4UONA

Crystal structure of c-terminal truncated (110-265) aura virus capsid protease.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
154
structure length
154
Chain Sequence
b'HMALKFEADRTFAVKNEDGKIMGYAVAMEGKVIKPLHVKGTIDHPALAKLKFTKSSSYDMEFAKLPTEMKSDAFGYTTEHPEGFYNWHHGAVQFSGGRFTIPTGAGGPGDSGRPILDNSGKVVAIVLGGANEGARTALSVVTWNKKGAAIKTTH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CAPSID PROTEASE
publication title Trans-Protease Activity and Structural Insights Into the Active Form of the Alphavirus Capsid Protease.
pubmed doi rcsb
source organism Aura virus
molecule tags Hydrolase
total genus 29
structure length 154
sequence length 154
chains with identical sequence B
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 2014-06-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4uonA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4uonA01
1DXWA 1C5QA 1DANH 1LHGH 1TPPA 4ZXYH 5DK1A 4H4FA 4AG1A 1L2EA 2QIQA 4X1RU 3E0PB 1KXCA 5EXMA 1NRPH 1GJ6A 3KN2A 3SU5A 1HIAB 1MCVA 5GWZA 1CT2E 1EX3A 3VGCC 4JZFH 3ZZCA 2O8WA 4UFGH 4ZHLU 3F68H 1C5VA 3GDUA 3SU6A 1OSSA 2W26A 1O2UA 4JZDH 3KHVA 4D9RA 1EASA 1NESE 2Y6TA 2PHBA 2XTTB 1QJ1B 2C8WB 5FHTA 4YM9A 2B9LA 3OU0A 4NA7A 2WPMS 4OS6A 1W3CA 1VJ9U 1XUIA 5E2OA 3LIWA 4DG4A 2RCEA 4Y7AA 5T3HA 1V2RT 2C8YB 1C1OA 1SG8B 1YPLH 3PTBA 1TMUH 1O2GH 4X2XA 1BRCE 1Q3XA 3RXUA 1XKBC 3MU0A 1DUAA 2C8ZB 1ELBA 3BTEE 3O8BA 1ZMLA 5C1YA 1ELEE 1ZHRA 2HPQH 5T6FA 1AFQB 1F0RA 2PR3A 1YPJH 1YPHE 2THFB 3E8LA 4ASHA 2ZFRH 1C5SA 1VGCB 2Z9KA 4H6SB 1OWDA 5EOKA 1Z71A 3ZVGA 3S7HB 1NM6A 3A81A 1ETTH 1O3BA 4LK4A 2FOGA 4B1TA 1EPTA 3M35A 2BD8A 2A4GA 3SW2B 2P3TB 4NSVA 1Z6JH 2AGEX 4AFSA 1G3DA 1O2TA 2ZO3H 1E36B 3SNBA 2AMQA 1P3EA 2FOMB 1O2XA 1GBTA 1ZPZA 3ITIA 3M3TA 1OWJA 2P93A 4YOJA 2BOKA 3A84A 2ZFSA 2GVFA 9ESTA 1SGEE 2HLCA 1A5HA 1S0QA 2VIOA 4X2VA 1O37A 2FI4E 3PMBB 3A82A 3Q3YA 1O2MA 3F9HA 2BOHB 4ZMAH 2XNIA 2BXUH 2QN5T 3ELAH 2XW9A 1C2JA 1MTNB 3SGAE 4MDSA 2ZPQA 1HAPH 1Y5AT 2VGCB 1JOUB 4E7NA 2GV7A 1GI6A 1Z7KA 1TB6H 1TX8A 4RKJB 5DP5A 3F6UH 4IS5A 4BTTB 4IGDA 3PO1C 4ZHMU 1A61H 1W8BH 2J92A 2TGAA 3SV9A 1ZLRA 2QXIA 3PLPA 3RM2H 4INLA 1KY9A 3P8OA 5EW1H 3NXPA 1FJSA 1RIWC 1YLCA 3T25A 5DP9A 5SGAE 2SGQE 1IQFA 1T8LA 3GY4A 3T27A 4SGAE 4Y11E 1E34B 1RS0A 4MPWA 3VB4A 1GBBA 4YOGA 1A46H 2HVXA 4DIHH 3FAOA 3SI4H 1DX5M 1OWEA 2JH5D 4OS2A 1O2NA 4NZQA 2QY0B 3L6PA 1A0HB 4UFFH 1QRZA 2A2QH 4ZHAA 1AWHB 1Z8RA 3MWIU 1NC6A 4X6NA 2CN0H 2F3CE 1TGTA 4X6OA 3UUZA 3ATLA 3RMMH 8ESTE 3S9AA 1O2PA 2GCTB 5C1UA 3V12A 2A7JA 5DJ7A 1BTYA 4FVBA 2F9UA 4Y79A 4X1NU 3NCLA 1KXBA 1AMHA 1H1BA 3BTFE 3DUXH 1HYLA 3MMGA 1N8OC 4CREA 4KP0A 1TRNA 3RXFA 4TWYA 7GCHG 2G4TA 3Q3KA 1S6FA 1UHBB 1SFQB 2F9OA 3DA9B 1GBMA 1SFIA 2QAAA 3LPRA 1QL7A 4H6TA 1P2KA 2BDGA 1SQOA 3RXQA 2SGFE 1FDPA 1QR3E 1EZQA 1C2LA 4YESB 3MH4A 3ZV8A 1Y3WA 4BAKB 3M5MA 3ZZ3A 3S9CA 3BEUA 2FOAA 3LDXH 2FTMA 3BIVH 3TNSA 1FY8E 2Y5HA 1LVMA 1GJ5H 1QRWA 3KEEA 1C5NH 4AZ2B 2GTBA 2BY7X 2AERH 1UVTH 3C1KA 1IQEA 3TGIE 1LMWB 3M3SA 3LH1A 2G55A 4X1SU 1GG6B 3TK6A 3SBKA 5FPSA 1ZHPA 4B76A 2H5DA 4IMZA 4GCHG 1CT4E 2G81E 5EXNA 1LHDH 3DFJA 4CH8B 1AN1E 4HTCH 2P3FH 3OSYA 8GCHG 5JBTA 1XVOA 1AWFH 1O3AA 1C5YB 2UUFB 2D2DA 1NFYA 4X6MA 5IYTA 1QNJA 3MHWU 1G2LA 1T8MA 3BTTE 2ZU3A 5F6MA 4I8JA 3A7ZA 1TONA 1V2MT 3VB6A 2CV3A 3TGJE 1GJ9B 1IQMA 1C5ZB 1LKBA 3A88A 2G00A 1BTZA 1RTFB 1DM4B 1TGSZ 1L1NA 2BD7A 1C2KA 2ZHFH 4FU8A 5FCRA 2FLRH 2ZF0H 2AEIH 3R3GB 1GHWH 2W7UA 5ETXA 3P8NA 4FUIA 4NCYA 1D6WA 1MTVA 4FUGA 4MPVA 3QN7A 1AKSB 4AN7A 3EGKH 4JK6A 1QGFA 2BDCA 1WQSA 4MLFB 4R0IA 3KCGH 3K9XB 3NKKA 5E0JA 2UUYA 3Q76A 3LGYA 2GZ9A 3RU4E 1LTOA 1ORFA 1V2OT 2B8OH 4MG3A 3RM0H 1GVZA 9LPRA 2OUAA 1QCPA 3NPSA 1MUEB 4BAMB 2QF3A 4RSPA 1EJMA 3NZIA 1LCYA 1L4ZA 4Y6DA 2FOHA 1KXAA 1DLKB 4J1YA 2BXTH 3ZYEA 2AH4X 3PWCA 2ZCLP 1ACBE 1LQEA 3BG8A 1ZMJA 1A5IA 4WMFA 1BBRH 2OBQA 3GYMA 1IQKA 3IG6B 5I46H 1EZUC 1WBGB 2HNTC 1TAWA 5F8XA 3GY2A 2PV9B 3A8CA 1NPMA 4X2YA 1GVKB 3UNQA 1JIMA 1AFQC 3V7TA 4KKDA 2AS9A 1O31A 1DSTA 2ULLA 1W10U 1WSSH 1VGCC 5F8ZA 3TJNA 1V2NT 3IITA 3QDZB 3SJIA 1HGTH 3RXPA 2A7HA 4FUDA 1O3OA 1PFXC 1O3FA 1O2RA 3EDXB 3HKIB 4D76A 2VH6A 1Y3XA 3T28A 2QYIA 2XYAA 4FUEA 2OC8A 4YLUA 4LZ4B 1Z8IB 1V3XA 2FX6A 3TJVA 3RXTA 2C93B 4U2WA 2KAIB 5JBBS 3S69A 1O2KA 5HXFA 2BX3A 1SI5H 4ABGA 2XCNA 2IOTA 1UTKA 3RXRA 1GBCA 1CQQA 1DPOA 1ZOMA 2C90B 3FZDA 2A7CA 3GDSA 1ZSLA 3GCTG 5DG6A 2UWOA 4AGKA 1MAYA 3LT3A 2WYJA 1Q31A 4CH2B 1GHBF 1C1MA 3SOSA 3B23B 1AIXH 1ANEA 1PPGE 2LPRA 4NIVA 3TU7H 1QHRB 1G30B 1A7SA 2F9PA 4ABIA 5C1XA 2PKAA 2OC7A 2BLQA 1MTNC 1O3GA 4WXIA 2A2XH 3PLKA 4DCDA 1GHZA 2TIOA 1QL9A 1MD8A 2VGCC 1P8VC 5F8TA 1UK2A 5A0AE 1BOQA 2AIPA 3MTYA 5CE1A 3UNSA 3BG4B 2UWLA 1AQ7A 2R2WU 1P01A 3H5CB 3OX7U 4A7IB 2RA3A 5BRRE 1UVSH 2BDBA 4OGYA 1NO9H 1GBIA 2ANKH 1SBWA 3BTGE 4Y0ZE 4CR9A 1CHOF 2B5TB 3HGNA 1QA0A 2ZECA 4ABEA 1HCGA 2I6QA 1G3EA 1O36A 2STBE 2VIQA 3AAUA 3MO3A 1T31A 5ESTE 2PUQH 5A09A 1GBFA 3RXCA 4Y8XA 1GI3A 2A31A 3VB3A 3W95A 4CBOA 5AF9H 3SZNA 1C1UH 2DE9A 4SGBE 5J4QA 4FUFA 2BVRH 4IC5A 1C4Y2 4Q2KA 1ZGVA 3P95A 2D26C 2FZZA 1CGJE 2ZFQH 1O30A 1ANBA 2VH0A 2CMYA 3F9EA 5LPRA 3BEIB 1ELTA 1BA8B 1Y3VA 1O2ZA 