4UOOA

Structure of lipoteichoic acid synthase ltas from listeria monocytogenes
Total Genus 149
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
149
Knots found
sequence length
415
structure length
414
Chain Sequence
VTEVLNYTKSKYAAPNPEYFGKAKGKNVIYIHLESFQQFLVNYKLNGEEVTPFINSFFKDQNTLSFTNFFHQTGQGKADSEMLLENSLYGLPQGSAFTTKGQNTYESASAILGQQGYTSAVFHGNYKSFWNRDEIYKQFGYDNFFDASYYDMNEADVSNYGLKDKPFFKESEEYLSSLQQPFYTKFITLTNHFPYPIDEKDASIAPATTGDSSVDTYFQTARYLDESVKSFVDYLKKSGLYDNSVIIMYGDHYGISDNHEEAMTKILGKDYNTFENAQAQRVPLMIHVPGVQGGVQEQYGGQVDLLPTLLHLLGVDNKEYLQFGTDLLSKDHKQLVPFRNGDYITPTYSMIGGNMYNQQTGEPIATETKEMKETKEKVAKELELSDSVLQGDLLRFYAPDGFKKVDPSKYNYNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and mechanistic insight into the Listeria monocytogenes two-enzyme lipoteichoic acid synthesis system.
pubmed doi rcsb
source organism Listeria monocytogenes
molecule tags Transferase
molecule keywords LIPOTEICHOIC ACID SYNTHASE
total genus 149
structure length 414
sequence length 415
chains with identical sequence B, C, D, E
other databases KnotProt 2.0: S +31
ec nomenclature ec 2.7.8.-:
pdb deposition date 2014-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uooA02
1O98A 4ZG6A 2D1GA 5GRRA 1EW2A 2GSOA 1HQAA 2XR9A 3E2DA 4KAVA 4LRBA 1ALIA 3M7VA 4QAXA 2GLQA 4KAYA 4UPKA 4GTYA 4LRFA 4CYRA 3NKRA 4UOOA 1N2LA 3LXQA 3M8WA 3NKOA 5GOVA 1E3CP 1ZEFA 3ED4A 3MK0A 4LRAA 3UN3A 4YR1A 4LR7A 3NKMA 1ANIA 2W5VA 5IJSA 3NKPA 5DLTA 3BDHA 5DLWA 1KH9A 4GTXA 5DLVA 3T02A 4B56A 3IDDA 2W5WA 4LR8A 1KH7A 5C66A 1AJDA 5LRNA 2GA3A 3KD8A 3MK2A 4N7TA 4CXSA 3UN2A 1AJCA 1P49A 1EW8A 3BDGB 1ED9A 4UOPA 5LIAA 1K7HA 4ZG9A 2GSUA 1KH4A 2GSNA 5L0EA 2W5XA 4CXKA 5L0BA 3NKNA 1AJBA 2W5TA 4MHXA 4LQYA 3UO0A 1AJAA 3T01A 1KHLA 1O99A 2X98A 3NVLA 1SHNA 3UN5A 3TWZA 1E33P 4FDJA 1KHJA 3M8YA 1KHKA 3DYCA 5KXAA 1SHQA 4UPHA 4LREA 3WBHA 2IUCB 1ELYA 1ANJA 4KJGA 1Y6VA 2W5QA 3NKQA 2RH6A 4LR9A 1ALKA 1FSUA 3T00A 5K4PA 1EW9A 5INHA 2W8DA 3A52A 2ANHA 2G9YA 2XRGA 2W5SA 4NWJA 3WAXA 1ZEBA 5EGHA 3B5QA 3WAVA 2QZUA 1URBA 2ZKTA 1KH5A 1EQJA 3DPCA 4ZG7A 4LRCA 1E2SP 2VQRA 1E1ZP 4MY4A 3SZZA 4UORA 3M8ZA 1N2KA 1HJKA 3MK1A 4TN0A 3UNYA 1ZEDA 5TJ3A 1B8JA 3Q3QA 1ED8A 4CXUA 3IGZB 1ALJA 4ZGAA 3IGYB 3TX0A 5HRTA 4MIVA 4UPIA 2W8SA 2IUCA 1ALHA 3SZYA 3BDFA 3BDGA 4CYSA 1Y7AA 4LRDA 4NWXA 3WAYA 1ELXA 3OT9A 1AUKA 4GTWA 4KM4A 4FDIA 2W5RA 4GTZA 5AJ9A 1URAA 4UPLA 3CMRA 1ELZA 3WAWA 1KHNA 5EGEA 2IFYA 1EJJA 5IJQA 4LR2A 1EI6A 3TG0A 5L0KA 1HDHA 5LRMA 5LQQA 4KJDA
