4UOZA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 nucleophile mutant e324a in complex with galactose
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
688
structure length
688
Chain Sequence
RAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 242
structure length 688
sequence length 688
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uozA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uozA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uozA02
4OZOA 1XCXA 3J7HA 5ABFB 5ABGA 5SY6A 4CD4A 4IUGA 3W82A 3L4ZA 1OX5A 1B3WA 4AZCB 1TA3B 2BXZA 1UR2A 2A3AA 3CC1A 4B7AA 5ABFA 3SCQA 1VFUA 4PSRA 4J3TA 3ALGA 1GGFA 4UOZA 1P5FA 4BIMA 3TA9A 2Y8VA 3AZTA 1JYNA 1JNEA 1ITXA 5CGTA 1W2PA 3BGAA 3F4VA 1GW1A 3PQ6A 1PX3A 3ARXA 4B31A 4P7OA 2PWGA 3P9RA 3UR7A 2QV4A 2WK2A 2WC7A 2X1IA 5IFPA 3PHAA 1C8YA 1UD5A 3ARSA 4OBRA 1R9GA 2YL5A 1IZZA 1IZJA 1W9DM 3VMNA 3N12A 1OI4A 2J7EA 3W26A 1RD6A 3ARQA 3WUBA 3VD4A 3R76A 3A24A 1KXVA 3KL5A 1SMAA 5I2UA 3UGJA 2D3LA 2XM2A 1WZKA 2XIIA 5E9AA 2X05A 2GJPA 2YBTA 4JKKA 1KTBA 4UNIA 1VBRA 4E8CA 3PQ2A 4D6GA 2V4UA 4KMQA 1B3ZA 2W67A 3AHTA 2V38A 1U9CA 1O7AA 2D24A 4H8HA 1V6UA 4H04A 2CETA 3ZIZA 1EQPA 4NX0A 2D0HA 2PBGA 3MV11 1UD8A 1R34A 3OGSA 5E0CA 3AXIA 5C71A 3CLWA 3U7BA 3TTXA 3D3AA 3ZSSA 4D1YA 4PBGA 1Y7VA 5E70A 1UWSA 2QPSA 4MAVA 2VX6A 5IFTA 4WKHA 5A1AA 1TMQA 4NZCA 4OQ4A 2CKRA 1KFWA 4JFTA 2VRNA 1RP8A 3A4AA 3WFZA 2YOCA 1GGHA 1ISYA 3LPFA 2GJXB 4Y1GA 3U5UA 4UZUA 3LPGA 2DH2A 3CTTA 1C7SA 4CD8A 1B0IA 4HOZA 1HWWA 1R33A 2OYKA 1QI2A 1PJ9A 4CN4A 1J9YA 2Y8KA 3PZTA 4TTUA 3FN9A 4DO6A 3OLDA 2QLYA 2GDUA 2R1VB 1GZJA 1TFVA 2GUYA 1HXJA 3NCOA 3MV01 1ESWA 4NXSA 3UK7A 2F18A 4GIAA 1OY1A 5A95A 4DWSD 3GXDA 4ZDKA 1JXJA 3OIHA 3ARZA 1UH3A 4N42A 3WL0A 1HJSA 5ABEA 3PZIA 1JDAA 1JL8A 1OGSA 1YQ2A 1DEDA 4IPLA 3VTRA 4D6CA 2WCAA 2ZX6A 3ZT7A 4BCEA 2CNCA 4MB4A 1BYAA 2OWCA 3T2OA 1E56A 2HVMA 4BZYA 1PPIA 4L95C 4RL3A 2DSKA 2VQTA 4IPNB 3M7SA 3WH5A 2UY4A 4OBSA 2BHZA 1I1QB 2IXUA 4OUEA 1P81A 1UKQA 1HJQA 1KGXA 1ZL1A 1MQRA 2GSJA 2XTKA 2C7FA 1ZB5A 1R8LA 2ZXQA 1DWIM 3EN0A 5D4YA 1PIGA 4UCFA 1PDVA 4CUCA 4HZ8A 3LPOA 4PMNA 4K68A 4XX6A 3A4XA 2EPOA 2UWFA 3A22A 1OCQA 4AMXA 3W27A 3WIJA 4ATWA 2WXDM 1JDBC 2XG9A 4GE0A 4AUEA 4EKJA 3OLIA 1QDLB 4PTMA 1UUQA 4ZEPA 2XSAA 4P7QA 3ZSTA 1OT1A 2JFEX 3W6MA 1WCGA 3UMMA 2XFYA 1PAMA 2PWDA 3CMJA 4GO8A 3WEZA 4AWEA 5CZKA 2ZE0A 2E3ZA 4MJ4A 4P8XA 1CXKA 5IXEA 4W8AA 3M46A 4CD7A 4F9DA 3L2MA 4JFSA 2DT1A 1GQJA 3N11A 5LIRA 3HMCA 1VAHA 3VGEA 4YHGA 1PZ2A 1LG2A 5FL1A 1J0JA 4HOWA 2D2OA 1J0ZA 1XRVA 3RJXA 3WSUA 1HJVA 2AAAA 3CPUA 2J7DA 2GFTA 1ODUA 4B2YA 1H0IA 2WC3A 2EQDA 4D1JA 4GI6A 5GQBA 1KCLA 2XN0A 5CG0A 3OGVA 2J25A 1E0XA 5HPCA 1G5AA 5AC4A 1UA7A 2D3NA 3BC9A 3AISA 1E6RA 4WSKA 5DFAA 3WEMA 1KBKA 1GPFA 1XHGA 3VKKA 4PMXA 3AIUA 3PZQA 2CEQA 4F8XA 2B31A 1I75A 3OGRA 3VIHA 4UR9A 3PZNA 5M17A 1KR1A 3GXTA 5EMYA 1VEOA 3L2LA 5CXPA 4LRUA 3TP4A 3LRLA 5SY4A 2WMHA 3EJRA 1C93A 5HBFA 4AJ9A 3NSMA 4JZ5A 2FEXA 4MB1A 3F5KA 1D2KA 3FHQA 3BVWA 2NW0A 3VDCA 3TV8A 3DDGA 1BG9A 3ZT5A 3AHVA 1CENA 4K2HA 2VURA 5A3HA 3IJ9A 5E6YA 4DM1A 3CZKA 3UCQA 1NH6A 4F66A 1G0CA 3CGTA 4KGJA 4DWSA 1ISVA 2A3CA 2A3HA 3GH4A 4ENUA 1T36B 1KXHA 2PWHA 1E6PA 3AMLA 3BXWA 3DHUA 4RKYA 3H55A 4GI8A 2BV9A 1UQZA 1E4MM 1DWFM 3GM8A 1C30B 1PS3A 4LX4A 4W5UA 5A8OA 3W4RA 1P7YA 1SYTA 4AYGA 4W7VA 1J0IA 4MJ2A 5DT7A 2GDVA 2ISSD 2VR5A 3BMVA 4P2GA 2BVYA 1UR0A 1CXIA 4ZXLA 1TQVA 2D23A 2EAEA 3MMWA 2FE0A 3EDKA 5E6ZA 5HDRA 1VCNA 4JFWA 3DC0A 2OR3A 2DH3A 4Z2LA 3LX9A 4MNTA 1TG7A 2CITA 3UESA 4W5ZA 1W3HA 3WH6A 3L4YA 2EPKX 3AMGA 1TQUA 3DECA 5D9PA 3CIVA 1OD8A 4P35A 1UQYA 2D1ZA 2ZXAA 3LXBA 3VPLA 3KL0A 3TONA 2OWXA 4U2ZA 3PN8A 4TX8A 4TTGA 1TCMA 3ZR4B 1QI3A 5I24A 5FCZA 1X6NA 5HOSA 4AMCA 1L8NA 2E9BA 1E4LA 2J7HA 2VRJA 1GUVA 2BY3A 1JZ2A 2W91A 2EBNA 2RK3A 2YDSA 3EMCA 1HKIA 2FH8A 2DT0A 3GXPA 3WY1A 1HF6A 1QI0A 3W25A 1WAWA 1LWJA 2WWCA 4CU6A 4KRUA 1R47A 4LYRA 1KCKA 5JUVA 1LL4A 5I77A 4D6DA 2J79A 4YHEA 1UD4A 3AS3A 5IHSA 3L4TA 1I1XA 2VI0A 4X9YA 4C7GA 3M3PA 1ZJBA 1NWRA 1GGKA 3MGKA 3FSEA 3D4YA 3AIQA 2BY1A 3CZEA 2X2HA 3GXIA 1XV8A 5TD4A 2ZUVA 1AMYA 1XH1A 4D1IA 3QHNA 2C0HA 4ENVA 3W81A 1DTUA 3ARUA 4NRSA 3QGVA 3VIMA 1E6NA 5A2BA 3AQUA 1JFXA 4Q22A 3WUEA 4J3WA 2E8ZA 1BYDA 4ENRA 1GVYA 3WMCA 4AD5A 2ALWA 1LWHA 1V02A 3WY3A 2OYLA 1W32A 4QDMA 3D54D 1VF8A 2VX4A 2YL6A 4AW7A 1XGZA 4NXKA 1BTCA 3WQ8A 4CCDA 1C91A 1EHNA 2WVVB 5D9MA 2BS9A 4J3XA 3SCPA 3VX1A 4HU0A 3PZGA 4U2YA 4AZGA 4HA1A 4OGZA 4WKFA 3RM4A 2R1VA 4AZHA 2E0PA 1EHAA 1BGGA 1HVXA 3RDKA 4A4AA 4L7QA 1JYVA 1QNSA 4PMZA 2AB0A 2J78A 4AIEA 1NOFA 2F1AA 1UD2A 1AQHA 4ACYA 1PE0A 3AXHA 1HXKA 2J8GA 1V02E 2CBJA 4FNQA 4ZENA 2XF2A 4CN1A 2XN1A 5E0FA 5M03A 3R75A 3GRAA 1FFRA 4OOUA 3OA5A 1M04A 1KQZA 3RCNA 1OIFA 5CPSA 2DDXA 3FXYA 1KBBA 2G41A 2XJ7A 1JXKA 5D9NA 3AI0A 1JF6A 1U2YA 4LPCA 4PMVA 1MYRA 1VBUA 1WPCA 2YA1A 3AHZA 1PX8A 1IT0A 1E3XA 4UQCA 3EBVA 2VZUA 1OWQA 3WQ6A 3IJ8A 5EFFA 3CZSA 3WQVA 2WLZA 3SCWA 2YA2A 4PTXA 3VIFA 3G6LA 3RILA 4JQSA 1ONSA 4GPNA 4X0VA 3VU3A 1BVNP 1J10A 1E0VA 2IUZA 3MU7A 2WWDA 3BAJA 1ODZA 7CGTA 4X0NA 3WD2A 1TQTA 1LLOA 2ABWA 