3C27B 3DFLA 2PWXA 5DP6A 1MQ5A 1GMCG 1VCPA 4FUJA 1KDQA 1GVLA 4OS4A 1F5RA 3GY3A 1NRNH 1S82A 1XM1A 1GBDA 2ZP0H 3ZVBA 5JDUB 1BQYA 1HB0B 2GCTC 2GX4A 3RXVA 1CA0B 2V0BA 2ZFPH 3LH3A 1DWCH 4UFEH 3LGIA 2GDDA 3MNCA 1NN6A 1SGFA 4JCNA 4JZEH 1NU7B 2GT7A 4JZIA 4Y76A 3ZVCA 1MH0A 3M7UA 3A8DA 1BJVA 4I8KA 2Y7ZA 1KSNA 3SNDA 2HOBA 4JK5A 1MKWH 3SNAA 1BIOA 1ESBA 1PYTC 1C4U2 3KQDA 4K3JA 2A4QA 1TNHA 1A2CH 1BTWA 1TPOA 2SGPE 1EATA 5BPEA 1RD3B 4AFQA 2SNVA 1P02A 2FTLE 1AY6H 1TOMH 2ZFFH 2FOBA 4MNXA 4NG9H 1N6YA 2GMTB 1JIRA 2B0FA 2Y82A 3P70B 3QK1A 2PTNA 2O8UA 4KTSA 1GJCB 4ISOA 1DS2E 4XSKU 2CGAA 1GJDB 1V2KT 1XXFA 1OP0A 1DDJA 1TE0A 1DWEH 2XWBI 2Y5FA 3O8RA 1TNIA 2JH6D 3TK9A 3ZZ7A 5FCKA 1W7XH 1W2KH 1MU6B 5DO4H 2FI3E 4WMDA 1GG6C 2FLBH 1D4PB 4I7YH 1F92A 3BTKE 4RKOB 1HDTH 1H4WA 3MU8A 3I29A 1KLTA 1O5FH 1FY4A 2ZU5A 1AUJA 4NWLA 3UIRA 3BSQA 3VEQB 4ZKOU 3M37A 3VPKA 1NFXA 1T8OA 4E06H 1K2I1 1PJPA 1SR5C 2ZEBA 3M5OA 4THNH 5HGGA 5GJ4B 4I33A 3TK5A 2Y5GA 4Y71A 1C5LH 2OQ5A 5DP8A 2CJIA 4ABHA 2BHGA 2ZGHA 4BXWA 1YBWA 4WVPE 2WPJS 1UK4A 3GICB 3P17H 3U98H 5A2MH 2EEKA 1O2QA 3PLBA 3P92A 1ZPCA 1J17T 1U6QA 4D7FA 2J9NA 1SOZA 1QFKH 1K9OE 2BY9X 1K22H 2C3SA 1SB1H 2PSXA 1O3DA 2R9PA 3ATMA 3KF2A 2BQ6B 1Z8JB 5GCHG 1D3QB 2FESH 4YT6H 2WPKS 3K6ZA 3PYHA 3HPTB 2QA9E 2ESTE 4NZLA 1CGHA 4K8BA 3RXJA 3URCA 4JMYA 1HAYB 2ZGXH 1GWAA 4YOIA 1O2WA 4XDEA 1OWIA 2O9QA 3CENA 1Y5UT 1GMHF 4K69A 1LO6A 1UJ1A 2NU2E 3SUDA 1HNEE 1AZZA 1F0TA 3AVZA 4BAQB 3PTNA 1TBZH 4B2CA 1ELCA 3D65E 1K1PA 1G37A 1SMFE 1PQ5A 1TQ0B 1FZZA 1OP2A 3GCNA 5PTPA 4AORA 1SLWB 3S9BA 3U1JB 1YPMH 1H9HE 1C5RA 3FP8E 5C20A 1FN8A 1MMJN 3GYLB 3QTVH 2ZNKH 4AX9H 2O8LA 1T4VH 2ZGJA 5GPIB 4B71A 4X1QU 2O8MA 2OLGA 3UQVA 1XKAC 1OWKA 4NFFA 2FP7B 2WINI 1FAKH 5TJXA 1W13U 3GY5A 3LC3A 3GY6A 5LPFA 5DP7A 1TABE 2SGEE 1EPTB 1UCYH 3LONA 1QRXA 4UONA 2ZCHP 1QB9A 2PSYA 1FMGA 2OXSA 3UOPA 1D3DB 1XXDA 1PPFE 1XVMA 1YKTA 4A6LA 1EAXA 3K2UA 3ESTA 4CR5A 1P04A 2XBXA 2TPIZ 3SI3H 1OKXA 1ELFA 1BT7A 1JBUH 1TOCB 3V13A 4Q7XA 4HZHA 4M7GA 2Z3EA 2W7SA 1BMLA 1KXDA 1ZTKA 5FPTA 2FS9A 3MU5A 1O5AB 2AFQB 1GJ7B 3ZVAA 3UR9A 2WPHS 5JB9S 3CS7A 3ZZ9A 1EJAA 3UR6A 2VIVA 1O32A 1OX1A 1QA7A 3LGVA 4UDWH 3RUOA 3QZQA 4Y7BA 1RGQA 3SORA 1GJBB 2FS8A 1BRBE 3UQOA 3RU4T 4XBBA 5G4BA 1UTNA 5K0HA 1TQ7B 2PUXB 1KYNA 1INCA 5T6GA 1P2MA 2GCHF 2A5AA 2J38A 1ARBA 1YPKH 2IJOB 1EXFA 2F9NA 3R0FA 3BV9B 3BTWE 1V2PT 2AMPA 3RXHA 1SGRE 3RC4A 3S7KB 1M9UA 1IQHA 5DGJA 3ZZAA 3A87A 1AI8H 1FXYA 4ZKNU 3A83A 1P0SH 5EPNA 4Z6AH 3GCHB 1GMDF 3A7XA 4BNRA 1SLXB 2XBYA 3QO6A 2WPIS 3ZZDA 3SV7A 3BG4C 1MKXH 2BD2A 2RG3A 1UO6A 1UVPA 1JWTA 1J14A 1RJXB 1NU9A 3MI4A 4IN1A 1SL3A 1BDAA 2JKHA 2HNTE 2OINA 5A0CA 3UWJH 3MO6A 3DT0H 3UFAA 1SHYA 1HJAC 2PLXA 3M7QA 5C5OA 4FUCA 4A92A 2WYGA 3JZ1B 1GCTB 4B2AA 1OYTH 1Y5BT 3TNTA 1NRSH 4D8NA 2SGAA 1S83A 1LVYA 3U8RH 2Y7XA 3RXOA 4JYVH 1SQAA 2QCYA 1ELDE 3LGWA 5AHGH 3O8CA 2G4UA 1WV7H 1O35A 2GT8A 3NK8A 5JYIA 2ZU4A 3LGUA 3PB1E 3SU4A 2BY8X 1O3JA 2J94A 3AW0A 5B6OA 3DD2H 5FBEA 2HPPH 1FY5A 1B0FA 2EA3A 3SUGA 4A1XA 2F83A 2PTCE 1OPHB 4MNWA 1ZR0A 1VCWA 1EOLA 1IQLA 2H9HA 1YM0A 1CA0C 2BM2A 1K1MA 2BB4A 3TLOA 3EE0B 3ZZBA 1EB1H 1GBAA 1W14U 1HLTH 2ANWA 1J8AA 1OYQA 3H7TA 1XMNB 2EI7A 2R2MB 1G3BA 1YCPH 4ABAA 1G36A 4X2WA 2VVVA 2Z3CA 1X7AC 2W5EA 4AB8A 1MBQA 3FZZA 2P59A 1ZRKA 5EQRA 1NZQH 3RU4D 3P8GA 1YP9A 3U8TH 1C2GA 2Z9LA 2GMTC 3U1IB 2QF0A 3M7TA 2ILNA 2QV1A 5EQQA 1HAHH 5T6DA 4JZ1A 2PGQB 5LPEA 1ESTA 1TRYA 4X8UH 1K1JA 2ODYB 3M5NA 6GCHF 3LJJA 2TBSA 4ZH8A 4GPGA 2ZHDA 1Z1IA 5A8XA 3L33A 5FBIA 2V3OH 8LPRA 1AGJA 2AGIX 2BYAX 2R3YA 2F9BH 1EZXC 1LQDB 3V0XA 1FN6A 3K6YA 4WMEA 1TWXB 3V3MA 4GCHF 5K7RA 3QZRA 4ABBA 1AE5A 2TGDA 1EKBB 3B8JA 1VR1H 1IHSH 2OC1A 1KLIH 2AMDA 2XBVA 1CU1A 1OXGA 3FP6E 4B74A 1GHYH 2W3KA 2A1DB 4YO9A 3RMLH 1SGCA 1B0EA 4K2YA 5EXLA 3TH3H 1VITF 4AFZA 1VZQH 2A4RA 3KQBA 4HI3A 1TGBA 1BZXE 4I8GA 2QC2A 5DP3A 2ZWLH 3UREA 2ZA5A 1C9PA 5DPAA 1FIZA 3BTHE 4NWKA 3FANA 3EAJA 1QB6A 2QGRA 3T26A 2ZG0H 1GJ4H 1WCZA 1AB9B 2FOEA 4DOQA 4NA8A 4IN2A 2UUKB 3CS0A 2RA0A 1HAGE 2XC4A 3E6PH 4VGCB 3BF6H 2YNAA 5C67A 1GI7B 5EODA 5E2PA 4TPIZ 1O3NA 3W94A 2DUCA 2BDIA 5FXLA 1YGCH 1NRRH 2NU0E 4GUXA 1SVPA 1GI9B 3KIDU 1GBLA 3P6ZB 2FDAA 2FYRA 3CP7A 3GY8A 5EU8A 3OY5U 1C1NA 1AVGH 2BZ6H 1KIGH 1C2IA 1C2EA 3BTQE 2Z3DA 3MU4A 4TY7A 5AVDA 3TH4H 4WXVA 3BTME 3TITA 3SU3A 1C5TA 4X0WU 4WY3A 5A8ZA 1EAIA 3A85A 3Q77A 3PM3A 3RXIA 1SSXA 1GHAF 1THRH 2DE8A 2CF8H 1GJAB 1P3CA 1TGNA 3ATIA 5CMXH 1WAYB 2ZQ2A 1C2FA 1OOKB 2UWPA 2P95A 2BQWB 1HXFH 3L3TA 2O8TA 2KAIA 2ZU2A 1P2IA 1F0UA 3VB7A 1AVWA 1BHXF 1PPBH 3UY9A 1C5UA 4UE7H 3ZZ4A 4ZAEA 2WUBA 4CRDA 2BZAA 1EPTC 1GHBG 1FY1A 1YCPM 1H9IE 3D62A 2LNCA 3RXMA 4U32A 2BY5X 2J4IA 1QJ7B 3PMHB 1E37B 1QQUA 4DW2U 2OP9A 1ZTLA 1BUIA 1BTXA 1C1SA 3BN9A 1OWHA 3PV4A 1YF4A 1PQ7A 4MPXA 3BEFB 1O5GH 2BLVA 3MNBA 1NS3A 2TGTA 3RLWH 4TY6A 3EQ0H 3MH6A 4BAOB 2P8OB 2VIDA 4ZROA 2BVXH 1P2JA 4DVAU 1TA2A 1UVOA 3SNEA 1AZ8A 1FV9A 1L0ZA 3SU1A 1MZAA 5EG4A 1GDNA 1A0JA 2FO9A 3MFJA 1QJ6B 1ZSKA 1JMOH 3SHCH 1UTPA 4HGCA 2Q6DA 1UMAH 1V2ST 1QBVH 1T4UH 2Q6FA 4MNVA 1ZYOA 3AW1A 3ODFA 4DGJA 1F5LA 3WY8A 1ESAA 1NROH 2XCFA 1J9CH 5FX6A 2ZKSA 3GCHC 4X8TH 2IPHA 1BMNH 1XX9A 