  1S9G A;  1X5O A;  2VFT A;  2OPP A;  3BYP A;  5T41 A;  2NQP A;  2GVD A;  1FDN A;  1RBL A;  2LDY A;  4LFC F;  2N3O A;  1XN9 A;  2J9E A;  2XWX A;  3K5P A;  1TK5 A;  1VIX A;  1RBO B;  5E0O A;  4ZKA A;  2VOP A;  4U6P A;  4OYX A;  4LF5 J;  1R43 A;  3FSY A;  4PRF A;  4DSE A;  1RTH B;  3QZ7 A;  1KDN A;  1T7P A;  2KJW A;  4IOB A;  1KFD A;  2H1Y A;  1RTJ A;  3MGJ A;  3TUI C;  3MM8 A;  3EVO A;  3PO5 A;  3IR6 B;  2DRA A;  3G6Y A;  1T0T V;  1KVI A;  3QID A;  2K7K A;  3W1Y C;  1RAB B;  3W9H A;  2KG1 A;  3BO2 A;  1UVN A;  4DR6 F;  4Y3C A;  1M1K T;  1JXE A;  1UVL A;  2BJ3 A;  4ZCI A;  4Q43 A;  1CG2 A;  2YNH A;  2A1B A;  2DH8 A;  3N5F A;  2ZC3 A;  4DPW A;  2KDO A;  1N6Q B;  3PKM A;  4QPT A;  2O3D A;  4J9P A;  3RAX A;  3V81 B;  1JXL A;  2BDP A;  4HTJ A;  2JEG A;  3LAL A;  2Z56 B;  3W65 A;  2PEH A;  4U7C A;  1SJ1 A;  3CE8 A;  2DEJ A;  2HWI A;  4L6V 3;  2JOQ A;  5G4D A;  3D9B A;  1RHM B;  1TL5 A;  3O6Q A;  3K5O A;  1TP7 A;  1RWK B;  3TA0 A;  2GVD B;  4LBH A;  3T1A A;  1DAX A;  4K0K F;  4N8N A;  4ECQ A;  2HHP A;  1QE1 A;  4F0K A;  1I6J A;  4FXV A;  4S0M A;  3LW5 C;  2Q43 A;  3AD9 C;  3NS7 B;  4NAS A;  5E3P A;  1AFI A;  2M8H A;  1RB0 A;  3GTY X;  1CVJ A;  4U96 A;  2VIC A;  3PO4 A;  1RT1 A;  1CSJ A;  3O1L A;  4DMZ A;  3NL0 A;  1YSJ A;  3VAK A;  1QY7 A;  2YWG A;  4DOZ A;  3GJR B;  1R3N A;  2FJD B;  1ZH5 A;  4DR6 J;  4DQI A;  4PWD B;  1IJE B;  1HKA A;  2JX2 A;  2MZJ A;  4BHQ A;  3GJT B;  2IRX A;  3HD1 A;  5HVF A;  4CLL A;  4RW7 A;  5KFF A;  3J81 U;  2RRA A;  2I2Y A;  1CQN A;  1Y0H A;  5DS7 A;  4TU9 A;  1LKZ A;  3BR8 A;  1ZTT A;  1J5O B;  1M5V C;  5C24 A;  3GQC A;  2QA4 G;  4W90 B;  1FD8 A;  4USW A;  1C1C B;  2ROG A;  4ZPW R;  1WKK A;  4M5K A;  4NLP A;  4DR2 F;  2B7B B;  1J5E F;  3H5X A;  3K8W A;  4NCG B;  5HAT A;  2R9L A;  4KHP J;  2A3J A;  1TV6 A;  4KSE B;  4DG1 B;  1VQ6 S;  2J6S A;  5ADZ A;  1WTB A;  2JFK A;  2OKQ A;  2UVR A;  4ETX A;  2ZZT A;  3NP5 A;  1K1Q A;  5HMW A;  3D2W A;  3BQ0 A;  3PW5 A;  2B56 A;  1F5A A;  3P3D A;  4KHM A;  5DQH A;  2A2D A;  2RVJ A;  2E9T A;  3AJD A;  3BKF A;  3RR8 A;  1LXN A;  5SUH A;  1VRU A;  1NO8 A;  2NSC A;  3D1H A;  2AKW B;  2RQ4 A;  1BQX A;  3PKY A;  2QEX S;  4DR5 J;  3TW0 A;  5KFW A;  3JSM A;  4HDH A;  5F8N A;  1LW2 A;  3L7U A;  2IMO A;  4LR9 A;  2W9C B;  4ILR A;  2VH7 A;  3J80 U;  3MCM A;  4K50 A;  1X9S A;  2VDH A;  2UUA J;  2FLP A;  2M52 A;  4FYV B;  3KK2 A;  3BGL A;  6FDR A;  2POK A;  3PX6 A;  1GMW A;  3R7B B;  3FQL A;  1S7I A;  2OIH A;  3VGU A;  3D67 A;  1D9A A;  1KP6 A;  1Y5L B;  2AW0 A;  4WKR A;  5KFH A;  2FLO A;  4CWB A;  5ETS A;  1HBU B;  1RTD A;  4OX9 F;  3UD4 P;  1R6Y A;  2W7A A;  3T5L A;  1HHT P;  5KG3 A;  2DY9 A;  3EJM A;  3EDR B;  3IG1 B;  4NI2 A;  1LWF A;  1RT2 B;  2DR6 A;  2QGF B;  4NLV A;  2DH7 A;  3TO8 A;  1SUQ A;  2IFX A;  4M94 A;  1NND A;  2UXD F;  4C4W A;  2XYG B;  4MFB B;  5D4L A;  3SBM A;  2DRD A;  4DDF A;  2W9B B;  2FZG B;  1NPR A;  2NXJ A;  2RHS B;  4UQG A;  2E5G A;  3KK3 A;  2UU9 J;  3UNY A;  4IH7 A;  2VPW B;  1RHK B;  3RJM B;  2BJE A;  3Q8Y A;  4BCA A;  5KTQ A;  2J5A A;  2R7T A;  3TAN A;  3O44 A;  2YX4 A;  3BBF A;  3JAM Y;  4I6W A;  3KK2 B;  1SC1 B;  2BVZ A;  2PT0 A;  1TUW A;  2ZBP A;  5BJR A;  4DSF A;  2FD2 A;  3Q2T C;  5A8W A;  4I6Y A;  3VZH A;  3G9C A;  3G82 B;  4DFK A;  3OV7 A;  1URN A;  3J7Z 5;  4EYH B;  1KON A;  1NB2 A;  1O51 A;  2X7I A;  4YDD B;  1H38 A;  1UAW A;  2M8D B;  1T02 A;  2BRL A;  2LXI A;  3PJW A;  2MQ8 A;  2HLU A;  4WU3 A;  4USM A;  3LWM A;  4KKO B;  4DL6 A;  1S76 D;  3KK3 B;  3DLE A;  1OY6 A;  4YP3 A;  1CJU B;  4IRK A;  1CQM A;  2OPR B;  3LQV A;  4B9V A;  4HH1 A;  4ZIV A;  4UF4 A;  4Z37 A;  4ELV A;  4F2S A;  3ZZP A;  4DV7 J;  4LF8 F;  4N8O A;  1JJH A;  2MQL A;  1HWJ A;  3A12 A;  6FD1 A;  4R8U A;  3WIV A;  3AB4 B;  3M30 B;  2J76 E;  2VOD A;  3ZZU A;  2JSX A;  1O0P A;  1MWZ A;  2DIT A;  2YKN A;  4YB6 A;  4DL3 A;  2ALY B;  4NXM J;  3LA0 A;  2OHD A;  2VHG A;  3RTV A;  1S1W A;  2EPI A;  1IBK F;  5CYM A;  4IFV A;  3ZZT A;  3NNA A;  3H5S A;  4ED2 A;  4ZVT B;  1X4D A;  1J5O A;  3EVM A;  1SIZ A;  4FS1 A;  1WG5 A;  2CJY B;  1AFJ A;  2H54 B;  3DDN A;  2KKH A;  4NA2 A;  1FNM A;  3BGU A;  5EHH A;  3EYZ A;  3MM6 B;  2FJW A;  4QU7 A;  2KTQ A;  2VQE J;  4X62 J;  1WTF A;  2V69 A;  2VDI A;  5A6W A;  2E5L F;  2ZNY A;  1RP5 A;  2KT2 A;  3I82 A;  2MLZ A;  3J7Y U;  3V81 A;  1XMO J;  1RTI A;  2QE5 A;  2X1A A;  5D8H B;  3BH7 B;  3SFG A;  1VQO S;  3M7V A;  3BKT A;  3Q8R B;  1AA1 B;  5C7P A;  4X64 J;  1W26 A;  3OQ2 A;  3AA9 A;  1OIA A;  1TKT B;  4C0O C;  1W25 A;  3JQM A;  1SKS A;  1S6P A;  3DOM B;  4ED0 A;  2R7V A;  3QGH A;  4LQ3 A;  2HIQ A;  3EZ5 A;  2ZH6 A;  5DGB A;  4J9M A;  3V6J A;  5HRO A;  4Q2M A;  1SJF A;  2CQD A;  3PX4 A;  1Q79 A;  2FYX A;  2YKN B;  2UV8 A;  2W7P A;  3SSS A;  1YJR A;  1YQH A;  1NSP A;  3I87 A;  2AX0 A;  1KQF B;  3DLJ A;  2ZE2 B;  3B54 A;  4LBP A;  5C5J A;  3R5G A;  2Q6C A;  4OX9 J;  1FRI A;  1HL6 A;  1CS4 B;  2EFQ A;  2HS0 A;  4MKA A;  5IM0 A;  1AUD A;  4RWX A;  1YRT A;  2L9W A;  2KM8 B;  1UKU A;  3M8P B;  4OJ1 A;  1WI8 A;  3DLE B;  2HVI A;  4GVL A;  2RJZ A;  3KFW X;  1Q4R A;  2FGO A;  2NYI A;  4OV6 A;  1HIY A;  4ILL A;  2P5V A;  1VOM A;  5KFY A;  4DR3 J;  3HHN B;  3AY0 A;  2MZQ A;  5IQQ A;  4LUB A;  2Y8Y A;  4C0H A;  2VG7 B;  2VAS A;  1VK8 A;  2K1R B;  