3D52A 3ER6A 1H3GA 4I4NA 2UY5A 1VENA 3B38A 1OGBA 3N13A 3T2QA 4D6JA 2Q8XA 1MFVA 1P6WA 3DX2A 1K9EA 3VNZA 4D6IA 1W1VA 1CBGA 3CUHA 3D5HA 2IUFA 4B15A 4M80A 4MDPA 5KEZA 4R7GA 2XWDA 3U5YA 3SCNA 1BLIA 4BQ2A 3AHXA 1E73M 4E4PA 4BQ3A 5LYRA 3S5ZA 1UOKA 1PDWA 3NSNA 3FY1A 3WDPP 4AZBA 3CZLA 4TVUA 1CGTA 1QF7A 3PQ5A 1LJYA 2W5FA 4OKDA 5A2AA 3L4UA 2JIWA 4JFVA 4NRRA 1V3JA 3NOOA 1PIFA 4P7NA 1L0PA 3WDIA 1UD3A 2BVDA 3AICA 5A6BA 3CY6A 3N9KA 1T0OA 3WNOA 1QBBA 1T3TA 3SOZA 4W89A 3W24A 3WUFA 1E1FA 1W3JA 4PMOA 3NSXA 1J42A 4OIFA 2D20A 1Q6FA 1UG6A 4H7VA 3FHAA 2FH6A 1GOQA 1JZ5A 1KXJA 1JAKA 4J3VA 4TVDA 4XZWA 4DWSC 1H4PA 1MXDA 2XWEA 4PCSA 3OB8A 1R86A 3W28A 1U33A 3NDYA 3CO4A 1GQLA 4CD6A 1GOIA 4ZDIA 3EYPA 3EJTA 5BXTA 3WD4A 1OX6A 1BHGA 1C90A 1CS0B 3ZOAA 2OSWA 1UH2A 3W53A 1IPHA 3GBDA 4IM4A 1JNDA 2VO5A 4XB3A 4AD3A 3A47A 3AHYA 3WY2A 4ACZA 3WKZA 3SURA 3VIPA 2GK1A 3QR3A 1VRXA 1VCMA 3AZRA 5BROA 1XSIA 3ARRA 2DSWA 5A69A 5FKYA 3VM7A 4BFLA 1XD0A 4NZJA 2DT2A 2YWDA 1KR0A 1HL8A 1TVNA 1CWYA 3B9DA 5AC5A 3PQ8A 3TTSA 4PCTA 3MKKA 5HXMA 1Z32X 3HG3A 2YDQA 2GHRA 3LRKA 2WSPA 4L8YA 1JVNA 1F4AA 2BFGA 5D8WA 4AIUA 1VEMA 3UG4A 4HPHA 4AY1A 2FGLA 4AD0A 4LQ1A 3AYRA 2QPUA 2ZX7A 3DYOA 3NOVA 2CBUA 4AC1X 1ZBKA 2CERA 3THDA 1GORA 1NWTA 1AVAA 3BAYA 3ZQ9A 2VMFA 2DSVA 3TTWA 4PUDA 3W38A 2W4XA 4Z2JA 3ECQA 4CU8A 5A8MA 3F5JA 4M56A 1UKPA 1QHZA 1A9XB 1DP0A 4UTFA 1KEEB 4PMDA 1RPKA 1JZ8A 4ZDJA 3A23A 3UR8A 3AXXA 3KWXA 4FNUA 3RM8A 4OFWA 5LA0A 5CSUA 4Z2KA 1FH8A 2ZICA 4Q7NA 2XIBA 3R74A 1ISWA 2J74A 1W1YA 4RE3A 3QOMA 4QYTA 3EZGA 5I3DA 3K46A 1EDTA 3U57A 4EK7A 5A6JA 4E08A 3ARPA 4HMCA 4WXYB 2E40A 2WPGA 2YIHA 3BUBA 3IJ7A 2NT1A 3HN3A 4NSBA 1Q6CA 3K8MA 3WMSA 1WL8A 3LXAA 2VZVA 3SUUA 3BAKA 3AS1A 1GCYA 1JDCA 5CLTA 2GVYA 2CCRA 2YJQA 2X2YA 4BTEA 1TA3A 1A47A 3KE0A 1UKSA 2E9LA 2VRKA 3JUGA 4Z2HA 3FNDA 4WINA 1WDPA 1VFOA 1CDGA 4LYPA 5F7UA 1Q6EA 1KGWA 1SMDA 3NDZA 2W66A 3CZGA 1WP6A 5BV2P 3TTVA 1J0KA 2BXYA 4P7RA 4Y1EA 5A6KA 3VSTA 1R7OA 2FDMA 4KGLA 5AY7A 4EAMA 1C3FA 5E1QA 4ENSA 1OSEA 3RO8A 1J11A 4H2CA 5I0DA 3PTQA 1CGXA 1UWIA 2RK4A 4H41A 4R5EA 2WCSA 1ZBWA 1K9VF 3OLEA 1HNYA 3T0AA 3TTYA 1K6AA 1WB0A 4GQQA 3B8SA 1V6VA 4MNJA 1F4HA 3AIBA 1C7TA 6A3HA 3MO4A 4AD2A 1D3CA 2A9VA 5JIWA 3VM5A 2E9MA 5I78A 2XVLA 1ISXA 1W9BM 2W63A 4HZ6A 2O9OA 1V0LA 2XM1A 5A8NA 4UZSA 3NJ3A 7TAAA 1C3OB 3VVGA 3N17A 3OG2A 3QHMA 1VFMA 3VIKA 1MQQA 3PZOA 4PTWA 2XGIA 3LRMA 1PZ3A 5LA2A 4Y1FA 3S2CA 1E6QM 1Q2UA 4QCEA 1RP9A 1JG9A 1NM9A 1R75A 1H11A 1E6ZA 1NQ6A 3MUAA 4LGYA 1JD9A 2AOSA 3VD3A 1OT2A 3E1F1 3TOPA 1UKTA 3GTNA 1UR8A 3DX4A 1KTCA 2DSUA 8CGTA 3ZR5A 3WQ4A 1QWUA 3VSVA 5I5RA 1ZJAA 1BPLB 3BUPA 1NP2A 4HMDA 5BXRA 4QLKA 1FFQA 2D22A 4UFLA 3ZO9A 4XZBA 4YN5A 3WF2A 1XSJA 1K9DA 2WMIA 3CZ9A 1OX4A 2YA0A 2XHYA 1JZ4A 1QNRA 3A4WA 1FHDA 1QVVA 2R1TA 4AEEA 1JGIA 3DX1A 1FP8A 3PQ3A 3WFLA 5HNNA 4U31A 4QLLA 3BLPX 1IV8A 4E5VA 2EJ1A 3MANA 5E09A 2F7PA 4ML4A 3BAIA 3FIJA 3IGUA 2VXOA 3WELA 4RE2A 3LXCA 2XGBA 1B3XA 4Z2GA 2YFOA 1U30A 1MW2A 2OSXA 2YWJA 4FNSA 1UWQA 1KXTA 2OYMA 4D6EA 3WL1A 3WNNA 2XFRA 2WYSA 3VD5A 1V3HA 5GPRA 4D6FA 1WE5A 4AMWA 1E1EA 4AZCA 3ARYA 1SY7A 1KB3A 1W1TA 4OGFA 2D7JA 1H41A 1GOMA 2YL9A 5GNXA 1NARA 1NP0A 1HJWA 4UFJA 3CUGA 4I46A 2LXNA 2ZXDA 3VIJA 3BVTA 3PZVA 1JDDA 3BSGA 5CSYA 1V6YA 1GHRA 3OZOA 1BFNA 7A3HA 2JEPA 2J7GA 3WD0A 3HG2A 5A6SA 5M5DA 2O9TA 4UOJA 3BWEA 5JZMA 1OX4B 4PMRA 3OLGA 3MUIA 4W7WA 3GNRA 1LL6A 1W9UA 2CYGA 4B9ZA 1NOUA 3B9AA 2VNCA 4GINA 1UKOA 1JI1A 2O9RA 5FL0A 4PUEA 2VOTA 5JBFA 3BUIA 1M6VB 3PBGA 3GXFA 1DWJM 3DYPA 2CKSA 2YWCA 1W9PA 3MI6A 1OM0A 1EH9A 1GOKA 4J27A 4AZIA 2WCGA 3ZJ5A 2NT0A 2EPLX 2VZOA 3KEHA 3ARVA 1N57A 4L8FA 4B5KA 3MMUA 1CGWA 4W88A 1K9FA 4MTVA 1J12A 2WKLA 4W8LA 4D72A 2RGMA 1ZBVA 4WK9A 3WNKA 5FD0A 1BVZA 5JBEA 4PEEA 1FA2A 3VDHA 4HZ7A 2DEPA 4NI3A 2XYLA 3QOKA 3GNPA 6TAAA 1E15A 2WW5A 4URIA 1SOAA 4BQ4A 1J01A 4AZ5A 4WIWA 4ENWA 2ZUSA 4MB5A 5BRQA 2EACA 4H8UA 2F7QA 4BF7A 5D8ZA 4W85A 4WJXA 1HJUA 3IANA 2F7RA 4CU7A 6CGTA 4ATDA 3NUKA 4LYQA 3ZJ6A 1GPMA 4Z2IA 5BXSA 2WBGA 1MFUA 4ZE4A 4U5IA 1X6LA 5DT5A 1B3YA 3CH9A 2VVNA 4MDOA 3GXNA 1CE8B 2ZUUA 1P7ZA 3W29A 2ZX8A 1E5NA 1BF2A 1LL7A 3P9PA 4CGTA 4W86A 1MW1A 4ACZB 1VCOA 3VO0A 2EPMX 3AMKA 4ADSG 4JHZA 1QX1A 3WH8A 4GXPA 1GNXA 2Y24A 1CIUA 2XUCA 3I3BA 2XSBA 3BLBA 3FW6A 1UYQA 4M8UA 3EJQA 4TOQA 1YHTA 3K1DA 3EMQA 4C7DA 2ZOXA 4B40A 2PWFA 1MW3A 3U7VA 3PTKA 3RPMA 4UQ9A 3VX0A 4RE4A 2WHMA 3VINA 3S5YA 1UWRA 5C70A 5A8QA 1J0YA 3NVAA 1GHSA 1CPUA 4MNLA 3EFEA 3BVUA 5JIPA 2VTFA 5DO8A 3VOCA 1EDQA 2V3GA 2J7FA 3BLKA 5I23A 1O7DC 4JL1A 1C8XA 2WM0A 3MUY1 2W62A 2OSYA 1WO2A 1CEOA 2WAGA 1S1MA 2VDJA 2WZHA 3H54A 3WNLA 3WY4A 4BS0A 3KLLA 2Z1KA 1H5VA 5SYAA 4KH2A 3L4WA 3MS8A 3DX3A 2F8QA 4FNPA 3SUSA 1G2IA 2OW6A 2E8YA 1UR4A 1JZ7A 3P9QA 3WBAA 3SF8B 4OOZA 3HJEA 4W87A 5IDIA 5A6AA 2G3NA 3K4AA 3CV5A 2O92A 4MTCA 1VB9A 1AQMA 3K8LA 4AUMA 3A21A 4P36A 1XH2A 1E3ZA 2VKTA 1HT6A 3VGDA 1DHKA 1E70M 3HU7A 3SCSA 3WF1A 3WD1A 1MVYA 1Q4NX 4GZJA 3IAQA 3HG5A 4CVWA 3K8KA 2MANA 1CF9A 2D73A 1TR1A 2A3EA 2ZX9A 2JE8A 1WZMA 2X0HA 1E0WA 3O6AA 3BCDA 4L4OA 4JFUA 3VIGA 4BQ5A 1CLXA 3APGA 5DEZA 1GJWA 1UR1A 1FY2A 