3NWUA 5TCCA 4LZ1H 1W0YH 2YOLA 3EA9A 1D9IA 3AAVA 4UEHH 4KTUA 1DFPA 2M5TA 2AYWA 1TX6A 1LPGB 1RTKA 4U01A 1O2IA 3RXDA 4ISLA 2JH0D 5TCAA 1SLVB 1GI0A 1T32A 1MZDA 5DKMA 2ANYA 1ELVA 5FX5A 1AE8H 1BBRE 2Z7FE 3GISB 2G5NA 1GBKA 1ZJDA 5L2YH 1HXEH 3MNXA 3K65B 4NSYA 3QX5H 2ODPA 3FVFB 5A8YA 4B75A 1O2OA 4Y8YA 1TBQH 3AASA 2FXRA 4ZXXH 1F0SA 1A1RA 1P12E 1TBRH 2VNTA 1GCTC 2OQUA 2NU3E 1TNGA 4GVUA 4B2BA 1LPZB 1FY3A 1O3PB 3T5FH 1FAXA 1N6XA 2QXJA 1O3LA 5GDSH 2BD4A 3QGNB 2ZDKA 3SU0A 2FIRH 1GMCF 1P9UA 1O0DH 4IBLH 1S81A 1ZGIA 4BXSA 5E0HA 1BBRK 2FYQA 2ZTXA 3UNRA 4O3TA 1YC0A 3E91A 4INKA 1UTLM 3HATH 4F4OC 1ZMNA 4DT7B 4GSOA 5DP4A 1EZSC 3VXFH 5LGOA 1O3EA 3KL6A 3TIUA 2ALVA 3HKJB 4AYYB 3PROA 5EGMA 5EQSA 1KTSB 3MU1A 2Q1JA 1T7CA 4ABDA 2I6SA 4TYDA 2BDYA 1HAVB 1EJNA 2V3HH 1IHTH 3A89A 1V2QT 2Y80A 1UTJA 4A1TA 1O5BB 5JB8S 4ABJA 2ANMH 1UTQA 1GJ8B 4TPYA 1FLEE 4K8YA 4AGJA 1Y8TA 2K1QA 1W0ZU 1V2WT 4UD9H 2ZC9H 4IC6A 1O38A 1SGIB 3TJUA 2BVSH 2Z94A 3SU2A 1HIAA 5E8EH 2HALA 4BOHA 3M61U 3PMJA 4ISHH 3MH7A 4K60A 1TA6A 1V6DA 1NT1A 4FU9A 4FU7A 1GBJA 4ISNA 4X8SH 2FI5E 2ZU1A 2F91A 2A5KA 1ETRH 2V35A 1BB0B 1C2MA 1DWDH 5ESBA 3KGPA 2BDHA 1KLJH 1Z8GA 1JXPA 1GL1A 3RMOH 3QTOH 4R8TB 1BJUA 3GOVB 3LOXA 4JYUH 2Z6BD 2FOCA 2WUCA 4OS5A 3ZVEA 1LVOA 1GMHG 2ALPA 4XE4A 4D9QA 5HM2A 1UVUH 4Y8ZA 3MOCA 3RXKA 1EP5A 1SQTA 2H6MA 3VXEH 3D23A 4NFEA 1P2OA 2FODA 1GI2A 2AIQA 1ZHMA 2OC0A 4WJG2 4INHA 1IQJA 1UK3A 1SOTA 2F9VA 3OYPA 2XC5A 3QGJA 1O3HA 1BMMH 2CHAB 3RDZA 1O2YA 4J2YB 3KNXA 1GBHA 3HK3B 5GCHF 1DVAH 1AB9C 3LJOA 3ODDA 5ABWA 3FFGA 3N7OA 2ZHQH 2YNBA 3BTDE 3ZZ8A 2A32A 4VGCC 1HAZB 2OTVA 1SHHB 3A8AA 2J95A 1O3IA 3E16B 1DITH 1EAWA 1O33A 3U69H 4X8VH 3RC6A 4CRBA 1CBWB 4AYVB 1MD7A 1MQ6A 1PPHE 3ATKA 3IWMA 1UTMA 4Y10E 2D8WA 1WQVH 2A0QB 1SGFG 1IQGA 1V2TT 3NUMA 1T8NA 2VVUA 4GAWA 1H8IH 3F9FA 2TRMA 4NIYA 3SJKA 1AFEH 4MTBA 1D3TB 2VB0A 1C5WB 2BLWA 1TLDA 2V6NA 1K1NA 1S6HA 3Q00A 2EI8A 1C1WH 5AFZH 3QWCH 3P8FA 4Q7ZA 5C2ZA 1V2JT 2VIPA 2VJ1A 1SGDE 2ZPSA 3B9FH 2Z9GA 2XWAA 3M5LA 1CE5A 1UTOA 2GD4B 2P94A 4O03A 1GI8B 2ZHEH 1DUEA 4I31A 2HWLB 4HFPB 1NY22 4NA9H 4CHAB 3TGKE 3LC5A 3MH5A 3M36A 5JBAS 1AD8H 1D6RA 2GZ7A 2BDAA 4I8LA 1MKWK 2BD9A 1XUHA 1ABJH 2VWOA 2XRCA 3A7TA 3STJA 3SV8A 4QT8C 4H42U 4IW4E 2H1UA 3E0NB 2GCHG 1GHXH 4ABFA 2ZIQH 3A80A 1IAUA 1Q2WA 4K1SA 6LPRA 5CHAB 4Q7YA 1ARCA 1DLEA 1DY8A 1HAIH 1NTPA 2VVCA 3RXSA 1CA8B 2QXGA 4XBDA 3LGTA 4MVNA 3S0NA 5FPYA 1QBOA 4I8HA 1ZRBA 5GIBA 1LDTT 4F49A 2JETB 4E7RG 4AG2A 1S85A 3TH2H 1SLUB 1VITH 1GMDG 2R0KA 1GDUA 1A0LA 2RDLA 1O34A 3TPIZ 4CRGA 2GDEH 1ZSJA 3FP7E 3SUEA 2ASUB 4WF8A 2ZHWH 2A45B 2PGBB 1NFUA 3PMAB 3F9GA 3TVJB 3ZVFA 4ISIH 4YTAA 2FX4A 2G5VA 3SJ8A 3VB5A 1KXEA 2VWLA 2J2UA 3RXGA 2ODQA 1G9IE 1WYKA 2P16A 2P8OC 5I25A 1V2LT 5C5NA 1G3CA 1HFDA 5L30H 1QURH 3Q3XA 2H9TH 1BTPA 3M3VA 2FM2A 1P03A 1TMTH 2HRVA 2ZDNA 3SJ9A 1BRAA 4DJZB 1C5MD 1DT2A 3EYDA 3F1SB 1E0FD 1IQIA 1EOJA 1FQ3A 1GBEA 2W3IA 3URDA 3SQEE 2ZDLA 1QB1A 2TGPZ 3E90B 4WWYA 2NWNA 1C1RA 1P2NA 1BMAA 1XUKA 2GP9B 5H4IB 1UHBA 2CXVA 3ZZ6A 5A0BA 1PQ8A 1RTLA 2Z9IA 1Y3YA 2HNTF 1LHEH 1S5SA 2PKSB 1FIWA 4YLQH 1O2HA 1KXFA 4NGAH 1DICA 1FUJA 1Z1JA 1TIOA 3RXEA 1YPEH 2ZDVH 1J15A 4MPUA 7LPRA 1FI8A 2P3UB 2CF9H 2STAE 1GPZA 4BAHB 1TNLA 4LOYH 1IQNA 1C5PA 3I77A 7GCHF 1YPHC 1BHXB 1UCYE 3DHKH 2GKVE 3PWBA 2SFAA 1BITA 1YPGH 2BMGB 4ZUHA 1HBTH 3STIA 1K1OA 1PPZA 1HAXB 3KQEA 1THPB 2XXLA 4XOJA 2G52A 1P06A 1NFWA 1DOJA 1GI4A 3SJOA 1MU8B 3SUFA 1TRMA 4YT7H 1P57B 1JRSA 1V2UT 4K1TA 6GCHG 1C9TA 4TWWA 4K5ZA 1W11U 1GGDB 1UCYK 1P9SA 1SGYE 6CHAB 2GV6A 5EW2H 1PPCE 1CHGA 2VINA 4AOQA 1S0RA 4Q80A 4B73A 2R3UA 2BY6X 6ESTA 1L4DA 3T2NA 1VCQA 1WTGH 3A86A 1TFXA 1O39A 2ZTZA 1C1TA 4Z0KA 1C2HA 3VGCB 1ANCA 1O5EH 1LHCH 1AKSA 1VITG 2WV4A 2ZTYA 4NIWA 3ZVDA 8GCHF 2BX4A 1ANDA 1RRKA 1XUFA 2FEQH 1PYTD 2SGDE 5JBCS 1HPGA 5EPYA 1MTWA 3ENSB 1GCDA 4XFQA 4CRAA 2ZDMA 1FNIA 1LKAA 1RXPA 5F03A 1GL0E 3RP2A 1N1LA 3O8DA 3VFEA 1SGPE 3UOUA 5HM9A 3A7YA 3QLPH 4E05H 2B7DH 1A3EH 1SC8U 1Y3UA 3GY7A 5AFYH 3UPEA 4OS7A 3LU9B 1HJ9A 4YZUA 4XBCA 1B7XB 3LKWA 1J16A 5IDKA 1WOFA 1A4WH 2ZFTA 2GZ8A 1Y59T 4MNYA 2XBWA 1CO7E 1RFNA 1A3BH 2NU1E 1K28D 2EC9H 5L2ZH 1MKXK 2Q6GA 4OGXA 3H7OA 1C1PA 2PW8H 4X6PA 4KTCA 1W12U 4A5TS 2OD3B 1ELGA 2AGGX 2OCVB 2CHAC 1L1GA 1SGNE 1G32B 1DE7H 4GHTA 8KME2 1GHAG 1BRUP 4OS1A 1TX7A 1SGTA 2VIWA 3E1XB 1HAOH 2ZCKP 4GHQA 3RC5A 5JPMH 1P09A 1SGQE 1DWBH 1F5KU 3SN8A 4ZKRU 3JZ2B 1EB2A 1DXPA 1Z6EA 4O97A 1C2DA 1GDQA 2ZI2H 1CBWC 1MCTA 3SGBE 1VJAU 5E0GA 3U8OH 4CBNA 1A5GH 4JYTA 1TMBH 4X1PU 2EI6A 1QY6A 3MNSA 3TJOA 3HK6B 1GHVH 1C5XB 3RXBA 1QL8A 2VWMA 1BCUH 4FUHA 1MAXA 2BQ7B 1CGIE 1K1IA 1GI1A 1NRQH 2BD3A 1ABIH 3PO1B 3SV6A 3SQHE 1XUJA 4DY7B 5FAHA 2ZGCA 1DY9A 1ZTJA 5J4SA 3SO3A 1OS8A 7ESTE 3SGQE 2H9EH 1ZZZA 4A1VA 1RIWB 1W7GH 1YYY1 2C8XB 1LHFH 4CHAC 2J34A 1TNKA 1AU8A 4PROA 1YCPK 3GCTF 1PPEE 1AO5A 1CHOG 1G2MA 4Y0YE 3ZV9A 3D49H 1GI5A 3BIUH 1TPSA 4ESTE 1AVXA 1K21H 4BANB 2PKAB 2ZQ1A 1CSOE 2BTCE 2NU4E 1AUTC 1TYNA 4FVDA 5CHAC 1O3MA 1O5DH 5HYOA 2H5CA 1IOEA 4K1EA 1B5GH 4CRCA 3ZYDA 2JETC 2R0LA 1CT0E 3GDVA 1WUNH 3RMNH 1E35B 1ETSH 1O2JA 1ID5H 2A5IA 3RXAA 1HUTH 1MTUA 1P2QA 1S84A 4WH8A 3U9AH 1MBMA 3HGPA 2WV5A 