4P10 A;  4QYR A;  3T19 A;  3T9N A;  2DGV A;  3M2V A;  2CJX B;  2Y3Y A;  1HW8 A;  3C14 A;  4RPF A;  4RO0 A;  3JAM U;  3EPI A;  2DNP A;  3V4M A;  3SDE B;  4X66 J;  2K2P A;  4F0H A;  3TI0 A;  2JHE A;  4MMO A;  4MKV A;  1UEK A;  4Q45 A;  1YJW S;  1F9H A;  5KT2 A;  3CJQ A;  2C2M B;  1FKA F;  1N5V A;  4LF6 J;  4FF2 A;  1OYD A;  3TZW A;  1VQS A;  2XNR A;  3LP0 A;  3N5B A;  2XSJ B;  2QMU B;  2BEF A;  3FKB A;  3JQK A;  2QYG A;  2FHJ A;  3NGS A;  4W4M A;  3G8T A;  1VRU B;  3CCE S;  3OR2 A;  1VQY A;  2L3M A;  4Y00 A;  1WEL A;  4O3N A;  4PYD A;  3HXM A;  1IR1 A;  1AW0 A;  1DLO B;  3TJ8 A;  1TFW A;  2VIH A;  3R5B A;  2DGU A;  2ZH8 A;  3ET6 A;  3D1O A;  4DCJ B;  1LOU A;  2N82 B;  2J8A A;  1XMO F;  3NBP B;  2ABY A;  2XMJ A;  1BQN A;  5F8I A;  2DPJ A;  3RB4 A;  5HVG A;  2MQP A;  1PYO B;  1UJ4 A;  4O3O A;  4ZLJ A;  2D3U A;  1X9W A;  2MQM A;  1DBD A;  3QT6 A;  2PFF B;  3CCQ S;  2DIS A;  2DTJ A;  4RW4 B;  1WOO A;  5J1P A;  1DFD A;  3V5R A;  1N5T A;  1FTR A;  2KN4 A;  3C6T A;  5KG7 A;  3PAC A;  4FKX A;  2VL1 A;  4HLB A;  1WNE A;  3U1M A;  2CQ4 A;  3O2I A;  3GV8 B;  1SJQ A;  3OLA A;  1N52 B;  2VG6 B;  2C1E B;  4PQU B;  2AEJ A;  3V4I A;  1TKD A;  4NXN J;  5FLX Y;  1MSW D;  3BPD A;  2E1C A;  1IBC B;  3BN4 A;  1F9E B;  1C2P A;  4KGM A;  4QWD A;  5ETQ A;  1RU2 A;  3OJU A;  2MZ1 A;  5DLG A;  2DXE A;  1YRU A;  2Z0G A;  1RLC L;  4C3M A;  5DDP C;  4ZK7 M;  1UP1 A;  1PGZ A;  1N48 A;  1XEZ A;  4KBI A;  1RHQ B;  1UJ5 A;  2GML A;  1FHT A;  1S48 A;  2GGP B;  1QTM A;  2VFV A;  5DZ6 A;  4ANC A;  5A2Q U;  3QSY B;  1VQM S;  2FJB B;  3I0R B;  3KK1 A;  3CUN A;  5M2U A;  4UOH A;  3EGZ A;  1QD1 A;  1HR0 J;  2R7S A;  2XTJ P;  2ZH2 A;  3HHL A;  3SYZ A;  3X1L B;  2OTJ S;  2JVO A;  3DLK B;  5HSP A;  1JMT A;  1BHN A;  1HNI A;  1CJK B;  1C0T B;  1REV B;  2B8Q A;  3I56 S;  5DGA A;  2MKK A;  2EBG A;  3DOL B;  3HLU A;  1K8A T;  3OFH A;  4DQQ A;  2DNY A;  3T1H F;  1KVJ A;  5G0R B;  5AXL A;  4YN3 B;  2XG8 A;  3MM9 B;  1K9M T;  2KZM A;  5K14 B;  4FXD A;  4PG5 A;  2WOM A;  4NZ0 A;  1Q78 A;  4L75 A;  4P2S A;  3H5Y A;  2DNZ A;  5DLF A;  4DSJ A;  3C66 A;  1TL4 A;  4ED4 A;  4LF5 F;  1YI2 S;  2K8G A;  2RDJ A;  1RAC B;  1F9F A;  2CQC A;  3P5T L;  4UY8 T;  3MXH P;  1GX5 A;  2QL5 B;  3OVS A;  3LTO A;  1RK8 A;  1CJT B;  1HBN B;  2AD9 A;  4EO8 A;  3L7P A;  3Q89 A;  4FS2 A;  3CCJ S;  2BAN B;  3PJX A;  3MM6 A;  4OHZ A;  2H5J B;  3AJ2 A;  3D3B J;  2HVD A;  2ZJR Q;  5HLF A;  4KYZ A;  2LKZ A;  5A76 A;  1OMS A;  3CJ0 A;  1I1G A;  1JLG A;  4TQR A;  3MEK A;  4X4Q A;  3TUJ C;  2C3P A;  3K5N A;  1HBM B;  3K59 A;  2M5Y A;  1H98 A;  2C3U A;  3OVA A;  2KYZ A;  3JB9 k;  1B99 A;  1KKH A;  2CUY A;  2QX0 A;  2GQC A;  4NEZ A;  3HFK A;  5KFI A;  5A8R B;  3UD3 P;  2B9E A;  1TFY A;  3J7A N;  3CMA S;  4QWA A;  2MKH A;  4DPY A;  2CPH A;  2AJ0 A;  3OBI A;  4QCL A;  4FNH A;  1O8B A;  3C14 B;  1R8C A;  2B4P A;  2GJ2 A;  3IMQ J;  5HAN A;  2WBR A;  4DN0 A;  7FD1 A;  2O01 C;  3PY8 A;  9RUB A;  4NWB A;  1WAC A;  2ZOM A;  4BLG A;  5DG8 A;  3CED A;  3SI8 A;  2HFV A;  4CLF A;  3N01 A;  3EGV A;  3PNI A;  2PMH A;  3MM8 B;  2IBK A;  2PI5 A;  5GAH I;  2CNO B;  4CLZ A;  3OFE A;  2SXL A;  4JV0 A;  4ECV A;  1JJC B;  2D9P A;  3KHR A;  1P6T A;  3CUL A;  4H4K A;  5A6P A;  1YRX A;  3EXY A;  4X4R A;  2HQI A;  5JVH Q;  2XYP B;  5KFV A;  4DR3 F;  2GO9 A;  2HBY B;  3DRR B;  4DR2 J;  3MD1 A;  2BM1 A;  3O5T B;  4RJV A;  3TQE A;  3G4S S;  4URG A;  3T1H J;  3PXG a;  3H8Y A;  4B3O B;  2UXD J;  3SSQ A;  1ZBT A;  5KG1 A;  3DFE A;  5HQ8 A;  2YH1 A;  1DHM A;  2V2K A;  3HVW A;  1SJ4 P;  3KMQ A;  1PJ7 A;  3NAI A;  1TVR B;  3ENV A;  3GJQ B;  3DYA A;  1FWP A;  4J9U E;  3G87 A;  4P74 A;  3N6N A;  4AE5 A;  1KD1 T;  4C8L A;  3KLF B;  1AUS L;  1VQP S;  2V5H G;  4TY9 A;  4X4T A;  4YHH F;  2VOO A;  3QRP A;  2JC0 A;  3UDL A;  4HL9 A;  1YZ6 A;  2W4C A;  3C16 A;  4KGK A;  4RW9 A;  1JJ4 A;  1KFS A;  5I3U B;  5JVG Q;  4DUY F;  4X84 A;  4USI A;  5AXN A;  5T14 A;  3R1L A;  4AND A;  3KTQ A;  4A47 A;  3P49 B;  1C1B A;  1TL1 B;  4Q0B B;  1BUX A;  4OYB A;  2F3J A;  4J37 A;  2DR9 A;  2BYC A;  3PCO B;  2QMX A;  1RT5 A;  3UR3 C;  3K89 A;  5DQG A;  2AGQ A;  1YIT S;  3BM7 A;  4ED3 A;  3ZZ0 A;  1X4F A;  4DL5 A;  2JDJ A;  4ZPA A;  3VAG A;  1LK7 A;  2I6W A;  3OFF A;  2QFJ A;  2E7V A;  4IG0 A;  3KHL A;  1Q7L B;  4WFZ A;  1QVF R;  2YTC A;  3RG6 A;  2F63 A;  3VCD A;  1C4C A;  2MKC A;  1OS5 A;  4EWT A;  1FVQ A;  4UST A;  3HFV A;  2JJ4 D;  2FHJ D;  4DV1 F;  3BKU A;  3M2R A;  4C2M A;  4P75 A;  4ZLN A;  4O0I A;  2AX1 A;  2XMM A;  1XC9 A;  5KFL A;  2DNQ A;  4HR2 A;  2ZHO A;  3DLG B;  2FHM A;  4RNH A;  4MK9 A;  2EC2 A;  3P8B B;  1P27 B;  1R0B G;  4WTY A;  4AXI A;  5L9X A;  2D69 A;  3IRX A;  5EWF A;  1RAH B;  2Q6B A;  2ZIT A;  3UVJ A;  3HZE A;  1IBL J;  2HHU A;  2XNQ A;  4JI8 F;  2EFV A;  1QSS A;  3A3N B;  3C6U A;  3DRY A;  4ECS A;  5L9N A;  1NDL A;  2KXH A;  4PG7 A;  1PIE A;  1Y7P A;  3B78 A;  3WQP A;  4FVC A;  4WK3 A;  2KVI A;  4JI7 J;  1MRO A;  3BR9 A;  3MUM P;  4L3N A;  5J2N B;  1YJT A;  2Z2M A;  1WKL A;  1S1V A;  2GHV C;  3MPY A;  3HT0 A;  1NXI A;  4FPI A;  4P6Q A;  2MGZ A;  4J9R A;  4O3R A;  1B0T A;  4OZ2 A;  3LPY A;  3HZG A;  2KRB A;  3SIP B;  2PEB A;  4FXW A;  3SMZ A;  5KFZ A;  1O5J A;  5CYJ A;  4GVB B;  4LSZ B;  4JI4 F;  2FY8 A;  1IQZ A;  1JLE A;  4MYT A;  