4UOOA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
415
structure length
414
Chain Sequence
VTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOTEICHOIC ACID SYNTHASE
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
total genus 149
structure length 414
sequence length 415
chains with identical sequence B, C, D, E
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uooA02
2IUCB 1ZEDA 1O99A 3NKPA 5LQQA 4LRDA 1ELXA 3CMRA 2GLQA 1AJAA 2X98A 4QAXA 4KAYA 1O98A 3M8YA 1EW9A 4FDIA 3BDGA 3WBHA 5IJQA 1EW8A 5TJ3A 1URAA 4UOOA 4ZG6A 2XR9A 1KH7A 3M8ZA 4KAVA 4CXKA 3M7VA 3T02A 2GSUA 3BDFA 5K4PA 4UPKA 1SHNA 3UN3A 3UN5A 3UNYA 5LIAA 2VQRA 1EJJA 5EGHA 3NKOA 1KHJA 1KHNA 5AJ9A 1ALKA 5L0EA 4LRFA 1URBA 2XRGA 4KJGA 1ALIA 1AJBA 2W5XA 3IGYB 2W5WA 5C66A 1KH9A 3IDDA 4UPLA 4MIVA 1KH5A 2ANHA 4UPIA 3TWZA 4LR7A 1P49A 1E1ZP 4GTXA 4CYSA 1E33P 1HQAA 5INHA 2G9YA 1KH4A 3B5QA 4LREA 5DLWA 4UORA 2W5VA 3M8WA 4UPHA 2RH6A 4LRCA 4B56A 2W8SA 1N2KA 3IGZB 2GSOA 5L0BA 3NKQA 1KHLA 4FDJA 3NKRA 3MK2A 2D1GA 5GOVA 4MY4A 1EW2A 1Y6VA 3BDGB 1ELZA 4KJDA 1AJDA 4NWXA 1ZEBA 5DLTA 3MK1A 3UO0A 3LXQA 4GTWA 4CXUA 2ZKTA 3T01A 1ED8A 5LRNA 1ANJA 1E2SP 5HRTA 5DLVA 1FSUA 2GSNA 5IJSA 3WAVA 4CYRA 3WAYA 4KM4A 2IUCA 4LR2A 3WAXA 5GRRA 1Y7AA 1KHKA 4CXSA 3TG0A 1B8JA 5L0KA 3NKNA 4UOPA 2W8DA 2QZUA 1AJCA 1ANIA 1ELYA 3NKMA 1ED9A 1HJKA 4N7TA 5LRMA 3T00A 3A52A 3DPCA 4ZG7A 4GTYA 1HDHA 2W5SA 4LR8A 1EI6A 4ZGAA 3SZYA 4TN0A 2IFYA 2W5TA 3UN2A 2W5RA 3TX0A 3OT9A 3SZZA 4LR9A 1ZEFA 3MK0A 3DYCA 1SHQA 3Q3QA 3WAWA 3KD8A 3NVLA 2W5QA 1EQJA 1ALHA 5EGEA 5KXAA 4LQYA 1N2LA 3E2DA 4LRAA 4NWJA 4LRBA 4ZG9A 1ALJA 4MHXA 4YR1A 1K7HA 1E3CP 3BDHA 2GA3A 1AUKA 3ED4A 4GTZA
chains in the Genus database with same CATH superfamily
2IUCB 1ZEDA 1O99A 3NKPA 5LQQA 4LRDA 1ELXA 3CMRA 2GLQA 1AJAA 2X98A 4QAXA 4KAYA 1O98A 3M8YA 1EW9A 4FDIA 3BDGA 3WBHA 5IJQA 1EW8A 5TJ3A 1URAA 4UOOA 4ZG6A 2XR9A 1KH7A 3M8ZA 4KAVA 4CXKA 3M7VA 3T02A 2GSUA 3BDFA 5K4PA 4UPKA 1SHNA 3UN3A 3UN5A 3UNYA 5LIAA 2VQRA 1EJJA 5EGHA 3NKOA 1KHJA 1KHNA 5AJ9A 1ALKA 5L0EA 