4UOZA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 nucleophile mutant e324a in complex with galactose
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
688
structure length
688
Chain Sequence
RAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 242
structure length 688
sequence length 688
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uozA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uozA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uozA02
1HP5A 3VX0A 3EWNA 4MAZA 1W9VA 2VQUA 1WDQA 1IV8A 2YL5A 3GRAA 1VJSA 2C0HA 4JFWA 3BAIA 1HJUA 4HZ6A 4L78A 1E4LA 3AMDA 4L4OA 1EOMA 1R9GA 1Z32X 3BHNA 2PWEA 2YIHA 5TD4A 2WM0A 4ACYA 3AROA 3WQ5A 4J7RA 4ENTA 4MDOA 5EFDA 3GXDA 4L4PA 3R76A 4B7AA 3AHVA 3TOPA 1CXHA 4XUYA 2JIWA 1XSKA 1V6UA 1R87A 6TAAA 3AIEA 1NWRA 3MKKA 1LF1A 3VGGA 4JFVA 3WNPA 1P81A 3NSNA 1PIGA 1UD2A 5BROA 2B31A 2VVSA 4WSJA 2WZEA 4ACZA 4AZ6A 3H53A 2CERA 2O92A 4MTCA 3BAXA 1M6VB 1OB0A 1C90A 2VI0A 3QHMA 3WD1A 1P6WA 2PBGA 3PTMA 4ML4A 4W7UA 5AYBA 4AZHA 5A6JA 4WINA 1JYXA 5LIRA 2YA1A 2FHCA 2ZX9A 1FYEA 3G6MA 3MIIA 3BSHA 1K6AA 2CBUA 4L7QA 1JDCA 1DTUA 4MDPA 4WKHA 2W67A 4M1RA 1JDDA 3T2QA 4TVUA 3DX2A 2F7RA 2V38A 4QCFA 5A6BA 1E40A 2XN0A 2WMFA 3VMNA 1KXVA 1C91A 4Y1RB 3TA9A 3LRKA 4JFTA 1CGUA 4MB5A 5F7UA 3T2PA 2PWHA 4JL1A 1W1VA 3BCDA 4XX6A 1JFHA 1QI3A 1BF2A 4NZFA 2WHLA 4P35A 4CN4A 2WKGA 2CBVA 5I0DA 1BAGA 5LA0A 2Q8XA 2YJQA 4PMXA 3L4YA 1M04A 2ZUVA 2AD5A 3EJUA 3SF8A 3AMCA 3NOVA 4J3VA 1KR0A 1JZ5A 1OIMA 4TUFA 1R47A 3UCQA 1J11A 1HKIA 4P34A 1MW1A 3NSXA 1ISZA 4BCEA 4B3KA 1D7FA 4B9ZA 4QFUA 3L7NA 2RGMA 1I7SB 1GOMA 1V03A 3KL3A 1MVYA 3ARYA 5D9PA 3W4RA 1D3CA 4CU8A 3UG5A 5AY7A 4GIAA 2BV9A 4AZGA 1UR8A 4W89A 3BAJA 3PN8A 3IK2A 2ZX5A 2WCSA 5A6KA 3GNRA 1PZ2A 4PMDA 2XIIA 3VIKA 1NQ6A 2OYMA 1OI4A 1UWSA 4YPJA 2QPSA 1CGVA 4Z2KA 4GI9A 4XV0A 2W62A 2ZWZA 1NP2A 3TTOA 1EH9A 3SCVA 3PZUA 3ARWA 1CXLA 3WD3A 4D6GA 3M3PA 2VZSA 3VGFA 4PEEA 2G8ZA 3OB8A 3VD4A 2BHYA 4X0VA 1HWWA 1GQLA 1W3HA 4AEFA 1KEEB 3UK7A 4FLOA 1W9BM 2XN1A 3L4UA 1C93A 2J8FA 1MFUA 4UFIA 4F8XA 1J0IA 4AWEA 1P5FA 3W24A 1JDAA 3DX4A 2OSWA 2PB1A 2R1TA 5EB8A 