2WNWA 3VMPA 4F9JA 2Y2WA 5ECUA 3BMWA 1TQSA 4FNTA 5C8BB 1WZAA 4M1RA 4B16A 3UOWA 2WANA 2CESA 4ENTA 1TVPA 3BAWA 1HKKA 3AIVA 3II1A 5BXPA 1EGZA 1GONA 1HN1A 3NIYA 1K9TA 1CLVA 3B3AA 1V6WA 3VGGA 1E43A 4DUXA 3AMDA 3WQ5A 1O1YA 4OGGA 3WEOA 4AXNA 4NZFA 3T0BA 1V3MA 4D6HA 4GZEA 3ZR6A 3DX0A 1MWOA 4Y1RB 1B3VA 4Y1RA 3OT1A 4FLQA 3F5LA 1VIWA 5A6BD 1TQWA 4PRWA 1XYZA 3SCTA 3QHOA 3RHTA 2CIPA 2QHAA 3SEPA 3NORA 1J18A 2VX5A 2YWBA 1HX0A 1R87A 3WDQA 1EO7A 3OBAA 2D0GA 9CGTA 2GJRA 1KXQA 2WBKA 3SCOA 1R7AA 2BVTA 3WF3A 3POCA 3EDJA 4JIEA 2ZX5A 2V3FA 4FNRA 4AEFA 1UH4A 3T2PA 2CBIA 3GZAA 3PZMA 4TX6A 3G6MA 3MSDA 4PMQA 1H49A 4JKLA 4D71A 2A3BA 2ZWZA 3BUDA 3BUQA 1UWUA 1QHPA 3S6TA 1VJZA 5DF0A 2YLAA 2WVVA 4AD1A 5EB8A 1E40A 4Y7EA 1LF1A 4AYSA 5CGMA 3CMGA 4J3SA 4QFUA 1QVZA 2CBVA 2WSKA 1V3IA 3SUVA 1QWSA 1QPKA 1CECA 1FH7A 3F5DA 1WDRA 1WDSA 1ZBCA 1KWGA 5EBAA 3VIOA 3ZJ7A 3TTOA 3GNOA 1R46A 2OW7A 3H53A 3ZJKA 1B9ZA 3ALFA 2ESCA 1UCFA 2G4FA 1E9LA 1VEPA 2DPEA 4AISA 1V0NA 1ZS2A 1ISZA 1W1PA 2EPNA 3CZJA 1HKMA 2FHBA 2NV2B 4LXFA 4E8DA 4GZIA 5KZ6A 1OIMA 4WSJA 5A2CA 3AROA 2DT3A 4AZ7A 3MMDA 1E4IA 4FK9A 1FH9A 4MAZA 2BNJA 1S46A 2GJXA 4MB3A 3D51A 1UR9A 2XVPA 1E6SM 4UOQA 1NWUA 2YBUA 2FHFA 2YDRA 3N7TA 4I2NA 4IISA 1QI4A 3A6OA 2YLLA 5AYIA 3TQIA 2IGTA 1JD7A 1HP5A 3ZM8A 4V2XA 3AFBA 1GOOA 3WD3A 1FOBA 1KA9H 4P5PA 1SFSA 2H2WA 3BCFA 3AS2A 3W6LA 1CGUA 4JL2A 5I6SA 2WVTA 1TE1A 2F61A 1HKJA 2NV0A 1N82A 1PBGA 1WNOA 2WMGA 1OB0A 3KLKA 2BHUA 2Z1SA 3TTTA 3VD7A 3DYMA 4E2OA 2WMJA 4FLSA 3L4VA 1DWAM 4C7FA 1XSKA 4P8UA 4B3KA 4UQEA 4KWUA 3TTUA 3BAXA 2RK6A 2NSXA 2VC9A 3EDDA 1EDGA 3HZ3A 3AJ7A 5GNZA 3OZPA 3ZJ8A 2EXOA 4N0MA 1JYXA 1ITCA 2AD5A 2V5CA 1BYBA 5ABHA 1IZKA 4CCCA 2W7TA 3VSUA 1BGAA 1R85A 3T08A 2F1BA 3CUIA 3N04A 2YL8A 1BQCA 1V03A 3CHDA 3T0DA 2X09A 1HP4A 3WF0A 2WZEA 1SZNA 3O2LA 3SCVA 5EFDA 1Q6GA 2VJXA 3VU2A 2QMJA 5A8PA 4QLJA 2VT0A 3EWNA 3L18A 2JALA 2GK3A 1V08A 3TTQA 2BY2A 5LA1A 1CTNA 4ZFMA 3VNYA 4WLCA 1W9XA 1I1WA 3GYCA 1VHQA 4L78A 3WQWA 4TVCA 1MXGA 2UY3A 1LQ0A 4UQBA 1SR0A 2IXVA 5A6LA 2PWEA 1B2YA 4HA3A 3FAXA 4UFKA 4CCEA 2WVSA 1TUXA 1V6XA 2XN2A 1W3KA 1E55A 3CUJA 2VR4A 3WDRA 1QWNA 2G3IA 3N1AA 5BYWA 4MADA 5JBDA 2W92A 1TZ7A 5GNYA 4U3AA 3EDEA 4U3CA 3L7NA 1WDQA 1ZU8A 4P34A 2X2IA 2J77A 2VZTA 3EJUA 1BYCA 4XUYA 2WC4A 4P8WA 2VL4A 1JIBA 2DGAA 1NOWA 4CKQA 4RKWA 3WDHA 3VGFA 1H0GA 2CHOA 2CHNA 5D9OA 1JFHA 4JCLA 3L4XA 4XLLA 3PZUA 1GVIA 2YFNA 2E4TA 1H1NA 2F2HA 4NF7A 4XV0A 2VQUA 5CJ5A 2VZSA 1CXHA 4UQDA 3DDFA 3EJ6A 1OGGA 3LPPA 2Y5EA 1BG4A 1UWTA 3WNMA 2ZUNA 4UFHA 2VCAA 1X1NA 1HVQA 3K4DA 4TXEA 1V0KA 2O9PA 1UZ1A 2JEQA 2ZUTA 3VDBA 5FOOA 2FYVA 3NYDA 1BSIA 2AMGA 1XYFA 1MQPA 1CYGA 3L3BA 3RIKA 2OWWA 4S0ZA 1UZ4A 3EJSA 3VUPA 3W0KA 3VMOA 4FF5A 3RJYA 2J75A 1EOKA 3PQ4A 4W8BA 2QF8A 2WMFA 4HP5A 1CNVA 3EDFA 5A6MA 2WHLA 4BA0A 1HIZA 1CGVA 5BWFA 4UFMA 1XCWA 1XC6A 1QBAA 1M53A 2WMKA 2V3EA 4PMUA 1O6IA 1QW9A 4AIOA 4JHOA 1GGEA 2C8NA 4JCMA 2D0FA 2EEXA 2WHJA 4MNMA 4S3KA 4DWSB 3NONA 2JIEA 3WDJA 1E71M 3ZMRA 3OT1B 2PBOA 4WF7A 3KZSA 2VX7A 4DUVA 3WUGA 2CXGA 1CGYA 4J28A 4QP0A 5FIPA 1KQYA 2J7BA 4AZ6A 3HG4A 2OLHA 3EJPA 3CZAA 1A3HA 1V3KA 3CZNA 4L4PA 3UJNA 2X0YA 4ENQA 1BAGA 3VILA 2ZUMA 5A94A 4B9YA 3M6DA 1Q6DA 1QVBA 1W9VA 4WKAA 5AYBA 1WKYA 1BXRB 3KKLA 3PZ9A 1E72M 1JI2A 1DWGM 3VIIA 3BSHA 4Y0NA 3MSGA 2DIJA 4HTYA 4AD4A 4F79A 1H09A 3B36A 3BH4A 4FLOA 1B90A 4U5KA 3THCA 3CBWA 4QAWA 5SY9A 1UA3A 4UQAA 4B3LA 2YKKA 1L9XA 3N18A 3SCRA 4S3JA 1G1YA 3UETA 2R1TB 3LMYA 5K4AA 2CPUA 2VPIA 3AS0A 2J4GA 3GH5A 4N12A 1M7XA 3A5VA 2ZIDA 2WZIA 1VFFA 4W7UA 1PX4A 4DO5A 3WMBA 3ARWA 4PXYA 1GG9A 4ZE5A 2UY2A 2XVGA 1GOWA 1XD1A 1KWKA 2PC8A 1JF5A 2QMKA 1T0BA 1PV2A 4P7LA 1QHOA 2DSZA 1UHVA 3I3EA 4FMVA 1GGJA 4M82A 2GK1B 2WKGA 4GKLA 2WB5A 2G8ZA 1WZLA 5JZOA 3WBEA 3WH7A 2HISA 4QCFA 2BHYA 4V28A 1IZYA 4JKMA 3WNPA 4ZXOA 3D4ZA 1DWHM 1Q7RA 2J8FA 2PI6A 4MPKA 4GE3A 4W84A 4MGHA 1GJUA 4H8VA 3W37A 3DHPA 4GQRA 1EOMA 3WENA 3D50A 5CLWA 1RH9A 2JF6A 1KGUA 4HCJA 3ZJ4A 4PN2A 1CXEA 4AUNA 3WH9A 2Y4SA 2VVSA 3PTMA 3AIWA 1CXLA 4CVUA 1E5JA 1W91A 4CD5A 4QYXA 2W61A 1C8QA 5CPTA 8A3HA 3BVVA 1C92A 2J7CA 1OINA 3SUWA 2EADA 3CYFA 1G94A 1CXFA 4ZGGA 4HU8A 3UERA 1NWSA 2DQXA 3CHFA 1GQKA 4PYSA 3SIMA 3AMCA 3IK2A 3WN6A 1GQIA 1US3A 4FLRA 4W93A 2RGLA 4GO9A 2R1UA 1FHLA 1HJXA 3SCUA 3MUZ1 3CUFA 3ZT6A 4LGXA 4J3UA 2WVUA 3F71A 3SUTA 5HPOA 3ARTA 1CZ1A 4PSPA 4HPGA 4A3YA 2J62A 1M03A 4PMYA 3GH7A 1JZ6A 1OD0A 4M29A 2F7OA 1H2JA 4V27A 5CPQA 4ATLA 5BCAA 1B1YA 3EMZA 2V5DA 2ZXBA 2WHKA 3KL3A 1PEZA 4UFIA 4M81A 2X2JA 1W2VA 5BRPA 4MNKA 3CHEA 1I7QB 4P8VA 3WF4A 1EO5A 4N0RA 5CQ1A 4J7RA 1US2A 3CZ8A 2BY0A 4AULA 1FYEA 3POHA 1E4NA 3VGHA 4JAWA 2FGZA 4EE9A 1ECEA 3B9EA 1QNOA 2WJZB 5M3WA 1V3LA 4U33A 1AQ0A 4DO4A 5IHRA 1HL9A 3GXMA 2XVNA 4R27A 1XH0A 3GBEA 3NOQA 2J47A 3AIEA 1OBAA 3RMEA 4A3HA 2VCBA 4L8WB 3VD9A 1I7SB 1D7FA 3VDAA 4DUWA 1QVWA 2FHCA 2G3MA 1EQCA 1J0HA 4CN6A 1V0MA 4EANA 1EA9C 3FAWA 3SF8A 2XFFA 2JF7A 1FP9A 2VUYA 2WLYA 2VRQA 5I79A 3T09A 1UASA 3CHCA 1EXPA 3BVXA 2ZUWA 2X8RA 3A3HA 1HTYA 2VCCA 5IP5A 3O9NA 1B31A 3AYSA 3PQ7A 3IAPA 3P9SA 1QOXA 3AOFA 1JAEA 4HA4A 4GUDA 4HMEA 3AIRA 1QNQA 1W3LA 1B30A 3N15A 2EABA 4YPJA 3RM9A 1QI5A 2WMIB 2V3DA 4DM2A 1JYWA 1G9HA 1E6XM 3L4EA 4M24A 1VJSA 5DMYA 3AZSA 3GDBA 1MW0A 1UD6A 1G01A 1EIBA 2G3JA 3I3DA 1LG1A 4TUFA 3MIIA 3BHNA 4KRTA 4ENPA 4GI9A 2PB1A 1QW8A 1QNPA 2DIEA 4HOXA 2XVKA 3UG3A 3UG5A 3VGBA 2XPKA 1P80A 3UEQA 2TAAA 4PTVA 1M01A 4OJYA 1JZ3A 2ZWYA 3CNEA 1GPWB 3M07A 2EO7A 2PF0A