4LRFA 1URBA 2XRGA 4KJGA 1ALIA 1AJBA 2W5XA 3IGYB 2W5WA 5C66A 1KH9A 3IDDA 4UPLA 4MIVA 1KH5A 2ANHA 4UPIA 3TWZA 4LR7A 1P49A 1E1ZP 4GTXA 4CYSA 1E33P 1HQAA 5INHA 2G9YA 1KH4A 3B5QA 4LREA 5DLWA 4UORA 2W5VA 3M8WA 4UPHA 2RH6A 4LRCA 4B56A 2W8SA 1N2KA 3IGZB 2GSOA 5L0BA 3NKQA 1KHLA 4FDJA 3NKRA 3MK2A 2D1GA 5GOVA 4MY4A 1EW2A 1Y6VA 3BDGB 1ELZA 4KJDA 1AJDA 4NWXA 1ZEBA 5DLTA 3MK1A 3UO0A 3LXQA 4GTWA 4CXUA 2ZKTA 3T01A 1ED8A 5LRNA 1ANJA 1E2SP 5HRTA 5DLVA 1FSUA 2GSNA 5IJSA 3WAVA 4CYRA 3WAYA 4KM4A 2IUCA 4LR2A 3WAXA 5GRRA 1Y7AA 1KHKA 4CXSA 3TG0A 1B8JA 5L0KA 3NKNA 4UOPA 2W8DA 2QZUA 1AJCA 1ANIA 1ELYA 3NKMA 1ED9A 1HJKA 4N7TA 5LRMA 3T00A 3A52A 3DPCA 4ZG7A 4GTYA 1HDHA 2W5SA 4LR8A 1EI6A 4ZGAA 3SZYA 4TN0A 2IFYA 2W5TA 3UN2A 2W5RA 3TX0A 3OT9A 3SZZA 4LR9A 1ZEFA 3MK0A 3DYCA 1SHQA 3Q3QA 3WAWA 3KD8A 3NVLA 2W5QA 1EQJA 1ALHA 5EGEA 5KXAA 4LQYA 1N2LA 3E2DA 4LRAA 4NWJA 4LRBA 4ZG9A 1ALJA 4MHXA 4YR1A 1K7HA 1E3CP 3BDHA 2GA3A 1AUKA 3ED4A 4GTZA
chains in the Genus database with same CATH topology
2IUCB 1ZEDA 1O99A 3NKPA 5LQQA 4LRDA 1ELXA 3CMRA 2GLQA 1AJAA 2X98A 4QAXA 4KAYA 1O98A 3M8YA 1EW9A 4FDIA 3BDGA 3WBHA 5IJQA 1EW8A 5TJ3A 1URAA 4UOOA 4ZG6A 2XR9A 1KH7A 3M8ZA 4KAVA 4CXKA 3M7VA 3T02A 2GSUA 3BDFA 5K4PA 4UPKA 1SHNA 3UN3A 3UN5A 3UNYA 5LIAA 2VQRA 1EJJA 5EGHA 3NKOA 1KHJA 1KHNA 5AJ9A 1ALKA 5L0EA 4LRFA 1URBA 2XRGA 4KJGA 1ALIA 1AJBA 2W5XA 3IGYB 2W5WA 5C66A 1KH9A 3IDDA 4UPLA 4MIVA 1KH5A 2ANHA 4UPIA 3TWZA 4LR7A 1P49A 1E1ZP 4GTXA 4CYSA 1E33P 1HQAA 5INHA 2G9YA 1KH4A 3B5QA 4LREA 5DLWA 4UORA 2W5VA 3M8WA 4UPHA 2RH6A 4LRCA 4B56A 2W8SA 1N2KA 3IGZB 2GSOA 5L0BA 3NKQA 1KHLA 4FDJA 3NKRA 3MK2A 2D1GA 5GOVA 4MY4A 1EW2A 1Y6VA 3BDGB 1ELZA 4KJDA 1AJDA 4NWXA 1ZEBA 5DLTA 3MK1A 3UO0A 3LXQA 4GTWA 4CXUA 2ZKTA 3T01A 1ED8A 5LRNA 1ANJA 1E2SP 5HRTA 5DLVA 1FSUA 2GSNA 5IJSA 3WAVA 4CYRA 3WAYA 4KM4A 2IUCA 4LR2A 3WAXA 5GRRA 1Y7AA 1KHKA 4CXSA 3TG0A 1B8JA 5L0KA 3NKNA 4UOPA 2W8DA 2QZUA 1AJCA 1ANIA 1ELYA 3NKMA 1ED9A 1HJKA 4N7TA 5LRMA 3T00A 3A52A 3DPCA 4ZG7A 4GTYA 1HDHA 2W5SA 4LR8A 1EI6A 4ZGAA 3SZYA 4TN0A 2IFYA 2W5TA 