4ZPT R;  1NME B;  2YQ0 A;  3WX4 A;  1WC6 A;  4F0M A;  5SZT A;  1S1T B;  3TUZ C;  3ENA A;  4KRW A;  2CVI A;  4MFB A;  2JLE A;  1S59 A;  5D4N A;  3NLC A;  5KFQ A;  2FZC B;  1Q86 T;  2P8I A;  1M5K C;  1JXV A;  1ZAW A;  1LWF B;  1RT2 A;  2DGW A;  4DR4 F;  2R42 A;  4L76 A;  3HJF A;  1QE1 B;  2B7C B;  3LO3 A;  2DK2 A;  2MZR A;  2NXU A;  4UOF A;  4RU9 A;  2MGZ B;  3OJS A;  3K57 A;  3R5D A;  4U67 Q;  2YWW A;  1EKR A;  3QIP B;  4I68 A;  2RQM A;  4UZC A;  4B9U A;  4XIU A;  1GQE A;  3LWL A;  2UUC F;  1GFW B;  3FSX A;  4ZVU B;  1DQA A;  4LRC A;  2V4J A;  3KLI A;  4M5L A;  4HI2 A;  3MM9 A;  4OZ3 A;  3R97 A;  4JI0 F;  1JLA B;  1OQ6 A;  1E6Y B;  1BGX T;  1F2H A;  2XUL A;  3Q8U A;  5A8W B;  3CO0 P;  4AYB D;  4EBC A;  3IC1 A;  3R1H A;  3OXL A;  1EIY B;  4EFA C;  2LXU A;  1M5H A;  3W2V A;  3HM9 A;  2XI2 A;  3GP9 A;  1FTC A;  2G2O A;  1F3V A;  2BOA A;  4O4G B;  5F0W A;  3ISN C;  1FXR A;  1TU0 B;  5ITH A;  5GMD A;  1JLE B;  1LK5 A;  2CAD A;  5A0Y A;  2GGP A;  3NG8 A;  2XY5 A;  2ATL A;  4X65 F;  5KOW A;  4DS4 A;  4B3S J;  2B9X A;  1FJG F;  1T94 A;  1ZOT A;  3I5C A;  3OTD A;  4JOU A;  5D0H A;  3MEC B;  1RTH A;  3A3P B;  3WIU A;  2BR0 A;  1AYE A;  2VF3 A;  3GLJ A;  3QMQ A;  4DSL A;  2HHS A;  4Q44 A;  2WSC C;  2XO6 A;  2ZC4 A;  3GFX A;  1RAD B;  4LJM A;  2ZWP A;  2IJR A;  5KFT A;  3R3T A;  4EBE A;  2OEL A;  2ADB A;  4C97 A;  3KUE A;  4I64 A;  3AOD A;  5IC4 B;  2O5D A;  4LSL A;  1J2V A;  2V0N A;  4F4W A;  3MMA B;  4CIO A;  3HVT A;  4MH8 A;  2RUG A;  4IO9 Q;  1XNQ F;  1B4S A;  4EK2 A;  2UVV A;  3B8H A;  1VC0 A;  4C8Y A;  3OXF A;  1EET A;  1OY8 A;  2MQN A;  1FFG B;  3EUN A;  3UN2 A;  3M8S A;  2BAN A;  4ID5 B;  5CH7 B;  2QC3 A;  3VGT A;  2VG5 A;  1RT6 A;  4DV2 J;  1CJT A;  1HBN A;  3D28 A;  3RB3 A;  1B7Y B;  1SJ3 P;  1K73 T;  2ZHB A;  2ZH4 A;  2K3K A;  2LVW A;  4YOE A;  2XMT A;  2YNF B;  2I5J B;  3FUY A;  2EFG A;  4ID8 A;  1IR0 A;  3W64 A;  1NK6 A;  4NLX A;  3SCJ E;  1WEY A;  2KG0 A;  1FFS B;  2FJE B;  1LNQ A;  2HSE B;  1PBU A;  3US5 A;  5DDR C;  1UA1 A;  4ZVE A;  4C8O A;  2HVH A;  4M5G A;  2EI5 A;  1VIS A;  2HND B;  1PG5 B;  3FBF A;  3SCK E;  5IV4 A;  3J7Y I;  1YDL A;  2OD4 A;  2D3O 1;  3HK2 A;  1C0T A;  1REV A;  2HWH A;  4UQT A;  3PIP Q;  4DV6 J;  3OR2 B;  1VLY A;  3R2C J;  1IWG A;  5LMU J;  1TL1 A;  2PI4 A;  2ZD1 A;  1XQI A;  5BR8 J;  3MZI A;  1T05 A;  3LOU A;  5HRO B;  4JBC A;  4OX6 A;  3HHE A;  4QJV A;  4OYP A;  1CC8 A;  1YJ7 A;  4AXJ A;  2MHN A;  3FNN A;  4YB1 P;  3HX9 A;  3RRK A;  2J0X A;  1Q5Y A;  4O44 B;  4OI3 A;  2QLX A;  2E7X A;  4PXB A;  3TZZ A;  1LV5 A;  1F5B A;  1AT1 B;  3EZO A;  1X4E A;  3CVK A;  3FBB A;  3GWC A;  2F9D A;  5ETO A;  1RAG B;  2GJF A;  2C2K B;  5KT5 A;  4DV2 F;  2UUB F;  3EVW A;  2DCU B;  1CC7 A;  2ASJ A;  2HEK A;  2F4F A;  1U0H A;  5K8P A;  1ZYQ A;  2V8G A;  4KFB A;  4OJH A;  2CYY A;  3U27 A;  1KQS R;  5E41 A;  2OUG A;  4RW6 B;  2W25 A;  2GC8 A;  3PEH A;  3T6J A;  2OO4 A;  4YR3 A;  1VK3 A;  1JJ2 R;  4M95 A;  3H59 A;  4E2F B;  3KHG A;  1SV5 A;  3IGN A;  1JNR B;  2RT3 A;  2ZH3 A;  1N34 F;  2XQC A;  3CCM S;  4RZR A;  1UZD A;  2ZH5 A;  1RT7 A;  3KUG A;  1IKX A;  1X4C A;  1YBU A;  2YWH A;  2HG4 A;  3NGK A;  5DDO C;  4J91 A;  3H40 A;  3VAL A;  4Q8E A;  4ZPV R;  4GO5 X;  1PYT A;  4HDG A;  1G2E A;  1QTN B;  4XDC A;  4BBY A;  2J9D E;  4LRF A;  1NDK A;  4OMF G;  3RU0 A;  1HI0 P;  3DGP A;  2N4C A;  3KLE B;  1YIJ S;  4JP8 A;  1R6V A;  1SQG A;  2MQQ A;  3PIO Q;  4U7U D;  3MAA A;  3AAW B;  3CJ2 A;  1LEO A;  3ET6 B;  5HL7 Q;  5AT1 B;  5JJB A;  2EK6 A;  2CJB A;  4ELT A;  2CPI A;  3PX0 A;  3V2U C;  4LF6 F;  4PUO B;  3ILO A;  3PEJ A;  3RBZ A;  5LJ3 Y;  4RKU C;  5E3Q A;  3OTB A;  1K1S A;  2YWF A;  1RWO B;  2XM3 A;  3FSI A;  2QLB B;  4OZJ A;  4IFY B;  2Y1I A;  4K4Z A;  1KNZ A;  4QYZ J;  1ZA1 B;  1N8R T;  2BJ8 A;  3TAQ A;  1X9M A;  2VON A;  3IA0 A;  1VQK S;  4M5N A;  4K59 A;  2B3T B;  3LGM A;  4RNM A;  4K8R A;  2V6A A;  3OUY A;  2CZV C;  3A8K A;  4M5M A;  3TVY A;  1X8D A;  3GFY A;  1YHQ S;  4DHV A;  4DR1 J;  3HSD A;  2MLY A;  1CBK A;  1HNV A;  4KV8 A;  3NY0 A;  3ILJ A;  5M2P A;  2E29 A;  3CD0 A;  3IBF B;  2VKZ G;  3QGI A;  3OL7 A;  4NYO A;  1UWA A;  2EXU A;  2E1A A;  3ZO7 A;  3CDU A;  2QSF A;  4WYW A;  2IA0 A;  2R8I A;  4TY8 A;  2XLJ A;  3UDV A;  1UA0 A;  1R0A A;  1IBK J;  1FA0 A;  2ACM A;  1RWU A;  4Y2A A;  3BS9 A;  4NEY A;  1T11 A;  2KT3 A;  2CNN B;  2VFU A;  4JI7 F;  4PUO A;  4RBU A;  5IC6 B;  3NRB A;  3D6F B;  2V8P A;  5B0C A;  1NHV A;  5HJX A;  2J9C A;  5ETL A;  2QV6 A;  5GAD U;  2F9J A;  2PMZ D;  3H25 A;  2DR8 A;  2R2U A;  4U8V A;  2V2V A;  5J2N A;  4ECZ A;  4ATN A;  3TRG A;  1GTE A;  1PCA A;  2NR0 A;  3PW0 A;  1VJQ A;  2IRU A;  1MN9 A;  1ZM4 A;  1EP4 A;  3LPE A;  1RE1 B;  2DHS A;  3H0P A;  3MMC B;  3PRV A;  2HVE A;  2YWK A;  4OQJ A;  4P52 A;  5ETV A;  3MDF A;  4JI3 F;  2BW7 A;  1V3S A;  1FRH A;  1U26 A;  3GG0 A;  3S1T A;  5C25 A;  2E5L J;  3BBB A;  3R5C A;  4A8Q A;  4GKJ F;  2YKQ A;  4I67 A;  2WTF A;  3LAK A;  2G0C A;  3W61 A;  4DV5 F;  1NK8 A;  5JMN A;  2DGQ A;  4BC9 A;  5B0B A;  1KLN A;  1YGY A;  2Y9H A;  5IS2 A;  3CWJ A;  3D54 A;  1KTV A;  1RT4 A;  3VV2 B;  1JQG A;  3L7O A;  4DZ6 A;  4TQS A;  3KMS A;  3WHI A;  4J9V A;  5H9E K;  1UW9 A;  1MWY A;  2BBE A;  1RCX B;  2U1A A;  3QAE A;  3QO9 A;  1FJE B;  2MJU A;  3NMA A;  