chains in the Genus database with same CATH superfamily
1O98A 4ZG6A 2D1GA 5GRRA 1EW2A 2GSOA 1HQAA 2XR9A 3E2DA 4KAVA 4LRBA 1ALIA 3M7VA 4QAXA 2GLQA 4KAYA 4UPKA 4GTYA 4LRFA 4CYRA 3NKRA 4UOOA 1N2LA 3LXQA 3M8WA 3NKOA 5GOVA 1E3CP 1ZEFA 3ED4A 3MK0A 4LRAA 3UN3A 4YR1A 4LR7A 3NKMA 1ANIA 2W5VA 5IJSA 3NKPA 5DLTA 3BDHA 5DLWA 1KH9A 4GTXA 5DLVA 3T02A 4B56A 3IDDA 2W5WA 4LR8A 1KH7A 5C66A 1AJDA 5LRNA 2GA3A 3KD8A 3MK2A 4N7TA 4CXSA 3UN2A 1AJCA 1P49A 1EW8A 3BDGB 1ED9A 4UOPA 5LIAA 1K7HA 4ZG9A 2GSUA 1KH4A 2GSNA 5L0EA 2W5XA 4CXKA 5L0BA 3NKNA 1AJBA 2W5TA 4MHXA 4LQYA 3UO0A 1AJAA 3T01A 1KHLA 1O99A 2X98A 3NVLA 1SHNA 3UN5A 3TWZA 1E33P 4FDJA 1KHJA 3M8YA 1KHKA 3DYCA 5KXAA 1SHQA 4UPHA 4LREA 3WBHA 2IUCB 1ELYA 1ANJA 4KJGA 1Y6VA 2W5QA 3NKQA 2RH6A 4LR9A 1ALKA 1FSUA 3T00A 5K4PA 1EW9A 5INHA 2W8DA 3A52A 2ANHA 2G9YA 2XRGA 2W5SA 4NWJA 3WAXA 1ZEBA 5EGHA 3B5QA 3WAVA 2QZUA 1URBA 2ZKTA 1KH5A 1EQJA 3DPCA 4ZG7A 4LRCA 1E2SP 2VQRA 1E1ZP 4MY4A 3SZZA 4UORA 3M8ZA 1N2KA 1HJKA 3MK1A 4TN0A 3UNYA 1ZEDA 5TJ3A 1B8JA 3Q3QA 1ED8A 4CXUA 3IGZB 1ALJA 4ZGAA 3IGYB 3TX0A 5HRTA 4MIVA 4UPIA 2W8SA 2IUCA 1ALHA 3SZYA 3BDFA 3BDGA 4CYSA 1Y7AA 4LRDA 4NWXA 3WAYA 1ELXA 3OT9A 1AUKA 4GTWA 4KM4A 4FDIA 2W5RA 4GTZA 5AJ9A 1URAA 4UPLA 3CMRA 1ELZA 3WAWA 1KHNA 5EGEA 2IFYA 1EJJA 5IJQA 4LR2A 1EI6A 3TG0A 5L0KA 1HDHA 5LRMA 5LQQA 4KJDA
chains in the Genus database with same CATH topology
1O98A 4ZG6A 2D1GA 5GRRA 1EW2A 2GSOA 1HQAA 2XR9A 3E2DA 4KAVA 4LRBA 1ALIA 3M7VA 4QAXA 2GLQA 4KAYA 4UPKA 4GTYA 4LRFA 4CYRA 3NKRA 4UOOA 1N2LA 3LXQA 3M8WA 3NKOA 5GOVA 1E3CP 1ZEFA 3ED4A 3MK0A 4LRAA 3UN3A 4YR1A 4LR7A 3NKMA 1ANIA 2W5VA 5IJSA 3NKPA 5DLTA 3BDHA 5DLWA 1KH9A 4GTXA 5DLVA 3T02A 4B56A 3IDDA 2W5WA 4LR8A 1KH7A 5C66A 1AJDA 5LRNA 2GA3A 3KD8A 3MK2A 4N7TA 4CXSA 3UN2A 1AJCA 1P49A 1EW8A 3BDGB 1ED9A 4UOPA 5LIAA 1K7HA 4ZG9A 2GSUA 1KH4A 2GSNA 5L0EA 2W5XA 4CXKA 5L0BA 3NKNA 1AJBA 2W5TA 4MHXA 4LQYA 3UO0A 1AJAA 3T01A 1KHLA 1O99A 2X98A 3NVLA 