3UN2A 2W5RA 3TX0A 3OT9A 3SZZA 4LR9A 1ZEFA 3MK0A 3DYCA 1SHQA 3Q3QA 3WAWA 3KD8A 3NVLA 2W5QA 1EQJA 1ALHA 5EGEA 5KXAA 4LQYA 1N2LA 3E2DA 4LRAA 4NWJA 4LRBA 4ZG9A 1ALJA 4MHXA 4YR1A 1K7HA 1E3CP 3BDHA 2GA3A 1AUKA 3ED4A 4GTZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUC B;  1ZED A;  1O99 A;  3NKP A;  5LQQ A;  4LRD A;  1ELX A;  3CMR A;  2GLQ A;  1AJA A;  2X98 A;  4QAX A;  4KAY A;  1O98 A;  3M8Y A;  1EW9 A;  4FDI A;  3BDG A;  3WBH A;  5IJQ A;  1EW8 A;  5TJ3 A;  1URA A;  4UOO A;  4ZG6 A;  2XR9 A;  1KH7 A;  3M8Z A;  4KAV A;  4CXK A;  3M7V A;  3T02 A;  2GSU A;  3BDF A;  5K4P A;  4UPK A;  1SHN A;  3UN3 A;  3UN5 A;  3UNY A;  5LIA A;  2VQR A;  1EJJ A;  5EGH A;  3NKO A;  1KHJ A;  1KHN A;  5AJ9 A;  1ALK A;  5L0E A;  4LRF A;  1URB A;  2XRG A;  4KJG A;  1ALI A;  1AJB A;  2W5X A;  3IGY B;  2W5W A;  5C66 A;  1KH9 A;  3IDD A;  4UPL A;  4MIV A;  1KH5 A;  2ANH A;  4UPI A;  3TWZ A;  4LR7 A;  1P49 A;  1E1Z P;  4GTX A;  4CYS A;  1E33 P;  1HQA A;  5INH A;  2G9Y A;  1KH4 A;  3B5Q A;  4LRE A;  5DLW A;  4UOR A;  2W5V A;  3M8W A;  4UPH A;  2RH6 A;  4LRC A;  4B56 A;  2W8S A;  1N2K A;  3IGZ B;  2GSO A;  5L0B A;  3NKQ A;  1KHL A;  4FDJ A;  3NKR A;  3MK2 A;  2D1G A;  5GOV A;  4MY4 A;  1EW2 A;  1Y6V A;  3BDG B;  1ELZ A;  4KJD A;  1AJD A;  4NWX A;  1ZEB A;  5DLT A;  3MK1 A;  3UO0 A;  3LXQ A;  4GTW A;  4CXU A;  2ZKT A;  3T01 A;  1ED8 A;  5LRN A;  1ANJ A;  1E2S P;  5HRT A;  5DLV A;  1FSU A;  2GSN A;  5IJS A;  3WAV A;  4CYR A;  3WAY A;  4KM4 A;  2IUC A;  4LR2 A;  3WAX A;  5GRR A;  1Y7A A;  1KHK A;  4CXS A;  3TG0 A;  1B8J A;  5L0K A;  3NKN A;  4UOP A;  2W8D A;  2QZU A;  1AJC A;  1ANI A;  1ELY A;  3NKM A;  1ED9 A;  1HJK A;  4N7T A;  5LRM A;  3T00 A;  3A52 A;  3DPC A;  4ZG7 A;  4GTY A;  1HDH A;  2W5S A;  4LR8 A;  1EI6 A;  4ZGA A;  3SZY A;  4TN0 A;  2IFY A;  2W5T A;  3UN2 A;  2W5R A;  3TX0 A;  3OT9 A;  3SZZ A;  4LR9 A;  1ZEF A;  3MK0 A;  3DYC A;  1SHQ A;  3Q3Q A;  3WAW A;  3KD8 A;  3NVL A;  2W5Q A;  1EQJ A;  1ALH A;  5EGE A;  5KXA A;  4LQY A;  1N2L A;  3E2D A;  4LRA A;  4NWJ A;  4LRB A;  4ZG9 A;  1ALJ A;  4MHX A;  4YR1 A;  1K7H A;  1E3C P;  3BDH A;  2GA3 A;  1AUK A;  3ED4 A;  4GTZ A; 