1IKY B;  4P2F A;  1U6Z A;  3D0I E;  1WG4 A;  4NZ6 A;  4CNY A;  3VAF A;  3G96 A;  1CPZ A;  1M1G A;  2NPI A;  1LWC B;  1VYA A;  5C25 B;  3GYX B;  4F04 B;  4NLG A;  2GIQ A;  2YKP A;  5CYM B;  2LEC A;  5K20 B;  2ROE A;  3CJ8 A;  3RAQ A;  3D6M B;  3W60 A;  3M8Y A;  2EG1 A;  2P9C A;  4F3M A;  3RR7 A;  5GME A;  5T7L A;  1MG7 A;  1U2F A;  5HAO A;  5KT4 A;  3CDW A;  3PW7 A;  4CTA A;  4GKJ J;  1WI6 A;  2HLT A;  5KFR A;  3ISN D;  2IC3 A;  3DRX A;  3GON A;  4OHW A;  1TUG B;  4WP9 A;  3W2W B;  5DM6 Q;  4JI1 J;  4WJB A;  3K0J A;  3AD8 C;  3MEC A;  5DDQ C;  1PIL A;  5C42 B;  4CZC A;  5F8G A;  1EAY C;  2DGS A;  1N5S A;  1RHU B;  4X66 F;  3BQ1 A;  2JEI A;  5GAG I;  1X4H A;  1IKW A;  2QRR A;  3CPW R;  2V9K A;  1IKV A;  2UXC J;  2QO3 A;  1ACM B;  5KFC A;  2JEJ A;  3N9U C;  2KM8 C;  1SB6 A;  4IR1 A;  3W5X A;  2J7K A;  5J2P B;  2CWK A;  4FVM A;  4IG0 B;  3AXK A;  1HNX F;  1T9W A;  4NMX A;  2HGN A;  3TQ1 A;  2WW8 A;  3IBW A;  4UOC A;  1Q0N A;  4A8K A;  2OGU A;  1U02 A;  2BKP A;  3DRR A;  4AFF A;  3HP6 A;  3GIJ A;  1PYS B;  3QLH A;  2R8H A;  4A4J A;  1S97 A;  2ZDP A;  3POT B;  2FIU A;  4JYA F;  2JWN A;  3HUL A;  3WDO A;  3KLG B;  4QZV B;  3A8E A;  2IIH A;  4ZN3 A;  2W2M P;  3TZX A;  1N0U A;  3MOZ A;  2HMI A;  5DQI A;  5J2M B;  1N33 F;  4ZVR B;  1IUJ A;  4Y65 A;  4NLQ A;  1RTI B;  2H65 B;  4ZP8 A;  2Q1L A;  3JYT B;  1ZAX A;  3NGU A;  1NUE A;  4ZVP B;  4A8X A;  4TNO A;  5B08 A;  5CZX A;  1GMV A;  3SFU A;  1MMN A;  3H98 A;  2HHH F;  3IG1 A;  4NI2 B;  2W4D A;  3W62 A;  2PGC A;  1N56 A;  2R7X A;  5CYQ B;  4ZIW A;  2ZNZ A;  3CJ3 A;  3VHQ A;  4YR2 A;  3HSG A;  3ILI A;  4HAC B;  4OZN A;  4WFY A;  4OI2 A;  4WZM A;  2HRY A;  1B0P A;  3F0N A;  3ZNJ 1;  1VBX A;  4AL5 A;  4J9S A;  2BX6 A;  4ZVH A;  2EC0 A;  1WHY A;  4TLR A;  4CLT A;  5EUH A;  2XCP A;  3M9M B;  1QVG R;  3OHB A;  1DTQ B;  4HAC A;  2H5E A;  4J7C A;  4LF4 J;  1S1U A;  4FYW B;  1T9V A;  1RTD B;  4ZS6 A;  1SH0 A;  3NGR A;  4F4Z A;  3L9Z A;  2H5I B;  4LBI A;  4NA3 A;  1LW2 B;  2IPO B;  3VAM A;  4DV1 J;  4LMZ A;  2YVS A;  1TMM A;  3D0G E;  1VRQ C;  3MEG A;  2WZ1 A;  5BXI A;  1NKC A;  2QA4 S;  3DXB A;  3L3C A;  1S9F A;  4Z7Y A;  3MUV P;  4RBT A;  4X4N A;  4B3R J;  3EGN A;  1M90 T;  3FEZ A;  3D3C J;  3E01 A;  5L46 A;  1Z2Z A;  5RUB A;  1OWX A;  4C8Z A;  4HTI A;  3OXG A;  2ZVS A;  2JZ5 A;  2ZWO A;  1HW9 A;  1MWQ A;  3IM9 A;  2CKW A;  1FEH A;  3NAH A;  4KGV B;  4KGX B;  4WXW A;  3IXQ A;  2C2E A;  3W2W A;  1U1P A;  3GPA A;  3S8S A;  3OTO F;  1HR0 F;  2J8S A;  1FX2 A;  4C0B A;  1S1U B;  4O44 A;  3D0H E;  5E33 A;  4NL5 A;  5CZV A;  1L3S A;  2DHG A;  2P6S A;  1RJJ A;  2CPX A;  1IM6 A;  2C3O A;  3HHL B;  4M1K A;  4ZA1 A;  2VJV A;  3IN5 A;  1BLU A;  1H73 A;  3CB4 A;  4DL7 A;  4CH7 A;  4HVZ A;  2GHP A;  1KQK A;  2W9B A;  4WWS A;  1FES A;  3GYG A;  3TX0 A;  3UD5 A;  5JXS A;  1APS A;  4F4K A;  4ES2 A;  3D6T B;  1HWU A;  3PYF A;  4PPZ A;  1SV5 B;  1S79 A;  2YQ1 A;  1KLM A;  1FK9 A;  1FXL A;  4ZCM A;  1T95 A;  3D5M A;  4PAB A;  4W98 A;  1S0N A;  1SKU B;  5KFA A;  1VQ7 S;  2HHH J;  1FE4 A;  3AHP A;  3JTO A;  4F25 A;  1FWL A;  3UNG C;  5IT9 U;  3KLH B;  2VUG A;  1U0H B;  2HAI A;  2HHQ A;  2Q3P A;  2CJA A;  3CJ4 A;  2YNI B;  4CRJ A;  1T03 B;  5K14 A;  3I0S B;  2GZO A;  1WG1 A;  3THT A;  2ZM6 J;  1Y11 A;  3AQO A;  2L41 A;  1F0X A;  2QT7 A;  4WFA Q;  5EDW A;  4QWE A;  3A1Y G;  4K2X A;  5KFJ A;  4F67 A;  3PZP A;  2OP5 A;  3UN3 A;  2Y0B B;  3EXC X;  1T05 B;  3HJV A;  3N4W A;  2MKY A;  4YDX A;  2J0Q D;  1NAQ A;  4G1Q A;  4RWW A;  4NLW A;  1GX6 A;  2HBR B;  4WE1 B;  2FZK B;  5CXT A;  3FRZ A;  1Y5N B;  1UEU A;  4NPO A;  5EX3 A;  1B64 A;  2MZS A;  2ZJQ Q;  1SH3 A;  1YVF A;  2YWE A;  1N6Q A;  3I55 S;  1D1U A;  1D0E A;  1ZM3 A;  2WRM A;  4U9R A;  1E6V A;  3MMB B;  3DMJ A;  1X5P A;  2HIY A;  5M2R A;  1VQL S;  3FBC A;  3M2U A;  2DIV A;  4YB7 A;  2CAJ A;  2WSE C;  3M9O B;  3CIM A;  3SSR A;  5F8L A;  3QT5 A;  1RBA A;  3I6P A;  3CF5 Q;  2G13 A;  3VAH A;  2ZJP Q;  1C0U B;  3Q22 A;  1B7F A;  4B17 A;  3NEK A;  3MR6 A;  3HFZ B;  5L1K A;  4EU0 A;  1X4G A;  4Y2M A;  1BWE A;  1V5V A;  4B9S A;  1SIW B;  3FGV A;  2E5H A;  3PRD A;  2CPY A;  3CCS S;  1IKX B;  1PAE X;  3MFH A;  1KR4 A;  3PJ9 A;  4FN5 A;  2FVQ A;  1V3R A;  2EVZ A;  3GJS B;  1TTH B;  4RW4 A;  3IAS 9;  1QSL A;  4N76 A;  1S77 D;  4J9Q A;  3MMA A;  3QT7 A;  5B0F A;  4LSL B;  3MPW A;  1WC5 A;  3QQC D;  1LWE A;  3GR0 A;  2MKJ A;  3DDK A;  4DX5 A;  3PM9 A;  4ANE A;  3KLG A;  3B4D A;  4IH5 A;  5D0E A;  1BD6 A;  4ZMM A;  1S0M A;  2QJ3 A;  4F2R A;  4ECW A;  1DLO A;  5D6G A;  1FDD A;  2F4V J;  2HRU A;  3FFI B;  1H6K X;  1HPZ B;  1HWK A;  4TKT A;  3G6X A;  3UCU P;  3KLE A;  2DHA A;  1NJX A;  4PG8 A;  3KG1 A;  4NCG A;  1ZET A;  2KHC A;  4WCE Q;  1OSC A;  2N3L A;  5J2M A;  2GCF A;  4C8K A;  2HZV A;  4K4W A;  2KJV A;  5EX0 A;  5IQ6 A;  4NLS A;  1RA7 A;  2OJ3 A;  3SDE A;  2Z4P A;  2NRE A;  1NPK A;  1NDP A;  1QM9 A;  4XDD A;  3M8Q A;  4UW2 A;  1NHU A;  3FRY A;  4ZVO B;  1P9Y A;  5ETN A;  3W8P A;  3M2V B;  3HD2 A;  4I56 A;  2HNY A;  3F73 A;  5HP1 A;  4RUA A;  2HQF A;  5ETK A;  3KNA A;  1PJ6 A;  2BJ9 A;  3LAN A;  4JI8 J;  3HSJ A;  4L72 B;  2Z58 B;  2CQI A;  1RT1 B;  1NJW A;  1UW4 A;  2CJ9 A;  1VQN S;  1JWW A;  2OPS B;  3H4D A;  2XMV A;  3HI9 A;  3J7A 1;  2F65 A;  2I8E A;  2NS1 B;  