chains in the Genus database with same CATH superfamily
3UZEC 3STUA 4X5WA 4OZOA 1SMKA 4Z5RA 2H08A 4M9XA 3BDAA 2BXZA 3CFNA 4UTAH 1UR2A 3TN4A 2IEZA 4B7AA 4C57C 1M9HA 3MMZA 4UBNA 2WJGA 4YT8A 2Y8VA 2Z31D 4KUCF 3DOFA 2AUTA 1NG9A 3RUPA 1BDJA 1ORQB 2A0NA 2GGJA 2JW5A 5T1DH 3WFEL 3GJSA 3ARXA 4B31A 3TSWA 5BVHA 1TZZA 3PP3K 2W0LA 3AERB 1YUHB 1YKGA 3F9IA 2WW8A 1VFHA 1VLJA 4I36A 1HUQA 4D9RE 3HCCA 5K6RA 4GQ0A 4GW4B 2WV7A 5KBKA 4BJ1A 4KXMA 4IOFD 3LT5A 3SGGA 3H9EO 2ZVIA 1R7RA 2DVMA 3GW0A 2HT2C 3G9XA 2E85A 5JIBA 4WOCA 4MA1B 3G5ZA 2XTJB 3AXMA 1FP4B 4AHOA 3T35A 4MY8A 1C9MA 2F54A 2Q2LA 1X1CA 4XSMA 3I39X 4UQPA 2RFXB 3VNRA 2D0HA 4S24A 5KTKA 2I2CA 3OGSA 4FQHA 4HNAA 1FHNA 5CD5D 1MIHA 2FZNA 5BVJA 3KZMA 1CTOA 4CVNA 2H3EA 4OJDH 3O8XB 3EOAA 3BMQB 3IB6A 2AKAB 1TR7A 4F21A 1I80A 4MAVA 1NUGA 1F00I 4EP1A 1Q0EA 3DURA 2H7WA 2AEPL 5E2VL 2Q3BA 3RV4A 4LNUA 1CP2A 3V7FA 2P5WA 4NAEA 4D0GA 3IUQA 3CWNA 3KPLA 2D7NA 4ZO7A 4LY8A 2WNIA 1L0QA 1XMSA 1HZHL 3S28A 2YD3A 5LYYA 2B8WA 1KARA 4DNMA 3V2GA 3KYBA 3QN3A 1DKQA 4EENA 3PM6A 3S96A 2GT9A 3QY9A 2JK5B 3WJJC 3JR7A 5D7IA 3TN5A 1RIIA 1UH3A 1V8DA 1WXXA 5I9IA 1B6GA 4BH7B 3EB9A 4MD4A 3W3AH 3BXZA 1KVSA 3Q2WA 3F58H 4KKZA 3UZUA 1XNRB 1X1SA 4G7EA 3KCWA 4DJFA 3PDHA 3WK6A 1RZKL 4ASTA 3BMQA 4DIOA 3ZNOA 1XEWX 3AX6A 4W1SA 5IC6A 3WGVB 3CMOL 2QR0A 1I1QB 1UKQA 3M1OA 2HQAA 1NLBH 3HQOA 3AR8A 2Z91A 3GUVA 2QUZA 1M42A 2PR4L 3GVRA 3C6SA 4LRXA 3BQNB 3EEYA 2NV6A 2CL7X 4C6SA 1K63A 5JH7B 1J48A 1DWIM 2Q5HA 4Z4CA 3L54A 1EAPB 5CP3H 4NN6C 3TA3D 4EBFA 1ORHA 2I2XB 5FYLL 3R2GA 3B8EA 2K5UA 2O2JA 4HB0A 4B5VA 4CSZA 3M1BA 4NJEB 1OCQA 4FE9A 1T21B 3TS8A 5CG7A 2J6IA 1T1XB 1UP6A 4J1OA 1B43A 2GI7A 2WPDA 1RJ9B 2VUSA 1PTKA 4A6EA 3N39C 4G8FB 4LV6A 2H0RA 4BFTA 3OTQA 2QFRA 4QHUA 2XFYA 5ALZA 2BIQA 3CMJA 3AKDA 2F84A 4HLZG 3JQ7A 3CVDA 2YBRA 4Y5YA 5FECA 4RSYA 4PPGA 4C3UA 1I2DA 1O4WA 3U6RA 3UP1A 3V7AG 4GX5A 3ECBB 4YFDB 1UEJA 2FDSA 2YWZA 5NLLA 2OHOA 1JKFA 2JASA 5GZOA 1NNUA 2ZJZA 1CF8L 1B0ZA 3ROLA 4AQ8C 3CPUA 2J7DA 5AN7A 1K2DA 1YQVL 2WNHA 4FDMA 2ZJ4A 2XYCA 5C46F 5KTYA 3GGDA 3OM8A 1GTL1 3BGVA 1GC1H 4RD4A 4F6LA 3A7DA 3BC9A 4FXLA 4QE4A 2BZ0A 3PFFA 1HDMB 5BN5A 2AKZA 2ZZ6A 4QNNA 2G5BA 5CZSA 3WEMA 1XPGA 1RLOA 2JB9A 3L1UA 1XDDA 3MBWB 3WRXA 1AC0A 2BDQA 4WI1A 5B30A 4RESB 5FR2A 4GT0A 2WVGA 2GYSA 3CWZA 2GTZA 3RN6A 2OR9H 1OAYL 1NFRA 1S02A 3PJEA 3UMJA 3ULUH 1S5WA 4JL5A 1ZUWA 4QEEA 3IRUA 1C93A 1J1XH 4UB0L 2Q9UA 1N4AA 4WSHA 1N36B 1EXNA 5B4VA 2BP5M 3OVPA 3CA8A 5IFHL 3ZJTA 4GOMD 1K2VN 2NLYA 1FZJB 1RVFL 5LLSA 4DM1A 4NZ4A 3NM6B 1UTDA 2HFEB 5ABAA 1WHTB 1HSBA 2V2HA 5T5FL 4BY3A 3ENQA 3L9WA 5DQPA 1J8HB 4FYTA 4KRNA 3LF1A 1GZQB 4OLUH 3NGFA 4F48A 1SOQA 2JJQA 3G5VB 1MOPA 4R9OA 3QMSA 2IS2A 4GVIA 1IQRA 1FFBA 4G1MB 3H55A 3J80A 1NE7A 1GKPA 5DJDA 1SHMA 4V1DE 2VNAA 3FA5A 3CJPA 4L16A 5BWBA 5DJ6A 3OGOE 3FU0A 2E9JA 4NASA 4OB7A 3EVZA 5C7IO 2WK1A 4MJ2A 3RTAA 1IILE 2CV2A 3H9ZA 5BZXA 4YPGA 4WSGA 1MN6A 2WQAA 4E1BA 4H4IA 4E5NA 3LN3A 4R9SA 1ZGHA 1R4ZA 3E5PA 2ICCA 3K8YA 4MHBA 1I14A 1GQQA 3DMPA 3Q88A 1XGDA 1UZHA 4DNXA 5I9NA 2DH3A 2OORA 1FU7A 3N87A 3F58L 4WGHA 3WFCL 4N9WA 2QMOA 3T42A 4OO3A 4HRVA 3MSCA 2PCXA 4RZ6A 3D3WA 8ABPA 3LZDA 4JFDB 4XXCC 1KBPA 5ESXA 4Z54A 5I24A 1NT4A 4MUPA 5HGDB 3G0GA 2GCYA 1DJWA 1Q9KA 8FABB 5IGXL 1SO6A 5ID1B 3LNPA 3U36B 3P6LA 1ULTA 2ZZMA 4ETQB 2LV4A 2ISQA 3C74A 4QEDA 3GA0A 1A22B 1M0TA 4F15B 2IYAA 3AITA 4NZPA 4XI9A 2DT0A 3WY1A 5C92A 2WWCA 3WLLA 4U63A 2BGKA 4UHKA 3TAHA 2CCJA 1NVBA 1R47A 2HFTA 4QHMA 2FKAA 1YHNA 4QGFA 1G3IA 2XHNA 5KWSA 2C4WA 1R3UA 2F1RA 4KRPD 3K5WA 4HU2A 3GHRA 5B2EA 5AWFC 2VF2A 4FG2A 4AUJA 1H0KA 2RGWA 2R0LH 3U6KA 5C7HA 2ZUVA 2J4WL 3QHNA 3PQDA 1CTMA 1TVHB 2PJUA 2FZMA 5GS1B 5K51A 2YWXA 5ISZA 1C1XA 3LHSA 3L7DA 3T3OA 2DJ4A 1TOXA 2AXFB 1IBGH 5DJYB 5IJ0B 1FP4A 1FFOB 1IK4A 4LJ9A 4TNEA 2OYLA 1JFLA 5HQ3B 3TSCA 1PYDA 1NRWA 5JEDA 4KPEC 3HACA 1E9SA 2N3JA 3D5QA 2CUAA 3WC4A 1CG9B 4NYUA 1DBKH 1SUCA 3GXUB 4RENA 3URQA 5D9MA 3LUJA 2ZF9A 2AC4A 1WC7B 4RETB 1PNQA 1NFFA 2BFVH 3R9IA 4FOUA 3UAWA 3BW3A 2YXDA 3RM4A 3VV3A 2R1VA 2QGNA 3EDCA 1CIVA 2FQYA 4CMEC 4L56A 3L7OA 2G1UA 2P0EA 4LFHG 3ZTWA 1N7IA 1H3NA 4L7QA 3GYGA 5LIKX 1AGCA 2HPTA 2YCEA 1FL9A 4DMCA 3VPCA 4WFJA 1EZVX 1XYBA 3VOIA 5JDIA 1DEEA 2J55A 5A40E 4IGHA 1N6HA 2OUIA 5CNKA 4K8RH 5EEYA 3DUWA 2ZOTA 1EG2A 3R75A 1QLEH 2G4JA 1E1RA 3T65B 3K4PA 1QM5A 3T94A 1OIFA 4MICA 3P0XA 2DHCA 5JFGA 1RQHA 4RGNB 3DFKA 4ODUB 1DC7A 5IH3A 2GIXA 5CR8A 1ZGLP 1U2YA 1UYWH 1XR8B 3CJJA 4AVJA 5HKLA 1C2YA 4QFCA 3U46A 4CM9A 4AG3A 4DLVA 3MVIA 1VM6A 5E4OA 1NMAL 1WEJL 3DFQA 4BAUA 5KMGB 1L8AA 3S8HA 2EZ4A 3C60A 1E0VA 3BMOA 3P0VL 4HS8L 1L1QA 3EUEA 2WWDA 3AQZA 1C0IA 2QD2A 1PTZA 2IELA 1AKVA 1JE0A 4K6CA 4FE3A 4GRMB 2ABWA 1SZEA 3WKYA 3MG9A 3ROMA 1O96A 5EPEA 1ZZMA 4Y6RA 4P04A 1CQIB 2I07B 