#chains in the Genus database with same CATH topology
 2IUC B;  1ZED A;  1O99 A;  3NKP A;  5LQQ A;  4LRD A;  1ELX A;  3CMR A;  2GLQ A;  1AJA A;  2X98 A;  4QAX A;  4KAY A;  1O98 A;  3M8Y A;  1EW9 A;  4FDI A;  3BDG A;  3WBH A;  5IJQ A;  1EW8 A;  5TJ3 A;  1URA A;  4UOO A;  4ZG6 A;  2XR9 A;  1KH7 A;  3M8Z A;  4KAV A;  4CXK A;  3M7V A;  3T02 A;  2GSU A;  3BDF A;  5K4P A;  4UPK A;  1SHN A;  3UN3 A;  3UN5 A;  3UNY A;  5LIA A;  2VQR A;  1EJJ A;  5EGH A;  3NKO A;  1KHJ A;  1KHN A;  5AJ9 A;  1ALK A;  5L0E A;  4LRF A;  1URB A;  2XRG A;  4KJG A;  1ALI A;  1AJB A;  2W5X A;  3IGY B;  2W5W A;  5C66 A;  1KH9 A;  3IDD A;  4UPL A;  4MIV A;  1KH5 A;  2ANH A;  4UPI A;  3TWZ A;  4LR7 A;  1P49 A;  1E1Z P;  4GTX A;  4CYS A;  1E33 P;  1HQA A;  5INH A;  2G9Y A;  1KH4 A;  3B5Q A;  4LRE A;  5DLW A;  4UOR A;  2W5V A;  3M8W A;  4UPH A;  2RH6 A;  4LRC A;  4B56 A;  2W8S A;  1N2K A;  3IGZ B;  2GSO A;  5L0B A;  3NKQ A;  1KHL A;  4FDJ A;  3NKR A;  3MK2 A;  2D1G A;  5GOV A;  4MY4 A;  1EW2 A;  1Y6V A;  3BDG B;  1ELZ A;  4KJD A;  1AJD A;  4NWX A;  1ZEB A;  5DLT A;  3MK1 A;  3UO0 A;  3LXQ A;  4GTW A;  4CXU A;  2ZKT A;  3T01 A;  1ED8 A;  5LRN A;  1ANJ A;  1E2S P;  5HRT A;  5DLV A;  1FSU A;  2GSN A;  5IJS A;  3WAV A;  4CYR A;  3WAY A;  4KM4 A;  2IUC A;  4LR2 A;  3WAX A;  5GRR A;  1Y7A A;  1KHK A;  4CXS A;  3TG0 A;  1B8J A;  5L0K A;  3NKN A;  4UOP A;  2W8D A;  2QZU A;  1AJC A;  1ANI A;  1ELY A;  3NKM A;  1ED9 A;  1HJK A;  4N7T A;  5LRM A;  3T00 A;  3A52 A;  3DPC A;  4ZG7 A;  4GTY A;  1HDH A;  2W5S A;  4LR8 A;  1EI6 A;  4ZGA A;  3SZY A;  4TN0 A;  2IFY A;  2W5T A;  3UN2 A;  2W5R A;  3TX0 A;  3OT9 A;  3SZZ A;  4LR9 A;  1ZEF A;  3MK0 A;  3DYC A;  1SHQ A;  3Q3Q A;  3WAW A;  3KD8 A;  3NVL A;  2W5Q A;  1EQJ A;  1ALH A;  5EGE A;  5KXA A;  4LQY A;  1N2L A;  3E2D A;  4LRA A;  4NWJ A;  4LRB A;  4ZG9 A;  1ALJ A;  4MHX A;  4YR1 A;  1K7H A;  1E3C P;  3BDH A;  2GA3 A;  1AUK A;  3ED4 A;  4GTZ A; 