3WNKA 1W3LA 3VTRA 2W61A 1OX6A 2DH2A 1FY2A 1QOXA 4ENPA 4URIA 4BQ3A 1DHKA 2XVLA 3FHQA 4AXNA 2XGIA 4ZDIA 2Y4SA 4UQ9A 4W7WA 2CETA 3D4YA 4CGTA 3EJSA 2J7EA 3TTSA 3MO4A 5IFTA 1GQKA 1MW2A 1H3GA 1HXKA 4IM4A 1R7AA 4AYGA 3D54D 1V3KA 1XRVA 1BVNP 3DC0A 1HJVA 1VHQA 2J8GA 2IGTA 1BVZA 3NYDA 1PBGA 3VIMA 2V5CA 3VILA 2QMJA 3E1F1 4E8CA 3ZQ9A 2GJXB 4IUGA 4CU7A 1EOKA 2G3IA 3ZR6A 2G41A 4UQAA 4UQCA 3IJ9A 4AMXA 2JEQA 3SUUA 1W9PA 3N15A 5JUVA 5C8BB 1XHGA 4M80A 3OLEA 3L4EA 4AUMA 3BVUA 3WN6A 4CCEA 4TX8A 4Z2GA 2R1VA 3EJTA 2XIBA 2FE0A 2ZXQA 3ZSTA 3TTQA 5A94A 3W37A 5ABFA 4W84A 2AMGA 2D0HA 4E2OA 2YFOA 2VRKA 1QNQA 1J0HA 2JIEA 4MNMA 5BXRA 4V28A 3ECQA 1H5VA 1R34A 3GXPA 2VJXA 2J75A 1I1QB 2ZOXA 1BFNA 3B3AA 2EAEA 4PMQA 4MAVA 2BVTA 2XFYA 4MADA 2WAGA 4W8BA 1VCMA 3HG4A 3D51A 1TQTA 4LQ1A 1CS0B 1W3JA 1ZS2A 2WVTA 2VOTA 2WC4A 1E6ZA 3MS8A 3WH5A 4QYTA 3CMGA 4HA3A 1TUXA 1Q6GA 2FGLA 4YHGA 1C92A 3GXFA 3VIPA 3MUY1 4M82A 5A6BD 2JFEX 2X2YA 3ZO9A 4GXPA 4AD0A 1CWYA 2GDUA 1OWQA 5DT5A 1VEPA 1ZBVA 5IHSA 3OLIA 3M7SA 4M29A 5D9OA 4EKJA 1PJ9A 2XYLA 1BLIA 2D7JA 1E73M 2EQDA 5C71A 1E9LA 2WXDM 1LG2A 1IPHA 4PUDA 1E4MM 4UFKA 1UWRA 3NCOA 4UOJA 3FN9A 4EE9A 1BGAA 5A8QA 4BQ2A 1PX8A 2WKLA 3WEZA 1TVNA 4W8AA 2PWDA 3CLWA 1KCLA 3VMPA 1VBRA 1B3YA 3VIFA 3OLDA 3CZGA 4ZXOA 2J25A 2J74A 2J7FA 3WEOA 2VT0A 1VIWA 2CITA 3PZOA 1PX4A 4TTUA 3VIGA 1ISYA 1OT1A 3AHZA 1JYNA 3WH6A 2WCGA 1MQPA 1CIUA 6CGTA 2E40A 3CHEA 2C8NA 3WNOA 2CESA 3WQVA 2YLLA 3KZSA 2VDJA 1G01A 1A3HA 1V02E 1Q6CA 5E0FA 4ZENA 2D1ZA 4W88A 1E3XA 1B3ZA 3KLLA 1C8XA 4NRRA 2OWWA 2E9BA 1UYQA 3BWEA 5CGMA 4AZCA 2OSXA 4AJ9A 1JDBC 3T0BA 4NZJA 3UERA 4DO4A 3WKZA 3K8KA 1K9FA 1QW9A 3EYPA 1JG9A 1V6WA 4ZDJA 2W66A 2WVUA 3RMEA 3IJ7A 1US3A 3TTXA 6A3HA 1E6NA 1ZJBA 1H1NA 1C7TA 2WW5A 1UZ1A 5BWFA 3EMZA 2OR3A 3ARSA 3CHFA 1QI4A 1BG4A 3OGSA 1CXKA 1MFVA 3CZ8A 3QOMA 1BSIA 1QDLB 1BYCA 2WJZB 3BH4A 3CZNA 2DDXA 3VGEA 3PQ2A 4BS0A 1J10A 3FNDA 5A2CA 5E70A 3OZPA 4MB1A 3MV11 4AW7A 2W4XA 4OBSA 4M24A 3GXIA 4J3TA 4ZEPA 1M53A 2XVGA 3AYSA 2BVDA 2Y5EA 4KRTA 3BAKA 3ZT7A 1E70M 4AEEA 3WF3A 2GHRA 3I3DA 4OIFA 2F8QA 3UOWA 2DT0A 3A21A 2A3HA 1HKMA 3WBEA 4AIEA 4MNTA 