4UOFA

Crystallographic structure of nucleoside diphosphate kinase from litopenaeus vannamei complexed with dadp
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
151
structure length
151
Chain Sequence
MVRERTFIAVKPDGVQRGLIGEIIKRFEAKGFKLAGMKYIQASEDLLKQHYIDLADKPFYPGLCKYMSSGPVVAMCWEGTGVVKTARVMMGETRPADSKPGTIRGDFCIEVGRNIIHGSDSVESANKEIALWFKPEELVSWTQTNESWIYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NUCLEOSIDE DIPHOSPHATE KINASE
publication title Structure of Nucleoside Diphosphate Kinase from the Pacific Shrimp (Litopenaeus Vannamei) in Binary Complexes with Purine and Pyrimidine Nucleoside Diphosphates
pubmed doi rcsb
source organism Litopenaeus vannamei
molecule tags Transferase
total genus 47
structure length 151
sequence length 151
chains with identical sequence B, C
ec nomenclature ec 2.7.4.6: Nucleoside-diphosphate kinase.
pdb deposition date 2014-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00334 NDK Nucleoside diphosphate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.141 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleoside diphosphate kinase-like domain 4uofA00
4HR2A 3G2XA 4FKYA 2BX6A 3FBEA 1F3FA 4FKXA 4C6AA 2HURA 1PAEX 4UOHA 2HVEA 3NGSA 1NSPA 1S59A 3MPDA 4ENOA 3DKDA 3FBCA 3ZTRA 3ETMA 5CAAA 2CWKA 4UOGA 5CABA 1XQIA 3L7UA 1B99A 1BE4A 2DXEA 1NB2A 3NGUA 4DI6A 1UCNA 1VYAA 1PKUA 3GPAA 3VVUA 3ELHA 3FCWA 1JXVA 1ZS6A 4S0MA 3FCVA 1NLKL 2B8QA 4O0NA 5IOLA 4EK2A 3WX8A 1LEOA 5BXIA 1KDNA 4KPCA 1NDPA 1NPKA 1BHNA 3EM1A 5C7PA 1MN9A 2BEFA 3Q89A 1HLWA 1NDLA 2DY9A 1K44A 1NCLA 3FC9A 3Q83A 3Q8YA 3BBCA 3EVMA 3FBFA 3B54A 3DDIA 2DXFA 2VU5A 3VGVA 4CP5A 1B4SA 3EE3A 1W7WA 2AZ1A 4ANEA 1WKLA 3GP9A 3BBBA 3EVWA 3NGRA 2DYAA 4W98A 1U8WA 4F4AA 3R9LA 3BH7B 4ANCA 2ZUAA 1WKKA 1XIQA 3Q8UA 2NCKL 1EHWA 3PRVA 3Q8VA 3VGUA 2DXDA 3EICA 2B8PA 3EMTA 2AZ3A 1MN7A 3FBBA 1NSKL 3ZTPA 3PJ9A 1LWXA 3JS9A 3NGTA 3VVTA 4UOFA 2HVDA 1NUEA 3EVOA 1NDCA 3VGTA 4DUTA 1NDKA 4DZ6A 1HIYA 3EJMA 3ENAA 4WBFA 1WKJA 3BBFA 1S57A 3Q86A 1S5ZA 3B6BA 3VGSA 1F6TA 1HHQA 3ZTOA 3BH6B 3ZTQA 3ZTSA 1BUXA 3FKBA 4F36A 1NSQA 1NHKL 4ANDA
chains in the Genus database with same CATH superfamily
2BX6A 1RAJA 4Y2MA 3RG6A 1S1WB 3R7NB 1KHWA 2OPPB 3PV8A 1NO8A 3NGSA 4OZ0A 1LWEA 3QO9B 3M8SA 2Z2LA 3P5TL 5B0AA 4DQIA 1CPZA 2KG1A 1LW2B 2XMJA 3MM6B 1IUJA 1RT5B 4LVOP 3T3FA 2GV1A 2C2ZB 1R3NA 1HQEA 1FTRA 3FQLA 5AXKA 4Z7CA 4OHZA 2WRMA 4ID5A 5GAEU 3T1AA 2KM8C 3OUYA 2KT2A 3MR7A 2LLZA 1CC7A 3D6FB 3HZEA 4OYPA 2KRRA 3R5DA 3MOZA 4DV1F 4ANCA 2P2CB 5M2RA 4WYLA 2VUGA 2ERRA 3CCZA 1ZPWX 2MQ8A 1VC0A 3N6NA 4AT1B 4P52A 1H7XA 1C1BA 2RNEA 3DRSB 5CZVA 3GIRA 2AYGA 3MM8B 1SJ4P 2EFPA 3HFZB 2GAHC 1U6FA 1FNMA 3I4HX 4X84A 4LQ9A 1JLAB 5HL7Q 1AFIA 1E6VB 5L1LA 4IH5A 4RW8B 5HO4A 5KFBA 2WTFA 5G0RB 2RILA 2D7SA 3DOKA 3Q23A 1BHNA 3KHLA 4NPOA 2QA2A 4J9UE 3G96A 4A8WA 2FVPA 5BJRA 3FBFA 5KG6A 2ZUGA 4A48A 4Z37A 5FDLA 1WD6A 7FD1A 2YH0A 1DHMA 3D3BJ 3KTQA 3VCDA 4PCQA 3FDSA 4K59A 1ZBTA 2CJYB 2W4CA 3CD7A 4WCEQ 1NRKA 3IM8A 2KDOA 2ZOFA 2BE2B 4NMLA 2XY6A 1X31C 2CUYA 1NDKA 4NL5A 2DHSA 2G0IA 1DLOB 2DNMA 2PO4A 4DX7A 2D9PA 3C8YA 3K89A 2AT1B 1VRTB 4IKAA 1VRQC 5CD4A 3DLGB 2MKCA 1S9EB 1S49A 4YB1P 2RDDA 2HHVA 4L74A 3FSIA 4E0DA 3GYNA 3PW0A 3JSYA 2YNHB 4JI1F 4OJ3A 3NGUA 1K8AT 3OFHA 1EAYC 3V6DA 2DISA 3BPDA 1UW9A 5EHHA 2IMWP 4GO5X 1RAAB 4ECVA 2F4VJ 3TX8A 2IM0A 3TAMB 3BSAA 4WIQA 4M5HA 3K5OA 1KVIA 1DRZA 1TL7B 3KK1B 2X3GA 3BO4A 1IM4A 1Q7LB 1HNXF 5LSLA 3D1OA 2M7SA 3NGRA 3DXSX 3RBDA 3MFHA 4FNIA 5HJXA 1S4EA 1XBWA 2AWZA 2E1RA 4Z2XA 1VHIA 3T19A 4KR0B 2FHJD 1YGYA 2GMLA 1HARA 2E1PA 2BACA 1U1NA 4EMDA 3W1YC 1BD6A 3CT9A 1UFLA 2J9EA 4DR3F 3SZ2A 1S5ZA 2QZ8A 2XNQA 1RWNB 4EFAC 4NZ0A 2G13A 2XS5A 2KXNB 4F25A 3DLHA 3OL9A 4TY9A 1IQZA 2B3TB 5D4LA 2ZEJA 1KS2A 1EQ0A 2B4UA 4J9RA 2JEIA 4RW6A 1TL1B 1KR4A 2Q6CA 1NAQA 5HBMB 4GRSA 8RUCA 1IM6A 2AV5A 1N52B 2BQ3A 1HQUA 3M32B 3Q8QB 1RTHA 4NLUA 4WWSA 4P7TA 5C7PA 2DPJA 2OEKA 3DDIA 4KH1B 3TW0A 1YJ7A 5E3CA 2PGCA 3PW5A 5BYQA 1TKZB 1HWKA 1KKHA 5IT4A 2BBEA 1HD0A 1HWJA 1TKXA 1E6YA 4WK1A 2Z58B 1VQYA 3EICA 2B8PA 4ED6A 2CQ4A 3EUNA 3GR0A 4G1PA 1X4FA 3QRRA 2EG2A 1BY9A 4ER8A 1OIAA 1JNZB 3RYLA 4AE5A 2ZHOA 2WBRA 4C97A 2GIRA 4X62J 2M8DB 2HYIB 2YPZA 1UMJA 2COLA 3JQKA 4ECYA 3QLHB 2NS1B 3EGVA 4A8YA 3GLJA 2B4VA 2OI2A 4A8KA 2LYVA 2HAIA 2XY5A 3KLIB 2C2OB 5D3GB 3DRPA 4LBPA 4DOZA 1X4HA 3KXDA 4QWBA 5HJYA 2ZM6F 3A8EA 1J5OB 3UCZP 1HBUB 1OMSA 2HIYA 4N7TA 3V6HA 4DFJA 2KYXA 4FVCA 1D9DA 1VCTA 1VBZA 3VR1A 1M5KC 4ES1A 3PO5A 1FESA 1IKWB 4HTJA 1T9WA 2ZWOA 2HBYB 1GT8A 2VQFJ 2J76E 3KMQA 3N9UC 3TJAA 3IG1B 3CJQA 4YHHF 1QSSA 2RE1A 4UZCA 2P5VA 3FVYA 2BMBA 4H4KA 1K9MT 2FJWA 4R5PB 3W5ZA 3H59A 3VGSA 3D2WA 3G8TA 3BGFA 3BKUA 2JVOA 2XMKA 4C3MA 2FZKB 3JTOA 1U1KA 4B9NA 1GXTA 3NCPA 1R89A 2HW3A 2OTJS 1GXLA 2ZH9A 4RUHA 2XEXA 1N32J 2E5IA 1F2HA 4Q7AA 3D67A 5KFUA 1JWWA 3KWMA 1C4CA 5A6PA 3DYAB 1URNA 4EWTA 2VPXB 1TK5A 1JLGA 4OI2A 1IBKF 4MJKA 1SUQB 3D0HE 1KOHA 2RSQA 2VU5A 3MEGA 3CVKA 1RWXB 3GMGA 4IO9Q 5LMUF 3L09A 5KFZA 4Y34A 3KLFA 2QYCA 2EW9A 2ACYA 4A8FA 4LVNP 1VLYA 1JJCB 4ZJQA 3MAAA 2XLKA 3CCQS 3OTOJ 3I87A 1XR5A 1D3WA 5K9FA 5AE3A 4O3PA 3BBFA 1Q0NA 2W7OA 2XZWA 3KJVB 2C42A 1L3KA 2OELA 3Q0AA 1WELA 2M2BA 3PYFA 4HYKA 4ANDA 3MURP 4C98A 3CJ3A 1M1KT 1XMQF 1VQLS 4KHMA 5DQHA 3L9ZA 2CZVC 3CIZA 4DX5A 4DPUA 2MEWA 1N5SA 2BOPA 2GO9A 1EZZB 4YUDA 2CJKA 2AGOA 2HHPA 5BXIA 1U1OA 3EM1A 3SSRA 3NBPB 3BQ1A 1EIYB 2GVDA 3QIDA 2R7OA 2V4JB 1V6HA 3M30B 3V81A 4CM0A 4D3GA 1IJEB 2VC1A 3G8QA 3QIPA 2AZ1A 1AZSB 3PEHA 1ITPA 1F9FA 2GIQA 2GAGC 3CDAA 2HK3A 4RW9A 3HFKA 4GVBA 4F7VA 1PJ7A 4QWEA 4URGA 1BMQB 4B3SF 3PRVA 2Y1RI 5K14A 1S6QA 4UW2A 3AHPA 4RW7B 2MXYA 4LSLA 2HVDA 4J9VA 4AQYF 1YWXA 2J5AA 4V1Ak 4U6PA 2EG1A 3ZTQA 2R7SA 1LXJA 2YKMA 4I7FB 1YBAA 3PIPQ 2AYMA 4C6AA 3AJDA 2MZQA 2JL9A 2EVZA 2VQEF 2XY7A 5GAGI 2P9CA 1HBMB 1FKOA 3ZNJ1 1LKZA 3HK2A 3AXKA 2A10A 1Z2LA 2AJFE 2NXEA 5KFSA 3H40A 2ZZTA 2DH7A 2CRLA 1WHVA 3MMBB 1YVFA 3PM9A 2KXHA 2CIMA 1U0SA 2XBPA 3FZ2A 2EFGA 1FTCA 4ZP7A 1JKHA 4B3RF 2RQMA 4AL5A 4DDFA 3CE8A 5DO2A 3RW6A 2XMWA 4YY3J 1IXKA 3JSBA 4JV1A 5B08A 3DOLA 2QLWA 1TV6B 1TL5A 4KHRA 1P9YA 1U45A 3IFEA 5ETTA 4OJGA 2O67A 2QV6A 4MFBB 4IQMA 1HBNA 1X9WA 2LXIA 1L5UA 4O3NA 3FEXB 3AB2B 2IA6A 4ZHRB 5IQQA 2MKIA 1U0HB 3CCTA 2WZ1A 2CXEA 5L9XA 2E1MC 5BYRA 4FXDA 2CADA 4ILMA 3N79A 5E3AA 2FYXA 4EU0A 1HR0J 1GMWA 4WXWA 5ETOA 4KV8B 1NLKL 3OR1B 2XG8A 5IQ6A 5D8HB 1YBUA 3TEGA 3VHQA 2D69A 3NCRA 2NPIA 3DGPB 1Q7YT 4JI4F 2XS2A 5DS7A 1NHUA 2IHR1 3A8JA 4QCLA 2GQ2A 3JYTB 4EEYA 4FVMA 5D0GA 1M1HA 4I1TA 3KJQB 3BH7B 4MKYA 1ZOTA 3LP2B 2CPDA 2KG0A 1F2GA 3HT0A 3EPIA 3GIKA 2Q6BA 1CS4A 1EJ7L 3AJ2A 4CO2A 2KO1A 3EXYA 3OTBA 3OXGA 4FF4A 1SKRA 2GVZB 2W2OP 2QYGA 1HQ2A 2XGQA 3HSZA 4MIBA 2UUCF 1VRUB 2L08A 3HP6A 1HMVA 3RBXA 2QFIA 4GKKJ 4DX6A 1YJRA 4CQ1A 4U96A 2AGPA 4L72B 4OI6A 3VWSA 3AH6A 1VJWA 3CO9A 3T5KA 1GH8A 1VQ8S 4WKRA 2RS8A 4YR2A 2VA2A 3KK3B 2CQ0A 2MQNA 1ZZNA 1C1CA 4CYUA 1VQOS 3H5XA 2V5HG 1GMWD 2Y0SD 2ALYB 4ED7A 1RWVB 4DN9A 2KVQE 4PQUB 3PYEA 2MLYA 1RHKB 2LFVA 4XTTA 3FFIA 2CPEA 4CH7A 2CA9A 2OAUA 3QJPA 2RT3A 2N7CA 1DTQA 4USIA 2DYAA 2J7UA 1JJ2R 3IO1A 2GNKA 2ZJQQ 3SIPB 4IR1A 3DRXA 1ZZFA 2RDJA 1QDUB 3TRGA 2RRNA 3IR6B 4IOAQ 4JYAJ 5AE1A 5J1EA 2V2QA 3CW2C 3OL6A 2PMHA 1H73A 3FKBA 4FPIA 4LF8J 1MSWD 1EETA 2FD2A 1UFWA 2RRBA 2BJ3A 4EZ9A 4I6WA 1MROB 4ICLA 1UWBA 3RJMB 3NAIA 4GKJJ 3OPKA 5J2QA 3L7UA 1GQEA 4NA1A 2LQBA 1B64A 3D4JA 2IPOB 3A13A 1D9AA 3VAJA 4LF6F 1FK9B 1Y5IB 1RA6A 3LP0A 1WHXA 5H9FJ 4EYHB 5C25A 3I82A 4KGMA 1P1TA 4IRCA 5GADI 2HNZA 4TQSA 3ENWA 4JI0J 3A8IA 1U47A 2ZBQA 1ICEB 4P71A 2J9DE 2W9CB 5IWAJ 4C8ZA 5CYQB 1YG0A 2ZE2B 3UD3P 4ETZA 2OD4A 4IRDA 2DHHA 1FHTA 4BBYA 3HSGA 4JP8A 3B4DA 4Q45A 4W4MA 2HG4A 3LWMA 2MDAA 3H4BA 1RAFB 2HFVA 3CF5Q 3CD6S 1C0TA 2IJRA 3CWJA 4KKOB 3HKZD 4FP9A 4DL0C 2J0QD 4FF3A 3MEKA 1VQMS 1KOOA 2ZZNA 2HNYB 2OPRB 1K1SA 3MUTP 1KBRA 1NPRA 1GEHA 3DLEA 3MTKA 1RAIB 5HQLA 2RKIA 3ZZOA 3A3NB 1OO0B 2UUBF 3SCLE 1S6UA 1SXLA 5B0EA 4HHHA 1RT2A 1NZ8A 4DUZJ 1TP7A 1DQ8A 4OX9J 2C3MA 5LM7E 4RNNA 4ERDA 3AD7C 3QSIA 5I3UA 4I2PA 5F9LA 4M5GA 4JB8B 1S1VA 1X8DA 4M5DA 2CVEA 3NGTA 5D78A 1RWUA 2L41A 1ZA1B 2KVIA 4DS5A 4LT6A 3H2UB 3PCOB 3UR0A 1JIHA 4NZ7A 2JEJA 3CTRA 4WF9Q 1ZAWA 3GWCA 3RGIA 4JV5F 1RTJB 1K73T 4KHPJ 8ATCB 2XCPA 4QBUA 4DXLA 3NL0A 2F9JA 2DRDA 5T14A 1PILA 2ZDPA 1HYSB 2IYIA 3DKDA 5KAKA 3DU6A 1L3VA 2QRRA 2R8GA 1AUSL 2R2SA 1X4DA 4ED5A 3J7ZT 1LWFA 3K5PA 3RU0A 1R43A 3MCOA 2F5GA 1OY6A 4LFBF 1QAXA 2OO4A 2V9KA 3R6LB 3PYGA 2AJQA 1LWEB 3GTYX 4TLRA 4NLTA 5L8RC 3EVMA 3TZWA 4DR1F 3MCSA 4DCJB 2Q43A 2W9AA 1FRJA 2HRUA 4HACA 4J9KA 1RADB 2EBGA 2MYFA 5DDOC 3N5BA 4WK3A 2H5JB 1QUVA 5T7LA 4NXNF 4QIEA 1WC1A 1U48A 3TNVA 3JB9k 4K4TA 1VK8A 2AJ1A 2IVMA 2QO3A 2DNRA 1XMOJ 3L3CA 1CULB 4PG5A 5THWA 1JLEB 2AKWB 3DN9A 3FQKA 3SCJE 3H25A 3T6JA 4OI3A 3DFEA 2NZCA 1X5SA 2OSRA 3WC0A 1SKWA 3CCVS 2DIUA 2DPIA 2D9OA 2GJ2A 4TY8A 2VOOA 4DFKA 5KFPA 4O23A 3C46A 1S7IA 3MGJA 5GVQA 1UPMB 3JXOA 2W8LA 3RB0A 1S0NA 3QT8A 3CD5A 3GP9A 2EBEA 1TKDA 1XNRF 3V6KA 1RU1A 1YITS 1FWLA 4K4XA 3W60A 1H74A 1PJ6A 4CTAA 1UFKA 2A2DA 2N4CA 5ITHA 2HWTA 4ZIWA 4JI6J 1HBOB 4HHUA 4TYAA 2RS2A 1ULRA 1X4CA 2EKNA 3QT5A 4JI7J 4CM2A 4C8YA 3C19A 1NSQA 3DI6A 4ZPVR 2R7QA 3QSYB 2VPZB 2D3ZA 3N6MA 1VHFA 2LEPA 1T05A 2OUGA 3CUNA 1Q8IA 3P3DA 1HNZJ 3CD0A 4I56A 3Q24A 3MCNA 1VBXA 4G1IA 4F3MA 2JC0A 4WE1A 4RUBA 1U49A 1F1BB 4U67Q 2EFQA 5IOLA 4FYWB 4Y6IA 3NS7B 2DK2A 4DSLA 1JLFB 5B0CA 1WI8A 4FS1A 5IXUA 2JJ4D 3KUGA 2H65B 2V69A 2W4DA 3AOCA 1S1WA 3R5GA 2OPPA 2VL1A 5A2QU 3QO9A 1Y00A 3S7RA 2XHCA 3J7YU 1WWHA 3QATA 4YFUA 1XIQA 2RU9A 2QX0A 4QIFA 5KFLA 1LW2A 4WTOB 4WFZA 4Q8FA 2JC1A 2JH3A 2YKAA 3SSSA 3MM6A 3MPUB 1RT5A 1RHQB 4KJIA 2J0WA 1UVIA 3ZZZA 4HTIA 1TL3B 2EC0A 3B6BA 2MSTA 1CC8A 3K58A 2UVWA 3NAHA 2HZVA 1PYOB 1JLQB 1KQSR 3BSCA 1Y7PA 3AD8C 1RKIA 3FNNA 3IRXB 1RLDA 3F0NA 4DCOB 4FN5A 1HA1A 3M9MB 4RKUC 3DRSA 1NJYA 2YXLA 4KY3A 2DY9A 2VJUA 2AJ0A 3MM8A 4XO0A 2FHKA 5M2PA 5U47A 1RTHB 1T9XA 1JLAA 2B51A 4ILRA 3PG9A 1E6VA 2CPYA 4RW8A 4WP3A 1Z4UA 3FCHA 5G0RA 5K8OA 1LFPA 3UD4P 2B5JB 4N8OA 4U95A 3C6TB 3N4WA 1HNIB 3I0RB 3OVAA 1UJ5A 2ZBIA 2V8PA 4M5IA 1FVQA 3THPA 2F4VF 3HM9A 1XQIA 2C2KB 2BE2A 1VQ5S 3UCGA 3UDCA 2E7WA 1CJKB 1SQFA 2B0GA 3W5XA 4FXVA 1DLOA 4RWXA 1IBLJ 4NRUA 1NPKA 1A7GE 1VRTA 1VBKA 2BRLA 2R2RA 1D9FA 3DLGA 2F7VA 4ECUA 5L38A 5A0YB 1JQGA 4ZMMA 5HMYA 1S9EA 5F8GA 5ETRA 2NXJA 4AXJA 2QL9B 2GHVC 4NRTA 2AYEA 2HNDB 5T41A 2YNHA 2PIIA 4WZMA 3E3XA 2R8HA 3IM9A 3S6EA 3M8YA 3VGUA 3RR7A 2QTWA 1G4CA 2AZ3A 3H90A 1S6PB 1N36J 1TAUA 2FJBB 3J81Y 5K8NA 5E3RA 2CVIA 2IBOA 3HXMA 1S57A 3KKFA 5GAHI 3Q2TC 3K8WA 1X5OA 1TL7A 3KK1A 1F3VA 5DQIA 