4DURA 1HRTH 2FMJA 1O3KA 4NIXA 1HJAB 4LXBH 1JRTA 1EP6A 4GLYA 1HJ8A 3OTJE 1P11E 1CVWH 3OY6U 3RXLA 1TNJA 2Y81A 1N8OB 1ZPBA 1E38B 2PFEA 3A8BA 4UFDH 3RLYH 1ZJKA 3A7WA 1O2SA 2XC0A 4AB9A 2A4OA 1L1JA 3G01A 4I32A 4DIIH 3EA8A 2SNWA 4FUBA 2HGTH 1C4V2 3ZZ5A 1QQ4A 1KDQB 2ZDAH 1MTSA 1QIXB 3I78A 2H2ZA 1TPAE 3MYWA 1F2SE 3A7VA 4U30A 1DSUA 2D1JA 4CRFA 2VU8E 2PKSC 3T29A 1LVBA 1LPKB 1KTTB 5C3NA 1ELAA 1QTFA 1WU1A 1D3PB 1H8DH 1P05A 7KMEH 3QUMP 4MQAA 1C1VH 4O9VA 2IN2A 3SNCA 4ZKSU 1HV7A 1SPJA 2G51A 3SV2H 1YLDA 1EUFA 1TGCA 4D7GA 2BLOA 1C1QA 1AHTH 1V2VT 1EAUA 2WPLS 2FOFA 1F7ZA 2QXHA 5HMAA 2UUJB 4RN6A 5LH8A 5GXPA 2GGVB 4AFUA 2VWNA 1THSH 3E3TA 1C5OH 1HAVA 3UWIA 3GCOA 2ZGBH 2Z9JA 1FONA 1EQ9A 4KGAA 2OBOA 2FPZA 1O2LA 1WTHD 4BTIB 4O3UA 1P10A 2FWWA 2ZPRA 4WH6A 3MO9A 1FPCH 4FXGH 1BTUA 1K1LA 3T62A 3ATWA 2C4FH 1OP8A 1O2VA 3UTUH 1PQAA 4IMQA 1BTHH 2ZZUH 3SHAH 1H9LB 4BTUB 3EA7A 2G8TA 1XUGA 3KQCA 1GGDC 1TALA 2BD5A 1QBNA 6CHAC 4KELA 1FPHH 1O3CA 1O5CB 5L6NH
chains in the Genus database with same CATH superfamily
1DXWA 3EE7A 1C5QA 1DANH 1LHGH 1TPPA 4ZXYH 1E1RD 5DK1A 4H4FA 4AG1A 3UB0A 1L2EA 2QIQA 4X1RU 3E0PB 1KXCA 5EXMA 1NRPH 1GJ6A 3KN2A 3SU5A 1HIAB 1MCVA 5GWZA 1CT2E 1EX3A 3VGCC 4JZFH 3ZZCA 2O8WA 4UFGH 4ZHLU 3F68H 2KFWA 1C5VA 3GDUA 3SU6A 5GNDA 1OSSA 2W26A 1O2UA 4JZDH 3KHVA 4D9RA 1EASA 1NESE 2Y6TA 2PHBA 2XTTB 1QJ1B 2C8WB 2WSSD 5FHTA 4YM9A 2JJ1D 2B9LA 3PRDA 3OU0A 4NA7A 2WPMS 4OS6A 1W3CA 1VJ9U 1XUIA 5E2OA 3LIWA 4DG4A 2RCEA 4Y7AA 5T3HA 1V2RT 2C8YB 1C1OA 1SG8B 1YPLH 3PTBA 1TMUH 1O2GH 3FO8D 4X2XA 1BRCE 1Q3XA 3UAIC 3RXUA 1XKBC 3MU0A 1DUAA 2C8ZB 1ELBA 3BTEE 3GS9A 3O8BA 1ZMLA 5C1YA 1ELEE 1ZHRA 2HPQH 5T6FA 1AFQB 1F0RA 2PR3A 1YPJH 1YPHE 2THFB 3E8LA 4ASHA 2ZFRH 1C5SA 1VGCB 2Z9KA 4H6SB 1OWDA 5EOKA 1Z71A 3ZVGA 3S7HB 1NM6A 3A81A 1ETTH 4P02A 1O3BA 4LK4A 2FOGA 4B1TA 2QF4A 1EPTA 1WDIA 3M35A 2BD8A 2A4GA 3SW2B 2P3TB 4NSVA 1Z6JH 2AGEX 4AFSA 1G3DA 1O2TA 2ZO3H 1E36B 3SNBA 2AMQA 1H8HD 1P3EA 2FOMB 1O2XA 1GBTA 1ZPZA 3ITIA 3M3TA 1OWJA 2P93A 4YOJA 2BOKA 3A84A 2GJGA 2ZFSA 2GVFA 4FETA 9ESTA 1SGEE 2HLCA 1A5HA 1S0QA 2VIOA 4X2VA 1O37A 2FI4E 3PMBB 3A82A 4XRNA 3Q3YA 1O2MA 3F9HA 2BOHB 4ZMAH 4OM9A 2XNIA 2BXUH 2QN5T 3ELAH 2XW9A 1C2JA 1MTNB 2L74A 3SGAE 5KEDA 4MDSA 2ZPQA 1HAPH 1S6LA 1Y5AT 2VGCB 1JOUB 4TT3D 4E7NA 2GV7A 1GI6A 1Z7KA 1TB6H 1TX8A 4RKJB 5DP5A 3F6UH 4IS5A 4BTTB 3KYFA 4IGDA 3PO1C 4ZHMU 5C94A 4RI0A 1A61H 1W8BH 2J92A 2TGAA 3SV9A 1ZLRA 2QXIA 3PLPA 3RM2H 4INLA 1KY9A 3P8OA 5EW1H 3NXPA 1FJSA 1RIWC 1YLCA 3T25A 5DP9A 5SGAE 5DN6D 2SGQE 1IQFA 5CHBA 1T8LA 3GY4A 3T27A 4SGAE 4Y11E 1E34B 1RS0A 4MPWA 3VB4A 1GBBA 4YOGA 1A46H 2HVXA 4DIHH 3FAOA 3SI4H 1DX5M 1OWEA 2JH5D 4OS2A 1O2NA 4NZQA 2QY0B 3L6PA 1A0HB 4UFFH 1QRZA 2A2QH 4ZHAA 3U28C 1AWHB 1Z8RA 3MWIU 1NC6A 4X6NA 2CN0H 2F3CE 1TGTA 4X6OA 3UUZA 3WWFA 3ATLA 3RMMH 8ESTE 3S9AA 1O2PA 2GCTB 2WZQA 5C1UA 3V12A 5HKKD 2A7JA 5DJ7A 1BTYA 4FVBA 2F9UA 4Y79A 4X1NU 3NCLA 1KXBA 1AMHA 5EJZA 1H1BA 4Q63A 3BTFE 2RFKC 3DUXH 1HYLA 3MMGA 1N8OC 4CREA 4KP0A 1TRNA 5EIYA 3RXFA 4TWYA 7GCHG 2G4TA 3Q3KA 1S6FA 1UHBB 1SFQB 2PP6A 2F9OA 3DA9B 1GBMA 1SFIA 2QAAA 3LPRA 1QL7A 4H6TA 1P2KA 2BDGA 1NBME 1SQOA 4F55A 1YWUA 3RXQA 2SGFE 1FDPA 1QR3E 1EZQA 1C2LA 5T1VA 4YESB 3MH4A 3ZV8A 1Y3WA 4BAKB 3M5MA 3ZZ3A 3S9CA 3BEUA 2FOAA 3LDXH 2FTMA 3BIVH 3TNSA 1FY8E 2Y5HA 1LVMA 1GJ5H 1QRWA 3KEEA 1C5NH 4AZ2B 2GTBA 2BY7X 2AERH 1UVTH 3C1KA 1IQEA 3TGIE 1LMWB 3M3SA 3LH1A 2G55A 4X1SU 1GG6B 3DCLA 3AK5A 3TK6A 3SBKA 5FPSA 1ZHPA 4B76A 2H5DA 4IMZA 4GCHG 1CT4E 2G81E 5EXNA 1LHDH 3DFJA 4CH8B 1AN1E 4HTCH 2P3FH 3OSYA 8GCHG 5JBTA 1XVOA 1AWFH 1O3AA 1C5YB 2UUFB 2D2DA 1NFYA 4X6MA 5IYTA 1QNJA 3MHWU 1G2LA 1T8MA 3BTTE 2ZU3A 5F6MA 4I8JA 1KMHB 3A7ZA 1TONA 1V2MT 3VB6A 2CV3A 3TGJE 1GJ9B 1IQMA 1C5ZB 1LKBA 3A88A 2G00A 1BTZA 1RTFB 1DM4B 1TGSZ 1L1NA 2BD7A 1C2KA 2ZHFH 4FU8A 5FCRA 2FLRH 2ZF0H 2AEIH 3OAAD 1GHWH 3R3GB 2W7UA 5ETXA 3P8NA 4FUIA 4NCYA 1D6WA 1MTVA 4FUGA 4MPVA 3QN7A 1AKSB 4AN7A 3EGKH 4JK6A 1QGFA 2BDCA 1WQSA 4MLFB 4R0IA 3KCGH 3K9XB 3NKKA 5E0JA 2UUYA 3Q76A 3LGYA 2GZ9A 3RU4E 1LTOA 1ORFA 1V2OT 2B8OH 4MG3A 3RM0H 1GVZA 9LPRA 2OUAA 1QCPA 1MABB 3NPSA 1MUEB 4BAMB 2QF3A 4RSPA 1EJMA 3NZIA 1LCYA 1L4ZA 4Y6DA 2FOHA 1KXAA 1DLKB 4J1YA 2BXTH 3ZYEA 2AH4X 3PWCA 2ZCLP 1ACBE 1LQEA 3BG8A 1ZMJA 1A5IA 4WMFA 1BBRH 2OBQA 3GYMA 1IQKA 3IG6B 5I46H 1EZUC 1WBGB 2HNTC 1TAWA 5F8XA 3OE7D 3GY2A 2PV9B 3A8CA 1NPMA 4X2YA 1GVKB 5DSFA 3UNQA 1JIMA 1AFQC 3V7TA 4KKDA 2AS9A 1O31A 1DSTA 2ULLA 1W10U 1WSSH 1VGCC 5F8ZA 3TJNA 1V2NT 3IITA 3QDZB 3SJIA 2WV9A 1HGTH 3RXPA 2A7HA 4FUDA 1O3OA 1PFXC 1O3FA 1O2RA 3EDXB 3HKIB 4D76A 2VH6A 1Y3XA 5CDFE 3T28A 2QYIA 2XYAA 4FUEA 2OC8A 4YLUA 4LZ4B 1Z8IB 1V3XA 2FX6A 3MQKC 3TJVA 3RXTA 1W0KD 2C93B 4U2WA 2KAIB 5JBBS 3S69A 1O2KA 5HXFA 2BX3A 1SI5H 4ABGA 2XCNA 2IOTA 1UTKA 3RXRA 1GBCA 1CQQA 1DPOA 1ZOMA 2C90B 3FZDA 2A7CA 3GDSA 1ZSLA 3GCTG 5DG6A 2UWOA 4AGKA 2J98B 1MAYA 3LT3A 2WYJA 1Q31A 4CH2B 1GHBF 1C1MA 3SOSA 3B23B 1AIXH 1ANEA 1PPGE 2LPRA 4NIVA 3TU7H 1QHRB 1G30B 1A7SA 2F9PA 4ABIA 5C1XA 2PKAA 2OC7A 2BLQA 1MTNC 1O3GA 4WXIA 2A2XH 3PLKA 4DCDA 1GHZA 2TIOA 1QL9A 1MD8A 2VGCC 1P8VC 5F8TA 1UK2A 4XD7D 5A0AE 1BOQA 2AIPA 3MTYA 5CE1A 