1E1EA 2RK6A 4AIOA 2VCBA 3BSGA 3J7HA 1UR9A 1LWJA 4Y7EA 2FEXA 1QWNA 4PBGA 3A4WA 2WBKA 3CNEA 1E4IA 2X2IA 2WMIB 1BQCA 3VD3A 4UZSA 4AZ5A 1FHDA 2E9MA 3A5VA 4W87A 1N82A 3MUZ1 3FAXA 3A47A 4Z2JA 4S3JA 1GGEA 2O9OA 1S1MA 1V3LA 4XZBA 3CZAA 1FOBA 1UKOA 1TFVA 3WF1A 3PQ5A 4PCSA 2EPNA 1QF7A 4UQEA 3SCNA 1QI5A 3LPGA 2XJ7A 3U7VA 1E0XA 2J79A 1PIFA 4H7VA 2WSPA 2H2WA 2ISSD 1SR0A 1U33A 3GNPA 1UWUA 2BHZA 3VMOA 3U5YA 3WSUA 4B31A 2WZIA 3WBAA 2YWBA 1I75A 1NWSA 2VR5A 3OZOA 3BAYA 4WSKA 1UH3A 2WMIA 4ZFMA 1J01A 4OZOA 5ECUA 1QI0A 1ISVA 1AQ0A 4UFMA 3II1A 3WQ6A 3WDRA 1GCYA 1E0VA 5A6MA 1JD9A 2E9LA 1MXDA 3NOQA 4ATWA 1J12A 1UA7A 4AMWA 3BUBA 3GH5A 3SUWA 2PWFA 2ZXAA 2V5DA 4JHOA 5CG0A 4W93A 2VO5A 3GYCA 4A4AA 1GGHA 4RKYA 5JBEA 2VVNA 5FKYA 3VGDA 1HJQA 5A8MA 1KB3A 2CKRA 2JF7A 1KXTA 3AS3A 1JXJA 1SOAA 1WE5A 4IPNB 4CD5A 1R46A 1QNPA 2FDMA 3LXCA 3W6LA 2O9PA 4CD7A 3OIHA 4H41A 4P7NA 1UKPA 1OX5A 3NORA 4OFWA 1V0KA 2YDQA 5K4AA 1ESWA 3SCSA 2WZHA 5M5DA 3LX9A 4OJYA 1WZMA 1ECEA 4PMNA 4FNTA 5HOSA 3N18A 5A8PA 3BAWA 4C7DA 1JZ7A 5ABGA 4P7RA 3TP4A 3CHDA 4LYPA 3LXBA 1WZKA 3CY6A 3CO4A 4J3UA 2YLAA 2XSBA 1HJSA 5D9NA 5GNXA 2XVKA 1TVPA 4Y1EA 5HXMA 4JKLA 4GQRA 4UCFA 4P8VA 3MMUA 3SUVA 4MJ4A 3ZR4B 3AJ7A 3OG2A 4QLJA 1PX3A 4AMCA 4E8DA 3I3BA 2FHBA 5DMYA 2VCCA 1UKTA 5A2BA 3EMQA 3QHNA 4LXFA 4CD8A 4CD4A 3SCUA 3ZJ4A 1DWGM 5E6ZA 3AS2A 1ISXA 1G2IA 2W5FA 3B9AA 1QW8A 4HPHA 1Q6DA 3VIIA 2EADA 3PQ4A 3P9QA 5FD0A 4WF7A 1LJYA 3BCFA 2XG9A 4IISA 4W7VA 3DDFA 3WNLA 3G6LA 4WIWA 2FYVA 3PZQA 3D52A 3MV01 2WWCA 2WVSA 4J3XA 2V3FA 1T0OA 4AD5A 3RJXA 2WWDA 2F1AA 3VGBA 5BRPA 3GH7A 1GOKA 2VX6A 5CXPA 1UD6A 3UGJA 5HPCA 2VRNA 4QP0A 5AYIA 1EDGA 1MQQA 2D2OA 3VD9A 1OSEA 2DPEA 1UD5A 5C70A 3SEPA 2CXGA 5SY9A 1GOQA 4ZDKA 1GONA 3VGHA 2XM2A 1HL8A 4FNQA 4U3AA 3MSGA 2X2HA 3WY2A 3EN0A 4ENVA 1UG6A 1U30A 4J28A 3R74A 4H8VA 1I1XA 1GQIA 4AD1A 3AIBA 4PMRA 1ODUA 1TMQA 4AUEA 5JBFA 1JYVA 1OX4B 3PHAA 1BTCA 3AFBA 3PTKA 3N17A 1QHOA 2DIEA 1C8YA 1WAWA 3DYPA 2A9VA 4UZUA 1ZB5A 3BC9A 3GXTA 1YQ2A 3MU7A 4IPLA 2QPUA 2LXNA 1WZLA 1E6PA 1Q6EA 3M6DA 1FH7A 2QMKA 4FF5A 5I23A 1IT0A 4U2ZA 5D9MA 3EJQA 1OT2A 2GUYA 1QPKA 3AI0A 3H55A 