1SHNA 3UN5A 3TWZA 1E33P 4FDJA 1KHJA 3M8YA 1KHKA 3DYCA 5KXAA 1SHQA 4UPHA 4LREA 3WBHA 2IUCB 1ELYA 1ANJA 4KJGA 1Y6VA 2W5QA 3NKQA 2RH6A 4LR9A 1ALKA 1FSUA 3T00A 5K4PA 1EW9A 5INHA 2W8DA 3A52A 2ANHA 2G9YA 2XRGA 2W5SA 4NWJA 3WAXA 1ZEBA 5EGHA 3B5QA 3WAVA 2QZUA 1URBA 2ZKTA 1KH5A 1EQJA 3DPCA 4ZG7A 4LRCA 1E2SP 2VQRA 1E1ZP 4MY4A 3SZZA 4UORA 3M8ZA 1N2KA 1HJKA 3MK1A 4TN0A 3UNYA 1ZEDA 5TJ3A 1B8JA 3Q3QA 1ED8A 4CXUA 3IGZB 1ALJA 4ZGAA 3IGYB 3TX0A 5HRTA 4MIVA 4UPIA 2W8SA 2IUCA 1ALHA 3SZYA 3BDFA 3BDGA 4CYSA 1Y7AA 4LRDA 4NWXA 3WAYA 1ELXA 3OT9A 1AUKA 4GTWA 4KM4A 4FDIA 2W5RA 4GTZA 5AJ9A 1URAA 4UPLA 3CMRA 1ELZA 3WAWA 1KHNA 5EGEA 2IFYA 1EJJA 5IJQA 4LR2A 1EI6A 3TG0A 5L0KA 1HDHA 5LRMA 5LQQA 4KJDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O98 A;  4ZG6 A;  2D1G A;  5GRR A;  1EW2 A;  2GSO A;  1HQA A;  2XR9 A;  3E2D A;  4KAV A;  4LRB A;  1ALI A;  3M7V A;  4QAX A;  2GLQ A;  4KAY A;  4UPK A;  4GTY A;  4LRF A;  4CYR A;  3NKR A;  4UOO A;  1N2L A;  3LXQ A;  3M8W A;  3NKO A;  5GOV A;  1E3C P;  1ZEF A;  3ED4 A;  3MK0 A;  4LRA A;  3UN3 A;  4YR1 A;  4LR7 A;  3NKM A;  1ANI A;  2W5V A;  5IJS A;  3NKP A;  5DLT A;  3BDH A;  5DLW A;  1KH9 A;  4GTX A;  5DLV A;  3T02 A;  4B56 A;  3IDD A;  2W5W A;  4LR8 A;  1KH7 A;  5C66 A;  1AJD A;  5LRN A;  2GA3 A;  3KD8 A;  3MK2 A;  4N7T A;  4CXS A;  3UN2 A;  1AJC A;  1P49 A;  1EW8 A;  3BDG B;  1ED9 A;  4UOP A;  5LIA A;  1K7H A;  4ZG9 A;  2GSU A;  1KH4 A;  2GSN A;  5L0E A;  2W5X A;  4CXK A;  5L0B A;  3NKN A;  1AJB A;  2W5T A;  4MHX A;  4LQY A;  3UO0 A;  1AJA A;  3T01 A;  1KHL A;  1O99 A;  2X98 A;  3NVL A;  1SHN A;  3UN5 A;  3TWZ A;  1E33 P;  4FDJ A;  1KHJ A;  3M8Y A;  1KHK A;  3DYC A;  5KXA A;  1SHQ A;  4UPH A;  4LRE A;  3WBH A;  2IUC B;  1ELY A;  1ANJ A;  4KJG A;  1Y6V A;  2W5Q A;  3NKQ A;  2RH6 A;  4LR9 A;  1ALK A;  1FSU A;  3T00 A;  5K4P A;  1EW9 A;  5INH A;  2W8D A;  3A52 A;  2ANH A;  2G9Y A;  2XRG A;  2W5S A;  4NWJ A;  3WAX A;  1ZEB A;  5EGH A;  3B5Q A;  3WAV A;  2QZU A;  1URB A;  2ZKT A;  1KH5 A;  1EQJ A;  3DPC A;  4ZG7 A;  4LRC A;  1E2S P;  2VQR A;  1E1Z P;  4MY4 A;  3SZZ A;  4UOR A;  3M8Z A;  1N2K A;  1HJK A;  3MK1 A;  4TN0 A;  3UNY A;  1ZED A;  5TJ3 A;  1B8J A;  3Q3Q A;  