1RTDB 2UP1A 3ENVA 3ZZYA 3EDQB 3K8VA 4ZCLA 1FVSA 4CDIA 3LANA 1H38A 2HVIA 3VAHA 3KLEB 3PKYA 4QR0A 3X1LB 1NDPA 1QE1B 4IUFA 3FSYA 3KFWX 4O4GA 5E3QA 1MMNA 4YB5A 1Q86T 3OXLA 5DG8A 4X62F 1TL1A 2WHOA 2HK2A 3C15B 1WG5A 4N76A 1KQKA 2P8IA 5HBMA 4K4SA 2OMLA 2UXBJ 2LU1A 4LF9F 5AT1B 2VPYB 4GC7A 5B09A 3Q22A 2K8GA 2R3VA 4A46A 4C8LA 1MN7A 3AB4B 4EBDA 2DRBA 1SKSA 2DKOB 3VVTA 4NLPA 2UV8G 1QSLA 3M1VB 1DTTB 1DZ5A 1UWAA 3M2UB 3E51A 4LFAF 1FE0A 3FK4A 2Y0BB 3IAM9 4LIWA 3GV5B 1UJ6A 4F36A 4GC6A 1U2CA 4J5OA 3UR3C 2ZWPA 1TKZA 2VG7B 3MM5B 2DNKA 5HLFB 3R2DJ 5HP1B 3OT9A 2DIVA 3F56A 4IDKB 2IM3A 4J9QA 4X4PA 1NNDA 2VQFF 1ELOA 2HFNA 4R0EA 2OEMA 2H3EB 4ZS6A 1HL6A 3IC1A 5CCLA 4DLEA 2C3YA 1YX2A 3QLHA 2DNPA 1OJ4A 2XZDB 4IG0B 1QTNB 5DLFA 3M2VA 3UNYA 1HI0P 3D5MA 2ABYA 3TUJC 2EFVA 2VD3A 4A8MP 3CJ4A 1IJFB 4KC5A 2B43A 2HLTA 2GVDB 3KLIA 5D3GA 5HATA 3EX7B 4QW9A 1N88A 4HI2A 1TUWA 1J5OA 3KLGB 1HBUA 2HHHJ 2UU9F 4F8RA 4ES3A 3DC2A 4LBIA 4LRBA 2HPUA 3QNWB 1WKJA 4PPDA 1FRHA 4NI2A 2B56A 5C42B 1N32F 2CPFA 2W7PA 5H9FK 3DMJB 2ZBRA 3GJTB 3PFEA 2UVVA 2J8SA 2K7KA 2UXCJ 4PG7A 2BE9B 2P9EA 3GG0A 4MYTA 4CH0S 3IG1A 2DCLA 2ZD1B 3PR4A 1RAHB 3HJFA 2MSSA 5KFXA 4KGVB 4R5PA 2I38A 1V3RA 1Q5VA 3KNAA 5G4DA 2XO7A 1WSVA 5CYJA 3MXHP 2Y1LB 4QYZJ 3NOGA 2UUTA 3W8GA 4DLGA 4XPEA 1WC5A 5E33A 1YJVA 1B4SA 3EE3A 2R8IA 5IFMA 4K4ZA 1Q8KA 3SFUA 1RISA 3SXLA 1VLOA 3OR2B 4URQU 3W7BA 2VBZA 2E5LJ 2E66A 1UETA 1NXIA 2YQ1A 3H5UA 4N77A 1JKHB 2FC8A 3DYAA 4DEZA 2CWXA 3Q86A 5B0FA 1P6TA 3EPGA 4USJC 5KFIA 4ZK7M 3O5TB 2OLWA 5HMXA 5D0HA 2LA4A 2ZBPA 4O4RA 3A3PB 5F8IA 5J1NA 4ZCKA 1M5SA 5CABA 2QG9B 2QC3A 2MHEA 3QGHA 5DM7Q 1DQAA 4DUYJ 2G0CA 2PD1A 1ROFA 3N0VA 1YJWS 1S0VA 4ZJOA 1NBEB 2JSXA 3KJVA 4CO4A 2UV8A 2JFKA 3W2VB 2BE7D 4F4WA 5CD4H 3BKFA 3PW7A 2CDQA 2M8HA 3RAQA 2RU3A 4RU2A 3BO2A 1DJ0A 2MKSA 4UUWA 1AA1B 2JDJA 4UUXA 3OJSA 4NYOA 4Y3CA 1LOUA 2HSEB 3NS6A 3M8RA 3HX9A 3IBWA 2RUSA 3NBPA 1SQGA 1RB0A 1S6OA 3M30A 1VDHA 1MNEA 3PW4A 2OPQA 3TVZA 5KT7A 1NHKL 9ATCB 5HMWA 1AZSA 2YKQA 1QJHA 2VOPA 3CNQP 3CJSA 4C8OA 4NLRA 1KSPA 4F04B 3JTNA 4HDGA 5JXSA 2ASDA 1RT1B 3OVBA 1LW0B 3LO3A 2HIQA 3TWZA 4MYUA 4RW7A 3KHGA 4JI2J 4LREA 2CQCA 4FS2A 3KLVA 3C16B 4YY3F 1VOMA 1V5IB 4ZVTB 2LEBA 3TX0A 3BYRA 2Y1IA 1ACMB 2FGCA 2NR0A 4I7FA 1KHVA 2VF3A 4HH1A 2BRKA 3SCKE 3B82A 3I5CA 2HRTA 1HBMA 2JVRA 4RX6A 4EO6A 3VAGA 3HI9A 3DU5A 4CYUB 5KT4A 4BWJA 3D54A 1FDBA 4PEOA 1SV5B 5HN0A 2HFZA 3A12A 3CJRA 4UOFA 3JSRA 4F4YA 3MMBA 3BGLA 3CJ5A 3JQJA 1HR0F 5LT5A 4DFMA 2WVBA 4PUOB 4LF7J 4AUKA 5KG2A 4PAAA 2DNGA 3W2WB 2NSBA 3A1YG 3UO0A 1KLNA 2YY3A 3HKWA 3UD5A 1Q5YA 4BC7A 3K5NA 1WOPA 2QMUB 5DRKA 3OFFA 2H1YA 2I0XA 1TV6A 3MD3A 1PKUA 4MFBA 2F4FA 4X64J 2GZOA 2YKNB 2ZH5A 3UDEA 3ETOA 3WX8A 1A6LA 1M5OC 1DARA 4ZHRA 3J81U 1U0HA 1P1LA 5DDQC 4QZVB 1R0AB 3MPYA 3DLKB 1BQNB 2LQJA 5CA5A 3BBBA 4R8UB 5L46A 4DPXA 3ZXWA 1S48A 3BEGB 4P7VA 2BXJA 3ISZA 1FJCA 2DR7A 4KV8A 4FZVA 2HHWA 3OR1A 1VJQA 1I3OB 2AMCB 4NA2A 3WDOA 1HW9A 1U1LA 2VFTA 1ZTTA 3DGPA 1SCJB 4NYZA 5KFJA 3ISNC 4KB7A 3RB4A 3G8SA 4AYBD 3JYTA 4O44B 4LSNB 4DWIA 2IAJB 1Y9OA 2CQPA 1U1QA 3LP2A 1X60A 5HSPA 2IYGA 2E9TA 3LQVA 4TU7A 1FFGB 2XSFA 5KOXA 4QYRA 5B7WA 1S9FA 3PHTA 1M1GA 2HS4A 2GVZA 3PY8A 1BGXT 4PWUA 4CO1A 3KHHA 1VRUA 1N33J 1PIEA 2DGWA 1S0MA 4JYAF 4G65A 1N5QA 1DFDA 3UDLA 1WC4A 2XMUA 4MAKA 4LF8F 2Y8WA 1GK8A 4WXOA 1VQPS 3C14B 3W63A 2BZ2A 3WBZA 2MJUA 5LXRA 1YTYA 4LR7A 1HNWF 4RUCA 2QMWA 3KK3A 2Z4PA 3IGVA 1RT2B 2C2EA 1SJFA 1NDCA 4LRAA 3CIMA 2NYHA 3BSOA 4ZVHA 4PQUA 3OTDA 1W25A 2DT9A 2KYZA 4JI5J 1TFWA 3H2LA 1EKRA 3VQTA 1S1TB 1D0EA 4FKXA 5J2MB 4RBTA 4G3IA 1SC6A 4CO5A 2JRSA 3NG8A 4F50A 2PI5A 2V8VA 1Q95G 3AT1B 4P6QA 1UAWA 4CO0A 2GHPA 1RP5A 3EGZA 1RABB 3IWXA 3FZBA 1XC9A 1T8EA 5IWAF 1Q81T 2QA4G 1T3NA 4UY85 3MEDB 4DV7F 1N54B 4F26A 3TA0A 2F1FA 3TP2A 1NSAA 2KM8B 2DNHA 2XYHB 3PO4A 1MROA 5M2UA 4M1KA 3AOBA 4ZPCA 1S9GB 1VQ9S 2FJVA 1TZ0A 4PG8A 4FDFA 2ADCA 2BVZA 2VKZG 4KSEB 1FK9A 2O01C 2ATLA 4OI0A 1CJVB 4X4OA 3HO1A 4H4MB 1IR2A 1BC6A 4NLWA 1T03B 4DFPA 4LR9A 5HMZA 5KFAA 3U1LA 1I1GA 3D0GE 2W9CA 4X66F 2FIUA 3MMJA 5CYQA 2ZE2A 1J5EJ 3P5BP 3ENQA 3K59A 1T7PA 3MR5A 5CH7B 4DUZF 4CNYA 4OX9F 4FYXB 3UPFA 5DM6Q 4M94A 1NK6A 1CG2A 2ZOGA 4Y00A 2H48B 2NXUA 5C5JA 4IR9A 4DQRA 1PG5B 3VAIA 2V63A 2CG8A 4L6V3 2EK6A 4YDXA 2QLJB 3PR5B 1HPZB 4KKOA 2L3MA 1Y11A 1Q82T 3UVJB 1UVNA 2HNYA 2DBBA 2OPRA 4KHPF 4DL4A 2X3DA 3Q8VA 5KTQA 3M05A 5KG3A 2EXUA 4C3LA 3CCSS 2BW2A 2V4QA 1RWMB 3M8WA 2L9NA 2OJ3A 3QBCA 3MAQA 1NB7A 3LA0A 2FLOA 2ZITA 1Y3JA 2Y9HA 2MLXA 3GB0A 2BV3A 2GS8A 6FDRA 1RA7A 2RQKA 4I4BA 4TU9A 2BUNA 4HVZA 4ZLPA 2DEIA 1XR6A 2RUGA 3I55S 3MPDA 4DR7J 1HNXJ 2C3PA 2EKYA 1IR0A 1NMEB 5KFEA 4J91A 4P10A 5CCMA 5JMNA 1VQ4S 4Y2KA 2D74B 3W62A 1RYSA 6AT1B 2K1RB 3CCMS 1RTJA 5GMDA 2AIRB 3JQMA 4YB6A 5K8PA 2IM1A 2HGLA 1HYSA 2RRAA 1U6BA 5LJ3Y 3FGVA 4O3SA 5CYMB 3NMAA 3UFCX 1XMOF 2BABA 1T95A 3WIVA 4NLQA 1H3DA 3I5AA 3HHLD 1UZHA 3OLBA 5E3PA 1ZH5A 4LUBA 3GJRB 5E41A 1XJWB 4USKA 5B0BA 4Y2IA 1S0OA 5LL6d 3IGNA 4UZBA 1KONA 1SI9A 2BQUA 4OYWA 3SDEB 1WC3A 4USWA 1T02A 1VC5A 4PWDB 1R6YA 4OYMA 4NXMJ 4PYAA 3MUVP 1Q79A 4CO3A 4HHJA 9RUBA 4NEZA 4OYOA 1S76D 5MLCV 4C48A 1CULA 1Q16B 1JLEA 1I5OB 2OTLS 5F0WA 4JI7F 2F9DA 1PC4A 1HHSA 4AFFA 1B7FA 3G82B 2J9CA 5KFVA 3Q2SC 1VIOA 1HNZF 4PG6A 2HBZB 4X2BA 3LWLA 3BR9A 4OX8A 2HQDA 2D3OR 3CSKA 5HANA 3BGRB 1NK7A 4OZ1A 4U9RA 3R3TA 3GR1A 4DG1B 4ZP9A 4HKQA 1IR1A 2R8KA 2XMMA 4EO8A 3GG1A 3N6LA 4K2XA 3K57A 1FWKA 2HHUA 1HBOA 2FHJA 1B0PA 2I9SA 4HL9A 1T11A 2LECA 5H9EJ 3IXQA 1UZDA 3CCLS 3OTCA 2AGQA 2NXCA 2HQIA 1HHTP 2FPHX 2W24A 3HVWA 4ZVGA 4PQAA 1XN9A 5F3ZA 1GMVA 4CWBA 4V19X 4B9LA 2OPSB 4IFVB 1OY8A 1WF2A 3D1QA 4WBFA 1JLFA 4ZVSB 1OS5A 4ECZA 1IBCB 2X1BA 4A4JA 4ZPAA 2VICA 3K5MA 3DDNA 2MZJA 1IBKJ 4DV5J 3JSMB 3CCJS 1WEYA 1KEKA 1RZMA 1NJWA 1MW7A 2W1BA 1V9OA 1B99A 4CLTA 1PYTA 3CC4S 1X4GA 4BC9A 1XNQJ 4CT9A 3PW2A 5CZXA 1TL3A 2PA8D 1YDLA 4KFBB 4KO0B 4JV2A 4B9SA 4M5NA 3NS5A 4B08A 2WAQD 3NWRA 2B6AB 1O6XA 1JLQA 1LK7A 2JFDA 4C0OC 4Z7YA 2JZ5A 4PABA 2J6SA 2LCWA 2FVRA 3C3LA 1YJTA 1XMQJ 2UXDJ 1PJ5A 3IRXA 1R27B 5EGYA 4LF4J 1TUVA 2W7AA 4QIVA 2Z8QA 4O4GB 4JI8J 5KT6A 3UDVA 3OFEA 1KNZA 3ZTPA 5K20B 4KAIA 4U8YA 5J2NB 4DV3J 2AW0A 2YWWA 1VQNS 4KGZB 4RR5A 2NQPA 1P9QC 3BGUA 2RHQB 3TVKA 3TANA 3PKMA 1YSJA 5D77A 2O5DA 4PYDA 1RHRB 1H2TZ 2W8KA 1IBLF 3FUYA 4ZITA 4K5RA 2DGQA 2G1HA 5L1JA 1XK8A 4YOEA 3D1HA 1I94J 4RW4B 3LAKA 2K3IA 4C2MA 1JB0C 2F65A 3SMZA 2HGNA 3R7BB 3M2RA 3PHEA 4DI6A 1YJNS 2C2NA 5GAGU 2B5JA 4DR2J 2NLWA 2CQ1A 3C6TA 1NK8A 4AQYJ 4H4KC 1HNIA 1JMTA 3FC9A 3I0RA 1N36F 2RQ4A 2LP4A 1PYSB 4DU8A 4DL6A 2G1DA 3OV7A 1N5VA 4C9DA 3TOQA 5I3QA 2VQEJ 4PZVA 3NOCA 1CJKA 1SIZA 3B4MA 1MWYA 2BM0A 2HAFA 4L3NA 1LWXA 3G6VA 2QMXA 3M2VB 1TK0A 4L73A 1H6KX 4NEYA 5A0YA 2XZTB 2NUHA 1RT7B 2KHCA 2HNDA 2UVUA 3G6YA 1F60B 4XAKA 5CAAA 2FVCA 5AXNA 1S4FA 4P72A 4A8OA 4NI2B 4F4KA 1CQMA 5IC6B 1S6PA 4Y2CA 3TAPA 2LXUA 2C2RA 2UXBF 2ZH3A 3QPIA 4D3HA 1UVKA 2CNNB 2MLZA 2KU7A 4USMA 3SQGB 2J0XA 2IDEA 2RH3A 2Z2ZA 3MR6A 2MQOA 2PI4A 4MK9A 4ANEA 4MTPA 4UTGA 1RTDA 2ZZMA 5HROB 3SSQA 3CJKB 3N28A 3DHWC 2VBWA 4F2RA 1XEZA 2V67A 3I31A 3KLEA 1G2EA 2YVSA 2VJVA 4WU2A 2IC3B 3BN7A 5A6WA 4ZKAA 2MKKA 4K4WA 1QE1A 3VAKA 4NLSA 3LGMA 3GJSB 4R0JA 3R2CJ 5D15A 1EKSA 1PAUB 2IJFA 1UP1A 3IRWP 7AT1B 4PXCA 3MM7A 2MKJA 3C15A 2N82B 2PEBA 2AU0A 2CJBA 3NNHA 4ZVUB 2C22A 3HVRA 1JJ4A 2RHSB 2HKEA 2WCXA 3M6VA 3M1VA 3R5BA 1D09B 1DTTA 5SUHA 4CLZA 3M2UA 2MB0B 4I0WA 2ZNZA 2WK4A 2XI3A 3GSDA 1QM9A 4P2FA 3POTA 4N56A 4B17A 2HHHF 3FMWA 3OSNA 2XI2A 4NZ6A 2E5GA 2VG7A 3MM5A 4OYIA 5A8WB 5HLFA 3AJ1A 5HP1A 2BJEA 2IVYA 3GFXA 2W9BB 4IDKA 5IV3A 4H4OB 3BR8A 1OWXA 2EI5A 1FD2A 1H7WA 1N5YB 3KK2B 2UXCF 1N0VC 1S79A 2EPIA 4IG0A 2Z0GA 3DNCA 4M5KA 5KG1A 3OLAA 3OFGA 2A2CA 3I9V9 4DSIA 2CDRB 1MU2B 2FLNA 4OHVA 3AXMA 5JVHQ 1TUGB 3HFVA 4P2XA 2ZC3A 2X1GA 1RAGB 1ZM3A 2MZ1A 2DXEA 1NB2A 2OPQB 5F8NA 3KLGA 1N8RT 1JLCB 3V4MA 1VQ7S 2J7WA 4NWBA 2KRBA 1XERA 2NZ4A 2QA1A 3G9CA 1FXDA 5C42A 2E5LF 1N6QB 4HH0A 3HULA 3DMJA 2EC2A 3LP1B 1Z1ZA 1FEEA 2IMOA 2MZSA 4OZLA 2HQ3A 3MM9B 3GZ7A 2C3OA 4DSEA 1UVLA 3MUMP 5HQMA 2ZD1A 3GV7B 2ATCB 5GADU 3BM7A 1PGZA 1F5AA 1R8AA 2IDLA 3PACA 1KVJA 2QLBB 4LFCF 3DGVA 4EGLA 3UI3A 3GCXP 2VB6A 1CJUB 2A1BA 2YNFB 4KPYA 1YBTA 3ZZTA 3TYTA 4DUYF 5AE2A 3ZTOA 3X3UA 4EYIB 2H9ZA 2BKPA 1D1UA 2HWIA 5JVGQ 2FJDB 1C0UB 4P73A 3AD9C 1T9YA 3OR2A 4J90A 1RHJB 1GFWB 1GTHA 1S7HA 4I69A 3DM2B 2BDPA 3B78A 2HBRB 3RBEA 3KHRA 2BJ8A 1VBYA 4CLWA 4KQZA 3BJYA 4K0KJ 3E01B 4BCAA 4P9SA 5SZTA 2R9LA 2WSCC 2RD5C 3VAFA 4DR6J 2Q79A 1NK9A 2DXFA 2M3DA 2MQPA 1WC6A 1T9VA 2P6SA 1SBRA 1FO1A 1YJUA 1WF1A 3R7SB 1UA0A 1QVFR 4C0HA 5L1IA 1IKYB 1JJHA 2YWHA 2V8HA 3N01A 3M7VA 1SPBP 1B7YB 3NGDA 5EWGA 3GIMA 3M6UA 3D6MB 3TR5A 2XMAA 3W2VA 2V4RA 4NLVA 2MGZB 1LK5A 1NJZA 4JI2F 1BUXA 1AUDA 3E2EA 4ID8A 1UW4A 1CEZA 2POKA 3SEOA 3EZUA 1WG4A 2OGUA 4JUZA 3MZIA 1DAXA 3CJ8A 1RTIB 3F73A 1Y5NB 5FD1A 4J9OA 1QAJA 3CMAS 3ONQA 2ROGA 4NE9C 1GTEA 3R8YA 1HW8A 3KUHA 1JXVA 5BR8J 1RTZA 4XDCA 5ETMA 4BWMA 1K1QA 3PJXA 4WZQA 2YBVA 1NDLA 1H2UX 4PWWA 2DGTA 4RNMA 2J9DA 5B0GA 3VV2B 4ITSA 4RZRA 1RT1A 1LW0A 4BHQA 4LF7F 2R7VA 2Q1LA 2FVQA 1URRA 3UW1A 4MMOA 1TK8A 2DJWA 3C16A 3D7SB 5KFCA 1NSKL 2KTQA 2VFSA 2BKNA 3H2VE 4OQJA 3QJJA 4OJ1A 2CG4A 3DRRB 2HQGA 1FF2A 4X64F 2D1CA 1F3FA 2Z2MA 3SI8A 1S59A 3BZQA 4I67A 2BA9A 3BF4A 1W2IA 3LPYA 4KIAA 1QY7A 1SV5A 4TU8A 1HWUA 5J1PA 4PPZA 2G2ZA 4ATNA 1EP4B 2BJ9A 4EZ6A 4USHA 3QZ8A 2DGVA 3U02A 3TZYA 2E5JA 4PUOA 3LTOA 1P8GA 2CNOB 3W2WA 2DO0A 5DGBA 1TVRB 2JX2A 2WSFC 5K5MA 2GFFA 1L3TA 1WHWA 2L48A 1SKUB 4JBCA 3QFHA 5FJ4A 4WP9A 4ZJLA 1VQKS 2HS0A 1IKVB 1NU4A 3IR5B 3ILOA 5F8JA 3KG1A 3GV8B 3ILLA 3G4SS 1RT6B 4OFZA 1G6BA 2YKNA 2LQ8A 2OMOA 4LSZB 3H98A 2V2KA 5C24B 3RAXA 1YK9A 1R0AA 3BKTA 4LRFA 2DNOA 4YMEA 3DLKA 4LRCA 1BQNA 2H4WB 2MY7A 4R8UA 4O3OA 3QJLA 2YKPA 2PFFB 4FPRA 2V50A 4LF5J 1VI7A 2LA6A 2KHDA 5KG4A 3PNIA 5EWFA 3SFGA 2XNRA 2KFZA 1N33F 1XNRJ 3P49B 2IFXA 5A8RB 3PJWA 3I32A 4ETXA 2IA0A 3U7JA 2ASLA 2ILYA 2YNIB 3TAQA 4LF1A 1NZAA 4BDPA 3Q83A 4O44A 4LSNA 3QAUA 1B0VA 4K5SA 2IAJA 2HVZA 4OV6A 1SJRA 4YB7A 4DPTA 1WKKA 4JI5F 1RBLA 2QL7B 4OYBA 3DRYA 5FLXY 5KFMA 4NCAA 3IWNC 3AA9A 3D9BA 3TJ8A 1SJ1A 1WG1A 4W90B 3GILA 2QLFB 2VFRA 3JS9A 2XTJP 2CAJA 1B3TA 4QWCA 3HHLB 1QAIA 2Q66A 4QWDA 2C2DA 3VZHA 1NKBA 2ILZA 4ELUA 5RUBA 3D28A 3CXCR 3MCMA 4K8RA 1YRTA 4IG3B 3C14A 3IA0A 1R8CA 4IFYB 4FYVB 1NK0A 3MDFA 3GONA 1R8BA 3TUIC 3VVUA 4USVA 3RZAA 2OKQA 3US5A 2Y1JA 1EQMA 4F0HA 2QE5A 2HMIB 4J7CA 3EZ5A 2CFXA 3CGIA 2ZOMA 1S1TA 4B9MA 2IY5B 2KN4A 5LMNJ 5J2MA 4AL6A 3D0IE 3MAHA 2NXNA 2GHWA 3TQEA 1RE1B 2GMJA 4X4TA 4DV2J 1M5PC 3CDWA 4Q5VA 1RT3B 4FBUA 1SC1B 5HVFA 2BJDA 2DHXA 4YP3A 2QN6B 