4KWUA 4D71A 1PV2A 1TQWA 2WVVB 4U3CA 3AOFA 3PZVA 4I2NA 3ZM8A 2W91A 2WMKA 1EHAA 4JL2A 4AYSA 3D4ZA 3VVGA 1EHNA 3F5JA 1W1TA 3WNMA 1KCKA 2D20A 1EQPA 3F5KA 1SZNA 3B9DA 1MWOA 4D6CA 4BA0A 4NF7A 3ZIZA 3AICA 1XYZA 1B9ZA 1E6SM 5BYWA 4AD3A 1GGJA 1EIBA 1J42A 2OW6A 3MGKA 1WO2A 1CE8B 2UY3A 4CVUA 1GORA 5LYRA 1R7OA 5M3WA 4CN1A 2X05A 4PUEA 4B15A 2UWFA 2XWEA 3WD0A 3ZJ6A 1XD0A 1I1WA 4JFSA 2VRJA 1DWHM 2VL4A 2ESCA 4P7QA 3L2LA 3SOZA 1JF6A 2IUFA 1F4AA 3K8MA 1AQMA 3RDKA 2GK3A 3A6OA 3IJ8A 3EDEA 3KWXA 3AIQA 1DWIM 2J47A 4LX4A 3RILA 4UNIA 5HPOA 3T2OA 1KQZA 5I79A 1CGTA 1VFUA 1JAKA 3PZ9A 2J4GA 3GM8A 1QVBA 4DO6A 3VINA 4D6JA 4PTVA 1BXRB 3NVAA 1VAHA 3BLPX 4GKLA 2WNWA 3O2LA 4AULA 3BLKA 3S6TA 2ZUNA 3WY3A 4E4PA 4FNRA 2W7TA 4PSRA 4WJXA 3WL0A 4Z2HA 1W2PA 2AB0A 4X0NA 3S2CA 2BHUA 2X09A 1WP6A 3EJRA 4TX6A 4H8UA 4JCLA 3N13A 3CUJA 3WUFA 4U5IA 4MTVA 3SUTA 1FFRA 1CF9A 2WMJA 1KWKA 2OW7A 3SCWA 4E5VA 2F2HA 3AMGA 2YBTA 1CNVA 2CHOA 3AMKA 1IZJA 3T0AA 2ZUUA 5CGTA 5CLTA 3S5ZA 3ARZA 7TAAA 4NRSA 2F7PA 4OBRA 3GBDA 3ALGA 5DT7A 2XTKA 1ZBWA 5CJ5A 4TVDA 2AOSA 3CPUA 2ZUWA 4HOXA 4P5PA 1EO7A 1UOKA 3OA5A 3PQ3A 1T36B 3N7TA 3N12A 1OINA 3WMBA 3TQIA 5FL0A 3VNYA 1I7QB 2YL9A 3EJ6A 2X2JA 1G1YA 2OSYA 5CSYA 3VKKA 5I24A 1H09A 1H41A 3SF8B 1QVWA 1BPLB 2YA0A 2ZUMA 4OUEA 1R85A 2YDSA 4F79A 3H54A 2F7OA 3GTNA 3WNNA 2C7FA 4PSPA 4HPGA 2VZTA 3SURA 1QNSA 3WQ8A 3VPLA 2OWXA 3ZJKA 3W28A 2V3DA 3CZLA 1JL8A 1OD0A 4QLKA 4AISA 2OWCA 3VSUA 3ZOAA 3WMCA 1NARA 2ZXBA 1VFFA 4AZBA 3CGTA 3QOKA 1JGIA 1JZ8A 4D1YA 4N0MA 3AISA 5D8ZA 4UTFA 4ENRA 2RGLA 4P2GA 3EDDA 3VSVA 5AC4A 2OYLA 5LA2A 3W82A 1W9DM 3UG3A 1UR1A 3A22A 1KR1A 4FLSA 5SYAA 3AHYA 3FY1A 3O9NA 4ENWA 1D2KA 4NXSA 4HU0A 1GGKA 1QVVA 1CZ1A 4HA1A 2X0HA 2BNJA 2VNCA 3F71A 1MQRA 3QHOA 2DT1A 1CGXA 1E55A 1V08A 1OCQA 5IDIA 4ATDA 1LWHA 2YL8A 4Y1FA 1EGZA 1E72M 3I3EA 3VDCA 1VF8A 1UKQA 1VFMA 2GK1B 1GJWA 2CPUA 1JZ2A 4H2CA 3RHTA 2G3JA 4AD2A 5M17A 5DO8A 1HP4A 1JZ4A 4GINA 1QBAA 4MJ2A 3AS1A 1UWIA 2FGZA 3BGAA 1Q2UA 2ZE0A 3KKLA 3W81A 4PTWA 3QR3A 2G3NA 4D1IA 3WL1A 3WIJA 3EFEA 1MXGA 3AMLA 2OYKA 4AZCB 4ENSA 1EXPA 5A3HA 1KFWA 2WSKA 2XWDA 7A3HA 3L18A 5JBDA 4PRWA 