1HNV B;  2AEF A;  1G6B A;  2D1C A;  2KVQ E;  2GV1 A;  3MUR P;  3CSK A;  1HYS B;  1EET B;  2WON B;  4CLK A;  3KG0 A;  5L38 A;  3DDI A;  5KFM A;  4Q8F A;  3CJS A;  1UVM A;  3OT9 A;  5I3P A;  4DLG A;  1RKJ A;  3GV7 B;  2XS7 A;  3LP2 B;  2H3E B;  3DOK A;  1TR0 A;  5THW A;  2B0G A;  4Q5V A;  2ZBQ A;  1ELO A;  4HT5 A;  5LSO A;  3G6E S;  2O1P A;  4I7F B;  3DGV A;  4K4S A;  3PTW A;  3RRH A;  3THV A;  1EQ0 A;  3NWR A;  3I9V 9;  2BJ7 A;  3HPO A;  3G86 A;  1JLC A;  1OY9 A;  4FNI A;  5A8K B;  4JI4 J;  1S6Q B;  1TKX A;  2LEP A;  3H4B A;  1M5P C;  2XS5 A;  2UXB F;  2ZUA A;  1TKT A;  4ZCK A;  4NLT A;  2RHQ B;  1WHV A;  1ZA2 B;  3ETM A;  3MAA B;  2UUB J;  2L9N A;  1WKJ A;  4DFP A;  1R8B A;  2FLL A;  1IQT A;  1GMW D;  3DM2 B;  1N34 J;  2PSZ A;  1RTJ B;  2PII A;  4L3K A;  3M6U A;  3BSN A;  5B0E A;  2HHW A;  3PW4 A;  2JL9 A;  4OJG A;  1U1K A;  5J2Q B;  2HMI B;  2YKO A;  1TEL A;  5D0R A;  2AIR B;  1CLF A;  4ICL B;  1PC4 A;  4C3K A;  5KT7 A;  2PA8 D;  4CLP A;  5L39 A;  1SC6 A;  4O3P A;  2CFX A;  1P9Q C;  1IBM J;  3BSO A;  3RAM A;  4C3L A;  1I3O B;  4DV0 F;  3KKF A;  5FII A;  3NXZ A;  3GV5 B;  1KRP A;  2JLF A;  4LF8 J;  1V9O A;  4KJI A;  1VFJ A;  5J2Q A;  3KLI B;  3LGN A;  1HNZ F;  4MK8 A;  5FJ4 A;  4H54 A;  1SQF A;  4A8W A;  4P2M A;  4NX9 A;  4GMK A;  1RT3 A;  2YNF A;  4IRD A;  1LW0 A;  5DM7 Q;  4I2P B;  5EWG A;  2UU9 F;  3KDN A;  2HBQ B;  3C8Y A;  5LMU F;  2IY5 B;  3KWM A;  1FX4 A;  4PR6 A;  4F4A A;  3PFO A;  2OML A;  2RKI A;  4X2B A;  4G1P A;  3SCI E;  3TNV A;  4NLD A;  1Y00 A;  2BA9 A;  2HQD A;  2LQB A;  2V34 A;  5AXK A;  2G4B A;  1FRK A;  1DJ0 A;  3CCT A;  9ATC B;  2ZD1 B;  1Q8B A;  2YKM A;  3R6G B;  5ETT A;  5F9N A;  1RCO B;  4JV5 J;  2QG9 B;  3NOG A;  2MPU A;  5HO4 A;  2HNZ B;  2ILZ A;  3R7N B;  2K06 A;  5D15 A;  4FBU A;  1XR7 A;  1HLW A;  2RAQ A;  3OL8 A;  2B4V A;  3D66 A;  3R7S B;  1R7I A;  1WOR A;  4ES3 A;  4ZHR A;  1LW0 B;  3MOJ B;  2DXD A;  3FCH A;  2ZDO A;  3MAQ A;  1EAR A;  1RT3 B;  2IM3 A;  2D9O A;  4NLY A;  4O23 A;  5AJ3 F;  2Z8Q A;  3Q8Q B;  1B0V A;  5J2P A;  1UWB A;  3F56 A;  4DZD A;  4IOA Q;  5H9F K;  2KH9 A;  2G1D A;  2KB2 A;  3T5J A;  1GXU A;  2OSQ A;  4A48 A;  4IFY A;  2DR5 A;  4KO0 A;  5KFP A;  3BV8 A;  2WW4 A;  2RQC A;  1T03 A;  2OFH X;  4ID5 A;  2FJV A;  1S7H A;  2FUG 9;  2QLW A;  3MCO A;  4IDK B;  2FQQ B;  1YTY A;  1ARO P;  2ZZM A;  1FJ7 A;  4WU2 A;  1NDC A;  3W8G A;  4Y28 C;  4CO1 A;  3KHH A;  2IYI A;  3KJN B;  2FVP A;  1IJF B;  4LVO P;  1C4A A;  3EZU A;  3U1L A;  5HMY A;  1RYR A;  4OYW A;  3NCR A;  1JLA A;  1WEZ A;  3TYT A;  5K5M A;  2E5I A;  3MR7 A;  5MLC V;  1UFW A;  3DM2 A;  1SJR A;  2CDR B;  5HBM A;  3GR1 A;  2XMA A;  4JI2 J;  1T3N A;  5D3G A;  3CDA A;  4R0J A;  1FKP A;  4CM2 A;  4B3S F;  1FJG J;  1U8S A;  1WC1 A;  3UN5 A;  2CWX A;  2GVZ B;  2ZBI A;  4LR7 A;  2V8H A;  4H4K C;  2LQJ A;  2DBB A;  3CD6 S;  2Y0S D;  2GIF A;  2G9O A;  2HVZ A;  1GMU A;  4MK7 A;  2YPY A;  4CP5 A;  3RYL A;  2RIJ A;  3IBC B;  1DRZ A;  3JTP A;  2L9D A;  4BWJ A;  3GU0 A;  1H7W A;  4YQW A;  4CLW A;  3LF0 A;  4KB7 A;  2ZFH A;  1MML A;  4WK1 A;  2NCK L;  2YNG A;  3CJT A;  3UR0 A;  3P6Y C;  1OQ3 A;  3M1V B;  1TK8 A;  5L1L A;  2PDA A;  1JLF A;  2OEM A;  4ZPB A;  2CA9 A;  3UWT A;  4NYZ A;  4OV1 A;  2E66 A;  2OPR A;  3GSI A;  4IDK A;  1UL3 A;  5KOX A;  1URR A;  2R4F A;  5CA5 A;  4H4O A;  4OFZ A;  1QSY A;  3G8S A;  1OSD A;  3L09 A;  1N32 J;  1X5S A;  4Q2L A;  2XGQ A;  3DHX A;  4OZ0 A;  1FXD A;  5KFX A;  1H2U X;  3IFE A;  3TJ9 A;  1SKR A;  3GIM A;  1RWW B;  4WXO A;  2WOM B;  1N88 A;  2HFU A;  1NK5 A;  3GFH A;  1KQG B;  4J90 A;  5IXU A;  3BQ2 A;  1IKV B;  3X3U A;  4N41 A;  1WOP A;  1CJV B;  3CCZ A;  4ED1 A;  2DNL A;  2N7C A;  2CPJ A;  3B6B A;  5EWE A;  4QIW D;  3DLH A;  4X4V A;  1JLB A;  1N33 J;  2XWY A;  2VBW A;  2AZ1 A;  4OX7 A;  4ZPD A;  2Z57 B;  3AFG A;  4DU7 A;  3QRQ A;  1U0S A;  4FPR A;  1FKO A;  2KFZ A;  2CIM A;  4PWD A;  3OVB A;  4J9N A;  1K47 A;  2VA3 A;  3ICL A;  1BQN B;  4ZVG A;  5C2G A;  3KNG A;  5F9L A;  2LLZ A;  2LQ5 A;  2A2C A;  1YJ9 S;  5T7L B;  1Q16 B;  2ADC A;  2P2C B;  4DQP A;  3C15 B;  1MNE A;  2LEA A;  1K44 A;  3EDQ B;  4PPD A;  3ZFV A;  5C2C A;  4YUD A;  1KEK A;  1UVK A;  1MN7 A;  1XJW B;  4C98 A;  3E3X A;  3E2E A;  1JLC B;  1RSC A;  3QT8 A;  4LFA J;  2DNG A;  2C28 A;  2B6A A;  3V6D A;  2ILY A;  4DSI A;  5AJ3 J;  2JFD A;  1N36 J;  2WCX A;  4A46 A;  3IAM 9;  5F3Z A;  2GW8 A;  1EHW A;  4TXS A;  2GJI A;  2XSJ A;  4OI1 A;  4KPC A;  5D3G B;  4DX6 A;  4DR4 J;  2EFO A;  3A13 A;  1ZM2 A;  2N4D A;  1FEE A;  2DNM A;  3E51 A;  1XNQ J;  5KFD A;  2VZ9 A;  4F7V A;  4DFJ A;  2XMW A;  3BGR B;  4HI1 A;  3TA2 A;  2AJ4 A;  3MWB A;  2NLW A;  3TWZ A;  2KU7 A;  2XS2 A;  1NBE B;  1ICE B;  2Y1R I;  3HHL D;  2BOP A;  1UFK A;  7AT1 B;  3KLF A;  4ZN1 A;  3ZC4 A;  4DUY J;  2DPI A;  5DO2 A;  5KFG A;  2IDE A;  1O6X A;  1J27 A;  1NZA A;  3FJ2 A;  4USH A;  5CCL A;  4QIF A;  4RW8 B;  5DET A;  1RA6 A;  3MFI A;  1HAR A;  3FC9 A;  4OIX A;  2BAB A;  4MIW A;  4AQY J;  2QYC A;  5E5N A;  1X60 A;  5J1E B;  4B3O A;  3NS5 A;  2LA4 A;  4CO0 A;  3MPD A;  5F8J A;  3QJL A;  1T9Y A;  2COL A;  2Q66 A;  1B3T A;  4D3H A;  3PR4 A;  3VR1 A;  3ULH A;  3BJY A;  1YJV A;  2OI2 A;  3H7H B;  4MKY A;  2XCA A;  1XWL A;  3AH6 A;  1SXL A;  2LDI A;  1RT5 B;  1I94 J;  4V19 J;  3HO1 