2CJQA 5LOQA 2G9OA 3PRBA 1TL4A 1K0VA 3QGPA 3KJNB 2PC6A 3MEDA 1J5EF 4C11B 3PXGa 3CDBA 2B4OA 2XSJB 3T9ZA 2IRUA 2DR6A 3PFOA 4RBUA 5E2QA 2ALZA 3ITHA 1S9GA 5IT0A 3IP0A 2D3UA 3CO0P 3U1NA 3PZPA 3O44A 2IVFB 1AW0A 3WHIA 3MECB 1DQ9A 1VMBA 3FSXA 1RBAA 2WOMB 1CJVA 4ZOSA 4H4MA 5KG7A 2CJXB 1FEHA 4B3TJ 1T03A 3L7OA 1X7VA 4NCBA 4L75A 2OHDA 5KFHA 2G4BA 1U25A 3TZXA 2AJ4A 1N0UA 4YN3B 1W2BR 1HWIA 1FXLA 1T94A 2HRYA 2AJ2A 3RRKA 3OTEA 4ZPTR 2FJEB 4HEA9 2CNLB 4DV6J 4XK8C 4DR7F 2R7TA 2MMYA 1HI8A 3NCQA 1REGX 2HWHA 1BQXA 4CLSA 1IN0A 2ADBA 4NMXA 3OBIA 2ZJPQ 4FYDA 1HPZA 3G71S 4DV0J 1FRXA 3H20A 4OLPA 4U7UK 1WC0A 1WDDA 2VBYA 4B9TA 3UVJA 5GAHU 3HHDA 1WOOA 4WFYA 1KQGB 1U1RA 2CWKA 4LMZA 2AX0A 4QQBA 3GFZA 4MK8A 2ZHAA 2ZVSA 3IBCB 1OPZA 1YI2S 4LRDA 4QR2A 4UT4A 4X4QA 4OYZA 4AXIA 4E98A 3CULA 3Q89A 3G6ES 1NJXA 2XQCA 3VQSA 2NREA 2YKOA 4QR1A 3PRDA 5J2PB 1YQHA 3C6UB 4W98A 1QD1A 1K0TA 5KT5A 3DLLQ 2QGFB 3F44A 1A0OB 1FX4A 4QIGA 1ZTWA 4DQPA 1OY9A 2M88A 3ZZPA 2K1RA 4FF2A 2P6TA 3W8PA 3ZZ0A 2QL5B 4GVLA 4IH6A 5F9NA 2GJIA 2R7XA 4NXMF 1RCOB 5GMKa 3HSDA 5MAOA 1SC3B 4QW8A 3NMRA 3DLBA 1B70B 3EXCX 2XLIA 5CYMA 2B9EA 3ZZRA 4UOHA 2RF2A 3T1HJ 1RBOB 2HVHA 2C2MB 2GCFA 1HNVB 1YRXA 4X65J 5EDWA 4LF9J 3HF5A 1FWPA 4F3QA 3I6PA 2XWXA 5GAEI 3P96A 4A8XA 3TJ9A 3P4UB 3OQ2A 1QTMA 2GGPB 3J7Z5 4LFAJ 4BS2A 3HDSA 3AAWB 3B54A 3L4BC 3ZNUA 1RACB 1R0CB 3SDEA 3QQCD 2A0FB 1U8WA 3SYZA 4ECRA 3I96A 4PWDA 1TKTB 2LXFA 3MMAB 2DXDA 1X0FA 2RVJA 2ROEA 1ZA2B 4RL1A 1HHQA 1MWQA 1OSCA 3UWTA 4IOCQ 1G1XA 3V4IB 1RDRA 3CEDA 3A3OB 3EGWB 2DVIA 3BQ2A 3G82A 1MG7A 2HHTA 3E8OA 4MIWA 2MZRA 2Z30B 1O5JA 1BE4A 1RAEB 4OZ5A 2JWNA 1WF0A 2ZKTA 3WZ0A 3MEEB 2GQQA 4CLLA 4WU3A 3D6TB 4DU7A 1FX2A 1WEZA 2BEFA 2UU9J 1BXNA 1RYRA 3QGGA 4OZJA 4Q0BB 4JV0A 2IM2A 5FIIA 4Q43A 3BGRA 1PCAA 3M2RB 4ED8A 4DG1A 3OSPA 3Q8SB 2VG6A 5I42B 1WHYA 2AEJA 5KT2A 2R7UA 3M8ZA 1MLAA 4DV5F 4RUAA 3PX6A 3LUYA 3EMTA 2N3OA 2QIFA 2K7JA 2R7RA 3LAMA 2U2FA 5D0EA 4F0MA 1TTHB 5AJ3J 5DZ7A 3BH6B 1XNQF 2VIHA 3W61A 1AYEA 3BGOP 3CB4A 1H2VZ 1RU2A 1U2FA 4N8NA 3U27A 1VISA 5AXLA 2AX1A 1FE4A 5IC4B 4YQWA 2KFNA 3J7AN 3F41A 2BYCA 3C66A 3UQSA 2F8HA 3H5SA 2OPSA 4HT7A 4IFVA 1SL1A 2UXDF 4LF4F 5FLXU 3KJFB 4JI8F 5JJBA 2FTRA 1S99A 3UN2A 4ZP8A 2DH8A 3JSMA 4DV3F 5HAOA 3SV3A 5DQGA 5ETPA 1FKPB 2ZBCA 3GSIA 1FNOA 4AL7A 2WVEA 2RB7A 2M5YA 4HDHA 5KFGA 2I6WA 1R7IA 2ZH7A 2XYPB 4DHVA 3OW2R 2RIJA 4DSFA 1REVB 2JHEA 4KFBA 1I94F 4KO0A 5EN1A 1FDNA 3H8YA 3O6QA 2B6AA 2CNKB 1NH7A 4DL3A 2MHNA 3BDEA 3KLHB 4EBEA 1FKAF 2APOA 1IWAA 2VFUA 4ZPWR 4DR2F 1FCAA 3KYLA 4J37A 2CQGA 4WTYA 4LJMA 5I4MA 2OH2A 1S10A 1B0TA 2VC0A 1IBMJ 2CQHA 3IS9B 1RSCA 1I6JA 1CLFA 4NCGB 4DSJA 5J2NA 4DSKA 4JOUA 3MM7B 4LF2A 1QVGR 1R31A 2VPWB 4I6AA 3ZC4A 1N34J 2N3LA 1QSYA 4OYXA 5DDPC 4C8KA 1SC4B 3HVTB 2J6UA 2M52A 2PMZD 2VODA 4PXEA 4ZDNA 2AEFA 3CDUA 4RW4A 1RWKB 3BSNA 2XCAA 4DQSA 3W5YA 2YX4A 2WB4A 3POTB 2DNYA 2WVCA 3KG4A 2BKOA 1S1UA 4GO7X 3LH2S 4G1QA 1NEEA 3ENAA 3LF0A 3D68A 3K7RA 4OZ3A 2CQ3A 1S77D 3VZIA 3CDEA 1TQLA 1KQFB 1Q1KA 3V5RA 4ELVA 2M9KA 3RAMA 2W25A 4CRJA 3FBCA 4DV4J 2GX8A 2YTCA 2UUAJ 4NOHA 3TO8A 2V6AA 1RXOB 4F67A 2DNQA 4DF4A 3S1TA 4O0NA 4ECTA 2QJ3A 2ACMA 1K44A 1KTQA 1RT7A 5CQGA 5KFOA 2FJXA 3BBCA 1YZ6A 1DY3A 2HFUA 1WI6A 4KE5A 1BWEA 2E7VA 2HEKA 2ZUAA 2UZAA 5A8KB 2VV5A 3TZZA 3CJ2A 1EHWA 5LXYA 3FEYB 3EZOA 3GFHA 1U6ZA 3AY0A 2CPIA 4TN2A 4CH1A 5JUMA 3R1LA 4URSA 3OXFA 5F41A 3SQGA 2A18A 2P9GA 1YHQS 3OL7A 2PN6A 5E5NA 1UVMA 1WOSA 2N7YA 1R0BG 5HROA 4DPYA 4LR8A 3CJKA 2EFOA 4MKAA 2DR8A 1YIJS 3OTOF 5IT9Y 4U8VA 1ZM9A 3DXBA 2AP6A 2CPXA 5A2QY 3IR7B 4HLBA 2DD8S 3TEHB 3MD1A 2IC3A 3PYDA 4OJHA 2FZGB 2GMHA 4M95A 3ICLA 3CCRS 2XGPA 1UA1A 3TQ1A 3DOMB 2XM3A 1ZAXA 2V68A 5C2CA 1YRUA 5H1SV 1V3ZA 1Y10A 4UQTA 3HMJG 2NYIA 2Z57B 3FRZA 3KMSA 2B4PA 2DHAA 1BLUA 1CSJA 5F8LA 2IRYA 2D3O1 3T5LA 2X1FA 4DZDA 2F63A 1VQ6S 4QOTA 2QT7A 1X9SA 1FJGJ 1KLMB 3EJMA 3GYXB 3O8WA 1RT4B 5F3TA 4WFBQ 4K4YA 1WDTA 1WUUA 4X4UA 2MKYA 3BQ0A 5BYSA 3G2XA 3AQOA 5A8WA 2HLUA 2YWKA 2R8JA 2WONB 4OZNA 2CJ9A 4C7QA 4EBCA 2W9BA 3ZZUA 4H4OA 1PC5A 3JAMY 4ZVOB 4C8MA 1N5YA 2RJZA 1TELA 2LEAA 2LMIA 1J27A 3KK2A 4NLGA 5D4NA 1HNWJ 1BQMB 2PFDA 2J0SD 1IKXA 5LSOA 3M8QB 4O3RA 1QUPA 2E5HA 2O3DA 1GX5A 5A76A 3OHAA 4ZN1A 4ZVPB 1MU2A 3VGVA 4IQXA 3FRYA 1ZYQA 2LDYA 5KFNA 4ELTA 1M5HA 1OYEA 3I0SB 4B3MJ 2K3KA 4WFXA 3Q8PB 2YWEA 1JLCA 2ZDOA 1OPIA 3H7HB 2X51A 2YQ0A 3T1YJ 1P27B 2WVDA 1N6QA 3K0JA 3LP1A 3M8PB 3DCAA 2CPHA 1U1PA 1CJTB 4DV7J 1LWCB 4RWWA 3MM9A 4K4VA 1RHMB 1R8HA 4K0KF 3FEZA 5IZHA 4B3OB 4CLUA 2H4YB 1APSA 1FD8A 4DR6F 1U8SA 3CJTA 3T5JA 1Q78A 2MPUA 1CJUA 1NPPA 5L9NA 3TUPA 2YNFA 1AB8A 4CLPA 1KD1T 3ULHA 2CYYA 2G2OA 4WJBA 2DEJA 2ZC4A 2CPJA 3GCWP 1C0UA 4CP5A 1W7WA 4DR4J 1Y0HA 2QFJA 2VFVA 4IYQA 2BANB 4WP8A 5LSRA 2I5JB 3B8HA 4F3OA 3RB6A 4X66J 5DG7A 2XLJA 1OYDA 3DM2A 3KDOA 3NXZA 2DGSA 1TMMA 1PSDA 4I2QB 4X4SA 5HVHA 1NKEA 3AA8A 1NUEA 5LJ5Y 1MMDA 3E01A 2VG5B 3ILJA 2ZKUA 2R4FA 4MT1A 3BN4A 2RMLA 4ZPDA 5D4PA 2Q3PA 5BR8F 2XYGB 3EWGA 3LOUA 2J6TA 1LNQA 1S97A 1H72C 4O3QA 1S1XA 1FJ7A 2JLGA 1IKYA 3ETMA 5L39A 2JOQA 4JI3J 3KNGA 4TQRA 4DPOA 4DL2A 3ET6B 2FZCB 1UJ4A 2LU2A 1JLBB 2RDIA 4ZN3A 2MQQA 7FDRA 1CQNA 3MMCB 2W2QP 2MGZA 3TARA 3MPWA 3HVAA 2HGMA 1KFSA 5EUHA 3UN5A 4NX9A 4GKKF 1PO6A 2YNGB 1JX4A 1RTIA 2U1AA 4CZCA 2FC9A 1GX6A 4E2FB 3RTVA 4Y28C 2ASYA 5ETKA 5KFTA 2B9XA 3SCIE 2OP5A 4PXDA 3RR8A 3BO3A 2LQ5A 4ZCMA 8AT1B 4B9VA 2VDHA 2YWFA 1ZM2A 1KFDA 3LGHA 3W3SA 2F40A 5E7OB 1IVZA 4ILLA 1ZAVA 4IOBA 1RJJA 3I5BA 1HQEB 4MK7A 1UPPA 3TA1A 3K5LA 4ID5B 4J9NA 3CC2S 3OUYB 2B9YA 4LIRA 4PXBA 4ECWA 4XPCA 4J9SA 1F9EB 4XDDA 2CJAA 1DBDA 3R27A 2G2YA 2KXFA 4DR5J 4J9PA 2YX1A 3GPAA 4PG4A 4OHWA 4M5LA 2J8AA 4S0MA 4M5MA 3FCVA 2FY8A 1LEOA 5L1KA 1N5TA 1Y4ZB 3QWUA 3DRRA 2FDNA 2GJFA 1RWPB 4L76A 3V2UC 4FBTA 5IM0A 2V9WA 1C1BB 3MR2A 4TLQA 4GKJF 3NY0A 1XMBA 1HKAA 5KG0A 1PBUA 3QZ7A 4TXSA 3RRHA 4XIUA 4ES2A 2KZMA 1RWOB 1FDAA 2PA3A 2QLXA 3NEKA 2ZH1A 3J80Y 1EP4A 2E44A 2F8MA 4LF5F 1KWMA 3QWPA 1NK5A 2FJAB 5I3PA 3WQPA 4U7CA 1HIYA 2HS3A 2F3JA 4NLOA 4NLDA 3DOKB 1TVRA 3OL8A 4JI0F 4DV1J 5HK4A 2HQCA 3M6WA 1LQ9A 2DGOA 3RUBL 3A8KA 2AHOB 5FDLB 2VH7A 1IKVA 4KGKA 2I2YA 3L95X 5IS2A 3HD1A 3HHLC 4OIXA 3OJUA 4QJVA 1RT6A 2FB0A 1JNRB 3BV8A 4P2SA 2XC9A 2V2VA 4Q8EA 2RAQA 2XMVA 2EWHA 1FXRA 1NM2A 2EK1A 5C24A 3ITHB 4RO0A 4E8UA 2ZNYA 3HSJA 3NWGA 5ADZA 4HI1A 3G87A 4N47A 3EYZA 1SVDA 2LDIA 5KFWA 1J2VA 1QLNA 4WPAA 3TVYA 3T41A 1L3UA 2A6MA 5A8RA 4F4AA 1C4AA 1RK8A 1VR6A 1G3OA 1FRMA 2JNJA 2YPYA 1Z2ZA 4OX7A 3DLJA 2DCUB 2WBMA 2QSFA 3J81j 5IT9U 4ED4A 1KRPA 2YNIA 5DGAA 1Y3KA 3V6DB 1AXQA 4PKDB 1UEUA 4DN0A 2XHWA 2I8EA 5F8MA 5DLGA 2CZ4A 3RB3A 2XB2D 3OHBA 3NNAA 5DJBA 5LMNF 4X4NA 2M70A 1U4BA 1DURA 3ELHA 3FCWA 1U02A 4IRKA 1V5VA 2GW8A 4DV2F 5F8HA 1S12A 3WC2A 3HHLA 5HQ8A 1WJ9A 3P8BB 3QGIA 3BS9A 2XULA 2V0NA 2DITA 2CKWA 4OI4A 4DX8H 1HLWA 1X5TA 3D66A 3AQPA 2DTJA 2DNNA 1CBKA 4A47A 3HCXA 4JI1J 1FJEB 4YDDB 4ECSA 1FERA 1UL3A 4IG3A 4P75A 4Q44A 2WB1D 4RW6B 1YLXA 3R9LA 2R2TA 4IFYA 5HI7A 4KRWA 5EX0A 3WIUA 4UQGA 4HT5A 3MR3A 1U2RA 3JAMU 1FI4A 1HQUB 3PJ9A 2OEJA 1F5BA 3JTPA 4M8LA 3G6XA 2HMIA 2W4PA 2LKZA 2YWGA 2FGOA 1FFSB 2H51B 2LVWA 2FHOB 2FLPA 4KT0C 3VAMA 4FNHA 3R5AA 4B3TF 2M0GB 4Y65A 1RT3A 1RAOA 1X4BA 1F5CA 1X9MA 4DMZA 3RW7A 1G7CB 3KG0A 1VFJA 1UTAA 4DR3J 4C3KA 1M0SA 1UCNA 1TKXB 1VYAA 1E6YB 4ED0A 3GIIA 4DS4A 2YH1A 4OX6A 4KH0B 4C11A 4ZVEA 2C3UA 4KPCA 2XSJA 3UN3A 2RF2B 3EGNA 2ZH2A 4C0BA 4DV6F 1YZ7A 3M9NB 3PX0A 2IBKA 3HHNB 4PRFA 1RLCL 3TA2A 2E9RX 2GO8A 3NLCA 2WW8A 2O1PA 2W2NP 4DV0F 4ED3A 5KFKA 3DDKA 3MECA 4CLFA 1U26A 1MMLA 4OHYA 2WOMA 1U24A 3DRPB 2K06A 4DQQA 2XWYA 4A8SA 4J9LA 1FDDA 4TKTA 2OIHA 2AYBA 2V94A 4CLKA 1ZM4A 4LBHA 5IV4A 2EFNA 1FFWB 2Y3YA 1BWVA 1V3SA 2IIHA 2KH9A 1TR0A 2KB2A 2PT0A 4YEAA 1AROP 3TAMA 3C2PA 2JLEA 1VQSA 2ROPA 4JI6F 4U7UD 3W64A 3IBFB 5F0UA 3W65A 2E9ZA 4NA3A 3J7A1 2H5IB 2HHXA 4RNHA 2W2PP 4KYZA 3SBMA 1HI1A 3M4XA 3CJ0A 2CQDA 2BQRA 1RWWB 4OHXA 2ZM6J 1QAYA 2HZAA 2BOAA 4FYYB 3GU0A 1WEXA 2GC8A 2IRXA 1OQ6A 3I4PA 4QYZK 1O0PA 4C8NA 1S72S 4ALZA 3HD2A 3T5HA 3UCUP 3T1HF 5ETSA 3EVOA 3VGTA 1SL2A 2VASA 4QU6A 4OLOA 3D3CJ 3MOJB 3CC7S 1W26A 2OFGX 4ECXA 4UF4A 2VG6B 4X65F 1JLGB 3M32A 1T0TV 4MIAA 5J2PA 1AT1B 2KL8A 3MEGB 3C6UA 3W9IA 4YHHJ 2H5EA 3KLFB 2C1EB 3KUEA 2HFSA 4KBIA 3K2YA 3PVXA 4ECQA 1JXLA 2A3JA 2XO6A 2MY8A 4K4UA 3MAAB 1NK4A 3O3LA 4PR6A 1OSDA 1Q4RA 2JEGA 2DY1A 4RBVA 2VHGA 2BJ7A 3J7YI 1A9NB 3Q8YA 2AF6A 2ZHBA 4AD6A 3Q8RB 3SV4A 1HNVA 2FVSA 1X4EA 3QT7A 3AODA 2V2ZA 5HVGA 1FNXH 1HWLA 2GGPA 1HFEL 5LMUJ 3CMES 5ETNA 2BM1A 1N56A 3LW5C 2DO4A 2AQ4A 3IMQJ 4DF8A 1X5PA 3V81B 1FRIA 1RI7A 4Q2MA 2VBXA 4RNFA 3QIPB 5KFYA 2IJNA 1NSPA 5E0OA 1TKTA 3MMAA 4OL8A 3QRQA 2J7KA 4RW9B 4GVBB 2ZVIA 3VTIA 2VZ9A 4OV1A 1GXUA 3TI0A 4ED1A 1IKWA 5K14B 1S6QB 1LV5A 4LSLB 5ETLA 4EK2A 3J80U 1WNEA 2MQMA 3T6BA 2V8GA 2FUG9 4ED2A 3V4IA 4RU9A 3O2IA 2YKMB 1WKLA 5AJ3F 4A8QA 1WSRA 4Q2LA 2MQLA 3KOAA 2DNZA 2W01A 2ZFHA 4X4RA 1FKOB 2NCKL 1VIXA 3MEEA 4F4ZA 1F0XA 5GMEA 1IQTA 1VK3A 2R2UA 4TNOA 3S8SA 4Q0BA 2VDIA 1SB6A 2CQBA 5ETVA 2WW4A 5KG5A 3PTWA 3ZFVA 1SJQA 1WTBA 3CMQA 4HR2A 4FKYA 1UEVA 3ZO7A 4B3SJ 3MPVA 3GFYA 2BW7A 4C4WA 1S1UB 1PBAA 5I42A 4FXWA 4G1QB 4RPFA 2B7CB 1SUQA 1SQEA 1KP6A 4F02A 2MKHA 3WX4A 3DOLB 1RUSA 1KVKA 3K17A 2UUWA 2AEMA 2DB1A 5DG9A 2EEYA 1SJ3P 4LFCJ 4GMKA 4IH7A 3H0PA 1RGVA 2MJNA 1GNKA 1H0HB 1HBNB 2QSWA 4BLGA 5B0DA 2E29A 2KJVA 3FMBA 5D0RA 3PEJA 1X0PA 4ZP6A 1GAOA 2KT5A 4UOCA 3I56S 3RRGA 3LALA 4M63A 1JK9B 1XR7A 2DR9A 1Q53A 2NSCA 1YJ9S 3HLUA 1LXNA 4L3KA 2DR5A 4WIIA 1U7LA 3FBBA 2G0JA 2SXLA 3GIJA 1D8ZA 3AOAA 3G86A 4DUTA 1RQ0A 4B3RJ 5ETQA 2PDAA 1IBMF 3IN5A 2HZCA 4NLXA 1D8YA 2BJ1A 1N34F 2FQQB 1FKPA 4YR0A 2KT3A 2DRAA 2HVEA 4K2JA 3P6YC 2V4JA 1SH2A 1F9HA 2V8DA 3VF0B 4CNZA 1WTFA 1OQ3A 1REVA 3BYPA 1EARA 2E7XA 2B8QA 5DDRC 2NUUG 3H42A 3NNCA 1CS4B 5KFQA 4EUVA 1MN9A 4OI1A 3QMQA 1M90T 3KLHA 3V6JA 1O51A 5EWEA 1LFWA 1NH8A 3H5YA 3T9NA 1HMVB 1CVJA 3BREA 3IS9A 3Q8UA 1FA0A 3FJ2A 3HT3A 3GJQB 1XWLA 4WKYA 4Y2AA 4WFNQ 4NCGA 4QPTA 3OD2A 2DNLA 6FD1A 1FRKA 4N5SA 4JI4J 4DZ6A 4DV4F 3LGNA 2DGXA 1M5VC 2UUAF 3HVTA 3MHYA 1C1CB 1F6TA 4CCHA 1KN6A 1UEKA 3MFIA 4NLYA 2O66A 2A6OA 1TFYA 2AD9A 3FBEA 3QAEA 2C28A 2BR0A 3FFIB 3MTJA 3L7PA 4ENOA 1Q8LA 4MKVA 3ZTRA 1DTQB 4UOGA 2H54B 3CCES 5CXTA 4UY8T 3CCWA 2PE8A 3ADAC 2MTLA 1WACA 2JEFA 2UUCJ 4OYAA 1KDNA 4CLYA 3ILIA 5J1EB 3LPEA 1X4AA 2K2PA 3NP5A 1TAQA 1SL0A 3IAS9 1RHUB 2HHSA 2DH9A 4ZLNA 1EETB 4O0IA 1ZETA 2UVRA 2ZJRQ 1IKXB 4DPWA 4ICLB 1UWBB 2B9WA 3CCUS 3OVSA 5J2QB 4M5JA 3W9HA 2YQ3A 4R25A 2YX7A 5K8MA 3THTA 4WYWA 4EI2A 3LP0B 4W92B 3NRBA 3GE9A 2Z56B 1U1MA 5C25B 4ZVQB 2N4DA 3M9OB 2HNZB 2D41A 4TYBA 2KZZA 2KKHA 3BDPA 5D4OA 5A8KA 1AFJA 