4TVCA 4R7GA 1KXJA 3RPMA 4CVWA 5BXTA 4FLQA 1DWAM 1T0BA 4H8HA 1XC6A 1PPIA 2QV4A 3WDPP 4B9YA 1B3XA 5E6YA 2GFTA 1GNXA 1UHVA 1OBAA 4AY1A 2BS9A 1XH0A 2AAAA 1IZKA 2BXYA 3L4ZA 1UZ4A 1H11A 4I46A 1E5NA 4CUCA 1G5AA 1E6QM 3ARRA 4ATLA 4MPKA 2GJXA 4D6FA 2F1BA 2VURA 1GHRA 5A6LA 4UOQA 4UQBA 2VXOA 3QGVA 4W86A 4M56A 3ZT6A 2YWJA 4U33A 4OQ4A 2D3NA 2Y8VA 4FMVA 2UY4A 5I2UA 3F4VA 2ZX7A 1ISWA 3PQ7A 5CLWA 4Q22A 2HVMA 4GI6A 4PMOA 2J7HA 3CYFA 1E4NA 4HA4A 4F66A 2WC7A 1QHPA 4BQ4A 1XV8A 3W38A 1G0CA 1NM9A 3GXNA 4PMZA 1VEOA 3MUIA 1X1NA 1HVQA 3T08A 1UA3A 5BXSA 2FH6A 5I3DA 3NDYA 4DM2A 2EXOA 1FH8A 5KEZA 2XSAA 4P36A 1BHGA 3VO0A 3L3BA 1H4PA 1HKKA 1KGUA 3DYOA 2E8YA 1ZBCA 3EDFA 1JAEA 1B90A 5EMYA 3TTUA 1KBKA 4P8XA 1UD8A 4KGJA 1NP0A 1A9XB 2PF0A 3PTQA 1JI2A 3THDA 1QBBA 1RH9A 3M07A 2FH8A 1TA3B 1CECA 3CMJA 1GVYA 1WKYA 3CBWA 4N0RA 5AC5A 3NJ3A 4P7OA 2CEQA 1B0IA 3ZSSA 1AVAA 4Y0NA 3U7BA 3ZMRA 2VQTA 2J7BA 1W9UA 4DWSD 1T3TA 1JNDA 5BXPA 5HBFA 1GGFA 4JFUA 3UJNA 1CBGA 1ZU8A 2E8ZA 3VX1A 1JFXA 4V2XA 1CPUA 3AZSA 2D0GA 2GSJA 4E08A 3EJPA 1H0GA 1WZAA 4K2HA 2D22A 3PBGA 1CTNA 3FXYA 3POHA 3VD7A 4BTEA 3NSMA 2YL6A 2F61A 3AS0A 4BFLA 1V02A 1KTBA 5BRQA 3B36A 3K4DA 3K4AA 4DM1A 3O6AA 3EZGA 2NT0A 3SCPA 1NWUA 3W53A 1PZ3A 2YBUA 1H0IA 4BF7A 3UESA 3PQ8A 5CPTA 4YN5A 2A3AA 1V0NA 5KZ6A 3NIYA 2NV0A 1JD7A 4DO5A 4RL3A 3ARTA 4HU8A 3RO8A 4RE4A 4B40A 1VCOA 2ZWYA 4C7GA 1V0MA 4H04A 1JZ6A 4HP5A 4PMVA 1WCGA 3D5HA 4L8WB 2JALA 1JF5A 1SY7A 2YDRA 1UCFA 1CENA 3NUKA 1GPMA 4B3LA 1JI1A 3RJYA 4MNLA 2F7QA 1E0WA 3RCNA 1B3VA 4KMQA 3OGVA 4GO8A 4B16A 8CGTA 1UD4A 1B3WA 3IAPA 1R33A 1N57A 4L8FA 5JIPA 4FNUA 4CD6A 2NW0A 3CV5A 4GE3A 2WBGA 4OGFA 1OIFA 4LYRA 1P80A 1US2A 4U5KA 2Z1KA 4HZ8A 3WDIA 4LYQA 4HOZA 4JHZA 1UR2A 2D3LA 1PAMA 3BVWA 2EEXA 2QF8A 3W0KA 3JUGA 3BUPA 1GOWA 1PDWA 2WMHA 1FFQA 4LGXA 4JQSA 3ZR5A 2EO7A 1GOOA 1CGYA 2R1UA 3CUFA 3TV8A 2XVPA 5A1AA 1FA2A 4AZIA 1SFSA 1JVNA 1P7ZA 4Y1RA 2WVVA 3LXAA 2VZOA 2DSUA 5FCZA 1K9TA 2IXVA 1QNRA 2WK2A 4BZYA 1E56A 1WDPA 3OGRA 1KTCA 4HMDA 1KWGA 4UFLA 1XSJA 3AXIA 1R8LA 3POCA 4PYSA 5EBAA 3BLBA 3KL0A 3DHPA 1VENA 5BCAA 1OGGA 2XHYA 5JZMA 2IXUA 4ENUA 1ZJAA 2VX7A 