2TMDA 5HNRA 5HATA 1T1SA 4RSVA 1IZ0A 3ET9F 5ESVB 5LYRA 2V33A 2MHCA 3RZCC 3TM5A 3N0XA 3F7JA 4J3OG 4OLEA 5E08L 5F5NA 5A4DA 3L9RA 4ERGA 2RH9B 4O02A 1TO3A 4BFUA 2EYQA 2QRJA 4YFVA 4LEXL 3V8VA 2HA5A 4E33A 5L8VA 2ANBA 2WWHA 2XZLA 1TUFA 4MZ3A 1JR3A 5I15L 1JT9A 2VC2L 3NRFA 5JYEA 1EFLA 3RDTC 4M98A 1N2OA 4GF5A 4W89A 4EHAA 3CFDB 5A62A 5E94B 3ZL4L 3ILQD 2B83A 4H0GA 4IOTA 2PDNA 1B2LA 1NFDB 3PUVA 1SUSA 2J56A 1J9CT 2BJML 2G08A 1ZE3H 1GZGA 2FDRA 4DV1B 4MZIA 5F1OB 4O2LA 4HJUA 2QZ4A 3INNA 2DKFA 3DCNA 4PLFA 4CDRA 1INEH 3NDYA 4MQTB 1AB6A 4EMBA 2VSNA 4LBWA 4BDVB 4PN7A 3C9NA 4FNAA 1WBZB 3UKDA 2IIJA 1UT8A 4S1QL 5JSQA 4LZPA 1T5LA 5E51A 3RR4A 3TPUA 4MV1A 5ALIA 3VR5H 3OM9A 2R23A 3VOFA 1WWWX 1XJ5A 5TDOA 1USKA 2DBLL 4IIZA 3QQ4B 3L0CA 2CLZA 4G63A 2GVNA 3VM7A 1LJLA 4H7EA 5ESDA 3HM2A 4DLXA 4MRCA 4UZFA 3KJ6L 4FQQB 3INYA 5BR7A 4F5WA 1KR0A 1HL8A 1X1OA 2Y7OA 4I3RL 3GBNL 1ZUHA 3O8BA 4O02L 3IVGA 4ZFGL 1JQBA 4FLEA 4PPQA 1V45E 3N34A 2OECA 2IG2H 1L5YA 1C16B 2AEOA 4LU5L 3B9KA 2H2PD 4HWEL 3OBKA 5E4YA 2EIKB 5C08B 1PFKA 5E0KB 5JNLA 4U7JA 5JW5B 1G3MA 4G6FB 3QKSB 4AD0A 2VQFB 2ZTHA 4ZS7H 4JI3B 2PU5A 4QIUA 3IVMA 1CVIA 3DB2A 2XSKA 1L7OA 3BIBX 3TIEB 4C0LA 4OHXA 1NDMA 1YHZA 3C4JA 4HUMB 2CERA 3THDA 1LRJA 4L22A 1BTOA 2DR0A 4KNVA 4EKGA 4JOQA 4LV9A 4DGSA 4NWUL 4OHFA 1LTXA 4HDNB 4P2RB 3OD1A 1YULA 1C29B 4F1WA 1O58A 2CFOA 3GVXA 3F5JA 3S3DB 1W44A 2D2FA 3RL2A 1JYEA 1X7QA 1QHZA 2I67A 4IAOA 4Y7CA 1F8XA 5HJEA 4JKPH 2XG4A 3S1AA 1CI1A 4G4SP 5FCDA 2XKKA 1PS8A 4YGYA 1EE1A 1U9KA 4YHML 4C4XA 2VBIA 4U7FA 1EFQA 3MI3A 2XSZA 4Z2KA 5IJXA 2TRHA 1AKYA 1HAWA 3HP1A 1NQ5A 2XKNB 2K4WA 4LCCA 2FAUA 3N85L 5J8OA 1ISWA 2PO5A 2QVYX 3I9KA 2C1PA 1TJHL 1KCRL 2GUGA 4Q48A 2C9QA 1MZHA 2ZIFA 4CAGA 2WZ5A 3KWUA 5A6JA 1P6QA 5IXJA 2Z2BA 2PW1A 3VAZA 3ERCA 3DFYA 2ZIUB 2GB2A 1M05A 4FRWA 3C70A 1WL8A 3CSPA 1Y5VA 3JXEA 3JSAA 4HYEA 3QEAZ 2OB2A 5C1MB 1Y18B 1GCYA 3RNDA 3KXFA 2ERJC 1RYNA 5DX7A 4PX5A 4IMLA 1SCQA 4B3MB 3QG1A 1QQTA 3DX7A 3WTCA 1QR1B 4O14A 1NG1A 1YQTA 1F3RB 1AYOA 4FEEA 2W9DL 3DO6A 4W9TA 4OOFA 2EDFA 5CW1A 3NFPA 5DZNA 1U2TA 4YUYA 3GDHA 3C4UA 4QA9A 2VLKD 4MGEA 1FIEA 3VFTA 1UMDA 3RI5F 4KGLA 2VK8A 3TW4A 3NG1A 2EYRB 1IM9B 2EIEA 4TVSa 5DJ0A 3MGTB 3NCWA 3C5CA 4LV5B 5B80A 2MNJB 2W4QA 1R3IH 3FMPB 4P2RE 2JJTA 4R3UA 2FN9A 4BNHA 3OVUB 1K5DA 2QZJA 4G7VH 5B1DA 3C7KA 4BC0A 4I4WB 1K66A 2QGYA 2WZPD 2R7AA 2W63A 1YVUA 2Q3MA 3O3EA 2IOFK 4U2EA 4ALAH 1PR5A 4MQSB 5DLDA 3NANA 3N17A 3OG2A 4ZFFB 1AP2B 2WNGA 4GPVA 4PGCA 1W4RA 3PWJB 3RVUC 1YE4A 1VRDA 1RE1A 1M1YE 3DFIA 5DW0A 5CVDA 4KVCL 4CM4B 5JUEH 4BWYA 5CLLA 3RAJL 1FZMA 1E6ZA 4X7RA 1QZXA 4P3OA 5D93B 1E9ZB 1OT2A 4Y5VC 1JCLA 1NR7A 4G83A 1NW8A 5F9OL 5HJ3B 5DB4A 5ESAB 1S7QA 1QBLL 4ITVA 3VOSA 1VIMA 4YCNA 5DUML 3N0VA 2Z1PA 4JLMA 4Z77B 1AMKA 1XZFA 3BANA 2P1YA 3QX9A 2ETWA 8XIMA 4QLKA 1D6SA 3ID6C 4L1BA 1I85C 2WXRA 1JKXA 3QSGA 3BPNC 2YZ8A 1OX4A 4PJXB 3WS7A 1M34B 2CLLA 1HT1E 4HATA 3W2NA 2QRUA 4BCCA 1G7TA 3KQOA 5E6RB 5TB5A 3QEQE 5AVUA 5A2IH 2BH9A 4TQGA 3BN3A 3NZGA 3V5HA 4KPGA 2KQMA 4FA8A 2DQSA 2E1WA 4RC9A 1E1MA 1KI4A 3MDUA 1N25A 2VXOA 2YFOA 3TEJA 1QATA 3L3GB 4N6NA 3I6SA 4D6EA 1GEHA 2IEYA 3BJ91 5BXQC 2J3JA 1ZXKA 5D1QB 4EF8A 3PUJA 4MXWH 4OGFA 4D8PB 4MBOA 1HSOA 5KREA 2RDWA 3CUGA 4G2DA 2VDNL 4NNPL 3V16A 5CBKA 1TTHA 4DV4B 3BVTA 3C5SA 1EBPA 3BJZA 5JDCA 4UT6L 5E2WH 2PQ6A 2PF6A 3DZJA 1L5MA 1TVBB 3VG0L 1M8GA 5BN4A 1GSKA 4OJNA 3OE5A 2NDGA 4JTKA 1T9AA 2X1RA 4FQXB 4NKMA 2CYGA 2QKSA 3O8OB 3L07A 3OEHD 4QT0A 4KNYA 35C8L 2O9RA 3VTFA 3G9VA 3BUIA 3DYBA 1ZC4A 1V96A 1V9CA 2JKLA 1SPDA 3FU3A 3B1TA 3V55A 2CWDA 3EKCA 1FNMA 3VSEA 3AHHA 3U4HA 3G8AA 1G0XA 1F41A 1TREA 3X2QB 5IMMA 4Z95H 1CUWA 4ZD6A 3AI3A 1ZOIA 1KBQA 3MMUA 1CJBA 4C2BA 3SGEH 4QASA 2F1IA 4GQZA 4V1DA 3GMMB 3ZQXA 4HALA 5FWRA 5TJHA 4DESA 3V5HB 4MA3B 2XH7A 3WA6A 3BKJH 3KWWA 4MYUA 2B4AA 1Y6FA 4TM9A 1J5TA 1ASPA 1KPRA 1P4IH 3O15A 4MCHA 3MS4A 4E0CA 3GO1L 2XICA 5EJ4A 1AKQA 4IT1A 3TNMA 4NU5A 2KLSA 1KJMA 2OAAA 4XWGL 5K9QG 2IYPA 2OYRA 5K8JB 2YB1A 3TLLA 2JCGA 2HJFB 3O3CA 1DKWA 1MFUA 2BS71 2HZGA 4CVZA 1X1AA 5HJ3A 1WBJB 4P80A 3VTZA 4UVEA 4MDOA 1F6WA 2GETA 2ZUUA 3VA8A 4QGCA 5CKGA 2DZEA 5LZ8A 1BF2A 2C3PA 1XZDA 5DTIA 4PCAA 2WDZA 3ONVA 2ADFA 4MVJF 2DW7A 3GWQA 4YAUA 5ITVA 5FW7A 2LVCA 4YMSA 2Y24A 2QZZA 4M8UA 4RSRA 2WSQA 3HUEA 4CCWA 1AQIA 1UBJS 4JVMA 1W4ZA 5HFJA 2PWFA 3HOGA 5AJWA 4AEHH 4WXHA 3B0VC 2XHEA 3PXBA 2JL1A 1RKXA 3U4MA 1PBYA 1J1PL 4IMRA 3ZD7A 5JIMA 4A5OA 1P3JA 3CVUA 3NVAA 4LCUA 4JB3A 3FL7A 4LCUB 5DO8A 3VOCA 1EXVA 3JAKA 5GRYA 4G80A 4E5XB 4D0BA 4HHEA 1J5DA 2GGGA 1NP6A 2G60L 3BLKA 3ILPB 3WMLA 4S3EA 1VKHA 1OHHA 4ELME 4YDLB 1H8LA 2WXNA 2XXMB 1Q0RA 1FWTA 4DLPA 4MWAC 4DAGL 2P9CA 4P3NA 1X2BA 1XU9A 4KCGA 1TJ5A 1ZALA 4BKNA 2H3NB 1WV2A 3MS8A 3I73A 5G0WA 5EMLA 1AO7B 3AC0A 3SK0A 3INPA 1P5JA 3ZD8A 4Q6JA 3D3NA 2CLVA 5A6AA 1DAPA 4PZCA 1W5SA 3IRCA 5TH2B 4LDRA 2R2CA 4HJEA 1C3LA 3MYZA 3U7WH 3DBVO 1HYRC 1ACLA 2D7OA 4LP5A 4CQDA 1RIFA 2SFPA 5FEUA 4DN3H 1XRLA 2JC3A 4OY9A 1MP0A 2MUCA 2H5EA 1CF9A 3B43A 3HMQA 3D2UB 1Q95A 3GCWA 4EY8A 1MY5A 5AEAA 5A1TA 2ILLA 1A5SA 3R77A 5T3UA 2Y7QB 3NRPA 3QI9C 4NN5C 4F56A 5B22A 