2R42A 4ZIVA 3MWBA 4I68A 2HQFA 3MI7X 1ZS6A 1RKJA 3R5JB 4H54A 4K7QA 1UKUA 3D6HB 2Y8YA 4IO1A 1FJGF 4ZLJA 3A4TA 4QWAA 2VA3A 1WORA 1C0TB 1IWGA 4CT8A 5KOWA 2KFYA 5C2GA 2XS7A 2LQ9A 4FF1A 2WSEC 4OMFG 4LF6J 5EX3A 2FY1A 1NKCA 4V19J 2CQ2A 2GIFA 4DJBA 5DZ6A 2HFOA 4N41A 3DOMA 3NKYA 1MWZA 2ZH6A 2PMWA 3CPWR 3DLEB 2MZTA 1GMUA 2DGUA 1KC8T 2RKIB 4Y0FA 4MH8A 1YKWA 3BB5A 2HBQB 2FHMA 4USUA 4P74A 1PAEX 2PSZA 4LQ3A 2GA7A 2B7BB 4ZLLA 1NJIT 3I9ZA 5I3UB 3RBZA 4I2PB 4F4XA 5D6GA 1O8BA 5KFDA 4NASA 3HHEA 1EX8A 4ZCIA 1I51B 1S1VB 1KLMA 2X7IA 4B3MF 3S01A 1RT4A 1UVJA 4M5DB 5CHCB 1S1XB 2FLLA 2R7WA 1FT8A 1NCLA 3T1YF 3PIOQ 2WONA 2ZH4A 3AFGA 4QU7A 4ZPBA 3N5FA 4F0KA 2OFHX 5KFFA 2VONA 3HHKA 4QIWD 3UNGC 2NPFA 1N4LA 2HHQA 1Y5LB 2XMTA 2UUBJ 1BQMA 4F2SA 1TU0B 4NYPA 4X4VA 1LWFB 1HD1A 3W9JA 3M8QA 1C2PA 2Z2YB 4CIOA 3ZTSA 1VGYA 4ZA1A 1VC6A 1N48A 3R6GB 2RQCA 1U09A 2L9WA 3I0SA 2WVFA 1T9UA 4HACB 3THVA 1SIWB 1JXEA 5T7LB 4DR4F 1R6VA 2GQCA 4JV5J 4CI0B 4YR3A 1R8PA 4RNOA 3M8PA 3HJVA 1T3OA 1CJTA 2CPZA 2OSQA 1LWCA 3DHXA 3EDRB 3ISND 3MF5A 2OD6A 4B3OA 2PEHA 3EVWA 2W2MP 4DL5A 2JLFA 3R5CA 3M6XA 4LFBJ 1TMJA 2X1AA 3QRPA 2QA4S 5IM0B 1T9TA 4ZVRB 4DR1J 4K50A 4TY8B 3IWLA 1Q8BA 4JI3F 4TVAB 3GQCA 4OZ2A 3VALA 3QYYA 4G6VB 4YS2A 3TUZC 2KI2A 1RCXB 1H98A 4KTQA 4NXNJ 4RLEA 2I1RA 3W66A 1NHVA 2BANA 2HURA 3QFWA 2KJWA 3P45B 3HPOA 2I5JA 4RJVA 3NGKA 2ZH8A 3PDNA 4ZVFA 4B9UA 2QEXS 4I64A 5AXMA 4I2QA 3PX4A 3UE2A 3BPSP 3O1LA 4DBQA 5KT3A 1KTVA 2ASJA 2VG5A 4CTAB 4J9MA 4MKBA 1EB0A 3GYGA 2E1CA 2M4MA 2L9DA 4B02A 2CZ9A 4DL7A 4I6YA 5KFRA 3DI6B 1FRLA 4QPXA 1T05B 1SH0A 2DHGA 3H4DA 3KDNA 2VKRA 3R97A 4P2MA 2V34A 2F8EX 2E1AA 1VS3A 4WFAQ 3SQOP 5H9EK 3ET6A 1SH3A 1JLBA 2CQIA 3QT6A 1K47A 1L3SA 3MMCA 4WE1B 1XTZA 5DETA 4KGXB 3HZGA 3R1HA 4DR5F 4USTA 1ZPVA 3U1MA 2YNGA 4DCPB
chains in the Genus database with same CATH topology
4HR2A 3G2XA 4FKYA 2BX6A 3FBEA 1F3FA 4FKXA 4C6AA 2HURA 1PAEX 4UOHA 2HVEA 3NGSA 1NSPA 1S59A 3MPDA 4ENOA 3DKDA 3FBCA 3ZTRA 3ETMA 5CAAA 2CWKA 4UOGA 5CABA 1XQIA 3L7UA 1B99A 1BE4A 2DXEA 1NB2A 3NGUA 4DI6A 1UCNA 1VYAA 1PKUA 3GPAA 3VVUA 3ELHA 3FCWA 1JXVA 1ZS6A 4S0MA 3FCVA 1NLKL 2B8QA 4O0NA 5IOLA 4EK2A 3WX8A 1LEOA 5BXIA 1KDNA 4KPCA 1NDPA 1NPKA 1BHNA 3EM1A 5C7PA 1MN9A 2BEFA 3Q89A 1HLWA 1NDLA 2DY9A 1K44A 1NCLA 3FC9A 3Q83A 3Q8YA 3BBCA 3EVMA 3FBFA 3B54A 3DDIA 2DXFA 2VU5A 3VGVA 4CP5A 1B4SA 3EE3A 1W7WA 2AZ1A 4ANEA 1WKLA 3GP9A 3BBBA 3EVWA 3NGRA 2DYAA 4W98A 1U8WA 4F4AA 3R9LA 3BH7B 4ANCA 2ZUAA 1WKKA 1XIQA 3Q8UA 2NCKL 1EHWA 3PRVA 3Q8VA 3VGUA 2DXDA 3EICA 2B8PA 3EMTA 2AZ3A 1MN7A 3FBBA 1NSKL 3ZTPA 3PJ9A 1LWXA 3JS9A 3NGTA 3VVTA 4UOFA 2HVDA 1NUEA 3EVOA 1NDCA 3VGTA 4DUTA 1NDKA 4DZ6A 1HIYA 3EJMA 3ENAA 4WBFA 1WKJA 3BBFA 1S57A 3Q86A 1S5ZA 3B6BA 3VGSA 1F6TA 1HHQA 3ZTOA 3BH6B 3ZTQA 3ZTSA 1BUXA 3FKBA 4F36A 1NSQA 1NHKL 4ANDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HR2 A;  3G2X A;  4FKY A;  2BX6 A;  3FBE A;  1F3F A;  4FKX A;  4C6A A;  2HUR A;  1PAE X;  4UOH A;  2HVE A;  3NGS A;  1NSP A;  1S59 A;  3MPD A;  4ENO A;  3DKD A;  3FBC A;  3ZTR A;  3ETM A;  5CAA A;  2CWK A;  4UOG A;  5CAB A;  1XQI A;  3L7U A;  1B99 A;  1BE4 A;  2DXE A;  1NB2 A;  3NGU A;  4DI6 A;  1UCN A;  1VYA A;  1PKU A;  3GPA A;  3VVU A;  3ELH A;  3FCW A;  1JXV A;  1ZS6 A;  4S0M A;  3FCV A;  1NLK L;  2B8Q A;  4O0N A;  5IOL A;  4EK2 A;  3WX8 A;  1LEO A;  5BXI A;  1KDN A;  4KPC A;  1NDP A;  1NPK A;  1BHN A;  3EM1 A;  5C7P A;  1MN9 A;  2BEF A;  3Q89 A;  1HLW A;  1NDL A;  2DY9 A;  1K44 A;  1NCL A;  3FC9 A;  3Q83 A;  3Q8Y A;  3BBC A;  3EVM A;  3FBF A;  3B54 A;  3DDI A;  2DXF A;  2VU5 A;  3VGV A;  4CP5 A;  1B4S A;  3EE3 A;  1W7W A;  2AZ1 A;  4ANE A;  1WKL A;  3GP9 A;  3BBB A;  3EVW A;  3NGR A;  2DYA A;  4W98 A;  1U8W A;  4F4A A;  3R9L A;  3BH7 B;  4ANC A;  2ZUA A;  1WKK A;  1XIQ A;  3Q8U A;  2NCK L;  1EHW A;  3PRV A;  3Q8V A;  3VGU A;  2DXD A;  3EIC A;  2B8P A;  3EMT A;  2AZ3 A;  1MN7 A;  3FBB A;  1NSK L;  3ZTP A;  3PJ9 A;  1LWX A;  3JS9 A;  3NGT A;  3VVT A;  4UOF A;  2HVD A;  1NUE A;  3EVO A;  1NDC A;  3VGT A;  4DUT A;  1NDK A;  4DZ6 A;  1HIY A;  3EJM A;  3ENA A;  4WBF A;  1WKJ A;  3BBF A;  1S57 A;  3Q86 A;  1S5Z A;  3B6B A;  3VGS A;  1F6T A;  1HHQ A;  3ZTO A;  3BH6 B;  3ZTQ A;  3ZTS A;  1BUX A;  3FKB A;  4F36 A;  1NSQ A;  1NHK L;  4AND A; 
#chains in the Genus database with same CATH topology
 2BX6 A;  1RAJ A;  4Y2M A;  3RG6 A;  1S1W B;  3R7N B;  1KHW A;  2OPP B;  3PV8 A;  1NO8 A;  3NGS A;  4OZ0 A;  1LWE A;  3QO9 B;  3M8S A;  2Z2L A;  3P5T L;  5B0A A;  4DQI A;  1CPZ A;  2KG1 A;  1LW2 B;  2XMJ A;  3MM6 B;  1IUJ A;  1RT5 B;  4LVO P;  3T3F A;  2GV1 A;  2C2Z B;  1R3N A;  1HQE A;  1FTR A;  3FQL A;  5AXK A;  4Z7C A;  4OHZ A;  2WRM A;  4ID5 A;  5GAE U;  3T1A A;  2KM8 C;  3OUY A;  2KT2 A;  3MR7 A;  2LLZ A;  1CC7 A;  3D6F B;  3HZE A;  4OYP A;  2KRR A;  3R5D A;  3MOZ A;  4DV1 F;  4ANC A;  2P2C B;  5M2R A;  4WYL A;  2VUG A;  2ERR A;  3CCZ A;  1ZPW X;  2MQ8 A;  1VC0 A;  3N6N A;  4AT1 B;  4P52 A;  1H7X A;  1C1B A;  2RNE A;  3DRS B;  5CZV A;  3GIR A;  2AYG A;  3MM8 B;  1SJ4 P;  2EFP A;  3HFZ B;  2GAH C;  1U6F A;  1FNM A;  3I4H X;  4X84 A;  4LQ9 A;  1JLA B;  5HL7 Q;  1AFI A;  1E6V B;  5L1L A;  4IH5 A;  4RW8 B;  5HO4 A;  5KFB A;  2WTF A;  5G0R B;  2RIL A;  2D7S A;  3DOK A;  3Q23 A;  1BHN A;  3KHL A;  4NPO A;  2QA2 A;  4J9U E;  3G96 A;  4A8W A;  2FVP A;  5BJR A;  3FBF A;  5KG6 A;  2ZUG A;  4A48 A;  4Z37 A;  5FDL A;  1WD6 A;  7FD1 A;  2YH0 A;  1DHM A;  3D3B J;  3KTQ A;  3VCD A;  4PCQ A;  3FDS A;  4K59 A;  1ZBT A;  2CJY B;  2W4C A;  3CD7 A;  4WCE Q;  1NRK A;  3IM8 A;  2KDO A;  2ZOF A;  2BE2 B;  4NML A;  2XY6 A;  1X31 C;  2CUY A;  1NDK A;  4NL5 A;  2DHS A;  2G0I A;  1DLO B;  2DNM A;  2PO4 A;  4DX7 A;  2D9P A;  3C8Y A;  3K89 A;  2AT1 B;  1VRT B;  4IKA A;  1VRQ C;  5CD4 A;  3DLG B;  2MKC A;  1S9E B;  1S49 A;  4YB1 P;  2RDD A;  2HHV A;  4L74 A;  3FSI A;  4E0D A;  3GYN A;  3PW0 A;  3JSY A;  2YNH B;  4JI1 F;  4OJ3 A;  3NGU A;  1K8A T;  3OFH A;  1EAY C;  3V6D A;  2DIS A;  3BPD A;  1UW9 A;  5EHH A;  2IMW P;  4GO5 X;  1RAA B;  4ECV A;  2F4V J;  3TX8 A;  2IM0 A;  3TAM B;  3BSA A;  4WIQ A;  4M5H A;  3K5O A;  1KVI A;  1DRZ A;  1TL7 B;  3KK1 B;  2X3G A;  3BO4 A;  1IM4 A;  1Q7L B;  1HNX F;  5LSL A;  3D1O A;  2M7S A;  3NGR A;  3DXS X;  3RBD A;  3MFH A;  4FNI A;  5HJX A;  1S4E A;  1XBW A;  2AWZ A;  2E1R A;  4Z2X A;  1VHI A;  3T19 A;  4KR0 B;  2FHJ D;  1YGY A;  2GML A;  1HAR A;  2E1P A;  2BAC A;  1U1N A;  4EMD A;  3W1Y C;  1BD6 A;  3CT9 A;  1UFL A;  2J9E A;  4DR3 F;  3SZ2 A;  1S5Z A;  2QZ8 A;  2XNQ A;  1RWN B;  4EFA C;  4NZ0 A;  2G13 A;  2XS5 A;  2KXN B;  4F25 A;  3DLH A;  3OL9 A;  4TY9 A;  1IQZ A;  2B3T B;  5D4L A;  2ZEJ A;  1KS2 A;  1EQ0 A;  2B4U A;  4J9R A;  2JEI A;  4RW6 A;  1TL1 B;  1KR4 A;  2Q6C A;  1NAQ A;  5HBM B;  4GRS A;  8RUC A;  1IM6 A;  2AV5 A;  1N52 B;  2BQ3 A;  1HQU A;  3M32 B;  3Q8Q B;  1RTH A;  4NLU A;  4WWS A;  4P7T A;  5C7P A;  2DPJ A;  2OEK A;  3DDI A;  4KH1 B;  3TW0 A;  1YJ7 A;  5E3C A;  2PGC A;  3PW5 A;  5BYQ A;  1TKZ B;  1HWK A;  1KKH A;  5IT4 A;  2BBE A;  1HD0 A;  1HWJ A;  1TKX A;  1E6Y A;  4WK1 A;  2Z58 B;  1VQY A;  3EIC A;  2B8P A;  4ED6 A;  2CQ4 A;  3EUN A;  3GR0 A;  4G1P A;  1X4F A;  3QRR A;  2EG2 A;  1BY9 A;  4ER8 A;  1OIA A;  1JNZ B;  3RYL A;  4AE5 A;  2ZHO A;  2WBR A;  4C97 A;  2GIR A;  4X62 J;  2M8D B;  2HYI B;  2YPZ A;  1UMJ A;  2COL A;  3JQK A;  4ECY A;  3QLH B;  2NS1 B;  3EGV A;  4A8Y A;  3GLJ A;  2B4V A;  2OI2 A;  4A8K A;  2LYV A;  2HAI A;  2XY5 A;  3KLI B;  2C2O B;  5D3G B;  3DRP A;  4LBP A;  4DOZ A;  1X4H A;  3KXD A;  4QWB A;  5HJY A;  2ZM6 F;  3A8E A;  1J5O B;  3UCZ P;  1HBU B;  1OMS A;  2HIY A;  4N7T A;  3V6H A;  4DFJ A;  2KYX A;  4FVC A;  1D9D A;  1VCT A;  1VBZ A;  3VR1 A;  1M5K C;  4ES1 A;  3PO5 A;  1FES A;  1IKW B;  4HTJ A;  1T9W A;  2ZWO A;  2HBY B;  1GT8 A;  2VQF J;  2J76 E;  3KMQ A;  3N9U C;  3TJA A;  3IG1 B;  3CJQ A;  4YHH F;  1QSS A;  2RE1 A;  4UZC A;  2P5V A;  3FVY A;  2BMB A;  4H4K A;  1K9M T;  2FJW A;  4R5P B;  3W5Z A;  3H59 A;  3VGS A;  3D2W A;  3G8T A;  3BGF A;  3BKU A;  2JVO A;  2XMK A;  4C3M A;  2FZK B;  3JTO A;  1U1K A;  4B9N A;  1GXT A;  3NCP A;  1R89 A;  2HW3 A;  2OTJ S;  1GXL A;  2ZH9 A;  4RUH A;  2XEX A;  1N32 J;  2E5I A;  1F2H A;  4Q7A A;  3D67 A;  5KFU A;  1JWW A;  3KWM A;  1C4C A;  5A6P A;  3DYA B;  1URN A;  4EWT A;  2VPX B;  1TK5 A;  1JLG A;  4OI2 A;  1IBK F;  4MJK A;  1SUQ B;  3D0H E;  1KOH A;  2RSQ A;  2VU5 A;  3MEG A;  3CVK A;  1RWX B;  3GMG A;  4IO9 Q;  5LMU F;  3L09 A;  5KFZ A;  4Y34 A;  3KLF A;  2QYC A;  2EW9 A;  2ACY A;  4A8F A;  4LVN P;  1VLY A;  1JJC B;  4ZJQ A;  3MAA A;  2XLK A;  3CCQ S;  3OTO J;  3I87 A;  1XR5 A;  1D3W A;  5K9F A;  5AE3 A;  4O3P A;  3BBF A;  1Q0N A;  2W7O A;  2XZW A;  3KJV B;  2C42 A;  1L3K A;  2OEL A;  3Q0A A;  1WEL A;  2M2B A;  3PYF A;  4HYK A;  4AND A;  3MUR P;  4C98 A;  3CJ3 A;  1M1K T;  1XMQ F;  1VQL S;  4KHM A;  5DQH A;  3L9Z A;  2CZV C;  3CIZ A;  4DX5 A;  4DPU A;  2MEW A;  1N5S A;  2BOP A;  2GO9 A;  1EZZ B;  4YUD A;  2CJK A;  2AGO A;  2HHP A;  5BXI A;  1U1O A;  3EM1 A;  3SSR A;  3NBP B;  3BQ1 A;  1EIY B;  2GVD A;  3QID A;  2R7O A;  2V4J B;  1V6H A;  3M30 B;  3V81 A;  4CM0 A;  4D3G A;  1IJE B;  2VC1 A;  3G8Q A;  3QIP A;  2AZ1 A;  1AZS B;  3PEH A;  1ITP A;  1F9F A;  2GIQ A;  2GAG C;  3CDA A;  2HK3 A;  4RW9 A;  3HFK A;  4GVB A;  4F7V A;  1PJ7 A;  4QWE A;  4URG A;  1BMQ B;  4B3S F;  3PRV A;  2Y1R I;  5K14 A;  1S6Q A;  4UW2 A;  3AHP A;  4RW7 B;  2MXY A;  4LSL A;  2HVD A;  4J9V A;  4AQY F;  1YWX A;  2J5A A;  4V1A k;  4U6P A;  2EG1 A;  3ZTQ A;  2R7S A;  1LXJ A;  2YKM A;  4I7F B;  1YBA A;  3PIP Q;  2AYM A;  4C6A A;  3AJD A;  2MZQ A;  2JL9 A;  2EVZ A;  2VQE F;  2XY7 A;  5GAG I;  2P9C A;  1HBM B;  1FKO A;  3ZNJ 1;  1LKZ A;  3HK2 A;  3AXK A;  2A10 A;  1Z2L A;  2AJF E;  2NXE A;  5KFS A;  3H40 A;  2ZZT A;  2DH7 A;  2CRL A;  1WHV A;  3MMB B;  1YVF A;  3PM9 A;  2KXH A;  2CIM A;  1U0S A;  2XBP A;  3FZ2 A;  2EFG A;  1FTC A;  4ZP7 A;  1JKH A;  4B3R F;  2RQM A;  4AL5 A;  4DDF A;  3CE8 A;  5DO2 A;  3RW6 A;  2XMW A;  4YY3 J;  1IXK A;  3JSB A;  4JV1 A;  5B08 A;  3DOL A;  2QLW A;  1TV6 B;  1TL5 A;  4KHR A;  1P9Y A;  1U45 A;  3IFE A;  5ETT A;  4OJG A;  2O67 A;  2QV6 A;  4MFB B;  4IQM A;  1HBN A;  1X9W A;  2LXI A;  1L5U A;  4O3N A;  3FEX B;  3AB2 B;  2IA6 A;  4ZHR B;  5IQQ A;  2MKI A;  1U0H B;  3CCT A;  2WZ1 A;  2CXE A;  5L9X A;  2E1M C;  5BYR A;  4FXD A;  2CAD A;  4ILM A;  3N79 A;  5E3A A;  2FYX A;  4EU0 A;  1HR0 J;  1GMW A;  4WXW A;  5ETO A;  