1PEZA 2GDVA 1J18A 5DFAA 1B30A 3VU3A 3ZJ8A 3VU2A 1OX4A 2J62A 1V0LA 3BMVA 5HNNA 4FNPA 1V6XA 4NI3A 2WLYA 2WCAA 3AIRA 4CCDA 4FK9A 1GZJA 1HL9A 1CGWA 1OD8A 1SYTA 3F5DA 3WF2A 4XZWA 1UH2A 4XB3A 4GO9A 3DX0A 2WANA 2CCRA 3LRLA 2XPKA 3WDHA 3BXWA 4L8YA 2EACA 4CKQA 9CGTA 1XYFA 4S3KA 2W63A 4EK7A 1KXHA 4JCMA 1EQCA 2Y8KA 3LRMA 1J0ZA 3TTWA 2GJRA 4Y1GA 1M03A 3VM5A 3EDJA 4HMCA 5CQ1A 3WQ4A 1NH6A 1YHTA 4QDMA 3TTTA 3CZSA 3RM4A 3GBEA 3W25A 5FIPA 1ZL1A 4PN2A 3VNZA 3SCTA 3TTVA 1DWFM 3HU7A 3N1AA 1C3OB 3D3AA 4DWSA 4TTGA 3U5UA 1J0YA 2CKSA 3FIJA 4DUVA 4WKFA 2CNCA 3L4WA 1ONSA 4UFHA 1F4HA 2VC9A 4BQ5A 2ZXDA 4NX0A 4A3YA 4QYXA 3WD2A 1TQSA 3L4XA 4KRUA 4GZJA 1W32A 3N11A 4DWSB 3ZT5A 5JZOA 3NOOA 4TOQA 3CZ9A 1HJXA 1BGGA 1QNOA 1FH9A 1EDQA 3VDAA 4OGGA 1ZBKA 3CIVA 5LA1A 8A3HA 5A6AA 1GJUA 1GPFA 3VIJA 3LMYA 5I77A 4D6EA 2VX4A 4JKMA 1BYBA 1CEOA 3BUDA 4OOZA 3CUGA 3T09A 2DGAA 5ABFB 1QVZA 3GZAA 3CZJA 5A95A 5M03A 2D24A 1Q4NX 1GW1A 1RP9A 1KXQA 2YWCA 1XGZA 2ZX6A 1CDGA 2RK3A 4I4NA 2X0YA 1NOFA 2DSWA 3S5YA 1W91A 1KA9H 1C30B 5SY4A 2ALWA 3NDZA 3WQWA 5ABHA 5IXEA 2ABWA 1UD3A 1KGXA 4F9JA 5I6SA 1TZ7A 3CUHA 1TE1A 3RIKA 5SY6A 3PZTA 3UG4A 1VJZA 1LLOA 4N42A 1B1YA 1X6NA 4C7FA 2BY1A 5FL1A 4MNKA 4N12A 4ACZB 2CIPA 3DDGA 1HIZA 1HXJA 5E09A 4CU6A 1Y7VA 3AIWA 5CPQA 3UR7A 1UKSA 2DIJA 1HJWA 4MB4A 4WLCA 3IGUA 3P9PA 1CLVA 1L9XA 2TAAA 3WDJA 3AHXA 1L0PA 2FHFA 1KBBA 2PWGA 5E1QA 3CHCA 1CLXA 3W6MA 2O9TA 3SCOA 2IUZA 2X1IA 2VMFA 4TXEA 3WY1A 1ITXA 1ITCA 2CBJA 2BY2A 2DSZA 3SUSA 2ZUSA 1H2JA 2EPLX 3ARXA 3EMCA 3KE0A 3AHTA 5GNZA 4R5EA 1VCNA 1Q7RA 1CXIA 4JAWA 1RPKA 4OGZA 1CXFA 5A8OA 3FHAA 5DF0A 1MW0A 2VPIA 2W92A 1IZZA 4AD4A 3CZEA 4P8WA 5DEZA 1OY1A 2PBOA 4GPNA 3VDHA 1WDSA 3WD4A 3OBAA 1TQUA 1WPCA 3ALFA 3MMDA 1LL7A 2EJ1A 3AYRA 2ZIDA 1CYGA 2Y24A 1RD6A 2WC3A 3HJEA 4DUWA 3OT1A 1DP0A 3D50A 4UOZA 5IFPA 1MW3A 1VEMA 3TTYA 4U31A 3FAWA 5A69A 2CBIA 1L8NA 4W5UA 2E0PA 3AIVA 3GH4A 3VIHA 1QHZA 1W1YA 3CH9A 2A3EA 4U2YA 2WLZA 3M46A 4Z2LA 3WELA 1G9HA 2VX5A 1GG9A 4QLLA 2YOCA 4J3SA 3DHUA 4LGYA 1WB0A 4AC1X 1XSIA 3IANA 3WEMA 2VZUA 3SCQA 4D6DA 1V6VA 4ZE4A 1J9YA 3NONA 1UR4A 1R75A 4Z2IA 1JYWA 4D6IA 3ARPA 