3UNSA 3BG4B 2UWLA 1AQ7A 2R2WU 1P01A 3H5CB 3OX7U 4YXWD 4A7IB 2RA3A 5BRRE 1UVSH 2BDBA 4OGYA 1NO9H 1GBIA 2ANKH 1SBWA 3BTGE 4Y0ZE 4CR9A 1CHOF 2B5TB 3HGNA 1QA0A 2ZECA 4ABEA 1HCGA 2W6JD 2I6QA 1G3EA 1O36A 2STBE 2VIQA 3AAUA 3MO3A 1T31A 5ESTE 2PUQH 5A09A 1GBFA 3RXCA 1YY3A 4Y8XA 1GI3A 2A31A 3VB3A 3W95A 4CBOA 5AF9H 3SZNA 1C1UH 2DE9A 4SGBE 5J4QA 4FUFA 2BVRH 4IC5A 1C4Y2 4Q2KA 1ZGVA 3P95A 2D26C 2FZZA 1CGJE 2ZFQH 1O30A 1ANBA 2VH0A 2CMYA 3F9EA 5LPRA 3KQ5A 3BEIB 1ELTA 1BA8B 1Y3VA 1O2ZA 3C27B 3DFLA 2J97A 2PWXA 5DP6A 1MQ5A 1GMCG 1VCPA 1QZ8A 4FUJA 1KDQA 1GVLA 4OS4A 1F5RA 3GY3A 1NRNH 1S82A 1VKYA 1XM1A 1GBDA 2ZP0H 3ZVBA 5JDUB 1BQYA 1HB0B 2GCTC 2GX4A 3RXVA 1CA0B 2V0BA 2ZFPH 3LH3A 1DWCH 4UFEH 3LGIA 2GDDA 3MNCA 1NN6A 1SGFA 4JCNA 4JZEH 1NU7B 2GT7A 4JZIA 4Y76A 3ZVCA 1MH0A 3M7UA 3A8DA 1BJVA 4I8KA 2Y7ZA 1KSNA 3SNDA 2HOBA 4JK5A 1MKWH 3SNAA 1BIOA 1ESBA 1PYTC 1C4U2 3KQDA 4K3JA 2A4QA 1TNHA 1A2CH 1BTWA 1TPOA 2SGPE 1EATA 5BPEA 1RD3B 4AFQA 2SNVA 1P02A 2FTLE 1AY6H 1TOMH 3FKSD 2ZFFH 2FOBA 4MNXA 4NG9H 1N6YA 2GMTB 1JIRA 2B0FA 2Y82A 3P70B 3QK1A 2PTNA 2O8UA 4KTSA 1GJCB 3F3BA 4ISOA 1DS2E 4XSKU 2CGAA 4B6FA 1GJDB 1V2KT 1XXFA 1OP0A 1DDJA 1BMFD 1DWEH 1TE0A 2XWBI 2Y5FA 3O8RA 1TNIA 2JH6D 3TK9A 3ZZ7A 5FCKA 1W7XH 1W2KH 1MU6B 5DO4H 2FI3E 4WMDA 1GG6C 2FLBH 1D4PB 4I7YH 1F92A 3BTKE 4RKOB 1HDTH 1H4WA 3MU8A 3I29A 1KLTA 1O5FH 1FY4A 2ZU5A 1AUJA 4NWLA 3UIRA 3BSQA 3VEQB 4ZKOU 3M37A 3VPKA 1NFXA 1T8OA 4E06H 1K2I1 1PJPA 1SR5C 2F4LA 2ZEBA 3M5OA 4THNH 5HGGA 5GJ4B 4I33A 3TK5A 2Y5GA 4Y71A 1C5LH 2OQ5A 5DP8A 2VBCA 2CJIA 4ABHA 2BHGA 2ZGHA 4BXWA 1YBWA 4WVPE 2WPJS 1UK4A 3GICB 3P17H 3U98H 5A2MH 2EEKA 1O2QA 3PLBA 3P92A 1ZPCA 1J17T 1U6QA 4D7FA 2J9NA 1SOZA 1QFKH 1K9OE 2BY9X 1K22H 2C3SA 1SB1H 2PSXA 1O3DA 2R9PA 3ATMA 3KF2A 2BQ6B 1Z8JB 5GCHG 3N7EA 1D3QB 2FESH 2EQNA 2KX4A 4YT6H 4FOUC 2WPKS 3K6ZA 3PYHA 3HPTB 2QA9E 2ESTE 4NZLA 1CGHA 4K8BA 3RXJA 3URCA 4JMYA 1HAYB 2ZGXH 1GWAA 4YOIA 1O2WA 4XDEA 1OWIA 2O9QA 3CENA 1Y5UT 1GMHF 4K69A 2YMSB 1LO6A 1UJ1A 2NU2E 3SUDA 1HNEE 2KR7A 1AZZA 1F0TA 3AVZA 4BAQB 3PTNA 1TBZH 4B2CA 1ELCA 2KCYA 1K1PA 3D65E 1G37A 1SMFE 1PQ5A 1TQ0B 1FZZA 1OP2A 3GCNA 5PTPA 4AORA 1SLWB 3S9BA 3U1JB 1YPMH 1H9HE 1C5RA 3PRBA 3FP8E 5C20A 1FN8A 1MMJN 3GYLB 3QTVH 2ZNKH 4AX9H 5F53A 2O8LA 1T4VH 2ZGJA 5GPIB 4B71A 4X1QU 2O8MA 2OLGA 5C17A 3UQVA 1XKAC 1OWKA 4NFFA 2FP7B 2WINI 1FAKH 5TJXA 1W13U 3GY5A 3LC3A 3GY6A 5LPFA 5DP7A 1TABE 2SGEE 1EPTB 1UCYH 3LONA 1QRXA 4UONA 2ZCHP 1QB9A 2PSYA 1FMGA 2OXSA 3UOPA 1D3DB 1XXDA 1PPFE 1XVMA 1YKTA 4A6LA 2JDID 1EAXA 3K2UA 3ESTA 4CR5A 1P04A 2XBXA 2TPIZ 3SI3H 1OKXA 1ELFA 1BT7A 1JBUH 1TOCB 3V13A 4Q7XA 4HZHA 4M7GA 2Z3EA 2W7SA 1BMLA 1KXDA 1ZTKA 5FPTA 2FS9A 3MU5A 1O5AB 2AFQB 2YMSD 1GJ7B 3ZVAA 3UR9A 2WPHS 5JB9S 3CS7A 3ZZ9A 1EJAA 5C0TA 3UR6A 2VIVA 3KYGA 1O32A 1OX1A 1QA7A 3LGVA 4UDWH 3RUOA 3QZQA 4Y7BA 1RGQA 2W6ID 3SORA 1GJBB 2FS8A 1BRBE 3UQOA 3SYJA 3RU4T 4XBBA 5G4BA 1UTNA 5K0HA 1TQ7B 2PUXB 1KYNA 1INCA 5T6GA 1P2MA 2GCHF 2A5AA 2J38A 1ARBA 1EFRD 1YPKH 2IJOB 1EXFA 2F9NA 3R0FA 3BV9B 3BTWE 1V2PT 2AMPA 3RXHA 1SGRE 3RC4A 3S7KB 1M9UA 1IQHA 5DGJA 3ZZAA 3A87A 1AI8H 1FXYA 4ZKNU 3A83A 1P0SH 5EPNA 4Z6AH 3GCHB 1GMDF 3A7XA 4BNRA 1SLXB 2XBYA 3QO6A 2K8IA 2WPIS 3ZZDA 3SV7A 1NBMD 3BG4C 1MKXH 2BD2A 2RG3A 1UO6A 1UVPA 1JWTA 1J14A 1RJXB 1NU9A 3MI4A 4IN1A 1SL3A 1BDAA 2JKHA 2HNTE 2JIZD 3CNRA 2OINA 5A0CA 3UWJH 3MO6A 3DT0H 3UFAA 1SHYA 1HJAC 2PLXA 3M7QA 1YLNA 5C5OA 4FUCA 4A92A 2WYGA 3JZ1B 3OFND 1GCTB 4B2AA 1OYTH 1Y5BT 3H09A 3TNTA 1NRSH 4D8NA 2SGAA 1S83A 1LVYA 3U8RH 2Y7XA 3RXOA 4JYVH 1SQAA 2QCYA 1ELDE 3LGWA 5AHGH 3O8CA 2G4UA 1WV7H 1O35A 2GT8A 3NK8A 5JYIA 2ZU4A 3LGUA 3PB1E 3SU4A 2BY8X 1O3JA 2J94A 3AW0A 5B6OA 3DD2H 5FBEA 2HPPH 1FY5A 4HG6A 1B0FA 2EA3A 3SUGA 4A1XA 2F83A 2PTCE 1OPHB 4MNWA 1ZR0A 1VCWA 1EOLA 1IQLA 2H9HA 1YM0A 1CA0C 2BM2A 1K1MA 2BB4A 5EJLA 3EE0B 3TLOA 3ZZBA 1EB1H 1GBAA 1W14U 1HLTH 2ANWA 1J8AA 1OYQA 3H7TA 1XMNB 2EI7A 2R2MB 1G3BA 1YCPH 4ABAA 1G36A 4X2WA 2VVVA 2Z3CA 3WW7A 1X7AC 2W5EA 4AB8A 1MBQA 3FZZA 2P59A 1ZRKA 5EQRA 1NZQH 3RU4D 3P8GA 1YP9A 3U8TH 1C2GA 2Z9LA 2GMTC 3U1IB 2QF0A 3M7TA 2ILNA 2QV1A 5EQQA 1HAHH 5T6DA 4JZ1A 2PGQB 5LPEA 1ESTA 1TRYA 4X8UH 1K1JA 2ODYB 3M5NA 6GCHF 3LJJA 2TBSA 4ZH8A 4GPGA 2ZHDA 1Z1IA 5A8XA 3L33A 5FBIA 2IJD1 2V3OH 8LPRA 3NRLA 1AGJA 2AGIX 2BYAX 2R3YA 2F9BH 1EZXC 1LQDB 3V0XA 1FN6A 3K6YA 4WMEA 3WWBA 1TWXB 3V3MA 4GCHF 5K7RA 3QZRA 4ABBA 1AE5A 2TGDA 1EKBB 3B8JA 1VR1H 1IHSH 2OC1A 1KLIH 2AMDA 2XBVA 1CU1A 1OXGA 3FP6E 4B74A 1GHYH 2W3KA 2A1DB 4YO9A 3RMLH 1SGCA 1B0EA 1H8ED 4K2YA 5EXLA 3TH3H 1VITF 4AFZA 1VZQH 2A4RA 3KQBA 4HI3A 1TGBA 1BZXE 4I8GA 2QC2A 5DP3A 2ZWLH 3UREA 2ZA5A 2QF5A 1C9PA 5DPAA 1FIZA 3BTHE 4NWKA 3FANA 3EAJA 1QB6A 2QGRA 3F2HA 3T26A 2ZG0H 1GJ4H 1WCZA 1AB9B 2FOEA 4DOQA 4NA8A 2XOKD 4IN2A 2UUKB 3CS0A 2RA0A 1HAGE 4ACAA 2XC4A 3E6PH 4VGCB 3BF6H 2YNAA 5C67A 1GI7B 5EODA 5E2PA 4TPIZ 1O3NA 3W94A 2DUCA 2BDIA 5FXLA 1YGCH 1NRRH 2NU0E 4GUXA 1SVPA 1GI9B 3KIDU 1GBLA 3P6ZB 2FDAA 2FYRA 3CP7A 3GY8A 5EU8A 3OY5U 1C1NA 1AVGH 2BZ6H 1KIGH 1C2IA 1C2EA 3BTQE 2Z3DA 3MU4A 4TY7A 5AVDA 3TH4H 4WXVA 3BTME 3TITA 3SU3A 3F0PA 1C5TA 4X0WU 4WY3A 5A8ZA 1EAIA 3A85A 3Q77A 3PM3A 3RXIA 