2J9GA 2P7HA 1EC7A 1UR1A 4QQ8A 2OCBA 2I32A 3FT0A 3KAAA 3HPQA 4LL9A 3ZZLA 1ICPA 5C8BB 2CALA 1NTRA 4DEPC 4YHMH 1QHIA 3DOHA 4OZIE 4EA6A 3MOQA 2EYSB 1UATA 4R71A 1BWKA 2XG4B 5GZ6A 5AHIA 1C8KA 4X1KB 5T64A 4C6OA 2WHEA 2J88A 1J6OA 2V9ZA 1E43A 3A4FA 2BG5A 3E81A 5L2KA 1SKBA 4OGGA 4AIBA 2YPLA 3UYKA 1JK8A 4IWWA 4MA8H 3DX0A 4M0EA 1JQXA 3DVNB 3IMGA 2VHVA 4FYHA 4IKLA 3CRNA 1RPXA 4PRWA 5T9BG 4R8RA 3SCTA 1XZBA 1W0WA 3FOWA 3EHBC 2G7ZA 2ZWPA 3SC2B 4X84A 4P23A 1R87A 4QT5B 1KIFA 2C88A 2XUKA 2ZS8A 2D0GA 2PNFA 4BE7B 3OE7D 3MJSA 2NYYC 3PUHA 4HS3A 3I6LE 3EDJA 1SJAA 4ZQBA 4GBJA 1X0XA 4QG8A 3OZEA 2FL5A 4IH1A 3CUUA 4C56B 4TX6A 1J8HE 5DRTA 2GZ2A 1NXPA 4DO7A 3R58A 5DHQA 3IMTA 1HE8B 1HQYE 2YX0A 1MCCA 4IP0A 2IIQA 1VIDA 4EX7A 2HJLA 1RD4A 4QYAA 5IMLB 4YRFA 2OD2A 1US8B 1EFVB 3DTVD 5CTJA 2IBMA 3GHBL 2UZ1B 2XKJE 2R23B 3D8TA 5HNUA 5LIPA 2LQRA 4GX2A 3V8NA 4LCCC 3TU9A 2BVQB 3VR4D 1YASA 3RYFB 1JOIA 1ZBCA 1KWGA 5EBAA 1D5IH 3VIOA 5EHQA 2Y1YA 3EYFB 1USZA 3TTOA 3GNOA 4Y2HA 2DHDA 4EX6A 3FN4A 3CXFA 4G9FA 1JR3E 3IBFA 1ZDMA 2I56A 5FBLB 1KLGA 1X9GA 1QKJA 1I8UA 5E23A 3HZMA 3EG5A 2FHBA 1TETL 4GAEA 4AMKL 2HV5A 4I3SL 1FI8C 4D26A 1A7UA 1ILUA 1ZRNA 5KTEH 3HWWA 5DA0B 5F7EH 4BKTC 3EG9B 1LZOA 3OJ0A 3OKFA 4L2IA 1E3QA 1P6FA 1OYVA 1TF4A 4UOQA 2I9PA 4OIIH 1Q13A 2YBUA 4RS4A 2HLHA 3EA5A 4LSUL 3HZYA 1TGVA 1QI4A 1NELA 4NH0A 1JALA 3N8NA 2R8SL 4JC0A 4GGMX 2YVLA 2OA9A 4FFDA 4MNQB 3T4AB 4UHCA 1XR3A 4QIRA 1DT5A 3BGDA 4MYHA 2PAJA 4NZRL 5K3AA 1XF1A 4Y2WA 1T0MB 3VD2A 1CGUA 3NJ4A 4I4WA 5AOMA 3FTCA 3ZE0B 2FRDC 4YEFA 3OF6A 3IE9A 1MWAL 1TM7E 1L7NA 3W0WB 5I8CA 5KOHA 3CT7A 5EIEA 3V4SA 2BHUA 2QTLA 4YHZH 3UMVA 4KVNH 2PKCA 3TUIC 4P8UA 5HHVH 1JMYA 2X86A 4XDYA 2A78A 4ES6A 2VC9A 2WD0A 3E0IA 3ZJ8A 1E9PB 3P0VH 4HS8H 4EWJA 2X9VA 5D6DA 4N0MA 1GA6A 4WTXA 2X7WA 3SX4A 1YPZA 1AHKA 4XBJA 2V5CA 1IVYA 4E09A 1JGDA 2GWHA 4LDPA 1BGAA 4NZZA 2F1BA 4N5DA 4CIDA 4LYEA 1M34E 2QDXA 1VCVA 3OIDA 2I4RA 1SZNA 4FQXC 4YDJB 3HA7A 1Q6GA 1OVGA 5DSZA 3MUGA 1MH1A 5AHKA 1R3QA 3T99A 5K59F 2JCXA 2HLEB 2BY2A 3L48A 4ZNCD 5HDBB 3DLHA 1T8TA 4YWSA 2J0SA 2YDYA 4CV0A 2RJGA 3ZKMC 1MO6A 3HVJA 4S0HA 2X10A 4TVCA 1MXGA 5I76A 1H22A 4UU9B 4FHJA 3L1IA 1Z0AA 4H0LC 4HLCA 2WWTA 3UVEA 1V6XA 1ED3B 3CUJA 1XCJA 4M7ZC 2E6AA 4ROPA 1NOAA 2VCOA 2XKNA 3GBLA 4D92A 2YB4A 1U94A 4MADA 3MR9A 4YLEA 4WZ9A 4ME6A 4Q8WA 4X1YA 1S2WA 2OXNA 3C7AA 4C5BA 2G9RA 3MRXA 5JZVA 5RUBA 3WJSA 2HIMA 2BAGA 1LNSA 5IROC 3IUMA 2FZ9A 2X58A 1F8FA 1MXFA 4Q02A 5K0ZA 3A67H 1WMEA 3K2UH 5BQPA 2XZQL 3QJSB 1YR3A 3IJSA 2FOIA 3FAZA 3O6DA 1JEQA 4RJEA 4WHYG 1KRCC 4RDQG 1E1QD 1V5FA 1NV9A 3BBLA 1GKYA 1DE6A 4FQ7A 5MN6A 3THWA 1L9MA 2QGCA 2XRAL 3MLWH 3D0OA 2VRCD 3U44A 3OEWA 3N2XA 5EUKA 2X0NA 4KPUA 1JFFA 3LMZA 1NQVA 1CY8A 1AXIB 1UZ4A 1SJCA 4KIJA 1CWUA 1U92A 4G9DA 5I8ZA 3II2A 2Z6AA 3RWIA 4R8LA 3KPJA 2JGYA 4V02A 3OF5A 1ZD1A 1IMOA 3DTVB 4QGGA 4HP5A 1K02A 3ARBD 4H7CA 1BRLA 2VKXA 3RO7A 3C3BA 4BXVA 4UHJA 1EP9A 1CW2A 3MTXA 2XE8A 4GG8A 1X19A 3P19A 3W2IA 4JHOA 5HVNA 4FTVA 1UWVA 2IAMB 5LN8A 3SFVA 3MB5A 5CFAA 2BZGA 5EUCA 1L8QA 3HR4A 4NTZA 3QC6X 5IGXH 4Y6LA 3OESA 3K74B 3NZHL 2GITA 2AQRA 4UV7L 4XAWH 4AZ6A 2QR5A 3QOXA 4DA4A 3NDZE 2WSYA 3UTSA 3SN4A 2G4CA 3PS6A 2VDNH 4NNPH 1NSYA 2AVNA 1ODCA 3M6DA 1KM6A 1E51A 1SOWA 3BH4A 3S3BB 3EB3A 1AO0A 1T7ZA 4KXAA 4LVEA 1MAML 1TB3A 1PEAA 4QRUB 4LVOC 1MG2C 2D4DA 1QNIA 3K5IA 5LQKA 2V7HB 1V8EA 3UOGA 2X7VA 4FX8A 3ZCVA 5CB6A 1SJDA 1LXCA 3CIQA 5IQMA 1TZIB 3VKCA 4AX8A 3LMYA 3P7YA 4LE8A 1LDNA 2VPIA 3O41A 3PVCA 4YHIB 5CJJA 5IWLC 3GJFA 3RGBA 3PHOB 5T33L 1U5CA 1VG9B 3SQDA 3O3AB 3U4FA 1BHJA 2P2CA 1KWKA 4NAEB 5EA2A 3GFBA 3CUPB 2JIZD 2HE8A 1ROWA 3RT7A 3WSQH 2HZHA 4Z76A 2OJZH 3WBEA 3PDIB 3CQPA 1W1IA 4DLWA 3X1DA 1L6SA 3KXDA 3L66A 2J8FA 1FNAA 3TX2A 2QRVA 1RC0A 5AUQA 1NUUA 3NGXA 4G0QA 1R0AH 1EYWA 3LM3A 1OZGA 3FTNA 3N29A 3PPHA 3ABIA 3L4JA 1CXEA 4M6NL 1JI0A 4UMDA 4UTWC 2JKEA 4FL4C 1OSNA 2DWDB 4YJZL 2OGSA 4LUTB 5IP4A 1YGPA 1U0QA 1E7MA 3Q1EA 1SJBA 2V4LA 1XZ0B 1BDMA 2J08A 1NM4A 1KENH 1U5AA 4Q7QA 4RNIA 4UNRA 1V3TA 3DEAA 3FC8A 1U8MA 4IZOA 3FB1A 3MLRL 3ENZA 1DBIA 1Z08A 5A5EA 5LXVA 2Z24A 4ZK6A 1MB9A 3CIFA 5DYGA 1X7DA 4NLLA 2A1IA 4XMLH 5EESA 5A16B 4JNYA 4WDQA 3G0SA 5IESH 5KSAD 3GM0A 2K8MA 3KPWA 3VXNB 1A8JH 2YYSA 4KDCA 4HCHA 2OQLA 4NP6A 5EGRA 3G1FA 2V7QD 1S2NA 5LQMA 3MBIA 4ZTEA 4QXWA 1R6TA 5GISL 1LOSA 2YYTA 1S7XB 1IM9D 1RZRD 1OEZW 1OG6A 5E4FA 4XTDA 3R5HA 2I7DA 3EFHA 2RJNA 4MKZA 4WENB 1CB4A 2YPVL 3LL7A 1Z37A 4ZPJA 1QSZA 4TYPA 3LK6A 1CFSB 5IMLA 4UFIA 3EYQD 1PLBA 4QR7A 4XCFL 4HPOH 1RWBA 3K2UL 1S0UA 2V4MA 1E7WA 4UR7A 2BY0A 2GBIA 4YE0A 4EG5A 1HG1A 4YJ5A 1DQQB 4DZRA 4F37K 5GS0C 4PB3A 3VFPB 1TU3A 4ICCX 2ZPUA 1U3YA 3OKKA 3BGFB 1ZSHA 1FFOA 4JR9L 2VCBA 5AKHA 4G5FA 3RUGA 3IPLA 1J0HA 4JLRA 4CL2A 1PX0A 2Q76B 3SXUB 2DEWX 2O50A 3IVAA 2V8OA 3ZDRA 5FK9B 3KTSA 4Z3GA 3VABA 4C6NA 1Q44A 2VYVA 3MTRA 3GMMA 3QXDA 1KP2A 5I79A 3LYUA 3W4JA 4PP1D 3T09A 2ZJBA 5DVKA 3HBJA 3JRKA 3TE6A 3FTGA 4N8CL 3RWCA 1IBYA 4F7CA 1T9HA 5E4EC 1C9KA 1AURA 4QC2A 5ILOA 3WXBA 4HA4A 3CW8X 1BFDA 3L0IB 3WLQA 4YMHA 5D6DC 4XXWA 4NNBA 2DB3A 4MV8A 3FQTB 4CV1A 2VWQA 2JK5A 3C60C 2WMIB 1X8JA 