1PDVA 3DECA 1OGBA 1KQYA 1HTYA 4L95C 1J0KA 2G3MA 4CN6A 4LPCA 1LL6A 4F9DA 2VR4A 3UR8A 1GVIA 3K1DA 3ZJ5A 2VRQA 3WMSA 2VCAA 3LPOA 4M81A 4PTXA 1JIBA 1FHLA 1IZYA 3DX1A 3W27A 2ZICA 2DH3A 2EABA 3WFLA 4HZ7A 1K9VF 1QWSA 5CSUA 1GPWB 5HDRA 3WUGA 5IHRA 2NSXA 2WMGA 2QHAA 3VD5A 1WNOA 5D8WA 1XD1A 4OOUA 3GNOA 3R75A 4EANA 4NZCA 1U9CA 2EBNA 3HG3A 1E6RA 1HX0A 2R1VB 3W29A 1JXKA 2GVYA 2J78A 2XVNA 3MUAA 4AUNA 3AZTA 1R86A 5FOOA 3MANA 1E43A 1TQVA 2F18A 1C8QA 2BY3A 1O7AA 2DSVA 2JEPA 2MANA 1UWTA 2PI6A 1HVXA 1X6LA 3MMWA 4WXYB 4AIUA 3LPPA 2D0FA 3KL5A 3PZGA 3THCA 1PE0A 3A3HA 3BVTA 1H49A 1NOUA 1LL4A 1W1PA 4HCJA 3WF0A 4W85A 1VBUA 1B2YA 1TA3A 4B2YA 4UR9A 1P7YA 7CGTA 4R27A 3CC1A 4P8UA 4X9YA 4MB3A 1UASA 1E71M 1K9EA 4PCTA 3FSEA 1E15A 3L4TA 3HN3A 3AQUA 3T0DA 3WUBA 3BVVA 1AMYA 5E0CA 1HT6A 3A4AA 1XH1A 2NT1A 4RE3A 2NV2B 4P7LA 3CTTA 1V3MA 1ODZA 3ARUA 3IAQA 1JNEA 4DUXA 5I78A 1UH4A 1C7SA 4Q7NA 1V3JA 4MNJA 2EPOA 3WH9A 1RP8A 2D73A 3AXHA 2EPMX 1E3ZA 4WKAA 2XGBA 3MI6A 3LPFA 2HISA 3MSDA 3W26A 5I5RA 1UQYA 3KEHA 4K68A 4NSBA 4GE0A 1GOIA 3WH8A 2EPKX 1DWJM 3GXMA 2XUCA 4HOWA 3K46A 4D6HA 3KLKA 1O6IA 1UQZA 1XCXA 2YKKA 3HMCA 3AXXA 3N04A 1KGWA 2E4TA 4JIEA 5BV2P 1BYAA 1V3HA 1SMAA 3PQ6A 1HN1A 4QAWA 2A3BA 1UWQA 3EBVA 3BMWA 4W5ZA 4RKWA 2E3ZA 1K9DA 1V6YA 3OT1B 1TCMA 4A3HA 3UETA 1GUVA 2OLHA 4ENQA 1BG9A 4PMYA 3A24A 2CHNA 1LQ0A 2Y2WA 4GZEA 4B5KA 1HF6A 2CYGA 2J7DA 1TG7A 2DEPA 1EDTA 2XN2A 3WFZA 5ABEA 2O9RA 3AIUA 3WH7A 1OM0A 2BXZA 3EDKA 2YA2A 3DX3A 4HTYA 3ARVA 5CPSA 3RM8A 1A47A 3N9KA 3P9SA 1WL8A 2VTFA 4S0ZA 2DSKA 1AQHA 1FP9A 4W8LA 2XF2A 3GDBA 2WHJA 2YFNA 3VM7A 1CXEA 4KGLA 2WPGA 1V3IA 2BFGA 2DQXA 2GK1A 5GQBA 5A6SA 1PS3A 1XH2A 1FP8A 1WDRA 5D4YA 3SCRA 3B38A 3VDBA 5GPRA 5A2AA 2G4FA 2J7CA 1BYDA 4XLLA 2JE8A 4MGHA 1E1FA 3VUPA 3L2MA 1OGSA 5GNYA 4FLRA 1NOWA 3BUQA 1NWTA 4CCCA 2XFFA 2J7GA 1QWUA 3RM9A 1QX1A 4GQQA 1B31A 4J27A 2V4UA 4PMUA 4GI8A 3PZIA 4DWSC 1EO5A 4J3WA 1M01A 3VIOA 3PZMA 2D23A 4HMEA 3WF4A 3DYMA 1W9XA 2VZVA 1QI2A 2XFRA 3A23A 1EA9C 2J77A 1M7XA 4V27A 4D1JA 2V3GA 2UY2A 3K8LA 4ZGGA 4PXYA 4JZ5A 3VOCA 2GJPA 2DT3A 3UMMA 3WUEA 1XCWA 3WENA 3AZRA 2VKTA 4UQDA 