1SSXA 1GHAF 1THRH 2DE8A 2CF8H 4TSFD 1GJAB 1P3CA 1TGNA 3ATIA 5CMXH 1WAYB 4ACBA 2ZQ2A 1C2FA 1OOKB 2UWPA 2P95A 2BQWB 1HXFH 3L3TA 2O8TA 2KAIA 2ZU2A 1P2IA 1F0UA 3VB7A 3FOAA 1AVWA 1BHXF 1PPBH 3UY9A 2LP6A 1C5UA 4UE7H 3ZZ4A 4ZAEA 2WUBA 4CRDA 2BZAA 1EPTC 1GHBG 1FY1A 1YCPM 1H9IE 3D62A 2LNCA 3RXMA 2J98A 4U32A 2BY5X 2J4IA 1QJ7B 3PMHB 1E37B 1QQUA 1W0JD 2EY4C 5IK2D 4DW2U 2OP9A 1ZTLA 1BUIA 1BTXA 1C1SA 3BN9A 1OWHA 1FX0B 3PV4A 1YF4A 2WHXA 1PQ7A 4MPXA 3BEFB 1O5GH 2BLVA 3MNBA 1NS3A 2TGTA 3RLWH 4TY6A 3EQ0H 3MH6A 4BAOB 2P8OB 2VIDA 4ZROA 2BVXH 1P2JA 4DVAU 1TA2A 1UVOA 4Z1MD 3SNEA 1AZ8A 1FV9A 1L0ZA 5KGOA 3SU1A 1MZAA 5EG4A 5EJ1A 1GDNA 1A0JA 2FO9A 3MFJA 1QJ6B 1ZSKA 1JMOH 3SHCH 1UTPA 4HGCA 2Q6DA 1UMAH 1V2ST 1QBVH 1T4UH 2Q6FA 4I86A 4MNVA 1ZYOA 3AW1A 3ODFA 4DGJA 1F5LA 3WY8A 1ESAA 1NROH 2XCFA 1J9CH 5FX6A 2ZKSA 3GCHC 4X8TH 2IPHA 1BMNH 1XX9A 3NWUA 5TCCA 4LZ1H 1W0YH 2YOLA 3EA9A 1D9IA 3AAVA 4UEHH 4KTUA 1DFPA 2M5TA 2AYWA 1TX6A 1LPGB 1RTKA 4U01A 1O2IA 3RXDA 4ISLA 2JH0D 5TCAA 1SLVB 1GI0A 1T32A 1MZDA 5DKMA 2ANYA 1ELVA 5FX5A 1AE8H 1BBRE 2Z7FE 3GISB 1COWD 1GBKA 1ZJDA 2G5NA 5L2YH 3N7DA 1HXEH 3MNXA 3K65B 4NSYA 3QX5H 1E1QD 2ODPA 3FVFB 5A8YA 4B75A 1O2OA 4Y8YA 1UW7A 1TBQH 3AASA 2FXRA 4ZXXH 3F2GA 1F0SA 1A1RA 1P12E 1TBRH 2VNTA 1GCTC 2OQUA 2NU3E 1TNGA 4GVUA 4B2BA 1LPZB 1FY3A 1O3PB 3T5FH 1FAXA 1N6XA 2QXJA 1O3LA 5GDSH 2BD4A 3QGNB 2ZDKA 3SU0A 2FIRH 1GMCF 1P9UA 1O0DH 4IBLH 1S81A 1ZGIA 4BXSA 5E0HA 1BBRK 2FYQA 2KM0A 2ZTXA 3UNRA 4O3TA 1YC0A 3E91A 4INKA 1UTLM 3HATH 4F4OC 1ZMNA 4DT7B 4GSOA 2LELA 5DP4A 1EZSC 3VXFH 5LGOA 4ZCNA 1O3EA 3KL6A 3TIUA 2ALVA 3HKJB 4AYYB 3PROA 5EGMA 5EQSA 1KTSB 1K0HA 3MU1A 2Q1JA 1T7CA 4ABDA 2I6SA 4TYDA 3FN8A 2BDYA 3OEHD 2L6OA 1HAVB 3N99A 1EJNA 2V3HH 1IHTH 3A89A 1V2QT 2Y80A 5C0UA 1UTJA 4A1TA 1O5BB 2JJ2D 5JB8S 3F0OA 4ABJA 2ANMH 1UTQA 1GJ8B 4TPYA 1FLEE 4K8YA 4AGJA 1Y8TA 2K1QA 1W0ZU 1V2WT 4UD9H 2ZC9H 4IC6A 1O38A 1SGIB 3TJUA 2BVSH 1SKYE 2Z94A 2AHME 3SU2A 1HIAA 5E8EH 2HALA 4BOHA 3M61U 3PMJA 4ISHH 3MH7A 4K60A 1TA6A 1V6DA 1NT1A 4FU9A 4FU7A 1GBJA 4ISNA 4X8SH 2FI5E 2ZU1A 2F91A 2A5KA 1ETRH 2V35A 1BB0B 1C2MA 1DWDH 5ESBA 3KGPA 2BDHA 2IPQX 1KLJH 1Z8GA 1JXPA 1GL1A 3RMOH 3QTOH 4R8TB 1BJUA 3GOVB 3LOXA 4JYUH 2Z6BD 2FOCA 2WUCA 4OS5A 3ZVEA 1LVOA 1GMHG 2ALPA 4XE4A 4D9QA 5HM2A 1UVUH 4Y8ZA 2KCAA 3MOCA 3RXKA 1EP5A 1SQTA 2H6MA 3VXEH 3D23A 4NFEA 1P2OA 2FODA 1GI2A 2AIQA 1ZHMA 2OC0A 4WJG2 4INHA 1IQJA 1UK3A 1SOTA 2F9VA 3OYPA 2XC5A 3QGJA 1O3HA 1BMMH 4P00A 2CHAB 3RDZA 1O2YA 4J2YB 3KNXA 1GBHA 3HK3B 5GCHF 1DVAH 1AB9C 3LJOA 3ODDA 5ABWA 3FFGA 3N7OA 2ZHQH 2YNBA 3BTDE 3ZZ8A 2A32A 4VGCC 1HAZB 3OTPA 2OTVA 1SHHB 2WPDD 3A8AA 2J95A 1O3IA 3E16B 1DITH 1EAWA 1O33A 3U69H 4X8VH 3RC6A 4CRBA 1CBWB 4AYVB 1MD7A 1MQ6A 1PPHE 3ATKA 3DSPA 3IWMA 1UTMA 4Y10E 2D8WA 1WQVH 2A0QB 1SGFG 1IQGA 1V2TT 3NUMA 1T8NA 2VVUA 4GAWA 1H8IH 3F9FA 2TRMA 4NIYA 3SJKA 1AFEH 4MTBA 1D3TB 2VB0A 3ZIAD 1C5WB 2BLWA 1TLDA 2V6NA 1K1NA 1S6HA 3Q00A 2EI8A 1C1WH 5AFZH 3QWCH 3P8FA 4Q7ZA 5C2ZA 1V2JT 2VIPA 2VJ1A 1SGDE 2ZPSA 3B9FH 2Z9GA 2XWAA 3M5LA 1CE5A 1UTOA 2GD4B 2P94A 4O03A 1GI8B 2ZHEH 1DUEA 4I31A 2HWLB 3W1EA 4HFPB 1NY22 4NA9H 4CHAB 3TGKE 3LC5A 3MH5A 3M36A 5JBAS 1AD8H 1D6RA 2GZ7A 2BDAA 4I8LA 1MKWK 2BD9A 1XUHA 1ABJH 2VWOA 2XRCA 3A7TA 3STJA 3SV8A 4QT8C 4H42U 4IW4E 2H1UA 3E0NB 2GCHG 1GHXH 4ABFA 2ZIQH 3A80A 1IAUA 1Q2WA 4K1SA 6LPRA 5CHAB 4Q7YA 1ARCA 1DLEA 1DY8A 1HAIH 1NTPA 2VVCA 3RXSA 1CA8B 2QXGA 4XBDA 3LGTA 4MVNA 3S0NA 5FPYA 1QBOA 4I8HA 1ZRBA 5GIBA 1LDTT 4F49A 2JETB 4E7RG 4AG2A 1S85A 3TH2H 1SLUB 1VITH 1GMDG 2R0KA 1GDUA 1A0LA 2RDLA 1O34A 3TPIZ 4CRGA 2GDEH 3DSGA 5KECA 1ZSJA 3FP7E 3SUEA 2ASUB 4B6EA 4WF8A 2ZHWH 2A45B 2PGBB 1NFUA 3PMAB 3F9GA 3TVJB 3F2FA 3ZVFA 4ISIH 4YTAA 2FX4A 2G5VA 3SJ8A 3VB5A 1KXEA 2VWLA 2J2UA 3RXGA 2ODQA 1G9IE 1WYKA 2P16A 2P8OC 5I25A 1V2LT 5C5NA 1G3CA 1HFDA 5L30H 1QURH 3Q3XA 2H9TH 1BTPA 3M3VA 2FM2A 1P03A 1TMTH 2HRVA 2ZDNA 3SJ9A 1BRAA 3SZEA 4DJZB 1C5MD 1DT2A 3EYDA 3F1SB 1E0FD 1IQIA 1EOJA 1FQ3A 1GBEA 2W3IA 3URDA 3SQEE 2ZDLA 1QB1A 2TGPZ 4Q4LA 3E90B 4WWYA 2NWNA 1C1RA 1P2NA 1BMAA 1XUKA 2GP9B 5H4IB 1UHBA 2CXVA 3ZZ6A 2F43B 5A0BA 1PQ8A 1RTLA 2Z9IA 1Y3YA 2HNTF 1LHEH 2KCPA 1S5SA 2PKSB 1FIWA 2K0QA 4YLQH 1O2HA 1KXFA 4NGAH 1DICA 1FUJA 1Z1JA 1TIOA 3RXEA 1YPEH 2ZDVH 1J15A 4MPUA 7LPRA 1FI8A 2P3UB 2CF9H 2STAE 1GPZA 4BAHB 1TNLA 4LOYH 1IQNA 1C5PA 3I77A 3OEED 7GCHF 1YPHC 1BHXB 1UCYE 3DHKH 2GKVE 3PWBA 2SFAA 1BITA 1YPGH 2BMGB 4ZUHA 1HBTH 3STIA 1K1OA 1PPZA 1HAXB 3KQEA 1THPB 2XXLA 4XOJA 2G52A 1P06A 1NFWA 1DOJA 1GI4A 3SJOA 1MU8B 3SUFA 1TRMA 4YT7H 1P57B 1JRSA 1V2UT 4K1TA 6GCHG 1C9TA 4TWWA 4K5ZA 1W11U 1GGDB 1UCYK 1P9SA 1SGYE 6CHAB 2GV6A 5HIZA 1PPCE 5EW2H 1CHGA 2VINA 4AOQA 1S0RA 4Q80A 4B73A 1OHHD 2R3UA 2BY6X 6ESTA 1L4DA 3T2NA 1VCQA 1WTGH 3A86A 1TFXA 1O39A 2ZTZA 1C1TA 4Z0KA 1C2HA 3VGCB 1ANCA 1O5EH 1LHCH 4AC9A 1AKSA 1VITG 2WV4A 2ZTYA 4NIWA 3ZVDA 8GCHF 2BX4A 1ANDA 1RRKA 1XUFA 2FEQH 1PYTD 2SGDE 5JBCS 1HPGA 5EPYA 1MTWA 3ENSB 1GCDA 4XFQA 4CRAA 2ZDMA 1FNIA 1LKAA 1RXPA 5F03A 1GL0E 3RP2A 1N1LA 2KZ4A 3O8DA 3VFEA 1SGPE 3UOUA 5HM9A 3A7YA 3QLPH 4E05H 2B7DH 1A3EH 1SC8U 1Y3UA 3GY7A 2QE7D 5AFYH 3UPEA 4OS7A 3LU9B 2M2AA 1HJ9A 