4KV8 B;  1NLK L;  3OR1 B;  2XG8 A;  5IQ6 A;  5D8H B;  1YBU A;  3TEG A;  3VHQ A;  2D69 A;  3NCR A;  2NPI A;  3DGP B;  1Q7Y T;  4JI4 F;  2XS2 A;  5DS7 A;  1NHU A;  2IHR 1;  3A8J A;  4QCL A;  2GQ2 A;  3JYT B;  4EEY A;  4FVM A;  5D0G A;  1M1H A;  4I1T A;  3KJQ B;  3BH7 B;  4MKY A;  1ZOT A;  3LP2 B;  2CPD A;  2KG0 A;  1F2G A;  3HT0 A;  3EPI A;  3GIK A;  2Q6B A;  1CS4 A;  1EJ7 L;  3AJ2 A;  4CO2 A;  2KO1 A;  3EXY A;  3OTB A;  3OXG A;  4FF4 A;  1SKR A;  2GVZ B;  2W2O P;  2QYG A;  1HQ2 A;  2XGQ A;  3HSZ A;  4MIB A;  2UUC F;  1VRU B;  2L08 A;  3HP6 A;  1HMV A;  3RBX A;  2QFI A;  4GKK J;  4DX6 A;  1YJR A;  4CQ1 A;  4U96 A;  2AGP A;  4L72 B;  4OI6 A;  3VWS A;  3AH6 A;  1VJW A;  3CO9 A;  3T5K A;  1GH8 A;  1VQ8 S;  4WKR A;  2RS8 A;  4YR2 A;  2VA2 A;  3KK3 B;  2CQ0 A;  2MQN A;  1ZZN A;  1C1C A;  4CYU A;  1VQO S;  3H5X A;  2V5H G;  1GMW D;  2Y0S D;  2ALY B;  4ED7 A;  1RWV B;  4DN9 A;  2KVQ E;  4PQU B;  3PYE A;  2MLY A;  1RHK B;  2LFV A;  4XTT A;  3FFI A;  2CPE A;  4CH7 A;  2CA9 A;  2OAU A;  3QJP A;  2RT3 A;  2N7C A;  1DTQ A;  4USI A;  2DYA A;  2J7U A;  1JJ2 R;  3IO1 A;  2GNK A;  2ZJQ Q;  3SIP B;  4IR1 A;  3DRX A;  1ZZF A;  2RDJ A;  1QDU B;  3TRG A;  2RRN A;  3IR6 B;  4IOA Q;  4JYA J;  5AE1 A;  5J1E A;  2V2Q A;  3CW2 C;  3OL6 A;  2PMH A;  1H73 A;  3FKB A;  4FPI A;  4LF8 J;  1MSW D;  1EET A;  2FD2 A;  1UFW A;  2RRB A;  2BJ3 A;  4EZ9 A;  4I6W A;  1MRO B;  4ICL A;  1UWB A;  3RJM B;  3NAI A;  4GKJ J;  3OPK A;  5J2Q A;  3L7U A;  1GQE A;  4NA1 A;  2LQB A;  1B64 A;  3D4J A;  2IPO B;  3A13 A;  1D9A A;  3VAJ A;  4LF6 F;  1FK9 B;  1Y5I B;  1RA6 A;  3LP0 A;  1WHX A;  5H9F J;  4EYH B;  5C25 A;  3I82 A;  4KGM A;  1P1T A;  4IRC A;  5GAD I;  2HNZ A;  4TQS A;  3ENW A;  4JI0 J;  3A8I A;  1U47 A;  2ZBQ A;  1ICE B;  4P71 A;  2J9D E;  2W9C B;  5IWA J;  4C8Z A;  5CYQ B;  1YG0 A;  2ZE2 B;  3UD3 P;  4ETZ A;  2OD4 A;  4IRD A;  2DHH A;  1FHT A;  4BBY A;  3HSG A;  4JP8 A;  3B4D A;  4Q45 A;  4W4M A;  2HG4 A;  3LWM A;  2MDA A;  3H4B A;  1RAF B;  2HFV A;  3CF5 Q;  3CD6 S;  1C0T A;  2IJR A;  3CWJ A;  4KKO B;  3HKZ D;  4FP9 A;  4DL0 C;  2J0Q D;  4FF3 A;  3MEK A;  1VQM S;  1KOO A;  2ZZN A;  2HNY B;  2OPR B;  1K1S A;  3MUT P;  1KBR A;  1NPR A;  1GEH A;  3DLE A;  3MTK A;  1RAI B;  5HQL A;  2RKI A;  3ZZO A;  3A3N B;  1OO0 B;  2UUB F;  3SCL E;  1S6U A;  1SXL A;  5B0E A;  4HHH A;  1RT2 A;  1NZ8 A;  4DUZ J;  1TP7 A;  1DQ8 A;  4OX9 J;  2C3M A;  5LM7 E;  4RNN A;  4ERD A;  3AD7 C;  3QSI A;  5I3U A;  4I2P A;  5F9L A;  4M5G A;  4JB8 B;  1S1V A;  1X8D A;  4M5D A;  2CVE A;  3NGT A;  5D78 A;  1RWU A;  2L41 A;  1ZA1 B;  2KVI A;  4DS5 A;  4LT6 A;  3H2U B;  3PCO B;  3UR0 A;  1JIH A;  4NZ7 A;  2JEJ A;  3CTR A;  4WF9 Q;  1ZAW A;  3GWC A;  3RGI A;  4JV5 F;  1RTJ B;  1K73 T;  4KHP J;  8ATC B;  2XCP A;  4QBU A;  4DXL A;  3NL0 A;  2F9J A;  2DRD A;  5T14 A;  1PIL A;  2ZDP A;  1HYS B;  2IYI A;  3DKD A;  5KAK A;  3DU6 A;  1L3V A;  2QRR A;  2R8G A;  1AUS L;  2R2S A;  1X4D A;  4ED5 A;  3J7Z T;  1LWF A;  3K5P A;  3RU0 A;  1R43 A;  3MCO A;  2F5G A;  1OY6 A;  4LFB F;  1QAX A;  2OO4 A;  2V9K A;  3R6L B;  3PYG A;  2AJQ A;  1LWE B;  3GTY X;  4TLR A;  4NLT A;  5L8R C;  3EVM A;  3TZW A;  4DR1 F;  3MCS A;  4DCJ B;  2Q43 A;  2W9A A;  1FRJ A;  2HRU A;  4HAC A;  4J9K A;  1RAD B;  2EBG A;  2MYF A;  5DDO C;  3N5B A;  4WK3 A;  2H5J B;  1QUV A;  5T7L A;  4NXN F;  4QIE A;  1WC1 A;  1U48 A;  3TNV A;  3JB9 k;  4K4T A;  1VK8 A;  2AJ1 A;  2IVM A;  2QO3 A;  2DNR A;  1XMO J;  3L3C A;  1CUL B;  4PG5 A;  5THW A;  1JLE B;  2AKW B;  3DN9 A;  3FQK A;  3SCJ E;  3H25 A;  3T6J A;  4OI3 A;  3DFE A;  2NZC A;  1X5S A;  2OSR A;  3WC0 A;  1SKW A;  3CCV S;  2DIU A;  2DPI A;  2D9O A;  2GJ2 A;  4TY8 A;  2VOO A;  4DFK A;  5KFP A;  4O23 A;  3C46 A;  1S7I A;  3MGJ A;  5GVQ A;  1UPM B;  3JXO A;  2W8L A;  3RB0 A;  1S0N A;  3QT8 A;  3CD5 A;  3GP9 A;  2EBE A;  1TKD A;  1XNR F;  3V6K A;  1RU1 A;  1YIT S;  1FWL A;  4K4X A;  3W60 A;  1H74 A;  1PJ6 A;  4CTA A;  1UFK A;  2A2D A;  2N4C A;  5ITH A;  2HWT A;  4ZIW A;  4JI6 J;  1HBO B;  4HHU A;  4TYA A;  2RS2 A;  1ULR A;  1X4C A;  2EKN A;  3QT5 A;  4JI7 J;  4CM2 A;  4C8Y A;  3C19 A;  1NSQ A;  3DI6 A;  4ZPV R;  2R7Q A;  3QSY B;  2VPZ B;  2D3Z A;  3N6M A;  1VHF A;  2LEP A;  1T05 A;  2OUG A;  3CUN A;  1Q8I A;  3P3D A;  1HNZ J;  3CD0 A;  4I56 A;  3Q24 A;  3MCN A;  1VBX A;  4G1I A;  4F3M A;  2JC0 A;  4WE1 A;  4RUB A;  1U49 A;  1F1B B;  4U67 Q;  2EFQ A;  5IOL A;  4FYW B;  4Y6I A;  3NS7 B;  2DK2 A;  4DSL A;  1JLF B;  5B0C A;  1WI8 A;  4FS1 A;  5IXU A;  2JJ4 D;  3KUG A;  2H65 B;  2V69 A;  2W4D A;  3AOC A;  1S1W A;  3R5G A;  2OPP A;  2VL1 A;  5A2Q U;  3QO9 A;  1Y00 A;  3S7R A;  2XHC A;  3J7Y U;  1WWH A;  3QAT A;  4YFU A;  1XIQ A;  2RU9 A;  2QX0 A;  4QIF A;  5KFL A;  1LW2 A;  4WTO B;  4WFZ A;  4Q8F A;  2JC1 A;  2JH3 A;  2YKA A;  3SSS A;  3MM6 A;  3MPU B;  1RT5 A;  1RHQ B;  4KJI A;  2J0W A;  1UVI A;  3ZZZ A;  4HTI A;  1TL3 B;  2EC0 A;  3B6B A;  2MST A;  1CC8 A;  3K58 A;  2UVW A;  3NAH A;  2HZV A;  1PYO B;  1JLQ B;  1KQS R;  3BSC A;  1Y7P A;  3AD8 C;  1RKI A;  3FNN A;  3IRX B;  1RLD A;  3F0N A;  4DCO B;  4FN5 A;  1HA1 A;  3M9M B;  4RKU C;  3DRS A;  1NJY A;  2YXL A;  4KY3 A;  2DY9 A;  2VJU A;  2AJ0 A;  3MM8 A;  4XO0 A;  2FHK A;  5M2P A;  5U47 A;  1RTH B;  1T9X A;  1JLA A;  2B51 A;  4ILR A;  3PG9 A;  1E6V A;  2CPY A;  4RW8 A;  4WP3 A;  1Z4U A;  3FCH A;  5G0R A;  5K8O A;  1LFP A;  3UD4 P;  2B5J B;  4N8O A;  4U95 A;  3C6T B;  3N4W A;  1HNI B;  3I0R B;  3OVA A;  1UJ5 A;  2ZBI A;  2V8P A;  4M5I A;  1FVQ A;  3THP A;  2F4V F;  3HM9 A;  1XQI A;  2C2K B;  2BE2 A;  1VQ5 S;  3UCG A;  3UDC A;  2E7W A;  1CJK B;  1SQF A;  2B0G A;  3W5X A;  4FXV A;  1DLO A;  4RWX A;  1IBL J;  4NRU A;  1NPK A;  1A7G E;  1VRT A;  1VBK A;  2BRL A;  2R2R A;  1D9F A;  3DLG A;  2F7V A;  4ECU A;  5L38 A;  5A0Y B;  1JQG A;  4ZMM A;  5HMY A;  1S9E A;  5F8G A;  5ETR A;  2NXJ A;  4AXJ A;  2QL9 B;  2GHV C;  4NRT A;  2AYE A;  2HND B;  5T41 A;  2YNH A;  2PII A;  4WZM A;  3E3X A;  2R8H A;  3IM9 A;  3S6E A;  3M8Y A;  3VGU A;  3RR7 A;  2QTW A;  1G4C A;  2AZ3 A;  3H90 A;  1S6P B;  1N36 J;  1TAU A;  2FJB B;  3J81 Y;  5K8N A;  5E3R A;  2CVI A;  2IBO A;  3HXM A;  1S57 A;  3KKF A;  5GAH I;  3Q2T C;  3K8W A;  1X5O A;  1TL7 A;  3KK1 A;  1F3V A;  5DQI A;  1RTD B;  2UP1 A;  3ENV A;  3ZZY A;  3EDQ B;  3K8V A;  4ZCL A;  1FVS A;  4CDI A;  3LAN A;  1H38 A;  2HVI A;  3VAH A;  3KLE B;  3PKY A;  4QR0 A;  3X1L B;  1NDP A;  1QE1 B;  4IUF A;  3FSY A;  3KFW X;  4O4G A;  5E3Q A;  1MMN A;  4YB5 A;  1Q86 T;  3OXL A;  5DG8 A;  4X62 F;  1TL1 A;  2WHO A;  2HK2 A;  3C15 B;  1WG5 A;  4N76 A;  1KQK A;  2P8I A;  5HBM A;  4K4S A;  2OML A;  2UXB J;  2LU1 A;  4LF9 F;  5AT1 B;  2VPY B;  4GC7 A;  5B09 A;  3Q22 A;  2K8G A;  2R3V A;  4A46 A;  4C8L A;  1MN7 A;  3AB4 B;  4EBD A;  2DRB A;  1SKS A;  2DKO B;  3VVT A;  4NLP A;  2UV8 G;  1QSL A;  3M1V B;  1DTT B;  1DZ5 A;  1UWA A;  3M2U B;  3E51 A;  4LFA F;  1FE0 A;  3FK4 A;  2Y0B B;  3IAM 9;  4LIW A;  3GV5 B;  1UJ6 A;  4F36 A;  4GC6 A;  1U2C A;  4J5O A;  3UR3 C;  2ZWP A;  1TKZ A;  2VG7 B;  3MM5 B;  2DNK A;  5HLF B;  3R2D J;  5HP1 B;  3OT9 A;  2DIV A;  3F56 A;  4IDK B;  2IM3 A;  4J9Q A;  4X4P A;  1NND A;  2VQF F;  1ELO A;  2HFN A;  4R0E A;  2OEM A;  2H3E B;  4ZS6 A;  1HL6 A;  3IC1 A;  5CCL A;  4DLE A;  2C3Y A;  1YX2 A;  3QLH A;  2DNP A;  1OJ4 A;  2XZD B;  4IG0 B;  1QTN B;  5DLF A;  3M2V A;  3UNY A;  1HI0 P;  3D5M A;  2ABY A;  3TUJ C;  2EFV A;  2VD3 A;  4A8M P;  3CJ4 A;  1IJF B;  4KC5 A;  2B43 A;  2HLT A;  2GVD B;  3KLI A;  5D3G A;  5HAT A;  3EX7 B;  4QW9 A;  1N88 A;  4HI2 A;  1TUW A;  1J5O A;  3KLG B;  1HBU A;  2HHH J;  2UU9 F;  4F8R A;  4ES3 A;  3DC2 A;  4LBI A;  4LRB A;  2HPU A;  3QNW B;  1WKJ A;  4PPD A;  1FRH A;  4NI2 A;  2B56 A;  5C42 B;  1N32 F;  2CPF A;  2W7P A;  5H9F K;  3DMJ B;  2ZBR A;  3GJT B;  3PFE A;  2UVV A;  2J8S A;  2K7K A;  2UXC J;  4PG7 A;  2BE9 B;  2P9E A;  3GG0 A;  4MYT A;  4CH0 S;  3IG1 A;  2DCL A;  2ZD1 B;  3PR4 A;  1RAH B;  3HJF A;  2MSS A;  5KFX A;  4KGV B;  4R5P A;  2I38 A;  1V3R A;  1Q5V A;  3KNA A;  5G4D A;  2XO7 A;  1WSV A;  5CYJ A;  3MXH P;  2Y1L B;  4QYZ J;  3NOG A;  2UUT A;  3W8G A;  4DLG A;  4XPE A;  1WC5 A;  5E33 A;  1YJV A;  1B4S A;  3EE3 A;  2R8I A;  5IFM A;  4K4Z A;  1Q8K A;  3SFU A;  1RIS A;  3SXL A;  1VLO A;  3OR2 B;  4URQ U;  3W7B A;  2VBZ A;  2E5L J;  2E66 A;  1UET A;  1NXI A;  2YQ1 A;  3H5U A;  4N77 A;  1JKH B;  2FC8 A;  3DYA A;  4DEZ A;  2CWX A;  3Q86 A;  5B0F A;  1P6T A;  3EPG A;  4USJ C;  5KFI A;  4ZK7 M;  3O5T B;  2OLW A;  5HMX A;  5D0H A;  2LA4 A;  2ZBP A;  4O4R A;  3A3P B;  5F8I A;  5J1N A;  4ZCK A;  1M5S A;  5CAB A;  2QG9 B;  2QC3 A;  2MHE A;  3QGH A;  5DM7 Q;  1DQA A;  4DUY J;  2G0C A;  2PD1 A;  1ROF A;  3N0V A;  1YJW S;  1S0V A;  4ZJO A;  1NBE B;  2JSX A;  3KJV A;  4CO4 A;  2UV8 A;  2JFK A;  3W2V B;  2BE7 D;  4F4W A;  5CD4 H;  3BKF A;  3PW7 A;  2CDQ A;  2M8H A;  3RAQ A;  2RU3 A;  4RU2 A;  3BO2 A;  1DJ0 A;  2MKS A;  4UUW A;  1AA1 B;  2JDJ A;  4UUX A;  3OJS A;  4NYO A;  4Y3C A;  1LOU A;  2HSE B;  3NS6 A;  3M8R A;  3HX9 A;  3IBW A;  2RUS A;  3NBP A;  1SQG A;  1RB0 A;  1S6O A;  3M30 A;  1VDH A;  1MNE A;  3PW4 A;  2OPQ A;  3TVZ A;  5KT7 A;  1NHK L;  9ATC B;  5HMW A;  1AZS A;  2YKQ A;  1QJH A;  2VOP A;  3CNQ P;  3CJS A;  4C8O A;  4NLR A;  1KSP A;  4F04 B;  3JTN A;  4HDG A;  5JXS A;  2ASD A;  1RT1 B;  3OVB A;  1LW0 B;  3LO3 A;  2HIQ A;  3TWZ A;  4MYU A;  4RW7 A;  3KHG A;  4JI2 J;  4LRE A;  2CQC A;  4FS2 A;  3KLV A;  3C16 B;  4YY3 F;  1VOM A;  1V5I B;  4ZVT B;  2LEB A;  3TX0 A;  3BYR A;  2Y1I A;  1ACM B;  2FGC A;  2NR0 A;  4I7F A;  1KHV A;  2VF3 A;  4HH1 A;  2BRK A;  3SCK E;  3B82 A;  3I5C A;  2HRT A;  1HBM A;  2JVR A;  4RX6 A;  4EO6 A;  3VAG A;  3HI9 A;  3DU5 A;  4CYU B;  5KT4 A;  4BWJ A;  3D54 A;  1FDB A;  4PEO A;  1SV5 B;  5HN0 A;  2HFZ A;  3A12 A;  3CJR A;  4UOF A;  3JSR A;  4F4Y A;  3MMB A;  3BGL A;  3CJ5 A;  3JQJ A;  1HR0 F;  5LT5 A;  4DFM A;  2WVB A;  4PUO B;  4LF7 J;  4AUK A;  5KG2 A;  4PAA A;  2DNG A;  3W2W B;  2NSB A;  3A1Y G;  3UO0 A;  1KLN A;  2YY3 A;  3HKW A;  3UD5 A;  1Q5Y A;  4BC7 A;  3K5N A;  1WOP A;  2QMU B;  5DRK A;  3OFF A;  2H1Y A;  2I0X A;  1TV6 A;  3MD3 A;  1PKU A;  4MFB A;  2F4F A;  4X64 J;  2GZO A;  2YKN B;  2ZH5 A;  3UDE A;  3ETO A;  3WX8 A;  1A6L A;  1M5O C;  1DAR A;  4ZHR A;  3J81 U;  1U0H A;  1P1L A;  5DDQ C;  4QZV B;  1R0A B;  3MPY A;  3DLK B;  1BQN B;  2LQJ A;  5CA5 A;  3BBB A;  4R8U B;  5L46 A;  4DPX