1ED8 A;  4CXU A;  3IGZ B;  1ALJ A;  4ZGA A;  3IGY B;  3TX0 A;  5HRT A;  4MIV A;  4UPI A;  2W8S A;  2IUC A;  1ALH A;  3SZY A;  3BDF A;  3BDG A;  4CYS A;  1Y7A A;  4LRD A;  4NWX A;  3WAY A;  1ELX A;  3OT9 A;  1AUK A;  4GTW A;  4KM4 A;  4FDI A;  2W5R A;  4GTZ A;  5AJ9 A;  1URA A;  4UPL A;  3CMR A;  1ELZ A;  3WAW A;  1KHN A;  5EGE A;  2IFY A;  1EJJ A;  5IJQ A;  4LR2 A;  1EI6 A;  3TG0 A;  5L0K A;  1HDH A;  5LRM A;  5LQQ A;  4KJD A; 
#chains in the Genus database with same CATH topology
 1O98 A;  4ZG6 A;  2D1G A;  5GRR A;  1EW2 A;  2GSO A;  1HQA A;  2XR9 A;  3E2D A;  4KAV A;  4LRB A;  1ALI A;  3M7V A;  4QAX A;  2GLQ A;  4KAY A;  4UPK A;  4GTY A;  4LRF A;  4CYR A;  3NKR A;  4UOO A;  1N2L A;  3LXQ A;  3M8W A;  3NKO A;  5GOV A;  1E3C P;  1ZEF A;  3ED4 A;  3MK0 A;  4LRA A;  3UN3 A;  4YR1 A;  4LR7 A;  3NKM A;  1ANI A;  2W5V A;  5IJS A;  3NKP A;  5DLT A;  3BDH A;  5DLW A;  1KH9 A;  4GTX A;  5DLV A;  3T02 A;  4B56 A;  3IDD A;  2W5W A;  4LR8 A;  1KH7 A;  5C66 A;  1AJD A;  5LRN A;  2GA3 A;  3KD8 A;  3MK2 A;  4N7T A;  4CXS A;  3UN2 A;  1AJC A;  1P49 A;  1EW8 A;  3BDG B;  1ED9 A;  4UOP A;  5LIA A;  1K7H A;  4ZG9 A;  2GSU A;  1KH4 A;  2GSN A;  5L0E A;  2W5X A;  4CXK A;  5L0B A;  3NKN A;  1AJB A;  2W5T A;  4MHX A;  4LQY A;  3UO0 A;  1AJA A;  3T01 A;  1KHL A;  1O99 A;  2X98 A;  3NVL A;  1SHN A;  3UN5 A;  3TWZ A;  1E33 P;  4FDJ A;  1KHJ A;  3M8Y A;  1KHK A;  3DYC A;  5KXA A;  1SHQ A;  4UPH A;  4LRE A;  3WBH A;  2IUC B;  1ELY A;  1ANJ A;  4KJG A;  1Y6V A;  2W5Q A;  3NKQ A;  2RH6 A;  4LR9 A;  1ALK A;  1FSU A;  3T00 A;  5K4P A;  1EW9 A;  5INH A;  2W8D A;  3A52 A;  2ANH A;  2G9Y A;  2XRG A;  2W5S A;  4NWJ A;  3WAX A;  1ZEB A;  5EGH A;  3B5Q A;  3WAV A;  2QZU A;  1URB A;  2ZKT A;  1KH5 A;  1EQJ A;  3DPC A;  4ZG7 A;  4LRC A;  1E2S P;  2VQR A;  1E1Z P;  4MY4 A;  3SZZ A;  4UOR A;  3M8Z A;  1N2K A;  1HJK A;  3MK1 A;  4TN0 A;  3UNY A;  1ZED A;  5TJ3 A;  1B8J A;  3Q3Q A;  1ED8 A;  4CXU A;  3IGZ B;  1ALJ A;  4ZGA A;  3IGY B;  3TX0 A;  5HRT A;  4MIV A;  4UPI A;  2W8S A;  2IUC A;  1ALH A;  3SZY A;  3BDF A;  3BDG A;  4CYS A;  1Y7A A;  4LRD A;  4NWX A;  3WAY A;  1ELX A;  3OT9 A;  1AUK A;  4GTW A;  4KM4 A;  4FDI A;  2W5R A;  4GTZ A;  5AJ9 A;  1URA A;  4UPL A;  3CMR A;  1ELZ A;  3WAW A;  1KHN A;  5EGE A;  2IFY A;  1EJJ A;  5IJQ A;  4LR2 A;  1EI6 A;  3TG0 A;  5L0K A;  1HDH A;  5LRM A;  5LQQ A;  4KJD A; 