A;  4JI5 F;  3CJK A;  5KFU A;  3ZZO A;  4DV5 J;  1ITP A;  4DEZ A;  2V4J B;  3FEY B;  1Y5I B;  2MY8 A;  4MYU A;  3MR2 A;  2O66 A;  2E9R X;  2CG4 A;  7FDR A;  1MLA A;  5I4M A;  1RAF B;  4B9L A;  1WSV A;  2LP4 A;  5FDL B;  3KLV A;  3QIP A;  2M2B A;  2HK3 A;  4NZ7 A;  2WB4 A;  3FFI A;  3BO4 A;  3BEG B;  4C6A A;  2AU0 A;  1TAU A;  4IO1 A;  4JI5 J;  2R8J A;  4MJK A;  4UTG A;  1NZ8 A;  4QWB A;  3H2L A;  1GEH A;  4BC7 A;  2M88 A;  2VPY B;  3RUB L;  2E44 A;  2QL7 B;  3HSZ A;  4K2J A;  4XTT A;  5K8M A;  4YHH J;  4I0W A;  2DR7 A;  4WBF A;  3AOA A;  1WF2 A;  4PXD A;  2YNG B;  5CQG A;  1LWX A;  4RL1 A;  2C3Y A;  3M8P A;  4GVB A;  4QU6 A;  5HQL A;  2PN6 A;  2VBX A;  4KHR A;  1A6L A;  5E3C A;  4WFB Q;  1ZZN A;  1D9F A;  5HN0 A;  3V6D B;  4JI3 J;  3ITH B;  2R2R A;  1QJH A;  2F1F A;  1HNI B;  2KFY A;  1ZS6 A;  4LF7 F;  4BS2 A;  1G3O A;  1S1W B;  4D3G A;  5KG0 A;  4DQR A;  1A7G E;  4FKY A;  3PW2 A;  4AUK A;  1FKP B;  1UJ6 A;  2V68 A;  4RUH A;  2DH9 A;  3MED B;  4DX8 H;  3DGP B;  2KO1 A;  3C3L A;  4G1I A;  2RS8 A;  1HI8 A;  3C6U B;  3FZ2 A;  4M5D A;  4DBQ A;  2M0G B;  1W2I A;  1RKI A;  3DU6 A;  3W66 A;  4EUV A;  3PFE A;  1VC6 A;  1QAJ A;  5IT4 A;  1DTT A;  3CD5 A;  2PO4 A;  2RUS A;  5IV3 A;  2FVS A;  3DMJ B;  1HWL A;  2EEY A;  3NNH A;  1SC3 B;  2ZKU A;  3LUY A;  4H4M B;  2IM2 A;  2ZOG A;  1CJU A;  2D7S A;  2FLN A;  3ITH A;  2W8L A;  4X4P A;  1E6Y A;  2BJD A;  2YXL A;  5LSR A;  2F8H A;  3M4X A;  5A8R A;  2BKO A;  2X1F A;  3EMT A;  3D7S B;  3VZI A;  4LF4 F;  1EX8 A;  3GFZ A;  4RW6 A;  1HBM A;  3O3L A;  3TEH B;  4CO3 A;  1D8Y A;  3MF5 A;  1CEZ A;  3RB0 A;  4FBT A;  3DRP A;  3M6X A;  5B0A A;  3W5Y A;  1NK9 A;  5L8R C;  2W2N P;  3HCX A;  1NSA A;  4IFV B;  4L73 A;  1VHF A;  4LRA A;  4GC7 A;  4A8Y A;  2VG7 A;  3E8O A;  3CT9 A;  4ED5 A;  1YJU A;  4N56 A;  1YZ7 A;  3DLL Q;  1C1B B;  2YBV A;  3M30 A;  4OYO A;  6AT1 B;  1UPP A;  4X4O A;  3MED A;  1FF2 A;  3V4I B;  4OYI A;  3T6B A;  3VF0 B;  3OSN A;  1HBO B;  1A9N B;  4P73 A;  4QR2 A;  1QUP A;  3EGW B;  4N7T A;  4LSN A;  3Q0A A;  4OYM A;  1RHR B;  2C2N A;  3NWG A;  4ILM A;  1PBA A;  3JYT A;  3IWL A;  1FDB A;  2MY7 A;  4KKO A;  2GVZ A;  2AGO A;  4NE9 C;  4PCQ A;  3UDC A;  5J1E A;  1P8G A;  1LFW A;  2D3Z A;  2Q79 A;  3CCW A;  2VPZ B;  3OPK A;  1U49 A;  4F4X A;  4FF1 A;  5IWA J;  5CCM A;  5BR8 F;  4JV1 A;  1U2R A;  3UVJ B;  3MM7 A;  3Q86 A;  4HH0 A;  2HZC A;  3NOC A;  4DV3 J;  5CD4 H;  3I0S A;  5K8O A;  4J9L A;  2XSF A;  4RBV A;  4A8M P;  2DHH A;  1S0O A;  5H1S V;  1U6B A;  3AJ1 A;  2UVU A;  1R0C B;  1VHI A;  2V4Q A;  2XO7 A;  4JI1 F;  1LWE B;  3KJF B;  1T3O A;  4Q7A A;  4ECY A;  4CLY A;  4DR1 F;  3BSA A;  3MEG B;  4DUT A;  2AJ2 A;  1GNK A;  4PG4 A;  1EZZ B;  2NZC A;  4QR1 A;  4ALZ A;  4OHV A;  1R8P A;  4K7Q A;  1S9E A;  3PHT A;  2FJA B;  1X31 C;  2RU9 A;  2F40 A;  3CCV S;  2EKY A;  3BB5 A;  4E98 A;  3CTR A;  1DTQ A;  5LSL A;  4OLP A;  1NB7 A;  4DSK A;  1XNR J;  1S6U A;  2X51 A;  3RRG A;  4MAK A;  3IWN C;  2MMY A;  1HFE L;  2IRY A;  2VD3 A;  2BE7 D;  3ONQ A;  4YY3 J;  2DO0 A;  3LGH A;  2UUW A;  3RB6 A;  2G2Z A;  1VCT A;  2OEJ A;  3BBC A;  4DXL A;  1G7C B;  4RLE A;  1SL1 A;  2CDQ A;  4A8F A;  5CYQ A;  3H20 A;  4QW8 A;  1BQM A;  2B8P A;  3B4M A;  4JI6 J;  2XI3 A;  3OR1 A;  1Q82 T;  1N5Q A;  2K7J A;  4JUZ A;  5KG4 A;  2N7Y A;  2MLX A;  3KUH A;  4LFA F;  2OAU A;  2VFS A;  3IP0 A;  3GCW P;  1AZS A;  4KO0 B;  2ZE2 A;  2BJ1 A;  4ZP9 A;  1KTQ A;  3TAM B;  3TUP A;  2E1M C;  3OW2 R;  1NLK L;  5U47 A;  1WWH A;  4K0K J;  4NCA A;  2QSW A;  2XZW A;  5H9F J;  3VGS A;  1UPM B;  3NS6 A;  3CC4 S;  2JEF A;  4C9D A;  1NH8 A;  2CG8 A;  1ZPW X;  3ELH A;  3G82 A;  3QLH B;  2NXC A;  5G0R A;  4ZVF A;  3AD7 C;  4I4B A;  2X3G A;  1NK7 A;  4JI0 J;  2I0X A;  4M5I A;  1VBY A;  4F3O A;  2G0I A;  3D1Q A;  8RUC A;  1Y4Z B;  4B9T A;  2V63 A;  1VGY A;  4FDF A;  3VAI A;  5K8N A;  3GII A;  1EP4 B;  3NGD A;  2DNO A;  4DV3 F;  2KHD A;  4WYL A;  1S1T A;  2RQK A;  2BV3 A;  2H48 B;  4U8Y A;  1VBZ A;  1WF1 A;  1WD6 A;  4B3M J;  4XK8 C;  1M5O C;  3GG1 A;  3MTJ A;  3J81 Y;  2YNH B;  2KZZ A;  2QMW A;  5LXY A;  1UVI A;  1T9T A;  2A18 A;  1KS2 A;  4B3R F;  3I5A A;  2J7U A;  2HFO A;  2GAG C;  4I2P A;  1UEV A;  4NLU A;  3JSY A;  4JI2 F;  1FER A;  4I1T A;  1HQ2 A;  2CXE A;  2RML A;  3ISZ A;  2CNK B;  4CI0 B;  2BE9 B;  3B82 A;  3TJA A;  2WVD A;  1FNO A;  2GA7 A;  4DS5 A;  1YG0 A;  4PWU A;  4DU8 A;  1IR2 A;  5BYR A;  3MR3 A;  1GXL A;  4KV8 B;  2OFG X;  3ENQ A;  1KN6 A;  2WAQ D;  3OD2 A;  4K4Y A;  4CLU A;  2V67 A;  3DN9 A;  4X4S A;  1FD2 A;  3M6W A;  4PZV A;  3WX8 A;  3ZZR A;  4DPX A;  3HHK A;  1OYE A;  3CW2 C;  3R9L A;  4ECT A;  2M9K A;  1DTT B;  1P1L A;  2OPQ B;  4NRT A;  5I3Q A;  1Q1K A;  3UDE A;  1W2B R;  2WBM A;  3VQT A;  2W4P A;  5HMZ A;  3HHD A;  4ZP7 A;  3W9I A;  3G8Q A;  3FCV A;  4NLR A;  1HNX J;  1NJZ A;  4KPY A;  1SVD A;  3CO9 A;  3BRE A;  4TN2 A;  4O0N A;  4BWM A;  1RAE B;  3OR1 B;  3CCU S;  2NZ4 A;  2P9G A;  4EO6 A;  2EW9 A;  1VRT A;  5DJB A;  1X0P A;  2CRL A;  3HVA A;  3MM7 B;  4DPO A;  4LVN P;  4DCO B;  2ASL A;  4ZJQ A;  1RAO A;  1SKW A;  2B9W A;  4MIA A;  1FRJ A;  1D8Z A;  1S49 A;  5ETP A;  4GRS A;  1NK0 A;  1FE0 A;  3LP0 B;  2C3M A;  4Q0B A;  2GX8 A;  3DHW C;  1RI7 A;  2Z30 B;  3CME S;  1JLG B;  1YBA A;  2JVR A;  5GAH U;  3AB2 