4YZUA 4XBCA 1B7XB 3LKWA 1J16A 5IDKA 1WOFA 1A4WH 2ZFTA 2GZ8A 1Y59T 4MNYA 2XBWA 1CO7E 1RFNA 1A3BH 2NU1E 1K28D 2EC9H 5L2ZH 1MKXK 2YMSC 5FL7D 2Q6GA 4OGXA 3H7OA 3PV5A 1C1PA 2PW8H 2KCOA 4KTCA 4X6PA 1W12U 4A5TS 2OD3B 1ELGA 2AGGX 2OCVB 2CHAC 1L1GA 1SGNE 1G32B 1DE7H 2HLDD 4GHTA 8KME2 1GHAG 1BRUP 4OS1A 1TX7A 1SGTA 2VIWA 3E1XB 1HAOH 4DT4A 2ZCKP 4GHQA 3RC5A 5JPMH 1P09A 1SGQE 1DWBH 1F5KU 3SN8A 4ZKRU 3JZ2B 1EB2A 1DXPA 1Z6EA 4O97A 1C2DA 1GDQA 2ZI2H 1CBWC 1MCTA 3SGBE 1VJAU 5E0GA 3U8OH 4CBNA 1A5GH 4ASUD 4JYTA 1TMBH 4X1PU 2EI6A 1QY6A 3MNSA 3TJOA 3HK6B 1GHVH 1C5XB 3RXBA 1QL8A 2VWMA 1BCUH 4FUHA 1MAXA 2BQ7B 2J5UA 1CGIE 1K1IA 1GI1A 1NRQH 2BD3A 1ABIH 3PO1B 3SV6A 1SQRA 3SQHE 1XUJA 4DY7B 4F48B 5FAHA 2ZGCA 1DY9A 1ZTJA 2V3MA 5J4SA 3SO3A 1OS8A 1WXRA 7ESTE 3SGQE 2H9EH 1ZZZA 4A1VA 1RIWB 1W7GH 1YYY1 2C8XB 1LHFH 4CHAC 2J34A 1TNKA 1AU8A 4PROA 1YCPK 3GCTF 4M9FA 1PPEE 1AO5A 1CHOG 1G2MA 4Y0YE 3ZV9A 5B6LA 3D49H 2V7QD 1GI5A 3BIUH 1TPSA 4ESTE 1AVXA 1K21H 4BANB 2PKAB 2ZQ1A 1CSOE 2BTCE 2NU4E 1AUTC 1TYNA 4FVDA 5CHAC 1O3MA 1O5DH 5HYOA 2H5CA 3DSOA 1IOEA 1E79D 4K1EA 1B5GH 4CRCA 3ZYDA 3VG8A 2JETC 2R0LA 1CT0E 3GDVA 2XNDD 1WUNH 3RMNH 1E35B 1ETSH 1O2JA 1ID5H 2CK3D 2A5IA 3RXAA 1HUTH 1MTUA 1P2QA 3PV2A 1S84A 4WH8A 3U9AH 2HVYB 1MBMA 3HGPA 2WV5A 4DURA 1HRTH 2FMJA 1O3KA 4NIXA 1HJAB 4LXBH 1JRTA 1EP6A 4GLYA 1HJ8A 3OTJE 1P11E 1CVWH 3OY6U 3RXLA 1TNJA 2Y81A 1N8OB 1ZPBA 1E38B 2PFEA 3A8BA 4UFDH 3RLYH 1ZJKA 3A7WA 1O2SA 2XC0A 4AB9A 2A4OA 1L1JA 3G01A 4I32A 4DIIH 3EA8A 2SNWA 2OK5A 4FUBA 2HGTH 1C4V2 3ZZ5A 1QQ4A 1KDQB 2ZDAH 5HIYA 1MTSA 1QIXB 3I78A 2H2ZA 1TPAE 3MYWA 1F2SE 3A7VA 4U30A 1DSUA 2D1JA 4CRFA 2VU8E 2PKSC 3T29A 1LVBA 1LPKB 1KTTB 5C3NA 1ELAA 1QTFA 1WU1A 1D3PB 1H8DH 1P05A 7KMEH 3QUMP 4MQAA 1C1VH 4O9VA 2IN2A 4RT1A 3SNCA 4ZKSU 1HV7A 1SPJA 2G51A 3SV2H 1YLDA 1EUFA 1TGCA 4D7GA 2BLOA 1C1QA 1AHTH 1V2VT 1EAUA 2WPLS 2FOFA 1F7ZA 2QXHA 5HMAA 2UUJB 4RN6A 5LH8A 5GXPA 2GGVB 4AFUA 2VWNA 1THSH 3E3TA 1C5OH 1HAVA 3UWIA 3GCOA 2ZGBH 4RT0A 2Z9JA 1FONA 1EQ9A 4KGAA 2OBOA 2FPZA 1O2LA 1WTHD 4BTIB 4O3UA 1P10A 2FWWA 2ZPRA 4WH6A 3MO9A 1FPCH 4FXGH 1BTUA 1K1LA 3T62A 3ATWA 2C4FH 1OP8A 1O2VA 3UTUH 1PQAA 4IMQA 1BTHH 2ZZUH 2RDEA 3SHAH 1H9LB 4BTUB 3EA7A 2G8TA 1XUGA 3KQCA 1GGDC 1TALA 2BD5A 1QBNA 6CHAC 4KELA 1FPHH 1O3CA 1O5CB 5L6NH
chains in the Genus database with same CATH topology
1DXWA 1C5QA 1DANH 1LHGH 1TPPA 4ZXYH 5DK1A 4H4FA 4AG1A 1L2EA 2QIQA 4X1RU 3E0PB 1KXCA 5EXMA 1NRPH 1GJ6A 3KN2A 3SU5A 1HIAB 1MCVA 5GWZA 1CT2E 1EX3A 3VGCC 4JZFH 3ZZCA 2O8WA 4UFGH 4ZHLU 3F68H 1C5VA 3GDUA 3SU6A 1OSSA 2W26A 1O2UA 4JZDH 3KHVA 4D9RA 1EASA 1NESE 2Y6TA 2PHBA 2XTTB 1QJ1B 2C8WB 5FHTA 4YM9A 2B9LA 3OU0A 4NA7A 2WPMS 4OS6A 1W3CA 1VJ9U 1XUIA 5E2OA 3LIWA 4DG4A 2RCEA 4Y7AA 5T3HA 1V2RT 2C8YB 1C1OA 1SG8B 1YPLH 3PTBA 1TMUH 1O2GH 4X2XA 1BRCE 1Q3XA 3RXUA 1XKBC 3MU0A 1DUAA 2C8ZB 1ELBA 3BTEE 3O8BA 1ZMLA 5C1YA 1ELEE 1ZHRA 2HPQH 5T6FA 1AFQB 1F0RA 2PR3A 1YPJH 1YPHE 2THFB 3E8LA 4ASHA 2ZFRH 1C5SA 1VGCB 2Z9KA 4H6SB 1OWDA 5EOKA 1Z71A 3ZVGA 3S7HB 1NM6A 3A81A 1ETTH 1O3BA 4LK4A 2FOGA 4B1TA 1EPTA 3M35A 2BD8A 2A4GA 3SW2B 2P3TB 4NSVA 1Z6JH 2AGEX 4AFSA 1G3DA 1O2TA 2ZO3H 1E36B 3SNBA 2AMQA 1P3EA 2FOMB 1O2XA 1GBTA 1ZPZA 3ITIA 3M3TA 1OWJA 2P93A 4YOJA 2BOKA 3A84A 2ZFSA 2GVFA 9ESTA 1SGEE 2HLCA 1A5HA 1S0QA 2VIOA 4X2VA 1O37A 2FI4E 3PMBB 3A82A 3Q3YA 1O2MA 3F9HA 2BOHB 4ZMAH 2XNIA 2BXUH 2QN5T 3ELAH 2XW9A 1C2JA 1MTNB 3SGAE 4MDSA 2ZPQA 1HAPH 1Y5AT 2VGCB 1JOUB 4E7NA 2GV7A 1GI6A 1Z7KA 1TB6H 1TX8A 4RKJB 5DP5A 3F6UH 4IS5A 4BTTB 4IGDA 3PO1C 4ZHMU 1A61H 1W8BH 2J92A 2TGAA 3SV9A 1ZLRA 2QXIA 3PLPA 3RM2H 4INLA 1KY9A 3P8OA 5EW1H 3NXPA 1FJSA 1RIWC 1YLCA 3T25A 5DP9A 5SGAE 2SGQE 1IQFA 1T8LA 3GY4A 3T27A 4SGAE 4Y11E 1E34B 1RS0A 4MPWA 3VB4A 1GBBA 4YOGA 1A46H 2HVXA 4DIHH 3FAOA 3SI4H 1DX5M 1OWEA 2JH5D 4OS2A 1O2NA 4NZQA 2QY0B 3L6PA 1A0HB 4UFFH 1QRZA 2A2QH 4ZHAA 1AWHB 1Z8RA 3MWIU 1NC6A 4X6NA 2CN0H 2F3CE 1TGTA 4X6OA 3UUZA 3ATLA 3RMMH 8ESTE 3S9AA 1O2PA 2GCTB 5C1UA 3V12A 2A7JA 5DJ7A 1BTYA 4FVBA 2F9UA 4Y79A 4X1NU 3NCLA 1KXBA 1AMHA 1H1BA 3BTFE 3DUXH 1HYLA 3MMGA 1N8OC 4CREA 4KP0A 1TRNA 3RXFA 4TWYA 7GCHG 2G4TA 3Q3KA 1S6FA 1UHBB 1SFQB 2F9OA 3DA9B 1GBMA 1SFIA 2QAAA 3LPRA 1QL7A 4H6TA 1P2KA 2BDGA 1SQOA 3RXQA 2SGFE 1FDPA 1QR3E 1EZQA 1C2LA 4YESB 3MH4A 3ZV8A 1Y3WA 4BAKB 3M5MA 3ZZ3A 3S9CA 3BEUA 2FOAA 3LDXH 2FTMA 3BIVH 3TNSA 1FY8E 2Y5HA 1LVMA 1GJ5H 1QRWA 3KEEA 1C5NH 4AZ2B 2GTBA 2BY7X 2AERH 1UVTH 3C1KA 1IQEA 3TGIE 1LMWB 3M3SA 3LH1A 2G55A 4X1SU 1GG6B 3TK6A 3SBKA 5FPSA 1ZHPA 4B76A 2H5DA 4IMZA 4GCHG 1CT4E 2G81E 5EXNA 1LHDH 3DFJA 4CH8B 1AN1E 4HTCH 2P3FH 3OSYA 8GCHG 5JBTA 1XVOA 1AWFH 1O3AA 1C5YB 2UUFB 2D2DA 1NFYA 4X6MA 5IYTA 1QNJA 3MHWU 1G2LA 1T8MA 3BTTE 2ZU3A 5F6MA 4I8JA 3A7ZA 1TONA 1V2MT 3VB6A 2CV3A 3TGJE 1GJ9B 1IQMA 1C5ZB 1LKBA 3A88A 2G00A 1BTZA 1RTFB 1DM4B 1TGSZ 1L1NA 2BD7A 1C2KA 2ZHFH 4FU8A 5FCRA 2FLRH 2ZF0H 2AEIH 3R3GB 1GHWH 2W7UA 5ETXA 3P8NA 4FUIA 4NCYA 1D6WA 1MTVA 4FUGA 4MPVA 3QN7A 1AKSB 4AN7A 3EGKH 4JK6A 1QGFA 2BDCA 1WQSA 4MLFB 4R0IA 3KCGH 3K9XB 3NKKA 5E0JA 2UUYA 3Q76A 3LGYA 2GZ9A 3RU4E 1LTOA 1ORFA 1V2OT 2B8OH 4MG3A 3RM0H 1GVZA 9LPRA 2OUAA 1QCPA 3NPSA 1MUEB 4BAMB 