5JCZA 3TBCA 3FGOA 1F42A 4XQGA 4BNXA 2NW3A 4L85A 3D5OF 3HN8A 5FDWA 1KBVA 5AOCA 4HWRA 3PEFA 1RLTA 4Q3CA 3MTDA 5F71A 1QNPA 1PY0A 3EBOA 4EA9A 4HOXA 4I8YA 1I45A 4QOSA 1VFBA 3UG5A 4IJVA 3ZHXA 3UHFA 4D3YA 3LO5A 4MIYA 2GLTA 1KBOA 2K2QB 3BPNB 1FBNA 3D31A 1IVLA 1DBWA 5D9SB 4FDUA 1NA8A 2Y1EA 3WIIL 4XGNA 1AKMA 3N5CA 3PBKA 4UEWA 5IQNA 4WZZA 5AVXA 3PDDA 3AGWA 4YDSA 5D7JB 2DM3A 1MFBH 1YMMD 2I85A 5CZVL 1QHEA 2QW8A 4ZEVA 1LO0H 5JRDS 3ET4A 2IQ5A 1I3RB 3IFLL 1KCXA 4Y8EA 4MXDA 2XMDA 4QSFA 1Z7EA 1FZTA 1Q2SA 4K5LA 1MDTA 4UNNA 5AJUA 2V7QA 1KAGA 3DZDA 2QEZA 5FO7B 4CLRA 1P4AA 4UUIA 2HYMA 3TJEH 1R9GA 1SFRA 2IAMA 2JB6B 121PA 4RWYL 1SOXA 1D7DA 3LDHA 4JYEA 1KPVB 2J7EA 1CQXA 2FT8A 3IBTA 3ND9A 3QYSA 4FR0A 3R8BB 2AFRA 3MV9D 3VXME 1JPTH 3UGJA 2CLDX 3T95A 1SCNE 4DLRA 2O3SA 2Y5SA 3ZLUA 2H0EA 1DG9A 1YY9C 3DFFA 1QG6A 2BMDA 5KOHB 1YEFL 1B3ZA 3QUYD 1EJTC 4EFLA 1XAUA 5DR5H 1ICIA 4J3BA 5EOQH 1O7AA 3WP0A 1L4LA 4ENZA 4H04A 4X93A 4S2CA 4LFCB 3RI5K 5B58C 2PDWA 3WBFA 3L5WA 2RHEA 1H7NA 3CLWA 4LF2A 4CM4A 3VPAA 3FTVA 3N59A 1H1LA 4UBIA 2QF7A 5DFVC 3DGBA 2LLLA 1UWSA 1Q3TA 4PYGA 5FYJD 5IFTA 2PGLA 2EE6A 4F1ZA 5IBQA 3NO5A 3MYYA 2AQOA 3OKKB 4MZ2A 3DVAB 2YFQA 1JXAA 4ZPVA 5D3QA 5ISZE 2AEQL 3HAEG 1JEQB 2EJWA 2FQGA 4L5YA 5ALPA 1ISYA 4BVAA 1Z5VA 3W78A 3BW9A 3TA4D 3EG9A 1A4KA 1O2DA 3D18A 4HOZA 1U36A 2VSMB 4ACTA 1QI2A 1EK5A 1TYJA 4E9VA 1AF4A 4ANVA 4AJHA 2ZRFA 4REMA 1T1IA 1VQ1A 2ZUQC 2QLLA 4Y2DA 1R0AL 4FAAB 4XO7A 4NPJA 2Z6QA 1JJBA 3B9BA 3QIBA 1XICA 2EYTA 1TO6A 4TNWF 4PHHA 1O8CA 1TD1A 4Q9RH 12E8L 1QPPA 4B80A 3ROLB 4FKBA 5KQMA 1ADQL 4JXXA 3LM8A 2QTVB 3W39B 2H26A 3BK2A 3S47A 1TLFA 3ARZA 4CL0A 1U3GA 4I48B 1QB8A 4FBLA 2YKLH 4XWAA 1U1DA 3K2IA 4NERA 1YQ2A 5I6LA 3ZWXA 3HAEA 2WCAA 3KKOA 4P5UA 2VB5A 3STZB 2A0WA 4G9FE 3KR0A 2POCA 1EANA 5HGHB 5KYWB 2C1XA 4UKDA 3UTTE 1UC9A 3BE1H 2UY4A 4GKJB 2OM5A 4OUEA 4NYYA 1AXGA 3VC6A 1NVMA 2YARA 4E41A 3LRHA 3VR1A 2JNZA 5I9SA 5K0TA 4R90H 4X9GA 2PPFA 3MB9A 1OC5A 3QE4A 5IH7A 5EZSA 1A8IA 4ONVA 4NMLA 4PTUB 4UCFA 3VXUE 3D7PA 1L8LA 3DSFL 1KTDA 2WSSD 4HS3B 4PR3A 4LDZA 1J23A 5MEOA 2PD6A 3UJSA 1HT2E 3IVRA 4AVHA 4OQZA 4ATWA 2P9ZA 1P1FA 1IJKA 1AK5A 3V8MA 1OLXA 3EMBA 4JIIX 1UUQA 2GJ8A 1CR0A 3RH0A 2OXHA 2CHUA 1IWPB 3QX7A 1SJEB 2HK1A 3EEFA 3R8FA 1ORIA 3PGJA 2X42A 2PWDA 2H52A 4GECA 1OD7A 3WLEA 4N9OB 4QTIH 3RL2B 5AC8A 3Q6GH 2BM1A 5SYMA 3COVA 5H80A 4HADA 1CD8A 1GFZA 1NJFA 1CXKA 4OV6F 3UADA 4FXGC 4HCDA 1P2VA 4TMYA 3D08A 4JBNA 4DLUA 4XWOC 1XRVA 5DYOA 3OA0A 4CQJA 4NV3A 4L23A 1IUPA 1JDFA 5D05A 4OEHA 2NY2C 4HNRA 1MZPA 4Y4FD 2HXGA 5KBNC 3ADPA 3MF4A 7PCYA 2P4AB 5CG0A 1AE6L 2GIYA 3ORHA 2V9TA 1T2EA 1AR1B 1PR9A 5IFJA 1L5HB 4JX5A 1IGYB 1EQWA 3JV4B 1FS5A 1X86B 3BBPA 3MLUL 1FDLH 2Q5LA 1ZPLA 1U3FA 3OJDA 3EQ9A 3BSZL 3CQHA 4HWGA 5DEGA 5LNVA 5TE6L 1MQKH 4M8VA 5FB8A 2FN8A 1MB4A 4F8XA 3BK0A 1UC5B 4LASH 1AS6A 2CUMA 5IT5A 2H51A 2NY3D 1YVLA 4GL2A 1O77A 5EMYA 3SKJH 1V71A 5T1JA 4NO5B 4TF4A 3LRLA 2AG8A 5H4GA 1ZNZA 1VL8A 4YFLF 4HXBH 1YDPA 4HHAB 5IW1B 2ZTKA 3NSMA 4MB1A 3LSCA 3E5NA 2ZOLA 3LB6C 1ULVA 2VNJA 3OX8B 4OLHA 3AHVA 2EDCA 3KYDA 4HDKB 2R6ZA 1EGHA 3E18A 1OIXA 2W8CA 1G0CA 3GZJA 2RHTA 4F7WA 2A3HA 2OEJA 4DR6B 2K3TA 4RAVB 3DLQR 4TRMA 3RDTA 3TQKA 3C6KA 4BFGA 4BZ2H 2O4MA 1E1NA 5I3HA 5HIKA 3DHUA 4L51A 3GIVB 3F1QA 4U05A 1U3DA 4WX2A 1DWFM 5GSVB 5K33A 3ETDA 4IRJD 4FQJH 3U56A 2AL2B 3VW3L 1F2UB 4ZCQA 4LOAA 3FPEA 3PHIA 4R8KA 2FL5B 3WL7A 4EIUA 2OYSA 3OMXA 3UF0A 1XQXA 3UACA 3CEJA 1BXNA 4J9JA 4PQEA 1KERA 2PMKA 3CNHA 3T0XA 2XQ0A 4NABA 4I19A 4ZXLA 3ZGIA 4UTOA 3MLSL 4XIYA 5E8DH 5L9DL 5D1QD 5JISA 4HNVA 3M8KA 4MWEA 4RU1A 3LLUA 5CDYA 4BIIA 4R0NA 1Z0NA 2YQ5A 3SBEA 1F02I 3BMCB 1WX0A 2OMXA 2X76A 1FNSL 3F7RA 2CK3D 4FONA 4U2ZA 2RARA 1FVFA 4AQAB 5HWJA 2OTUB 3V9FA 4LPVA 4HAYA 2BIIA 4UTHA 1YC7A 1G8JA 4K5NA 1WCIA 1X6NA 3TJZA 1P7VA 3G88A 1WSWA 4JRWA 4P2OB 3MA9L 3ZRCC 5JQIB 1GUVA 4YQYA 5LQUA 3GFQA 4A7PA 5DN1A 1SQSA 1QFUH 3MOAL 3BJEA 2XQYG 4K7PL 5K9JL 3AT8A 5E7BA 2Z6UA 4CC4A 1NTDA 3S83A 3HVHA 2CXKA 3IK4A 3M47A 3R9XB 4Y4FA 1GYPA 1JDBB 3UW3A 3SQOA 4GLRI 2Q8PA 5DF1A 5E7MA 4YHEA 4N9CA 2QUKA 1D5WA 3DUSB 2J1KA 3WKEA 1HDRA 3TINA 3INRA 5DSXA 4MV5A 3CT4A 1F3JA 2IHKA 3HJRA 1SN0A 1J7JA 4MTMA 4DE5A 1EA7A 1BDHA 1Z4LA 1IGCL 2P0YA 1XYGA 1GNQA 3AQUA 3WJLA 4F2TA 2O0TA 4GVGA 3KPMB 4BK9A 3GGSA 3O8OA 4IBOA 1HYBA 5KOIA 3D54D 1JPUA 4U3XA 1ZA6B 4OV9A 2R29A 1OW0C 1C7RA 4U9IS 4CQ9A 4NPHA 5GM1A 2NM0A 1QIGA 5CU7A 2QRNA 2P52A 2CLMB 3SCPA 4XP6L 1AMNA 3WIBA 3NQEA 5TDPB 3D3QA 4TQ8A 4GJIA 5DGRA 4J6RL 3MRTA 1XZHA 4JA2A 4V0QA 3KJ4C 4AYDC 5DHRA 5CXQA 2LD4A 1SYVB 4F8TA 4GOAA 4CE6A 5JXAH 5I6XB 2CO7B 1JYVA 3T77B 1QNSA 2AB0A 1NOFA 1UACL 2YFYA 5FESA 3RYIB 1QONA 5KNCH 1TSIA 5JLAA 1ESOA 1T22B 4W5WA 2BFOA 2XLBA 4FNQA 4YVVA 5LA6F 3WICA 3U30B 3BP5B 4MDJA 3MCTA 4OOUA 2OGZA 4JGBA 4N2KA 3AKZA 3RCNA 1XW8A 2XNKA 3FDFA 1REQB 3W5IA 1NUPA 2PWBA 4PRNA 1IUNA 1T5BA 5IDQA 3HPFA 2DLHA 2WLNA 1FDZA 3LSYA 2V7UA 1PHPA 2ZTMA 1N2HA 3RHZA 1JGTA 5I1DA 1MYRA 4YGXB 3UBGA 1VSVA 5AI8A 3OTHA 4HBZA 1J07A 4Y4HC 2DWXA 2PDAA 5DHYA 3TFKD 4UU8A 2VF7A 4HDSA 3CZSA 3BG9A 2WWGA 1Q1AA 3E9UA 2ZA3A 3GU2A 4M1DH 4ZOBA 