#chains in the Genus database with same CATH homology
 2IUC B;  1ZED A;  1O99 A;  3NKP A;  5LQQ A;  4LRD A;  1ELX A;  3CMR A;  2GLQ A;  1AJA A;  2X98 A;  4QAX A;  4KAY A;  1O98 A;  3M8Y A;  1EW9 A;  4FDI A;  3BDG A;  3WBH A;  5IJQ A;  1EW8 A;  5TJ3 A;  1URA A;  4UOO A;  4ZG6 A;  2XR9 A;  1KH7 A;  3M8Z A;  4KAV A;  4CXK A;  3M7V A;  3T02 A;  2GSU A;  3BDF A;  5K4P A;  4UPK A;  1SHN A;  3UN3 A;  3UN5 A;  3UNY A;  5LIA A;  2VQR A;  1EJJ A;  5EGH A;  3NKO A;  1KHJ A;  1KHN A;  5AJ9 A;  1ALK A;  5L0E A;  4LRF A;  1URB A;  2XRG A;  4KJG A;  1ALI A;  1AJB A;  2W5X A;  3IGY B;  2W5W A;  5C66 A;  1KH9 A;  3IDD A;  4UPL A;  4MIV A;  1KH5 A;  2ANH A;  4UPI A;  3TWZ A;  4LR7 A;  1P49 A;  1E1Z P;  4GTX A;  4CYS A;  1E33 P;  1HQA A;  5INH A;  2G9Y A;  1KH4 A;  3B5Q A;  4LRE A;  5DLW A;  4UOR A;  2W5V A;  3M8W A;  4UPH A;  2RH6 A;  4LRC A;  4B56 A;  2W8S A;  1N2K A;  3IGZ B;  2GSO A;  5L0B A;  3NKQ A;  1KHL A;  4FDJ A;  3NKR A;  3MK2 A;  2D1G A;  5GOV A;  4MY4 A;  1EW2 A;  1Y6V A;  3BDG B;  1ELZ A;  4KJD A;  1AJD A;  4NWX A;  1ZEB A;  5DLT A;  3MK1 A;  3UO0 A;  3LXQ A;  4GTW A;  4CXU A;  2ZKT A;  3T01 A;  1ED8 A;  5LRN A;  1ANJ A;  1E2S P;  5HRT A;  5DLV A;  1FSU A;  2GSN A;  5IJS A;  3WAV A;  4CYR A;  3WAY A;  4KM4 A;  2IUC A;  4LR2 A;  3WAX A;  5GRR A;  1Y7A A;  1KHK A;  4CXS A;  3TG0 A;  1B8J A;  5L0K A;  3NKN A;  4UOP A;  2W8D A;  2QZU A;  1AJC A;  1ANI A;  1ELY A;  3NKM A;  1ED9 A;  1HJK A;  4N7T A;  5LRM A;  3T00 A;  3A52 A;  3DPC A;  4ZG7 A;  4GTY A;  1HDH A;  2W5S A;  4LR8 A;  1EI6 A;  4ZGA A;  3SZY A;  4TN0 A;  2IFY A;  2W5T A;  3UN2 A;  2W5R A;  3TX0 A;  3OT9 A;  3SZZ A;  4LR9 A;  1ZEF A;  3MK0 A;  3DYC A;  1SHQ A;  3Q3Q A;  3WAW A;  3KD8 A;  3NVL A;  2W5Q A;  1EQJ A;  1ALH A;  5EGE A;  5KXA A;  4LQY A;  1N2L A;  3E2D A;  4LRA A;  4NWJ A;  4LRB A;  4ZG9 A;  1ALJ A;  4MHX A;  4YR1 A;  1K7H A;  1E3C P;  3BDH A;  2GA3 A;  1AUK A;  3ED4 A;  4GTZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...