B;  5EN1 A;  5DZ7 A;  3GIL A;  4NXN F;  3Q8P B;  5HLF B;  2C22 A;  1YX2 A;  4K5R A;  3ADA C;  1Z1Z A;  2Z2Z A;  4IR9 A;  1R89 A;  1MW7 A;  1BXN A;  2OPS A;  2KL8 A;  1RWM B;  1C0U A;  2W2O P;  3VVT A;  4ETZ A;  1WC4 A;  2AZ3 A;  2DNN A;  3TZY A;  1G4C A;  3KLH A;  1I94 F;  2E1R A;  3M6V A;  4OHX A;  3W63 A;  4MKB A;  1KBR A;  2DGT A;  2KI2 A;  4WTO B;  1UCN A;  2ZM6 F;  3UI3 A;  2RD5 C;  4CM0 A;  5GAE U;  4G3I A;  2H9Z A;  2HFS A;  3C6T B;  2HAF A;  2YX1 A;  5EGY A;  4QYZ K;  4I2Q A;  2PMW A;  2MDA A;  4O4R A;  4QOT A;  3KXD A;  4O3Q A;  2XEX A;  4YB5 A;  1W7W A;  4FZV A;  4URS A;  2UUA F;  2EKN A;  2R8K A;  2HFN A;  2U2F A;  3D68 A;  3QSI A;  1X4B A;  4LIW A;  3DKD A;  4ZDN A;  3W5Z A;  1Y10 A;  1RHJ B;  2QA2 A;  3RZA A;  3PV8 A;  1HQE B;  2NPF A;  2UXB J;  4NML A;  5MAO A;  4DV4 F;  3JTN A;  3FMW A;  2ZOF A;  3QYY A;  2LQ9 A;  4RW7 B;  1T9U A;  5K9F A;  3VGV A;  1VQ9 S;  4ZLL A;  3O8W A;  4ZVS B;  2BQ3 A;  1V6H A;  2GQQ A;  2XLI A;  5LMN F;  3CC2 S;  3OSP A;  4UUX A;  1HBU A;  2F8E X;  2UP1 A;  1XMB A;  4PYA A;  4QIE A;  1U47 A;  3T1Y F;  4DLE A;  1FO1 A;  1X5T A;  2I5J A;  3E01 B;  4JI6 F;  2HHV A;  4WF9 Q;  4ED8 A;  2HWT A;  5D4O A;  2AJ1 A;  2K3I A;  2QIF A;  4USU A;  1T9X A;  4GKK J;  1BE4 A;  1DQ8 A;  2X1G A;  3AOC A;  3M05 A;  1ZAV A;  3KG4 A;  3LP2 A;  4CYU A;  2VBZ A;  1FRM A;  1PAU B;  2OMO A;  3JQJ A;  2LU2 A;  2ATC B;  1ZPV A;  3DXS X;  3AOB A;  2FC8 A;  3J80 Y;  4DCP B;  1SL2 A;  2BAC A;  4EZ6 A;  3NCQ A;  2GIR A;  4P9S A;  2OPP B;  1HYS A;  4IKA A;  4PKD B;  1REG X;  3I96 A;  5AXM A;  1XMQ J;  3IGV A;  2QLF B;  1M1H A;  1FFW B;  3MMJ A;  1MMD A;  2CQ2 A;  2APO A;  2FTR A;  2DJW A;  5LOQ A;  2V8D A;  3I31 A;  4Z7C A;  4ED7 A;  1N4L A;  2VA2 A;  4EZ9 A;  4JV2 A;  4LFB F;  3D6H B;  4P71 A;  2OD6 A;  4AT1 B;  2ASY A;  1HA1 A;  3L95 X;  3UW1 A;  1WHX A;  4EYI B;  4TLQ A;  3T5H A;  3V6H A;  3GB0 A;  4H4M A;  2AQ4 A;  2HHT A;  3M2U B;  3VAJ A;  5H9E J;  1KLM B;  2AYG A;  4KY3 A;  1E6V B;  1OJ4 A;  3MMB A;  5CAA A;  1U1M A;  2IM0 A;  4PAA A;  1H7X A;  5F41 A;  1U1Q A;  1NK4 A;  1CS4 A;  2YX7 A;  5F8H A;  3QJP A;  1VI7 A;  2FDN A;  4G65 A;  1RZM A;  1RAA B;  4XAK A;  4CO4 A;  2AYM A;  3R27 A;  5F0U A;  1NPP A;  5DRK A;  3QGP A;  1TQL A;  1YJN S;  5D0G A;  4DL4 A;  4RX6 A;  1C1C A;  3W2V B;  2QA1 A;  2NYH A;  1BY9 A;  2J7W A;  2B43 A;  3CJK B;  3DRS A;  4NXM F;  3ZZY A;  1LXJ A;  2DT9 A;  3OTE A;  2CQB A;  3CJ5 A;  2LXF A;  5ETM A;  1BC6 A;  3TVK A;  2HS3 A;  5IT0 A;  3T3F A;  2XLK A;  1NKB A;  3BDE A;  2HBZ B;  1HD1 A;  1PJ5 A;  5LT5 A;  2P6T A;  4K5S A;  1WHW A;  2W2Q P;  5D78 A;  4RNF A;  4LF7 J;  2E5J A;  1NRK A;  4TY8 B;  3PHE A;  2RS2 A;  2AMC B;  2RIL A;  4AD6 A;  1UTA A;  4JYA J;  3QWP A;  3N28 A;  5IT9 Y;  4YME A;  2CPE A;  2BRK A;  3C19 A;  3CGI A;  2AP6 A;  1R27 B;  4DFM A;  2CZ9 A;  4PG6 A;  2MYF A;  3EM1 A;  3FQK A;  3TOQ A;  3QRR A;  2IYG A;  5GMK a;  1NEE A;  1N0V C;  2MKI A;  4B3T J;  3OL9 A;  4J9O A;  3NMR A;  2MSS A;  2CVE A;  4ZCL A;  3DI6 B;  3HVT B;  1FT8 A;  2A0F B;  4CTA B;  2E7W A;  1XNR F;  1RGV A;  3AXM A;  4CDI A;  2QN6 B;  1OO0 B;  3R6L B;  1WDD A;  4ECU A;  3FCW A;  1PC5 A;  2DYA A;  1L3U A;  2RH3 A;  1X4A A;  4DF4 A;  3Q83 A;  4C7Q A;  3DNC A;  1UVJ A;  2HHX A;  2LU1 A;  3W9J A;  4W92 B;  3ZTO A;  3QAT A;  2EG2 A;  3R5J B;  4KH0 B;  1KHW A;  2V4R A;  3CIZ A;  4CH0 S;  4CO5 A;  1Y3K A;  3GCX P;  1RAJ A;  1SCJ B;  2VC0 A;  2UZA A;  2CQ3 A;  1SI9 A;  2C42 A;  1P1T A;  3TP2 A;  1VLO A;  3I5B A;  2ALZ A;  5AE2 A;  1RUS A;  5LM7 E;  1WDT A;  2F7V A;  2VBY A;  3GIK A;  1JLQ A;  2EBE A;  4RU2 A;  4QBU A;  4GKK F;  1KSP A;  1S57 A;  1Z2L A;  1MU2 B;  4DL2 A;  2MEW A;  4I69 A;  4Y0F A;  4F3Q A;  2MXY A;  3UO0 A;  1JLB B;  1YLX A;  1SBR A;  4R5P B;  2IJN A;  2FHO B;  2G1H A;  5E2Q A;  1F3F A;  1CJV A;  1IVZ A;  1ZM9 A;  1F2G A;  4Y6I A;  2CJK A;  3SZ2 A;  4EEY A;  1L3T A;  4KR0 B;  3IR7 B;  1UET A;  4IOC Q;  2IBO A;  3DC2 A;  2VQF J;  2W7O A;  2LFV A;  2FJX A;  4A8S A;  3JSB A;  4QIV A;  2HK2 A;  3K5M A;  5KFS A;  5GAD I;  4ECR A;  1RLD A;  2ZVI A;  2ZUG A;  3OLB A;  4DJB A;  2ZH1 A;  2IDL A;  5C42 A;  5DG9 A;  5KFE A;  3ENW A;  4J5O A;  4U7U K;  2D3O R;  4L74 A;  1NM2 A;  2FHK A;  2V2Q A;  3K7R A;  2GMH A;  3H2U B;  3PYG A;  3SEO A;  3VVU A;  1HQE A;  2PC6 A;  5HVH A;  1L3V A;  4O3S A;  3WC0 A;  3WC2 A;  4QQB A;  4C8N A;  1ULR A;  3K5L A;  3CXC R;  1G1X A;  3P4U B;  5KFN A;  2XB2 D;  4NLO A;  4KHP F;  1NSK L;  4DN9 A;  2WVB A;  2GS8 A;  3TEG A;  1I51 B;  3FBE A;  4Y2C A;  3RW7 A;  1N5Y B;  3UPF A;  3RW6 A;  1RDR A;  1S12 A;  4LIR A;  1LWC A;  1WOS A;  2XMK A;  3JS9 A;  3MHY A;  3SCL E;  4R5P A;  3T9Z A;  4CLS A;  1SL0 A;  1D3W A;  1HQU A;  2ASD A;  1M0S A;  1TKZ B;  1RQ0 A;  3MCS A;  3JSM B;  4RR5 A;  1U1R A;  2B51 A;  3GZ7 A;  4IYQ A;  2B9Y A;  2LA6 A;  3Q24 A;  1M5S A;  3M32 B;  4J9K A;  1X0F A;  4PWW A;  1WJ9 A;  2BUN A;  4QR0 A;  3PVX A;  3I4P A;  1S4E A;  3H42 A;  2PFD A;  1FK9 B;  2CPZ A;  2Z2L A;  2J6T A;  2DY1 A;  4RUC A;  3Q8S B;  3D4J A;  4WKY A;  2J6U A;  3J7Z T;  2M4M A;  1S6Q A;  1TKX B;  2IC3 B;  4ES1 A;  2AV5 A;  2XHW A;  5A8K A;  5BYS A;  3IS9 A;  2IA6 A;  3ZTR A;  1H72 C;  3ZTQ A;  2VQE F;  1TMJ A;  1TL3 B;  3QFH A;  5D4P A;  1WSR A;  4RNN A;  4YR0 A;  4LF9 F;  3VQS