1PNOA 3B2UC 2PU0A 4B83A 1Z69A 3MU7A 3RAPR 2VT7A 4W9JC 1M7PA 4A0FA 3CEMA 4V3BA 1M1ZA 3WD2A 5FFLA 4A03A 2UXCB 2YXEA 5BQXA 5AKQA 2UY5A 4JGIA 2A9KA 3WIHA 3H11B 1DRKA 4P0QB 2GCYB 3BORA 4O0KA 2HVJB 4CZ2A 4L05A 2IUFA 5DD3H 3IEXA 2ZJAA 1YEEH 3WKAA 4BQ2A 3ZS4A 5TF1L 1MUJB 2X40A 3C6MA 3PFQA 1P4RA 1TQBB 2AN1A 4FDLA 3LZLA 4MNHB 2DICA 2IXFA 2YXLA 4PAGA 4FS8A 2PMFA 1QJCA 3T4PA 3EZ9A 3DWFA 5AW1B 3JQDA 3H6OA 3DZCA 1SW7A 4NRRA 2CXSA 3FCTB 3ZQ6A 1RFGE 3F7QA 4JHWH 3V2AR 1VHTA 1UD3A 3RWHB 3D4GA 4U1IA 2KZBA 4RDHA 3F4WA 1T3TA 4M1SA 3SOZA 5KCMA 3AU2A 4TXMA 2ACRA 4UAOB 2Q8QA 1ZA6A 3E1KA 3THYB 5ACZB 2OZVA 2D20A 1KFAL 1CJKC 3TFCA 3UDWA 2J45A 4HIXH 1SU4A 1PJ3A 4FA3A 3WCYA 4EZLA 3H1GA 4XDZA 1PNVA 5BS0E 3UC0L 3V0GA 4UTJA 5FLYA 3DKHA 5FDYA 2R00C 1CFVH 3M5CA 3ZQ4A 2XG5A 2WLKA 2ODHA 1F3DH 3L1GA 4OMUA 2OVLA 1JKJA 1NOIA 2Q10A 2QSZA 4PQYA 5FUXA 4BZXA 2JCCE 1CIPA 1ZM4A 3DUSA 2GI4A 1NEZA 1KGSA 1RZVA 2IZ1A 4XIAA 3F2VA 5JMPA 3KLHD 2XTJC 5J1SB 3A04A 1I8IA 3L3KB 2QRHA 4AKEA 2H26B 4LWWA 2Z7UA 1K27A 1JS1X 4FEZA 4FHZA 1ZKDA 1VRXA 4LRYA 2UUOA 3LRXA 2R56L 4BKPA 1ISPA 1JLSA 1MFBL 4LHUG 1W49A 4LZZA 5BW6A 5KCZA 4L1DA 3B2VH 4BFEA 2NQ8A 3TOCA 3WADA 1G16A 3AF2A 4JFEB 4NM8H 2HRCA 2ZA1A 1KT2B 1GVNB 3F5SA 3HRZB 4YASA 1FDIA 3Q3GA 4ZVPA 2II6A 2JVUA 2AKMA 3PL6B 4Q24A 4L3ED 2GQAA 4I3RH 2C8JA 4EYKA 2JTYA 1JVNA 2AJCA 4LGVA 3C6BA 2JI1A 3WLRA 4YBRA 1HDMA 3R24A 5BN5B 3TN7A 2WJ5A 1DORA 3AVOA 4I2XE 3TBFA 1B74A 2C4VA 4PZDA 5EA0L 5KITA 1RI8A 2BP0A 5GGVY 3GG8A 3F6EX 1CUJA 2L2QA 5CLHA 4LARH 4B41A 4JHBA 4OECA 1IAOB 3QWHA 4BX3A 5FHQA 3UJ9A 5DD0L 1H9VA 1P3DA 4AFYA 4LVBA 2PEZA 4O2BF 2O7SA 5GIOE 5ADOL 4KTDH 5J12C 2EKLA 3OAWA 1CUOA 4M4SA 1HDXA 2DT5A 4XUCA 1BCRB 2P3ZA 2V8BA 4J9VA 5CN3A 3AXXA 1YX1A 2OMNA 3QSYA 1N12A 4KQ1A 1GGNA 4R2HA 4K94C 4P0DA 4IYKA 3UB4A 3WB2A 2DJXA 3P1VA 4XQ0A 3LHVA 1EWKA 3FO1B 3QF7A 4R5MA 3AWGA 4LF3B 3SPHA 4RE3A 2HIHA 1RLBA 3RDTB 3K46A 5KKCA 3NZ1A 1RFDL 2KHAA 4HMCA 3K1JA 4QTXA 4QPNA 4F4JA 4WO4B 4HIJB 2CDEA 1CUSA 2ORBH 3HKBA 3OKPA 4IBZA 1EDYA 4URYR 2CBXA 3WJJA 1ZYUA 4J7UA 3PY2A 3TFKC 2GSMB 4DG9A 3MUNA 3EOOA 1WEKA 5EPMA 3AREA 4H2AA 2VRKA 3DMHA 1F20A 5AW9A 4IKJA 5F0LB 1SY6A 1A7RH 4YC2B 3SZ6A 2R3SA 4KUZH 3TLJA 1MIEH 4YE4H 2P46B 3MLAA 1UBFA 4XX5A 2FB2A 1EXBA 2VDHA 3U4EB 1INQB 5BV2P 3B2UD 2EH7L 3KXQA 1J0KA 3PPFA 1SEVA 1AGNA 3VSTA 3HE7D 4CM5A 3SKMB 3M7OA 1CLUA 3RS4A 5GISH 1JFQH 2R4TA 5C09E 1V7MH 3RRNA 4LCCB 4I4IA 4RY0A 1JR6A 2F6KA 3RC7A 3TZVD 2PMBA 1PAZA 3T78A 4HVAA 2A0LC 4EO4A 5I16B 2WF5A 3AY2A 5AW6A 2PUZA 5CXUA 5EU6E 2DZVA 3RASA 1TV2A 3F3KA 3TZEA 1E2WA 4KQ2A 5DJDB 2CDFB 3DPBB 1VFPA 1IXYA 4LQLA 1IC4H 3O0FA 4P2BA 3DNMA 1OF8A 5HS4A 4IFOA 1P5UC 4QPJC 2NPFA 1ACXA 4BGEA 4JVUA 2J1YA 3KPPA 4PJ5D 4PVNA 5IB3B 1MG0A 2OHFA 1W8DA 3HY6A 1VL5A 3VVGA 4LVOB 1A7QH 4XWOA 2B1IA 4ARCA 3RWFA 4U0KA 1KI7A 1AOXA 3MPOA 1GGCH 4ODTL 1O4VA 5C0BB 3JQPA 3Q3HA 4M87A 1E6QM 5E6UA 1Z63A 4QCEA 3NJGA 1RP9A 3SDYH 4PCUA 4KDWA 2CC2A 5DQ9B 4XNMB 5M2QA 1E1QA 3CZMA 5MEOB 5KNBD 1UKTA 3DE2X 4MR9B 2K6ZA 3DX4A 3I6GA 5CJNA 1G7JA 2KSQA 2NQ5A 5FUCC 3VSVA 2O1AA 4NKIH 4X6DA 1QDSA 4J75A 4RMGA 3WQEA 1BEXA 3VFPA 4AJVA 1FK8A 3QNUA 4FHGA 4S05A 4OHMA 4YSPA 1KQ3A 4NP7A 1QPQA 3H18A 4XI5D 4YN5A 2OO7A 1XSJA 2A2IA 4DUPA 3KQKA 4RH0A 2QY6A 1SVBA 1F6PA 5LXTF 3ORQA 3GDGA 3VR3D 2R1TA 3PQ3A 3LKQB 3EHBD 4N8VA 3WFLA 4X63A 3L1JA 5C9UA 1DO0A 1X74A 3NXLA 4KJQC 3JYQA 4RV9A 1TO1E 4QLLA 1P4CA 4MQFB 2UXVA 2F2KA 2VZLA 1GG5A 1LTQA 4XNBA 4HC1L 4GP8B 1K3IA 1FWIC 3LOPA 4FTWA 3S36L 1MNAA 1E5UI 3SKJL 1DJPA 4GY1A 2JHPA 3TYFB 2D5AA 2NUWA 3K20A 2J5XA 3VR0A 2QNBA 4DIBA 1CTQA 3QWOB 3R5SA 2R0LL 2X13A 5FEMA 1JNNL 5AW3B 1PG2A 2BPOA 3Q5DA 5HHME 3RFZC 1ZTVA 3DUUB 4IJ5A 2Q8BL 3IARA 2DLFL 2W43A 4JI0B 4K9RA 3GEEA 1NFBA 4ZQGA 3JWNC 2HYDA 1Z6GA 3NCXA 3ZTNL 1RQEA 2A7BA 3NZQA 2P6NA 4OSUL 4LCWB 3QIWB 1A8QA 1UT9A 1XMWA 3T6CA 3Q58A 3VKDA 3OI7A 2DHQA 3B0UX 2WP0A 1NOUA 3IP6A 4ML3A 4JRXA 4B3TB 1G9XA 2NNRA 2ZTBA 2VOTA 3C3KA 1QSFE 4QTIL 3MI6A 2YBEA 1IEVA 2D03H 4WFGD 1MVOA 3DVGB 3UTPE 3TRKA 3I53A 1TX0A 3L0OA 4RZSA 1PL3A 4ZOCA 4AVKA 3EGOA 2H9GB 5D96C 1W1ZA 1PEDA 3VTTA 3RJZA 3PWNB 3APNA 4PICA 4D72A 4G1NA 3PJLA 4U5QA 3WNKA 2DORA 3TJMA 3Q7RA 2AFHB 4D43A 3ZCTA 3R7QA 1VL2A 5FV7A 4CEIB 1E6OL 3SJNA 2H1IA 4MWAD 3E82A 1A4LA 3SQXA 3QFHA 3GELA 5J3JA 5LMCA 5G1NA 5IG2A 1TFPA 2CXPA 2BP7B 4OZ4B 5KS9E 2JGLA 1RULH 5BRQA 3E7WA 5HF6A 2ZANA 4GRWE 4MGXA 4E9WA 1YZHA 1KO5A 3H19A 3K9LA 4FCTA 2DQMA 1VPXA 4LGCA 1DJOA 1Y5IA 4IQGA 5EU7E 5CA0F 1X6LA 5E4EB 2EVGA 3NZUA 5EWIH 1XB6A 3GXNA 4DF2A 1ADFA 5I3JA 1Q15A 3QPXL 2VDMH 3UWVA 4NBLA 2JIPA 4GGBA 3HL0A 4JWKA 2QCFA 3I3BA 4U3SA 2FX7L 4AY0A 4J03A 2W59A 2YLHA 4ZW8A 4DERA 5KS2A 3T4YA 1F4YH 1QMGA 3OG9A 3LOUA 2X7LB 2H7VA 5KSAB 1EX5A 2B4CH 1K68A 4JUTA 3P26A 4I0PB 5C8JA 1RURL 4M7PA 1S6NA 4MX7A 5FO9A 4IDPA 2YJZA 4KIEA 3NQ6A 3G0HA 1XDUA 2E7ZA 2GXUA 4G9PA 1EDQA 1PZXA 1ZL0A 5G4HC 1Q0LA 4B6EA 3DAOA 3IB3A 4FA7B 3H0EA 3BFKA 3VI3E 3OPYA 4J0EA 2FJUB 4A3SA 4OM1L 2WAGA 5HD8C 1Z29A 3UT5A 3ASVA 4KP7A 3N43B 4ZTOH 1YUBA 4A8JC 1BCRA 5EZIH 5AJXA 3IESA 2NXEA 1GLGA 3BT7A 2ZVDA 4PJBA 4ZCSA 4FCVA 2E8YA 1YHYA