A;  3ZXW A;  1S48 A;  3BEG B;  4P7V A;  2BXJ A;  3ISZ A;  1FJC A;  2DR7 A;  4KV8 A;  4FZV A;  2HHW A;  3OR1 A;  1VJQ A;  1I3O B;  2AMC B;  4NA2 A;  3WDO A;  1HW9 A;  1U1L A;  2VFT A;  1ZTT A;  3DGP A;  1SCJ B;  4NYZ A;  5KFJ A;  3ISN C;  4KB7 A;  3RB4 A;  3G8S A;  4AYB D;  3JYT A;  4O44 B;  4LSN B;  4DWI A;  2IAJ B;  1Y9O A;  2CQP A;  1U1Q A;  3LP2 A;  1X60 A;  5HSP A;  2IYG A;  2E9T A;  3LQV A;  4TU7 A;  1FFG B;  2XSF A;  5KOX A;  4QYR A;  5B7W A;  1S9F A;  3PHT A;  1M1G A;  2HS4 A;  2GVZ A;  3PY8 A;  1BGX T;  4PWU A;  4CO1 A;  3KHH A;  1VRU A;  1N33 J;  1PIE A;  2DGW A;  1S0M A;  4JYA F;  4G65 A;  1N5Q A;  1DFD A;  3UDL A;  1WC4 A;  2XMU A;  4MAK A;  4LF8 F;  2Y8W A;  1GK8 A;  4WXO A;  1VQP S;  3C14 B;  3W63 A;  2BZ2 A;  3WBZ A;  2MJU A;  5LXR A;  1YTY A;  4LR7 A;  1HNW F;  4RUC A;  2QMW A;  3KK3 A;  2Z4P A;  3IGV A;  1RT2 B;  2C2E A;  1SJF A;  1NDC A;  4LRA A;  3CIM A;  2NYH A;  3BSO A;  4ZVH A;  4PQU A;  3OTD A;  1W25 A;  2DT9 A;  2KYZ A;  4JI5 J;  1TFW A;  3H2L A;  1EKR A;  3VQT A;  1S1T B;  1D0E A;  4FKX A;  5J2M B;  4RBT A;  4G3I A;  1SC6 A;  4CO5 A;  2JRS A;  3NG8 A;  4F50 A;  2PI5 A;  2V8V A;  1Q95 G;  3AT1 B;  4P6Q A;  1UAW A;  4CO0 A;  2GHP A;  1RP5 A;  3EGZ A;  1RAB B;  3IWX A;  3FZB A;  1XC9 A;  1T8E A;  5IWA F;  1Q81 T;  2QA4 G;  1T3N A;  4UY8 5;  3MED B;  4DV7 F;  1N54 B;  4F26 A;  3TA0 A;  2F1F A;  3TP2 A;  1NSA A;  2KM8 B;  2DNH A;  2XYH B;  3PO4 A;  1MRO A;  5M2U A;  4M1K A;  3AOB A;  4ZPC A;  1S9G B;  1VQ9 S;  2FJV A;  1TZ0 A;  4PG8 A;  4FDF A;  2ADC A;  2BVZ A;  2VKZ G;  4KSE B;  1FK9 A;  2O01 C;  2ATL A;  4OI0 A;  1CJV B;  4X4O A;  3HO1 A;  4H4M B;  1IR2 A;  1BC6 A;  4NLW A;  1T03 B;  4DFP A;  4LR9 A;  5HMZ A;  5KFA A;  3U1L A;  1I1G A;  3D0G E;  2W9C A;  4X66 F;  2FIU A;  3MMJ A;  5CYQ A;  2ZE2 A;  1J5E J;  3P5B P;  3ENQ A;  3K59 A;  1T7P A;  3MR5 A;  5CH7 B;  4DUZ F;  4CNY A;  4OX9 F;  4FYX B;  3UPF A;  5DM6 Q;  4M94 A;  1NK6 A;  1CG2 A;  2ZOG A;  4Y00 A;  2H48 B;  2NXU A;  5C5J A;  4IR9 A;  4DQR A;  1PG5 B;  3VAI A;  2V63 A;  2CG8 A;  4L6V 3;  2EK6 A;  4YDX A;  2QLJ B;  3PR5 B;  1HPZ B;  4KKO A;  2L3M A;  1Y11 A;  1Q82 T;  3UVJ B;  1UVN A;  2HNY A;  2DBB A;  2OPR A;  4KHP F;  4DL4 A;  2X3D A;  3Q8V A;  5KTQ A;  3M05 A;  5KG3 A;  2EXU A;  4C3L A;  3CCS S;  2BW2 A;  2V4Q A;  1RWM B;  3M8W A;  2L9N A;  2OJ3 A;  3QBC A;  3MAQ A;  1NB7 A;  3LA0 A;  2FLO A;  2ZIT A;  1Y3J A;  2Y9H A;  2MLX A;  3GB0 A;  2BV3 A;  2GS8 A;  6FDR A;  1RA7 A;  2RQK A;  4I4B A;  4TU9 A;  2BUN A;  4HVZ A;  4ZLP A;  2DEI A;  1XR6 A;  2RUG A;  3I55 S;  3MPD A;  4DR7 J;  1HNX J;  2C3P A;  2EKY A;  1IR0 A;  1NME B;  5KFE A;  4J91 A;  4P10 A;  5CCM A;  5JMN A;  1VQ4 S;  4Y2K A;  2D74 B;  3W62 A;  1RYS A;  6AT1 B;  2K1R B;  3CCM S;  1RTJ A;  5GMD A;  2AIR B;  3JQM A;  4YB6 A;  5K8P A;  2IM1 A;  2HGL A;  1HYS A;  2RRA A;  1U6B A;  5LJ3 Y;  3FGV A;  4O3S A;  5CYM B;  3NMA A;  3UFC X;  1XMO F;  2BAB A;  1T95 A;  3WIV A;  4NLQ A;  1H3D A;  3I5A A;  3HHL D;  1UZH A;  3OLB A;  5E3P A;  1ZH5 A;  4LUB A;  3GJR B;  5E41 A;  1XJW B;  4USK A;  5B0B A;  4Y2I A;  1S0O A;  5LL6 d;  3IGN A;  4UZB A;  1KON A;  1SI9 A;  2BQU A;  4OYW A;  3SDE B;  1WC3 A;  4USW A;  1T02 A;  1VC5 A;  4PWD B;  1R6Y A;  4OYM A;  4NXM J;  4PYA A;  3MUV P;  1Q79 A;  4CO3 A;  4HHJ A;  9RUB A;  4NEZ A;  4OYO A;  1S76 D;  5MLC V;  4C48 A;  1CUL A;  1Q16 B;  1JLE A;  1I5O B;  2OTL S;  5F0W A;  4JI7 F;  2F9D A;  1PC4 A;  1HHS A;  4AFF A;  1B7F A;  3G82 B;  2J9C A;  5KFV A;  3Q2S C;  1VIO A;  1HNZ F;  4PG6 A;  2HBZ B;  4X2B A;  3LWL A;  3BR9 A;  4OX8 A;  2HQD A;  2D3O R;  3CSK A;  5HAN A;  3BGR B;  1NK7 A;  4OZ1 A;  4U9R A;  3R3T A;  3GR1 A;  4DG1 B;  4ZP9 A;  4HKQ A;  1IR1 A;  2R8K A;  2XMM A;  4EO8 A;  3GG1 A;  3N6L A;  4K2X A;  3K57 A;  1FWK A;  2HHU A;  1HBO A;  2FHJ A;  1B0P A;  2I9S A;  4HL9 A;  1T11 A;  2LEC A;  5H9E J;  3IXQ A;  1UZD A;  3CCL S;  3OTC A;  2AGQ A;  2NXC A;  2HQI A;  1HHT P;  2FPH X;  2W24 A;  3HVW A;  4ZVG A;  4PQA A;  1XN9 A;  5F3Z A;  1GMV A;  4CWB A;  4V19 X;  4B9L A;  2OPS B;  4IFV B;  1OY8 A;  1WF2 A;  3D1Q A;  4WBF A;  1JLF A;  4ZVS B;  1OS5 A;  4ECZ A;  1IBC B;  2X1B A;  4A4J A;  4ZPA A;  2VIC A;  3K5M A;  3DDN A;  2MZJ A;  1IBK J;  4DV5 J;  3JSM B;  3CCJ S;  1WEY A;  1KEK A;  1RZM A;  1NJW A;  1MW7 A;  2W1B A;  1V9O A;  1B99 A;  4CLT A;  1PYT A;  3CC4 S;  1X4G A;  4BC9 A;  1XNQ J;  4CT9 A;  3PW2 A;  5CZX A;  1TL3 A;  2PA8 D;  1YDL A;  4KFB B;  4KO0 B;  4JV2 A;  4B9S A;  4M5N A;  3NS5 A;  4B08 A;  2WAQ D;  3NWR A;  2B6A B;  1O6X A;  1JLQ A;  1LK7 A;  2JFD A;  4C0O C;  4Z7Y A;  2JZ5 A;  4PAB A;  2J6S A;  2LCW A;  2FVR A;  3C3L A;  1YJT A;  1XMQ J;  2UXD J;  1PJ5 A;  3IRX A;  1R27 B;  5EGY A;  4LF4 J;  1TUV A;  2W7A A;  4QIV A;  2Z8Q A;  4O4G B;  4JI8 J;  5KT6 A;  3UDV A;  3OFE A;  1KNZ A;  3ZTP A;  5K20 B;  4KAI A;  4U8Y A;  5J2N B;  4DV3 J;  2AW0 A;  2YWW A;  1VQN S;  4KGZ B;  4RR5 A;  2NQP A;  1P9Q C;  3BGU A;  2RHQ B;  3TVK A;  3TAN A;  3PKM A;  1YSJ A;  5D77 A;  2O5D A;  4PYD A;  1RHR B;  1H2T Z;  2W8K A;  1IBL F;  3FUY A;  4ZIT A;  4K5R A;  2DGQ A;  2G1H A;  5L1J A;  1XK8 A;  4YOE A;  3D1H A;  1I94 J;  4RW4 B;  3LAK A;  2K3I A;  4C2M A;  1JB0 C;  2F65 A;  3SMZ A;  2HGN A;  3R7B B;  3M2R A;  3PHE A;  4DI6 A;  1YJN S;  2C2N A;  5GAG U;  2B5J A;  4DR2 J;  2NLW A;  2CQ1 A;  3C6T A;  1NK8 A;  4AQY J;  4H4K C;  1HNI A;  1JMT A;  3FC9 A;  3I0R A;  1N36 F;  2RQ4 A;  2LP4 A;  1PYS B;  4DU8 A;  4DL6 A;  2G1D A;  3OV7 A;  1N5V A;  4C9D A;  3TOQ A;  5I3Q A;  2VQE J;  4PZV A;  3NOC A;  1CJK A;  1SIZ A;  3B4M A;  1MWY A;  2BM0 A;  2HAF A;  4L3N A;  1LWX A;  3G6V A;  2QMX A;  3M2V B;  1TK0 A;  4L73 A;  1H6K X;  4NEY A;  5A0Y A;  2XZT B;  2NUH A;  1RT7 B;  2KHC A;  2HND A;  2UVU A;  3G6Y A;  1F60 B;  4XAK A;  5CAA A;  2FVC A;  5AXN A;  1S4F A;  4P72 A;  4A8O A;  4NI2 B;  4F4K A;  1CQM A;  5IC6 B;  1S6P A;  4Y2C A;  3TAP A;  2LXU A;  2C2R A;  2UXB F;  2ZH3 A;  3QPI A;  4D3H A;  1UVK A;  2CNN B;  2MLZ A;  2KU7 A;  4USM A;  3SQG B;  2J0X A;  2IDE A;  2RH3 A;  2Z2Z A;  3MR6 A;  2MQO A;  2PI4 A;  4MK9 A;  4ANE A;  4MTP A;  4UTG A;  1RTD A;  2ZZM A;  5HRO B;  3SSQ A;  3CJK B;  3N28 A;  3DHW C;  2VBW A;  4F2R A;  1XEZ A;  2V67 A;  3I31 A;  3KLE A;  1G2E A;  2YVS A;  2VJV A;  4WU2 A;  2IC3 B;  3BN7 A;  5A6W A;  4ZKA A;  2MKK A;  4K4W A;  1QE1 A;  3VAK A;  4NLS A;  3LGM A;  3GJS B;  4R0J A;  3R2C J;  5D15 A;  1EKS A;  1PAU B;  2IJF A;  1UP1 A;  3IRW P;  7AT1 B;  4PXC A;  3MM7 A;  2MKJ A;  3C15 A;  2N82 B;  2PEB A;  2AU0 A;  2CJB A;  3NNH A;  4ZVU B;  2C22 A;  3HVR A;  1JJ4 A;  2RHS B;  2HKE A;  2WCX A;  3M6V A;  3M1V A;  3R5B A;  1D09 B;  1DTT A;  5SUH A;  4CLZ A;  3M2U A;  2MB0 B;  4I0W A;  2ZNZ A;  2WK4 A;  2XI3 A;  3GSD A;  1QM9 A;  4P2F A;  3POT A;  4N56 A;  4B17 A;  2HHH F;  3FMW A;  3OSN A;  2XI2 A;  4NZ6 A;  2E5G A;  2VG7 A;  3MM5 A;  4OYI A;  5A8W B;  5HLF A;  3AJ1 A;  5HP1 A;  2BJE A;  2IVY A;  3GFX A;  2W9B B;  4IDK A;  5IV3 A;  4H4O B;  3BR8 A;  1OWX A;  2EI5 A;  1FD2 A;  1H7W A;  1N5Y B;  3KK2 B;  2UXC F;  1N0V C;  1S79 A;  2EPI A;  4IG0 A;  2Z0G A;  3DNC A;  4M5K A;  5KG1 A;  3OLA A;  3OFG A;  2A2C A;  3I9V 9;  4DSI A;  2CDR B;  1MU2 B;  2FLN A;  4OHV A;  3AXM A;  5JVH Q;  1TUG B;  3HFV A;  4P2X A;  2ZC3 A;  2X1G A;  1RAG B;  1ZM3 A;  2MZ1 A;  2DXE A;  1NB2 A;  2OPQ B;  5F8N A;  3KLG A;  1N8R T;  1JLC B;  3V4M A;  1VQ7 S;  2J7W A;  4NWB A;  2KRB A;  1XER A;  2NZ4 A;  2QA1 A;  3G9C A;  1FXD A;  5C42 A;  2E5L F;  1N6Q B;  4HH0 A;  3HUL A;  3DMJ A;  2EC2 A;  3LP1 B;  1Z1Z A;  1FEE A;  2IMO A;  2MZS A;  4OZL A;  2HQ3 A;  3MM9 B;  3GZ7 A;  2C3O A;  4DSE A;  1UVL A;  3MUM P;  5HQM A;  2ZD1 A;  3GV7 B;  2ATC B;  5GAD U;  3BM7 A;  1PGZ A;  1F5A A;  1R8A A;  2IDL A;  3PAC A;  1KVJ A;  2QLB B;  4LFC F;  3DGV A;  4EGL A;  3UI3 A;  3GCX P;  2VB6 A;  1CJU B;  2A1B A;  2YNF B;  4KPY A;  1YBT A;  3ZZT A;  3TYT A;  4DUY F;  5AE2 A;  3ZTO A;  3X3U A;  4EYI B;  2H9Z A;  2BKP A;  1D1U A;  2HWI A;  5JVG Q;  2FJD B;  1C0U B;  4P73 A;  3AD9 C;  1T9Y A;  3OR2 A;  4J90 A;  1RHJ B;  1GFW B;  1GTH A;  1S7H A;  4I69 A;  3DM2 B;  2BDP A;  3B78 A;  2HBR B;  3RBE A;  3KHR A;  2BJ8 A;  1VBY A;  4CLW A;  4KQZ A;  3BJY A;  4K0K J;  3E01 B;  4BCA A;  4P9S A;  5SZT A;  2R9L A;  2WSC C;  2RD5 C;  3VAF A;  4DR6 J;  2Q79 A;  1NK9 A;  2DXF A;  2M3D A;  2MQP A;  1WC6 A;  1T9V A;  2P6S A;  1SBR A;  1FO1 A;  1YJU A;  1WF1 A;  3R7S B;  1UA0 A;  1QVF R;  4C0H A;  5L1I A;  1IKY B;  1JJH A;  2YWH A;  2V8H A;  3N01 A;  3M7V A;  1SPB P;  1B7Y B;  3NGD A;  5EWG A;  3GIM A;  3M6U A;  3D6M B;  3TR5 A;  2XMA A;  3W2V A;  2V4R A;  4NLV A;  2MGZ B;  1LK5 A;  1NJZ A;  4JI2 F;  1BUX A;  1AUD A;  3E2E A;  4ID8 A;  1UW4 A;  1CEZ A;  2POK A;  3SEO A;  3EZU A;  1WG4 A;  2OGU A;  4JUZ A;  3MZI A;  1DAX A;  3CJ8 A;  1RTI B;  3F73 A;  1Y5N B;  5FD1 A;  4J9O A;  1QAJ A;  3CMA S;  3ONQ A;  2ROG A;  4NE9 C;  1GTE A;  3R8Y A;  1HW8 A;  3KUH A;  1JXV A;  5BR8 J;  1RTZ A;  4XDC A;  5ETM A;  4BWM A;  1K1Q A;  3PJX A;  4WZQ A;  2YBV A;  1NDL A;  1H2U X;  4PWW A;  2DGT A;  4RNM A;  2J9D A;  5B0G A;  3VV2 B;  4ITS A;  4RZR A;  1RT1 A;  1LW0 A;  4BHQ A;  4LF7 F;  2R7V A;  2Q1L A;  2FVQ A;  1URR A;  3UW1 A;  4MMO A;  1TK8 A;  2DJW A;  3C16 A;  3D7S B;  5KFC A;  1NSK L;  2KTQ A;  2VFS A;  2BKN A;  3H2V E;  4OQJ A;  3QJJ A;  4OJ1 A;  2CG4 A;  3DRR B;  2HQG A;  1FF2 A;  4X64 F;  2D1C A;  1F3F A;  2Z2M A;  3SI8 A;  1S59 A;  3BZQ A;  4I67 A;  2BA9 A;  3BF4 A;  1W2I A;  3LPY A;  4KIA A;  1QY7 A;  1SV5 A;  4TU8 A;  1HWU A;  5J1P A;  4PPZ A;  2G2Z A;  4ATN A;  1EP4 B;  2BJ9 A;  4EZ6 A;  4USH A;  3QZ8 A;  2DGV A;  3U02 A;  3TZY A;  2E5J A;  4PUO A;  3LTO A;  1P8G A;  2CNO B;  3W2W A;  2DO0 A;  5DGB A;  1TVR B;  2JX2 A;  2WSF C;  5K5M A;  2GFF A;  1L3T A;  1WHW A;  2L48 A;  1SKU B;  4JBC A;  3QFH A;  5FJ4 A;  4WP9 A;  4ZJL A;  1VQK S;  2HS0 A;  1IKV B;  1NU4 A;  3IR5 B;  3ILO A;  5F8J A;  3KG1 A;  3GV8 B;  3ILL A;  3G4S S;  1RT6 B;  4OFZ A;  1G6B A;  2YKN A;  2LQ8 A;  2OMO A;  4LSZ B;  3H98 A;  2V2K A;  5C24 B;  3RAX A;  1YK9 A;  1R0A A;  3BKT A;  4LRF A;  2DNO A;  4YME A;  3DLK A;  4LRC A;  1BQN A;  2H4W B;  2MY7 A;  4R8U A;  4O3O A;  3QJL A;  2YKP A;  2PFF B;  4FPR A;  2V50 A;  4LF5 J;  1VI7 A;  2LA6 A;  2KHD A;  5KG4 A;  3PNI A;  5EWF A;  3SFG A;  2XNR A;  2KFZ A;  1N33 F;  1XNR J;  3P49 B;  2IFX A;  5A8R B;  3PJW A;  3I32 A;  4ETX A;  2IA0 A;  3U7J