#chains in the Genus database with same CATH homology
 1O98 A;  4ZG6 A;  2D1G A;  5GRR A;  1EW2 A;  2GSO A;  1HQA A;  2XR9 A;  3E2D A;  4KAV A;  4LRB A;  1ALI A;  3M7V A;  4QAX A;  2GLQ A;  4KAY A;  4UPK A;  4GTY A;  4LRF A;  4CYR A;  3NKR A;  4UOO A;  1N2L A;  3LXQ A;  3M8W A;  3NKO A;  5GOV A;  1E3C P;  1ZEF A;  3ED4 A;  3MK0 A;  4LRA A;  3UN3 A;  4YR1 A;  4LR7 A;  3NKM A;  1ANI A;  2W5V A;  5IJS A;  3NKP A;  5DLT A;  3BDH A;  5DLW A;  1KH9 A;  4GTX A;  5DLV A;  3T02 A;  4B56 A;  3IDD A;  2W5W A;  4LR8 A;  1KH7 A;  5C66 A;  1AJD A;  5LRN A;  2GA3 A;  3KD8 A;  3MK2 A;  4N7T A;  4CXS A;  3UN2 A;  1AJC A;  1P49 A;  1EW8 A;  3BDG B;  1ED9 A;  4UOP A;  5LIA A;  1K7H A;  4ZG9 A;  2GSU A;  1KH4 A;  2GSN A;  5L0E A;  2W5X A;  4CXK A;  5L0B A;  3NKN A;  1AJB A;  2W5T A;  4MHX A;  4LQY A;  3UO0 A;  1AJA A;  3T01 A;  1KHL A;  1O99 A;  2X98 A;  3NVL A;  1SHN A;  3UN5 A;  3TWZ A;  1E33 P;  4FDJ A;  1KHJ A;  3M8Y A;  1KHK A;  3DYC A;  5KXA A;  1SHQ A;  4UPH A;  4LRE A;  3WBH A;  2IUC B;  1ELY A;  1ANJ A;  4KJG A;  1Y6V A;  2W5Q A;  3NKQ A;  2RH6 A;  4LR9 A;  1ALK A;  1FSU A;  3T00 A;  5K4P A;  1EW9 A;  5INH A;  2W8D A;  3A52 A;  2ANH A;  2G9Y A;  2XRG A;  2W5S A;  4NWJ A;  3WAX A;  1ZEB A;  5EGH A;  3B5Q A;  3WAV A;  2QZU A;  1URB A;  2ZKT A;  1KH5 A;  1EQJ A;  3DPC A;  4ZG7 A;  4LRC A;  1E2S P;  2VQR A;  1E1Z P;  4MY4 A;  3SZZ A;  4UOR A;  3M8Z A;  1N2K A;  1HJK A;  3MK1 A;  4TN0 A;  3UNY A;  1ZED A;  5TJ3 A;  1B8J A;  3Q3Q A;  1ED8 A;  4CXU A;  3IGZ B;  1ALJ A;  4ZGA A;  3IGY B;  3TX0 A;  5HRT A;  4MIV A;  4UPI A;  2W8S A;  2IUC A;  1ALH A;  3SZY A;  3BDF A;  3BDG A;  4CYS A;  1Y7A A;  4LRD A;  4NWX A;  3WAY A;  1ELX A;  3OT9 A;  1AUK A;  4GTW A;  4KM4 A;  4FDI A;  2W5R A;  4GTZ A;  5AJ9 A;  1URA A;  4UPL A;  3CMR A;  1ELZ A;  3WAW A;  1KHN A;  5EGE A;  2IFY A;  1EJJ A;  5IJQ A;  4LR2 A;  1EI6 A;  3TG0 A;  5L0K A;  1HDH A;  5LRM A;  5LQQ A;  4KJD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...