A;  1TZ0 A;  4XO0 A;  1WEX A;  3MAH A;  3KJV B;  1LQ9 A;  1OPZ A;  2DB1 A;  3CD7 A;  1FCA A;  2BE2 A;  2DVI A;  5C24 B;  1ROF A;  3DI6 A;  4PXC A;  1S9E B;  2R7R A;  1ZTW A;  4DR7 J;  5I42 A;  4K4V A;  1SH2 A;  2XC9 A;  1VQ5 S;  3FEX B;  2DGX A;  2B5J A;  3BZQ A;  4PXE A;  1R0A B;  5LMN J;  1Q8K A;  1EKS A;  3SV4 A;  2JNJ A;  3BDP A;  4P7T A;  4RW9 B;  3A8J A;  1U1O A;  4NCB A;  2EK1 A;  3U02 A;  2PD1 A;  2YY3 A;  2I1R A;  4B9M A;  3CCL S;  2BQR A;  1S0V A;  4HKQ A;  1PKU A;  4WP8 A;  3CDE A;  2UXC F;  2HKE A;  1TL7 A;  3OFG A;  2JC1 A;  1U09 A;  1XR6 A;  4P2X A;  1RWN B;  4B3T F;  3DLB A;  1D09 B;  2R7Q A;  3WZ0 A;  2BQU A;  2CQ0 A;  3KDO A;  4IG3 B;  5KG2 A;  2DNH A;  3HF5 A;  5LJ5 Y;  3TAM A;  3EX7 B;  4CQ1 A;  2M3D A;  4NRU A;  2AJQ A;  4ELU A;  3MCN A;  4TVA B;  5IOL A;  2KRR A;  1JKH B;  4ZJO A;  2DNR A;  3HMJ G;  3UCG A;  5IFM A;  4CCH A;  1H2T Z;  2M7S A;  2QZ8 A;  4OLO A;  4DQS A;  1FJC A;  4DF8 A;  2ACY A;  3AA8 A;  3M8Z A;  3AT1 B;  1IM4 A;  4DV7 F;  2FVR A;  2V94 A;  2AT1 B;  2CPD A;  3I0R A;  3KK1 B;  1DZ5 A;  1CUL A;  2RSQ A;  3I4H X;  2E1P A;  4KFB B;  1S99 A;  2XY6 A;  5KFK A;  1K0T A;  1RIS A;  1S5Z A;  5A0Y B;  4CH1 A;  2DNK A;  2IHR 1;  5KG6 A;  1HMV A;  2A10 A;  2DIU A;  4UOG A;  1H2V Z;  2AWZ A;  4MT1 A;  5J1N A;  2NXN A;  3DRP B;  1RT7 B;  3BN7 A;  4M8L A;  3QBC A;  3SXL A;  2XMU A;  1VBK A;  3PYE A;  1IKY A;  1QAX A;  4WFX A;  3S7R A;  3TVZ A;  3BO3 A;  2HW3 A;  2XY7 A;  4OZ1 A;  3JSR A;  1KHV A;  2HS4 A;  2ERR A;  4E0D A;  3FZB A;  1AZS B;  2WHO A;  2DCL A;  2R7W A;  1IKW B;  1RT4 B;  1XK8 A;  4KTQ A;  2X3D A;  5AE3 A;  4X64 F;  2G0J A;  2JLG A;  2VQF F;  3TR5 A;  2VC1 A;  4KC5 A;  4YEA A;  2HYI B;  4DR5 F;  3PG9 A;  4OYZ A;  3R2D J;  2XHC A;  2LEB A;  1NSQ A;  1NU4 A;  1IWA A;  1HMV B;  4PQA A;  4Y34 A;  3ZTS A;  4KQZ A;  4N5S A;  3GSD A;  5L1I A;  2FB0 A;  4F4Y A;  1DQ9 A;  2RF2 A;  3Q8V A;  2VB6 A;  3MI7 X;  4LRE A;  2AHO B;  2VFR A;  2PA3 A;  2X1B A;  2XYH B;  3M2R B;  3N6M A;  3MM5 A;  3NBP A;  1TV6 B;  2HQ3 A;  4DG1 A;  3OHA A;  1HHS A;  2R8G A;  4CNZ A;  2JH3 A;  2KYX A;  2IVF B;  2RU3 A;  2BKN A;  2VG5 B;  8ATC B;  3BPS P;  1RXO B;  3VTI A;  2RRN A;  3QGG A;  2VKR A;  3T41 A;  5KT6 A;  4QW9 A;  4AL7 A;  4RUB A;  1FNX H;  3KOA A;  1H0H B;  2DD8 S;  3BGF A;  2R7U A;  2O67 A;  1F6T A;  1JNZ B;  1CJK A;  1YWX A;  2RDI A;  1RAI B;  3G6V A;  2J0W A;  1Q8I A;  1S9G B;  3BYR A;  3N79 A;  3ZZZ A;  4G6V B;  1VC5 A;  3SQG B;  4DV0 J;  4EGL A;  3QO9 B;  4FYY B;  1UFL A;  2J9D A;  2I9S A;  2FC9 A;  3NNC A;  2ZEJ A;  4YS2 A;  4C11 B;  4HHU A;  2Y8W A;  1FRL A;  1HHQ A;  1S1X B;  2GNK A;  1NJI T;  4K4U A;  1X7V A;  3CC7 S;  1S10 A;  2V8V A;  2XBP A;  5F8M A;  1N36 F;  2HRT A;  2UUC J;  2MST A;  1HNW F;  2CQP A;  3CMQ A;  1F1B B;  1TVR A;  1Y3J A;  4MTP A;  5KAK A;  4X62 F;  2IVM A;  3LP1 B;  1NJY A;  1KC8 T;  4OI6 A;  5HJY A;  3OUY B;  2EFP A;  3BH6 B;  2LQ8 A;  2AEM A;  1QDU B;  2D41 A;  3MMC A;  3C46 A;  3LH2 S;  1U4B A;  2GO8 A;  4O4G A;  8AT1 B;  2MKS A;  2L48 A;  1F60 B;  1FKO B;  1ZZF A;  3PYD A;  1H74 A;  2W9A A;  4ECX A;  3T5K A;  4OI0 A;  2AYE A;  4ZLP A;  4LT6 A;  4ITS A;  1J5E J;  2XZD B;  3DOL A;  2B4U A;  3QWU A;  4I2Q B;  1IN0 A;  3NGT A;  4WPA A;  2HND A;  2NXE A;  2RE1 A;  1VRT B;  3A3O B;  1HD0 A;  1IBM F;  3H2V E;  3SQO P;  4WZQ A;  4C48 A;  2C2Z B;  1VDH A;  1FRX A;  3CNQ P;  1AB8 A;  1WF0 A;  1L3K A;  4WP3 A;  3MR5 A;  1TL3 A;  1Q53 A;  2GHW A;  3LP1 A;  3R8Y A;  5B7W A;  1WUU A;  2J0S D;  2W01 A;  4H4O B;  5LXR A;  4Z2X A;  2WSF C;  2QLJ B;  3QPI A;  1Q81 T;  1S6O A;  3H5U A;  3MTK A;  1NHK L;  1S1X A;  1PO6 A;  1YKW A;  3QNW B;  2DGO A;  3BGR A;  4UUW A;  1N32 F;  2C2R A;  1GAO A;  1RWV B;  3GE9 A;  2WVC A;  2GFF A;  1N54 B;  2W8K A; 
#chains in the Genus database with same CATH homology
 1UCN A;  1KDN A;  3G2X A;  5IOL A;  1NPK A;  1NDP A;  4C6A A;  3EVO A;  3BBC A;  1S57 A;  1NB2 A;  1W7W A;  1B4S A;  4EK2 A;  2B8P A;  4WBF A;  3GPA A;  1MN9 A;  3DKD A;  4DI6 A;  4CP5 A;  1LWX A;  3PRV A;  4AND A;  2HVE A;  1BUX A;  1F3F A;  1S5Z A;  3VGT A;  4FKX A;  3BBB A;  4UOG A;  3VGV A;  2NCK L;  1NLK L;  3DDI A;  1ZS6 A;  3VGS A;  4FKY A;  3ELH A;  3FBF A;  3EE3 A;  4DZ6 A;  2DXE A;  1NCL A;  1BE4 A;  4S0M A;  4HR2 A;  4W98 A;  3VVU A;  4ANC A;  3EVM A;  4UOH A;  3ZTP A;  1XQI A;  1VYA A;  1NSQ A;  2ZUA A;  3ZTS A;  3ETM A;  1NSK L;  3Q8V A;  1WKJ A;  1BHN A;  3FBE A;  3B6B A;  2B8Q A;  1U8W A;  1NDL A;  3EMT A;  3FBB A;  3JS9 A;  2AZ1 A;  3BH7 B;  3EVW A;  2HUR A;  5C7P A;  1WKL A;  1WKK A;  5CAA A;  1F6T A;  1K44 A;  1MN7 A;  3Q89 A;  4ENO A;  2HVD A;  3WX8 A;  1NSP A;  3FBC A;  3ENA A;  3B54 A;  2CWK A;  3R9L A;  3ZTR A;  1S59 A;  3ZTQ A;  2DXF A;  1HHQ A;  1EHW A;  1JXV A;  1XIQ A;  1NDK A;  4KPC A;  1B99 A;  3FCV A;  4UOF A;  4F4A A;  4O0N A;  1LEO A;  1PAE X;  3L7U A;  3BH6 B;  3PJ9 A;  2VU5 A;  1HIY A;  5CAB A;  3EIC A;  3NGU A;  1NUE A;  1HLW A;  3EM1 A;  3Q8U A;  3Q86 A;  3VGU A;  3NGT A;  4F36 A;  3FC9 A;  4ANE A;  2DXD A;  3GP9 A;  3MPD A;  2DY9 A;  3EJM A;  2BEF A;  1PKU A;  2BX6 A;  3FCW A;  2DYA A;  3FKB A;  3NGS A;  3Q83 A;  4DUT A;  1NHK L;  3ZTO A;  3VVT A;  2AZ3 A;  3NGR A;  1NDC A;  3Q8Y A;  5BXI A;  3BBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...