A;  2ASL A;  2ILY A;  2YNI B;  3TAQ A;  4LF1 A;  1NZA A;  4BDP A;  3Q83 A;  4O44 A;  4LSN A;  3QAU A;  1B0V A;  4K5S A;  2IAJ A;  2HVZ A;  4OV6 A;  1SJR A;  4YB7 A;  4DPT A;  1WKK A;  4JI5 F;  1RBL A;  2QL7 B;  4OYB A;  3DRY A;  5FLX Y;  5KFM A;  4NCA A;  3IWN C;  3AA9 A;  3D9B A;  3TJ8 A;  1SJ1 A;  1WG1 A;  4W90 B;  3GIL A;  2QLF B;  2VFR A;  3JS9 A;  2XTJ P;  2CAJ A;  1B3T A;  4QWC A;  3HHL B;  1QAI A;  2Q66 A;  4QWD A;  2C2D A;  3VZH A;  1NKB A;  2ILZ A;  4ELU A;  5RUB A;  3D28 A;  3CXC R;  3MCM A;  4K8R A;  1YRT A;  4IG3 B;  3C14 A;  3IA0 A;  1R8C A;  4IFY B;  4FYV B;  1NK0 A;  3MDF A;  3GON A;  1R8B A;  3TUI C;  3VVU A;  4USV A;  3RZA A;  2OKQ A;  3US5 A;  2Y1J A;  1EQM A;  4F0H A;  2QE5 A;  2HMI B;  4J7C A;  3EZ5 A;  2CFX A;  3CGI A;  2ZOM A;  1S1T A;  4B9M A;  2IY5 B;  2KN4 A;  5LMN J;  5J2M A;  4AL6 A;  3D0I E;  3MAH A;  2NXN A;  2GHW A;  3TQE A;  1RE1 B;  2GMJ A;  4X4T A;  4DV2 J;  1M5P C;  3CDW A;  4Q5V A;  1RT3 B;  4FBU A;  1SC1 B;  5HVF A;  2BJD A;  2DHX A;  4YP3 A;  2QN6 B;  2CJQ A;  5LOQ A;  2G9O A;  3PRB A;  1TL4 A;  1K0V A;  3QGP A;  3KJN B;  2PC6 A;  3MED A;  1J5E F;  4C11 B;  3PXG a;  3CDB A;  2B4O A;  2XSJ B;  3T9Z A;  2IRU A;  2DR6 A;  3PFO A;  4RBU A;  5E2Q A;  2ALZ A;  3ITH A;  1S9G A;  5IT0 A;  3IP0 A;  2D3U A;  3CO0 P;  3U1N A;  3PZP A;  3O44 A;  2IVF B;  1AW0 A;  3WHI A;  3MEC B;  1DQ9 A;  1VMB A;  3FSX A;  1RBA A;  2WOM B;  1CJV A;  4ZOS A;  4H4M A;  5KG7 A;  2CJX B;  1FEH A;  4B3T J;  1T03 A;  3L7O A;  1X7V A;  4NCB A;  4L75 A;  2OHD A;  5KFH A;  2G4B A;  1U25 A;  3TZX A;  2AJ4 A;  1N0U A;  4YN3 B;  1W2B R;  1HWI A;  1FXL A;  1T94 A;  2HRY A;  2AJ2 A;  3RRK A;  3OTE A;  4ZPT R;  2FJE B;  4HEA 9;  2CNL B;  4DV6 J;  4XK8 C;  4DR7 F;  2R7T A;  2MMY A;  1HI8 A;  3NCQ A;  1REG X;  2HWH A;  1BQX A;  4CLS A;  1IN0 A;  2ADB A;  4NMX A;  3OBI A;  2ZJP Q;  4FYD A;  1HPZ A;  3G71 S;  4DV0 J;  1FRX A;  3H20 A;  4OLP A;  4U7U K;  1WC0 A;  1WDD A;  2VBY A;  4B9T A;  3UVJ A;  5GAH U;  3HHD A;  1WOO A;  4WFY A;  1KQG B;  1U1R A;  2CWK A;  4LMZ A;  2AX0 A;  4QQB A;  3GFZ A;  4MK8 A;  2ZHA A;  2ZVS A;  3IBC B;  1OPZ A;  1YI2 S;  4LRD A;  4QR2 A;  4UT4 A;  4X4Q A;  4OYZ A;  4AXI A;  4E98 A;  3CUL A;  3Q89 A;  3G6E S;  1NJX A;  2XQC A;  3VQS A;  2NRE A;  2YKO A;  4QR1 A;  3PRD A;  5J2P B;  1YQH A;  3C6U B;  4W98 A;  1QD1 A;  1K0T A;  5KT5 A;  3DLL Q;  2QGF B;  3F44 A;  1A0O B;  1FX4 A;  4QIG A;  1ZTW A;  4DQP A;  1OY9 A;  2M88 A;  3ZZP A;  2K1R A;  4FF2 A;  2P6T A;  3W8P A;  3ZZ0 A;  2QL5 B;  4GVL A;  4IH6 A;  5F9N A;  2GJI A;  2R7X A;  4NXM F;  1RCO B;  5GMK a;  3HSD A;  5MAO A;  1SC3 B;  4QW8 A;  3NMR A;  3DLB A;  1B70 B;  3EXC X;  2XLI A;  5CYM A;  2B9E A;  3ZZR A;  4UOH A;  2RF2 A;  3T1H J;  1RBO B;  2HVH A;  2C2M B;  2GCF A;  1HNV B;  1YRX A;  4X65 J;  5EDW A;  4LF9 J;  3HF5 A;  1FWP A;  4F3Q A;  3I6P A;  2XWX A;  5GAE I;  3P96 A;  4A8X A;  3TJ9 A;  3P4U B;  3OQ2 A;  1QTM A;  2GGP B;  3J7Z 5;  4LFA J;  4BS2 A;  3HDS A;  3AAW B;  3B54 A;  3L4B C;  3ZNU A;  1RAC B;  1R0C B;  3SDE A;  3QQC D;  2A0F B;  1U8W A;  3SYZ A;  4ECR A;  3I96 A;  4PWD A;  1TKT B;  2LXF A;  3MMA B;  2DXD A;  1X0F A;  2RVJ A;  2ROE A;  1ZA2 B;  4RL1 A;  1HHQ A;  1MWQ A;  1OSC A;  3UWT A;  4IOC Q;  1G1X A;  3V4I B;  1RDR A;  3CED A;  3A3O B;  3EGW B;  2DVI A;  3BQ2 A;  3G82 A;  1MG7 A;  2HHT A;  3E8O A;  4MIW A;  2MZR A;  2Z30 B;  1O5J A;  1BE4 A;  1RAE B;  4OZ5 A;  2JWN A;  1WF0 A;  2ZKT A;  3WZ0 A;  3MEE B;  2GQQ A;  4CLL A;  4WU3 A;  3D6T B;  4DU7 A;  1FX2 A;  1WEZ A;  2BEF A;  2UU9 J;  1BXN A;  1RYR A;  3QGG A;  4OZJ A;  4Q0B B;  4JV0 A;  2IM2 A;  5FII A;  4Q43 A;  3BGR A;  1PCA A;  3M2R B;  4ED8 A;  4DG1 A;  3OSP A;  3Q8S B;  2VG6 A;  5I42 B;  1WHY A;  2AEJ A;  5KT2 A;  2R7U A;  3M8Z A;  1MLA A;  4DV5 F;  4RUA A;  3PX6 A;  3LUY A;  3EMT A;  2N3O A;  2QIF A;  2K7J A;  2R7R A;  3LAM A;  2U2F A;  5D0E A;  4F0M A;  1TTH B;  5AJ3 J;  5DZ7 A;  3BH6 B;  1XNQ F;  2VIH A;  3W61 A;  1AYE A;  3BGO P;  3CB4 A;  1H2V Z;  1RU2 A;  1U2F A;  4N8N A;  3U27 A;  1VIS A;  5AXL A;  2AX1 A;  1FE4 A;  5IC4 B;  4YQW A;  2KFN A;  3J7A N;  3F41 A;  2BYC A;  3C66 A;  3UQS A;  2F8H A;  3H5S A;  2OPS A;  4HT7 A;  4IFV A;  1SL1 A;  2UXD F;  4LF4 F;  5FLX U;  3KJF B;  4JI8 F;  5JJB A;  2FTR A;  1S99 A;  3UN2 A;  4ZP8 A;  2DH8 A;  3JSM A;  4DV3 F;  5HAO A;  3SV3 A;  5DQG A;  5ETP A;  1FKP B;  2ZBC A;  3GSI A;  1FNO A;  4AL7 A;  2WVE A;  2RB7 A;  2M5Y A;  4HDH A;  5KFG A;  2I6W A;  1R7I A;  2ZH7 A;  2XYP B;  4DHV A;  3OW2 R;  2RIJ A;  4DSF A;  1REV B;  2JHE A;  4KFB A;  1I94 F;  4KO0 A;  5EN1 A;  1FDN A;  3H8Y A;  3O6Q A;  2B6A A;  2CNK B;  1NH7 A;  4DL3 A;  2MHN A;  3BDE A;  3KLH B;  4EBE A;  1FKA F;  2APO A;  1IWA A;  2VFU A;  4ZPW R;  4DR2 F;  1FCA A;  3KYL A;  4J37 A;  2CQG A;  4WTY A;  4LJM A;  5I4M A;  2OH2 A;  1S10 A;  1B0T A;  2VC0 A;  1IBM J;  2CQH A;  3IS9 B;  1RSC A;  1I6J A;  1CLF A;  4NCG B;  4DSJ A;  5J2N A;  4DSK A;  4JOU A;  3MM7 B;  4LF2 A;  1QVG R;  1R31 A;  2VPW B;  4I6A A;  3ZC4 A;  1N34 J;  2N3L A;  1QSY A;  4OYX A;  5DDP C;  4C8K A;  1SC4 B;  3HVT B;  2J6U A;  2M52 A;  2PMZ D;  2VOD A;  4PXE A;  4ZDN A;  2AEF A;  3CDU A;  4RW4 A;  1RWK B;  3BSN A;  2XCA A;  4DQS A;  3W5Y A;  2YX4 A;  2WB4 A;  3POT B;  2DNY A;  2WVC A;  3KG4 A;  2BKO A;  1S1U A;  4GO7 X;  3LH2 S;  4G1Q A;  1NEE A;  3ENA A;  3LF0 A;  3D68 A;  3K7R A;  4OZ3 A;  2CQ3 A;  1S77 D;  3VZI A;  3CDE A;  1TQL A;  1KQF B;  1Q1K A;  3V5R A;  4ELV A;  2M9K A;  3RAM A;  2W25 A;  4CRJ A;  3FBC A;  4DV4 J;  2GX8 A;  2YTC A;  2UUA J;  4NOH A;  3TO8 A;  2V6A A;  1RXO B;  4F67 A;  2DNQ A;  4DF4 A;  3S1T A;  4O0N A;  4ECT A;  2QJ3 A;  2ACM A;  1K44 A;  1KTQ A;  1RT7 A;  5CQG A;  5KFO A;  2FJX A;  3BBC A;  1YZ6 A;  1DY3 A;  2HFU A;  1WI6 A;  4KE5 A;  1BWE A;  2E7V A;  2HEK A;  2ZUA A;  2UZA A;  5A8K B;  2VV5 A;  3TZZ A;  3CJ2 A;  1EHW A;  5LXY A;  3FEY B;  3EZO A;  3GFH A;  1U6Z A;  3AY0 A;  2CPI A;  4TN2 A;  4CH1 A;  5JUM A;  3R1L A;  4URS A;  3OXF A;  5F41 A;  3SQG A;  2A18 A;  2P9G A;  1YHQ S;  3OL7 A;  2PN6 A;  5E5N A;  1UVM A;  1WOS A;  2N7Y A;  1R0B G;  5HRO A;  4DPY A;  4LR8 A;  3CJK A;  2EFO A;  4MKA A;  2DR8 A;  1YIJ S;  3OTO F;  5IT9 Y;  4U8V A;  1ZM9 A;  3DXB A;  2AP6 A;  2CPX A;  5A2Q Y;  3IR7 B;  4HLB A;  2DD8 S;  3TEH B;  3MD1 A;  2IC3 A;  3PYD A;  4OJH A;  2FZG B;  2GMH A;  4M95 A;  3ICL A;  3CCR S;  2XGP A;  1UA1 A;  3TQ1 A;  3DOM B;  2XM3 A;  1ZAX A;  2V68 A;  5C2C A;  1YRU A;  5H1S V;  1V3Z A;  1Y10 A;  4UQT A;  3HMJ G;  2NYI A;  2Z57 B;  3FRZ A;  3KMS A;  2B4P A;  2DHA A;  1BLU A;  1CSJ A;  5F8L A;  2IRY A;  2D3O 1;  3T5L A;  2X1F A;  4DZD A;  2F63 A;  1VQ6 S;  4QOT A;  2QT7 A;  1X9S A;  1FJG J;  1KLM B;  3EJM A;  3GYX B;  3O8W A;  1RT4 B;  5F3T A;  4WFB Q;  4K4Y A;  1WDT A;  1WUU A;  4X4U A;  2MKY A;  3BQ0 A;  5BYS A;  3G2X A;  3AQO A;  5A8W A;  2HLU A;  2YWK A;  2R8J A;  2WON B;  4OZN A;  2CJ9 A;  4C7Q A;  4EBC A;  2W9B A;  3ZZU A;  4H4O A;  1PC5 A;  3JAM Y;  4ZVO B;  4C8M A;  1N5Y A;  2RJZ A;  1TEL A;  2LEA A;  2LMI A;  1J27 A;  3KK2 A;  4NLG A;  5D4N A;  1HNW J;  1BQM B;  2PFD A;  2J0S D;  1IKX A;  5LSO A;  3M8Q B;  4O3R A;  1QUP A;  2E5H A;  2O3D A;  1GX5 A;  5A76 A;  3OHA A;  4ZN1 A;  4ZVP B;  1MU2 A;  3VGV A;  4IQX A;  3FRY A;  1ZYQ A;  2LDY A;  5KFN A;  4ELT A;  1M5H A;  1OYE A;  3I0S B;  4B3M J;  2K3K A;  4WFX A;  3Q8P B;  2YWE A;  1JLC A;  2ZDO A;  1OPI A;  3H7H B;  2X51 A;  2YQ0 A;  3T1Y J;  1P27 B;  2WVD A;  1N6Q A;  3K0J A;  3LP1 A;  3M8P B;  3DCA A;  2CPH A;  1U1P A;  1CJT B;  4DV7 J;  1LWC B;  4RWW A;  3MM9 A;  4K4V A;  1RHM B;  1R8H A;  4K0K F;  3FEZ A;  5IZH A;  4B3O B;  4CLU A;  2H4Y B;  1APS A;  1FD8 A;  4DR6 F;  1U8S A;  3CJT A;  3T5J A;  1Q78 A;  2MPU A;  1CJU A;  1NPP A;  5L9N A;  3TUP A;  2YNF A;  1AB8 A;  4CLP A;  1KD1 T;  3ULH A;  2CYY A;  2G2O A;  4WJB A;  2DEJ A;  2ZC4 A;  2CPJ A;  3GCW P;  1C0U A;  4CP5 A;  1W7W A;  4DR4 J;  1Y0H A;  2QFJ A;  2VFV A;  4IYQ A;  2BAN B;  4WP8 A;  5LSR A;  2I5J B;  3B8H A;  4F3O A;  3RB6 A;  4X66 J;  5DG7 A;  2XLJ A;  1OYD A;  3DM2 A;  3KDO A;  3NXZ A;  2DGS A;  1TMM A;  1PSD A;  4I2Q B;  4X4S A;  5HVH A;  1NKE A;  3AA8 A;  1NUE A;  5LJ5 Y;  1MMD A;  3E01 A;  2VG5 B;  3ILJ A;  2ZKU A;  2R4F A;  4MT1 A;  3BN4 A;  2RML A;  4ZPD A;  5D4P A;  2Q3P A;  5BR8 F;  2XYG B;  3EWG A;  3LOU A;  2J6T A;  1LNQ A;  1S97 A;  1H72 C;  4O3Q A;  1S1X A;  1FJ7 A;  2JLG A;  1IKY A;  3ETM A;  5L39 A;  2JOQ A;  4JI3 J;  3KNG A;  4TQR A;  4DPO A;  4DL2 A;  3ET6 B;  2FZC B;  1UJ4 A;  2LU2 A;  1JLB B;  2RDI A;  4ZN3 A;  2MQQ A;  7FDR A;  1CQN A;  3MMC B;  2W2Q P;  2MGZ A;  3TAR A;  3MPW A;  3HVA A;  2HGM A;  1KFS A;  5EUH A;  3UN5 A;  4NX9 A;  4GKK F;  1PO6 A;  2YNG B;  1JX4 A;  1RTI A;  2U1A A;  4CZC A;  2FC9 A;  1GX6 A;  4E2F B;  3RTV A;  4Y28 C;  2ASY A;  5ETK A;  5KFT A;  2B9X A;  3SCI E;  2OP5 A;  4PXD A;  3RR8 A;  3BO3 A;  2LQ5 A;  4ZCM A;  8AT1 B;  4B9V A;  2VDH A;  2YWF A;  1ZM2 A;  1KFD A;  3LGH A;  3W3S A;  2F40 A;  5E7O B;  1IVZ A;  4ILL A;  1ZAV A;  4IOB A;  1RJJ A;  3I5B A;  1HQE B;  4MK7 A;  1UPP A;  3TA1 A;  3K5L A;  4ID5 B;  4J9N A;  3CC2 S;  3OUY B;  2B9Y A;  4LIR A;  4PXB A;  4ECW A;  4XPC A;  4J9S A;  1F9E B;  4XDD A;  2CJA A;  1DBD A;  3R27 A;  2G2Y A;  2KXF A;  4DR5 J;  4J9P A;  2YX1 A;  3GPA A;  4PG4 A;  4OHW A;  4M5L A;  2J8A A;  4S0M A;  4M5M A;  3FCV A;  2FY8 A;  1LEO A;  5L1K A;  1N5T A;  1Y4Z B;  3QWU A;  3DRR A;  2FDN A;  2GJF A;  1RWP B;  4L76 A;  3V2U C;  4FBT A;  5IM0 A;  2V9W A;  1C1B B;  3MR2 A;  4TLQ A;  4GKJ F;  3NY0 A;  1XMB A;  1HKA A;  5KG0 A;  1PBU A;  3QZ7 A;  4TXS A;  3RRH A;  4XIU A;  4ES2 A;  2KZM A;  1RWO B;  1FDA A;  2PA3 A;  2QLX A;  3NEK A;  2ZH1 A;  3J80 Y;  1EP4 A;  2E44 A;  2F8M A;  4LF5 F;  1KWM A;  3QWP A;  1NK5 A;  2FJA B;  5I3P A;  3WQP A;  4U7C A;  1HIY A;  2HS3 A;  2F3J A;  4NLO A;  4NLD A;  3DOK B;  1TVR A;  3OL8 A;  4JI0 F;  4DV1 J;  5HK4 A;  2HQC A;  3M6W A;  1LQ9 A;  2DGO A;  3RUB L;  3A8K A;  2AHO B;  5FDL B;  2VH7 A;  1IKV A;  4KGK A;  2I2Y A;  3L95 X;  5IS2 A;  3HD1 A;  3HHL C;  4OIX A;  3OJU A;  4QJV A;  1RT6 A;  2FB0 A;  1JNR B;  3BV8 A;  4P2S A;  2XC9 A;  2V2V A;  4Q8E A;  2RAQ A;  2XMV A;  2EWH A;  1FXR A;  1NM2 A;  2EK1 A;  5C24 A;  3ITH B;  4RO0 A;  4E8U A;  2ZNY A;  3HSJ A;  3NWG A;  5ADZ A;  4HI1 A;  3G87 A;  4N47 A;  3EYZ A;  1SVD A;  2LDI A;  5KFW A;  1J2V A;  1QLN A;  4WPA A;  3TVY A;  3T41 