2QF3A 4RSPA 1EJMA 3NZIA 1LCYA 1L4ZA 4Y6DA 2FOHA 1KXAA 1DLKB 4J1YA 2BXTH 3ZYEA 2AH4X 3PWCA 2ZCLP 1ACBE 1LQEA 3BG8A 1ZMJA 1A5IA 4WMFA 1BBRH 2OBQA 3GYMA 1IQKA 3IG6B 5I46H 1EZUC 1WBGB 2HNTC 1TAWA 5F8XA 3GY2A 2PV9B 3A8CA 1NPMA 4X2YA 1GVKB 3UNQA 1JIMA 1AFQC 3V7TA 4KKDA 2AS9A 1O31A 1DSTA 2ULLA 1W10U 1WSSH 1VGCC 5F8ZA 3TJNA 1V2NT 3IITA 3QDZB 3SJIA 1HGTH 3RXPA 2A7HA 4FUDA 1O3OA 1PFXC 1O3FA 1O2RA 3EDXB 3HKIB 4D76A 2VH6A 1Y3XA 3T28A 2QYIA 2XYAA 4FUEA 2OC8A 4YLUA 4LZ4B 1Z8IB 1V3XA 2FX6A 3TJVA 3RXTA 2C93B 4U2WA 2KAIB 5JBBS 3S69A 1O2KA 5HXFA 2BX3A 1SI5H 4ABGA 2XCNA 2IOTA 1UTKA 3RXRA 1GBCA 1CQQA 1DPOA 1ZOMA 2C90B 3FZDA 2A7CA 3GDSA 1ZSLA 3GCTG 5DG6A 2UWOA 4AGKA 1MAYA 3LT3A 2WYJA 1Q31A 4CH2B 1GHBF 1C1MA 3SOSA 3B23B 1AIXH 1ANEA 1PPGE 2LPRA 4NIVA 3TU7H 1QHRB 1G30B 1A7SA 2F9PA 4ABIA 5C1XA 2PKAA 2OC7A 2BLQA 1MTNC 1O3GA 4WXIA 2A2XH 3PLKA 4DCDA 1GHZA 2TIOA 1QL9A 1MD8A 2VGCC 1P8VC 5F8TA 1UK2A 5A0AE 1BOQA 2AIPA 3MTYA 5CE1A 3UNSA 3BG4B 2UWLA 1AQ7A 2R2WU 1P01A 3H5CB 3OX7U 4A7IB 2RA3A 5BRRE 1UVSH 2BDBA 4OGYA 1NO9H 1GBIA 2ANKH 1SBWA 3BTGE 4Y0ZE 4CR9A 1CHOF 2B5TB 3HGNA 1QA0A 2ZECA 4ABEA 1HCGA 2I6QA 1G3EA 1O36A 2STBE 2VIQA 3AAUA 3MO3A 1T31A 5ESTE 2PUQH 5A09A 1GBFA 3RXCA 4Y8XA 1GI3A 2A31A 3VB3A 3W95A 4CBOA 5AF9H 3SZNA 1C1UH 2DE9A 4SGBE 5J4QA 4FUFA 2BVRH 4IC5A 1C4Y2 4Q2KA 1ZGVA 3P95A 2D26C 2FZZA 1CGJE 2ZFQH 1O30A 1ANBA 2VH0A 2CMYA 3F9EA 5LPRA 3BEIB 1ELTA 1BA8B 1Y3VA 1O2ZA 3C27B 3DFLA 2PWXA 5DP6A 1MQ5A 1GMCG 1VCPA 4FUJA 1KDQA 1GVLA 4OS4A 1F5RA 3GY3A 1NRNH 1S82A 1XM1A 1GBDA 2ZP0H 3ZVBA 5JDUB 1BQYA 1HB0B 2GCTC 2GX4A 3RXVA 1CA0B 2V0BA 2ZFPH 3LH3A 1DWCH 4UFEH 3LGIA 2GDDA 3MNCA 1NN6A 1SGFA 4JCNA 4JZEH 1NU7B 2GT7A 4JZIA 4Y76A 3ZVCA 1MH0A 3M7UA 3A8DA 1BJVA 4I8KA 2Y7ZA 1KSNA 3SNDA 2HOBA 4JK5A 1MKWH 3SNAA 1BIOA 1ESBA 1PYTC 1C4U2 3KQDA 4K3JA 2A4QA 1TNHA 1A2CH 1BTWA 1TPOA 2SGPE 1EATA 5BPEA 1RD3B 4AFQA 2SNVA 1P02A 2FTLE 1AY6H 1TOMH 2ZFFH 2FOBA 4MNXA 4NG9H 1N6YA 2GMTB 1JIRA 2B0FA 2Y82A 3P70B 3QK1A 2PTNA 2O8UA 4KTSA 1GJCB 4ISOA 1DS2E 4XSKU 2CGAA 1GJDB 1V2KT 1XXFA 1OP0A 1DDJA 1TE0A 1DWEH 2XWBI 2Y5FA 3O8RA 1TNIA 2JH6D 3TK9A 3ZZ7A 5FCKA 1W7XH 1W2KH 1MU6B 5DO4H 2FI3E 4WMDA 1GG6C 2FLBH 1D4PB 4I7YH 1F92A 3BTKE 4RKOB 1HDTH 1H4WA 3MU8A 3I29A 1KLTA 1O5FH 1FY4A 2ZU5A 1AUJA 4NWLA 3UIRA 3BSQA 3VEQB 4ZKOU 3M37A 3VPKA 1NFXA 1T8OA 4E06H 1K2I1 1PJPA 1SR5C 2ZEBA 3M5OA 4THNH 5HGGA 5GJ4B 4I33A 3TK5A 2Y5GA 4Y71A 1C5LH 2OQ5A 5DP8A 2CJIA 4ABHA 2BHGA 2ZGHA 4BXWA 1YBWA 4WVPE 2WPJS 1UK4A 3GICB 3P17H 3U98H 5A2MH 2EEKA 1O2QA 3PLBA 3P92A 1ZPCA 1J17T 1U6QA 4D7FA 2J9NA 1SOZA 1QFKH 1K9OE 2BY9X 1K22H 2C3SA 1SB1H 2PSXA 1O3DA 2R9PA 3ATMA 3KF2A 2BQ6B 1Z8JB 5GCHG 1D3QB 2FESH 4YT6H 2WPKS 3K6ZA 3PYHA 3HPTB 2QA9E 2ESTE 4NZLA 1CGHA 4K8BA 3RXJA 3URCA 4JMYA 1HAYB 2ZGXH 1GWAA 4YOIA 1O2WA 4XDEA 1OWIA 2O9QA 3CENA 1Y5UT 1GMHF 4K69A 1LO6A 1UJ1A 2NU2E 3SUDA 1HNEE 1AZZA 1F0TA 3AVZA 4BAQB 3PTNA 1TBZH 4B2CA 1ELCA 3D65E 1K1PA 1G37A 1SMFE 1PQ5A 1TQ0B 1FZZA 1OP2A 3GCNA 5PTPA 4AORA 1SLWB 3S9BA 3U1JB 1YPMH 1H9HE 1C5RA 3FP8E 5C20A 1FN8A 1MMJN 3GYLB 3QTVH 2ZNKH 4AX9H 2O8LA 1T4VH 2ZGJA 5GPIB 4B71A 4X1QU 2O8MA 2OLGA 3UQVA 1XKAC 1OWKA 4NFFA 2FP7B 2WINI 1FAKH 5TJXA 1W13U 3GY5A 3LC3A 3GY6A 5LPFA 5DP7A 1TABE 2SGEE 1EPTB 1UCYH 3LONA 1QRXA 4UONA 2ZCHP 1QB9A 2PSYA 1FMGA 2OXSA 3UOPA 1D3DB 1XXDA 1PPFE 1XVMA 1YKTA 4A6LA 1EAXA 3K2UA 3ESTA 4CR5A 1P04A 2XBXA 2TPIZ 3SI3H 1OKXA 1ELFA 1BT7A 1JBUH 1TOCB 3V13A 4Q7XA 4HZHA 4M7GA 2Z3EA 2W7SA 1BMLA 1KXDA 1ZTKA 5FPTA 2FS9A 3MU5A 1O5AB 2AFQB 1GJ7B 3ZVAA 3UR9A 2WPHS 5JB9S 3CS7A 3ZZ9A 1EJAA 3UR6A 2VIVA 1O32A 1OX1A 1QA7A 3LGVA 4UDWH 3RUOA 3QZQA 4Y7BA 1RGQA 3SORA 1GJBB 2FS8A 1BRBE 3UQOA 3RU4T 4XBBA 5G4BA 1UTNA 5K0HA 1TQ7B 2PUXB 1KYNA 1INCA 5T6GA 1P2MA 2GCHF 2A5AA 2J38A 1ARBA 1YPKH 2IJOB 1EXFA 2F9NA 3R0FA 3BV9B 3BTWE 1V2PT 2AMPA 3RXHA 1SGRE 3RC4A 3S7KB 1M9UA 1IQHA 5DGJA 3ZZAA 3A87A 1AI8H 1FXYA 4ZKNU 3A83A 1P0SH 5EPNA 4Z6AH 3GCHB 1GMDF 3A7XA 4BNRA 1SLXB 2XBYA 3QO6A 2WPIS 3ZZDA 3SV7A 3BG4C 1MKXH 2BD2A 2RG3A 1UO6A 1UVPA 1JWTA 1J14A 1RJXB 1NU9A 3MI4A 4IN1A 1SL3A 1BDAA 2JKHA 2HNTE 2OINA 5A0CA 3UWJH 3MO6A 3DT0H 3UFAA 1SHYA 1HJAC 2PLXA 3M7QA 5C5OA 4FUCA 4A92A 2WYGA 3JZ1B 1GCTB 4B2AA 1OYTH 1Y5BT 3TNTA 1NRSH 4D8NA 2SGAA 1S83A 1LVYA 3U8RH 2Y7XA 3RXOA 4JYVH 1SQAA 2QCYA 1ELDE 3LGWA 5AHGH 3O8CA 2G4UA 1WV7H 1O35A 2GT8A 3NK8A 5JYIA 2ZU4A 3LGUA 3PB1E 3SU4A 2BY8X 1O3JA 2J94A 3AW0A 5B6OA 3DD2H 5FBEA 2HPPH 1FY5A 1B0FA 2EA3A 3SUGA 4A1XA 2F83A 2PTCE 1OPHB 4MNWA 1ZR0A 1VCWA 1EOLA 1IQLA 2H9HA 1YM0A 1CA0C 2BM2A 1K1MA 2BB4A 3TLOA 3EE0B 3ZZBA 1EB1H 1GBAA 1W14U 1HLTH 2ANWA 1J8AA 1OYQA 3H7TA 1XMNB 2EI7A 2R2MB 1G3BA 1YCPH 4ABAA 1G36A 4X2WA 2VVVA 2Z3CA 1X7AC 2W5EA 4AB8A 1MBQA 3FZZA 2P59A 1ZRKA 5EQRA 1NZQH 3RU4D 3P8GA 1YP9A 3U8TH 1C2GA 2Z9LA 2GMTC 3U1IB 2QF0A 3M7TA 2ILNA 2QV1A 5EQQA 1HAHH 5T6DA 4JZ1A 2PGQB 5LPEA 1ESTA 1TRYA 4X8UH 1K1JA 2ODYB 3M5NA 6GCHF 3LJJA 2TBSA 4ZH8A 4GPGA 2ZHDA 1Z1IA 5A8XA 3L33A 5FBIA 2V3OH 8LPRA 1AGJA 2AGIX 2BYAX 2R3YA 2F9BH 1EZXC 1LQDB 3V0XA 1FN6A 3K6YA 4WMEA 1TWXB 3V3MA 4GCHF 5K7RA 3QZRA 4ABBA 1AE5A 2TGDA 1EKBB 3B8JA 1VR1H 1IHSH 2OC1A 1KLIH 2AMDA 2XBVA 1CU1A 1OXGA