A;  1L3U A;  2A6M A;  5A8R A;  4F4A A;  1C4A A;  1RK8 A;  1VR6 A;  1G3O A;  1FRM A;  2JNJ A;  2YPY A;  1Z2Z A;  4OX7 A;  3DLJ A;  2DCU B;  2WBM A;  2QSF A;  3J81 j;  5IT9 U;  4ED4 A;  1KRP A;  2YNI A;  5DGA A;  1Y3K A;  3V6D B;  1AXQ A;  4PKD B;  1UEU A;  4DN0 A;  2XHW A;  2I8E A;  5F8M A;  5DLG A;  2CZ4 A;  3RB3 A;  2XB2 D;  3OHB A;  3NNA A;  5DJB A;  5LMN F;  4X4N A;  2M70 A;  1U4B A;  1DUR A;  3ELH A;  3FCW A;  1U02 A;  4IRK A;  1V5V A;  2GW8 A;  4DV2 F;  5F8H A;  1S12 A;  3WC2 A;  3HHL A;  5HQ8 A;  1WJ9 A;  3P8B B;  3QGI A;  3BS9 A;  2XUL A;  2V0N A;  2DIT A;  2CKW A;  4OI4 A;  4DX8 H;  1HLW A;  1X5T A;  3D66 A;  3AQP A;  2DTJ A;  2DNN A;  1CBK A;  4A47 A;  3HCX A;  4JI1 J;  1FJE B;  4YDD B;  4ECS A;  1FER A;  1UL3 A;  4IG3 A;  4P75 A;  4Q44 A;  2WB1 D;  4RW6 B;  1YLX A;  3R9L A;  2R2T A;  4IFY A;  5HI7 A;  4KRW A;  5EX0 A;  3WIU A;  4UQG A;  4HT5 A;  3MR3 A;  1U2R A;  3JAM U;  1FI4 A;  1HQU B;  3PJ9 A;  2OEJ A;  1F5B A;  3JTP A;  4M8L A;  3G6X A;  2HMI A;  2W4P A;  2LKZ A;  2YWG A;  2FGO A;  1FFS B;  2H51 B;  2LVW A;  2FHO B;  2FLP A;  4KT0 C;  3VAM A;  4FNH A;  3R5A A;  4B3T F;  2M0G B;  4Y65 A;  1RT3 A;  1RAO A;  1X4B A;  1F5C A;  1X9M A;  4DMZ A;  3RW7 A;  1G7C B;  3KG0 A;  1VFJ A;  1UTA A;  4DR3 J;  4C3K A;  1M0S A;  1UCN A;  1TKX B;  1VYA A;  1E6Y B;  4ED0 A;  3GII A;  4DS4 A;  2YH1 A;  4OX6 A;  4KH0 B;  4C11 A;  4ZVE A;  2C3U A;  4KPC A;  2XSJ A;  3UN3 A;  2RF2 B;  3EGN A;  2ZH2 A;  4C0B A;  4DV6 F;  1YZ7 A;  3M9N B;  3PX0 A;  2IBK A;  3HHN B;  4PRF A;  1RLC L;  3TA2 A;  2E9R X;  2GO8 A;  3NLC A;  2WW8 A;  2O1P A;  2W2N P;  4DV0 F;  4ED3 A;  5KFK A;  3DDK A;  3MEC A;  4CLF A;  1U26 A;  1MML A;  4OHY A;  2WOM A;  1U24 A;  3DRP B;  2K06 A;  4DQQ A;  2XWY A;  4A8S A;  4J9L A;  1FDD A;  4TKT A;  2OIH A;  2AYB A;  2V94 A;  4CLK A;  1ZM4 A;  4LBH A;  5IV4 A;  2EFN A;  1FFW B;  2Y3Y A;  1BWV A;  1V3S A;  2IIH A;  2KH9 A;  1TR0 A;  2KB2 A;  2PT0 A;  4YEA A;  1ARO P;  3TAM A;  3C2P A;  2JLE A;  1VQS A;  2ROP A;  4JI6 F;  4U7U D;  3W64 A;  3IBF B;  5F0U A;  3W65 A;  2E9Z A;  4NA3 A;  3J7A 1;  2H5I B;  2HHX A;  4RNH A;  2W2P P;  4KYZ A;  3SBM A;  1HI1 A;  3M4X A;  3CJ0 A;  2CQD A;  2BQR A;  1RWW B;  4OHX A;  2ZM6 J;  1QAY A;  2HZA A;  2BOA A;  4FYY B;  3GU0 A;  1WEX A;  2GC8 A;  2IRX A;  1OQ6 A;  3I4P A;  4QYZ K;  1O0P A;  4C8N A;  1S72 S;  4ALZ A;  3HD2 A;  3T5H A;  3UCU P;  3T1H F;  5ETS A;  3EVO A;  3VGT A;  1SL2 A;  2VAS A;  4QU6 A;  4OLO A;  3D3C J;  3MOJ B;  3CC7 S;  1W26 A;  2OFG X;  4ECX A;  4UF4 A;  2VG6 B;  4X65 F;  1JLG B;  3M32 A;  1T0T V;  4MIA A;  5J2P A;  1AT1 B;  2KL8 A;  3MEG B;  3C6U A;  3W9I A;  4YHH J;  2H5E A;  3KLF B;  2C1E B;  3KUE A;  2HFS A;  4KBI A;  3K2Y A;  3PVX A;  4ECQ A;  1JXL A;  2A3J A;  2XO6 A;  2MY8 A;  4K4U A;  3MAA B;  1NK4 A;  3O3L A;  4PR6 A;  1OSD A;  1Q4R A;  2JEG A;  2DY1 A;  4RBV A;  2VHG A;  2BJ7 A;  3J7Y I;  1A9N B;  3Q8Y A;  2AF6 A;  2ZHB A;  4AD6 A;  3Q8R B;  3SV4 A;  1HNV A;  2FVS A;  1X4E A;  3QT7 A;  3AOD A;  2V2Z A;  5HVG A;  1FNX H;  1HWL A;  2GGP A;  1HFE L;  5LMU J;  3CME S;  5ETN A;  2BM1 A;  1N56 A;  3LW5 C;  2DO4 A;  2AQ4 A;  3IMQ J;  4DF8 A;  1X5P A;  3V81 B;  1FRI A;  1RI7 A;  4Q2M A;  2VBX A;  4RNF A;  3QIP B;  5KFY A;  2IJN A;  1NSP A;  5E0O A;  1TKT A;  3MMA A;  4OL8 A;  3QRQ A;  2J7K A;  4RW9 B;  4GVB B;  2ZVI A;  3VTI A;  2VZ9 A;  4OV1 A;  1GXU A;  3TI0 A;  4ED1 A;  1IKW A;  5K14 B;  1S6Q B;  1LV5 A;  4LSL B;  5ETL A;  4EK2 A;  3J80 U;  1WNE A;  2MQM A;  3T6B A;  2V8G A;  2FUG 9;  4ED2 A;  3V4I A;  4RU9 A;  3O2I A;  2YKM B;  1WKL A;  5AJ3 F;  4A8Q A;  1WSR A;  4Q2L A;  2MQL A;  3KOA A;  2DNZ A;  2W01 A;  2ZFH A;  4X4R A;  1FKO B;  2NCK L;  1VIX A;  3MEE A;  4F4Z A;  1F0X A;  5GME A;  1IQT A;  1VK3 A;  2R2U A;  4TNO A;  3S8S A;  4Q0B A;  2VDI A;  1SB6 A;  2CQB A;  5ETV A;  2WW4 A;  5KG5 A;  3PTW A;  3ZFV A;  1SJQ A;  1WTB A;  3CMQ A;  4HR2 A;  4FKY A;  1UEV A;  3ZO7 A;  4B3S J;  3MPV A;  3GFY A;  2BW7 A;  4C4W A;  1S1U B;  1PBA A;  5I42 A;  4FXW A;  4G1Q B;  4RPF A;  2B7C B;  1SUQ A;  1SQE A;  1KP6 A;  4F02 A;  2MKH A;  3WX4 A;  3DOL B;  1RUS A;  1KVK A;  3K17 A;  2UUW A;  2AEM A;  2DB1 A;  5DG9 A;  2EEY A;  1SJ3 P;  4LFC J;  4GMK A;  4IH7 A;  3H0P A;  1RGV A;  2MJN A;  1GNK A;  1H0H B;  1HBN B;  2QSW A;  4BLG A;  5B0D A;  2E29 A;  2KJV A;  3FMB A;  5D0R A;  3PEJ A;  1X0P A;  4ZP6 A;  1GAO A;  2KT5 A;  4UOC A;  3I56 S;  3RRG A;  3LAL A;  4M63 A;  1JK9 B;  1XR7 A;  2DR9 A;  1Q53 A;  2NSC A;  1YJ9 S;  3HLU A;  1LXN A;  4L3K A;  2DR5 A;  4WII A;  1U7L A;  3FBB A;  2G0J A;  2SXL A;  3GIJ A;  1D8Z A;  3AOA A;  3G86 A;  4DUT A;  1RQ0 A;  4B3R J;  5ETQ A;  2PDA A;  1IBM F;  3IN5 A;  2HZC A;  4NLX A;  1D8Y A;  2BJ1 A;  1N34 F;  2FQQ B;  1FKP A;  4YR0 A;  2KT3 A;  2DRA A;  2HVE A;  4K2J A;  3P6Y C;  2V4J A;  1SH2 A;  1F9H A;  2V8D A;  3VF0 B;  4CNZ A;  1WTF A;  1OQ3 A;  1REV A;  3BYP A;  1EAR A;  2E7X A;  2B8Q A;  5DDR C;  2NUU G;  3H42 A;  3NNC A;  1CS4 B;  5KFQ A;  4EUV A;  1MN9 A;  4OI1 A;  3QMQ A;  1M90 T;  3KLH A;  3V6J A;  1O51 A;  5EWE A;  1LFW A;  1NH8 A;  3H5Y A;  3T9N A;  1HMV B;  1CVJ A;  3BRE A;  3IS9 A;  3Q8U A;  1FA0 A;  3FJ2 A;  3HT3 A;  3GJQ B;  1XWL A;  4WKY A;  4Y2A A;  4WFN Q;  4NCG A;  4QPT A;  3OD2 A;  2DNL A;  6FD1 A;  1FRK A;  4N5S A;  4JI4 J;  4DZ6 A;  4DV4 F;  3LGN A;  2DGX A;  1M5V C;  2UUA F;  3HVT A;  3MHY A;  1C1C B;  1F6T A;  4CCH A;  1KN6 A;  1UEK A;  3MFI A;  4NLY A;  2O66 A;  2A6O A;  1TFY A;  2AD9 A;  3FBE A;  3QAE A;  2C28 A;  2BR0 A;  3FFI B;  3MTJ A;  3L7P A;  4ENO A;  1Q8L A;  4MKV A;  3ZTR A;  1DTQ B;  4UOG A;  2H54 B;  3CCE S;  5CXT A;  4UY8 T;  3CCW A;  2PE8 A;  3ADA C;  2MTL A;  1WAC A;  2JEF A;  2UUC J;  4OYA A;  1KDN A;  4CLY A;  3ILI A;  5J1E B;  3LPE A;  1X4A A;  2K2P A;  3NP5 A;  1TAQ A;  1SL0 A;  3IAS 9;  1RHU B;  2HHS A;  2DH9 A;  4ZLN A;  1EET B;  4O0I A;  1ZET A;  2UVR A;  2ZJR Q;  1IKX B;  4DPW A;  4ICL B;  1UWB B;  2B9W A;  3CCU S;  3OVS A;  5J2Q B;  4M5J A;  3W9H A;  2YQ3 A;  4R25 A;  2YX7 A;  5K8M A;  3THT A;  4WYW A;  4EI2 A;  3LP0 B;  4W92 B;  3NRB A;  3GE9 A;  2Z56 B;  1U1M A;  5C25 B;  4ZVQ B;  2N4D A;  3M9O B;  2HNZ B;  2D41 A;  4TYB A;  2KZZ A;  2KKH A;  3BDP A;  5D4O A;  5A8K A;  1AFJ A;  2R42 A;  4ZIV A;  3MWB A;  4I68 A;  2HQF A;  3MI7 X;  1ZS6 A;  1RKJ A;  3R5J B;  4H54 A;  4K7Q A;  1UKU A;  3D6H B;  2Y8Y A;  4IO1 A;  1FJG F;  4ZLJ A;  3A4T A;  4QWA A;  2VA3 A;  1WOR A;  1C0T B;  1IWG A;  4CT8 A;  5KOW A;  2KFY A;  5C2G A;  2XS7 A;  2LQ9 A;  4FF1 A;  2WSE C;  4OMF G;  4LF6 J;  5EX3 A;  2FY1 A;  1NKC A;  4V19 J;  2CQ2 A;  2GIF A;  4DJB A;  5DZ6 A;  2HFO A;  4N41 A;  3DOM A;  3NKY A;  1MWZ A;  2ZH6 A;  2PMW A;  3CPW R;  3DLE B;  2MZT A;  1GMU A;  2DGU A;  1KC8 T;  2RKI B;  4Y0F A;  4MH8 A;  1YKW A;  3BB5 A;  2HBQ B;  2FHM A;  4USU A;  4P74 A;  1PAE X;  2PSZ A;  4LQ3 A;  2GA7 A;  2B7B B;  4ZLL A;  1NJI T;  3I9Z A;  5I3U B;  3RBZ A;  4I2P B;  4F4X A;  5D6G A;  1O8B A;  5KFD A;  4NAS A;  3HHE A;  1EX8 A;  4ZCI A;  1I51 B;  1S1V B;  1KLM A;  2X7I A;  4B3M F;  3S01 A;  1RT4 A;  1UVJ A;  4M5D B;  5CHC B;  1S1X B;  2FLL A;  2R7W A;  1FT8 A;  1NCL A;  3T1Y F;  3PIO Q;  2WON A;  2ZH4 A;  3AFG A;  4QU7 A;  4ZPB A;  3N5F A;  4F0K A;  2OFH X;  5KFF A;  2VON A;  3HHK A;  4QIW D;  3UNG C;  2NPF A;  1N4L A;  2HHQ A;  1Y5L B;  2XMT A;  2UUB J;  1BQM A;  4F2S A;  1TU0 B;  4NYP A;  4X4V A;  1LWF B;  1HD1 A;  3W9J A;  3M8Q A;  1C2P A;  2Z2Y B;  4CIO A;  3ZTS A;  1VGY A;  4ZA1 A;  1VC6 A;  1N48 A;  3R6G B;  2RQC A;  1U09 A;  2L9W A;  3I0S A;  2WVF A;  1T9U A;  4HAC B;  3THV A;  1SIW B;  1JXE A;  5T7L B;  4DR4 F;  1R6V A;  2GQC A;  4JV5 J;  4CI0 B;  4YR3 A;  1R8P A;  4RNO A;  3M8P A;  3HJV A;  1T3O A;  1CJT A;  2CPZ A;  2OSQ A;  1LWC A;  3DHX A;  3EDR B;  3ISN D;  3MF5 A;  2OD6 A;  4B3O A;  2PEH A;  3EVW A;  2W2M P;  4DL5 A;  2JLF A;  3R5C A;  3M6X A;  4LFB J;  1TMJ A;  2X1A A;  3QRP A;  2QA4 S;  5IM0 B;  1T9T A;  4ZVR B;  4DR1 J;  4K50 A;  4TY8 B;  3IWL A;  1Q8B A;  4JI3 F;  4TVA B;  3GQC A;  4OZ2 A;  3VAL A;  3QYY A;  4G6V B;  4YS2 A;  3TUZ C;  2KI2 A;  1RCX B;  1H98 A;  4KTQ A;  4NXN J;  4RLE A;  2I1R A;  3W66 A;  1NHV A;  2BAN A;  2HUR A;  3QFW A;  2KJW A;  3P45 B;  3HPO A;  2I5J A;  4RJV A;  3NGK A;  2ZH8 A;  3PDN A;  4ZVF A;  4B9U A;  2QEX S;  4I64 A;  5AXM A;  4I2Q A;  3PX4 A;  3UE2 A;  3BPS P;  3O1L A;  4DBQ A;  5KT3 A;  1KTV A;  2ASJ A;  2VG5 A;  4CTA B;  4J9M A;  4MKB A;  1EB0 A;  3GYG A;  2E1C A;  2M4M A;  2L9D A;  4B02 A;  2CZ9 A;  4DL7 A;  4I6Y A;  5KFR A;  3DI6 B;  1FRL A;  4QPX A;  1T05 B;  1SH0 A;  2DHG A;  3H4D A;  3KDN A;  2VKR A;  3R97 A;  4P2M A;  2V34 A;  2F8E X;  2E1A A;  1VS3 A;  4WFA Q;  3SQO P;  5H9E K;  3ET6 A;  1SH3 A;  1JLB A;  2CQI A;  3QT6 A;  1K47 A;  1L3S A;  3MMC A;  4WE1 B;  1XTZ A;  5DET A;  4KGX B;  3HZG A;  3R1H A;  4DR5 F;  4UST A;  1ZPV A;  3U1M A;  2YNG A;  4DCP B; 
#chains in the Genus database with same CATH homology
 4HR2 A;  3G2X A;  4FKY A;  2BX6 A;  3FBE A;  1F3F A;  4FKX A;  4C6A A;  2HUR A;  1PAE X;  4UOH A;  2HVE A;  3NGS A;  1NSP A;  1S59 A;  3MPD A;  4ENO A;  3DKD A;  3FBC A;  3ZTR A;  3ETM A;  5CAA A;  2CWK A;  4UOG A;  5CAB A;  1XQI A;  3L7U A;  1B99 A;  1BE4 A;  2DXE A;  1NB2 A;  3NGU A;  4DI6 A;  1UCN A;  1VYA A;  1PKU A;  3GPA A;  3VVU A;  3ELH A;  3FCW A;  1JXV A;  1ZS6 A;  4S0M A;  3FCV A;  1NLK L;  2B8Q A;  4O0N A;  5IOL A;  4EK2 A;  3WX8 A;  1LEO A;  5BXI A;  1KDN A;  4KPC A;  1NDP A;  1NPK A;  1BHN A;  3EM1 A;  5C7P A;  1MN9 A;  2BEF A;  3Q89 A;  1HLW A;  1NDL A;  2DY9 A;  1K44 A;  1NCL A;  3FC9 A;  3Q83 A;  3Q8Y A;  3BBC A;  3EVM A;  3FBF A;  3B54 A;  3DDI A;  2DXF A;  2VU5 A;  3VGV A;  4CP5 A;  1B4S A;  3EE3 A;  1W7W A;  2AZ1 A;  4ANE A;  1WKL A;  3GP9 A;  3BBB A;  3EVW A;  3NGR A;  2DYA A;  4W98 A;  1U8W A;  4F4A A;  3R9L A;  3BH7 B;  4ANC A;  2ZUA A;  1WKK A;  1XIQ A;  3Q8U A;  2NCK L;  1EHW A;  3PRV A;  3Q8V A;  3VGU A;  2DXD A;  3EIC A;  2B8P A;  3EMT A;  2AZ3 A;  1MN7 A;  3FBB A;  1NSK L;  3ZTP A;  3PJ9 A;  1LWX A;  3JS9 A;  3NGT A;  3VVT A;  4UOF A;  2HVD A;  1NUE A;  3EVO A;  1NDC A;  3VGT A;  4DUT A;  1NDK A;  4DZ6 A;  1HIY A;  3EJM A;  3ENA A;  4WBF A;  1WKJ A;  3BBF A;  1S57 A;  3Q86 A;  1S5Z A;  3B6B A;  3VGS A;  1F6T A;  1HHQ A;  3ZTO A;  3BH6 B;  3ZTQ A;  3ZTS A;  1BUX A;  3FKB A;  4F36 A;  1NSQ A;  1NHK L;  4AND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...