3HG5A 4M8UA 4JKKA 1S46A 3ARQA 3L4VA 2VUYA 2ZUTA 3BVXA 2XM1A 4PTMA 1J0JA 1DEDA 3B9EA 4NXKA 2RK4A 4WK9A 1SMDA 1LG1A 2WHMA 2PC8A 1Q6FA 1C3FA 1VB9A 4RE2A 2UY5A 5A8NA 2WB5A 2YWDA 1GQJA 3SIMA 3HG2A 1MYRA 2QLYA 1G94A 3CUIA 3TONA 4ZE5A 4LRUA 3HZ3A 4ZXLA 1E6XM 2WHKA 3VSTA 3BUIA 3PZNA 4GZIA 1VFOA 1O7DC 1U2YA 5IP5A 2WYSA 1HNYA 1GHSA 2V3EA 5EFFA 2ZX8A 3U57A 2X8RA 1UR0A 3ZJ7A 3CZKA 3WDQA 5E9AA 4D72A 3P9RA 3A4XA 4AZ7A 4EAMA 1E5JA 2BY0A 2DT2A 3B8SA 4GUDA 1JZ3A 3WY4A 3FW6A 3F5LA 3UEQA 1UUQA 1W3KA 4YHEA 5JIWA 3OLGA 5CZKA 4BIMA 1TR1A 2JF6A 4KH2A 4FNSA 2Z1SA 1O1YA 3ER6A 1W2VA 2A3CA 4QCEA 4ADSG 4UFJA 1VRXA 2R1TB 1HKJA 4OKDA 3APGA 2BVYA
chains in the Genus database with same CATH superfamily
4B7UA 1I45A 4RDZA 3S4YA 4YTUA 1O0BA 1KN4L 3TA3A 2I4NA 2YD6A 2Y23A 4Y4KA 2A9RA 3GRAA 5DS8B 4YBLB 3BP4B 4LRIA 2L17A 1XRNA 5HHQB 1Z32X 4Y6PA 4NAJA 4OZHE 2FPGB 3WQ5A 1WZCA 5H16A 1V7NH 1FBAA 4FQPA 1VE6A 1NUGA 3TAKA 3W23A 1CY7A 5LL6P 2IPMA 2XV3A 2WF7A 1C29A 3TL2A 3HPQA 1TEVA 1XSKA 2WV3A 1IBBA 4Y8AA 1XBDA 4AQZA 4JEIA 1DJOA 1NC4B 1FX1A 2Q5JA 2VH1A 1CFQA 3W9EA 3ORJA 5HGGS 2I9TB 3VGGA 1G7IA 1RZKC 2GIXA 1XN4A 3D0CA 2HGZA 4MWBA 2NLYA 5AJWA 4LG1A 4WKBA 5HVHC 2ODNA 4DHEA 4QT4A 1N0IA 5ICMA 1LNUA 1ZA6B 4X54A 2OVBA 1PV8A 1LBMA 1DRKA 4I6VA 2X5KO 2XZLA 1QHHA 5EE1A 4PJ8A 5BQPA 2FD6H 4M1RA 3D2LA 3CLKA 5MEND 2HVKB 4M2LA 2HMTA 2RHLA 2BEVA 3R4RA 2PDIA 1EFXA 2QUBA 1M05B 3GZTB 5D7SL 4MVYA 5BV7B 4ZCWA 3GQBA 3OX8A 2B92A 4JFTA 1K72A 4RFEA 4KK5D 2NR6A 3DKLA 1BF2A 1GADO 4CKWB 2WHLA 4NB7A 1L7NA 1E60A 1GZDA 2QMQA 4X8JB 2UAGA 1X74A 4YR9A 2NY6C 4PHXA 2P44B 3NPXA 4EFMA 1SM9A 3D6VA 3VPSA 4M1WA 3ZTEA 1F58L 5I6XC 3PWLB 4JN7A 1ORQA 3QH2A 1YE5A 3HAEH 2VXCA 3AJDA 4V0RA 1YNLH 3FE2A 1A21A 3H12A 3V4OA 3B8TA 2PAAA 1OKEA 4Z78B 4CVXA 4AC4A 4XVJH 4MP6A 3RNQB 5CVCA 1QUEA 3I85A 5IDZA 2JJQA 4YCSA 2CJUL 5KETA 1LE9A 4AYMC 2H1OA 3HRKA 2F7IA 1EDBA 3M7IA 3ETCA 1IKNA 5EUMA 4C0XA 1OI4A 1I30A 2G72A 1G69A 4EYOA 3UXLA 1CGVA 4JPVL 2EDAA 1INQB 4FMBB 4X94A 2CJTA 1G1MA 4FEMA 3MRLA 4BFZA 2BP1A 3N44F 1OKKA 5BRZB 4O1EA 1FWJC 1DVRA 2ZRYA 4PFHA 3CLVA 4ZMAT 4B4DA 4KJPC 4XN9A 2HA0A 5I8CB 1O6GA 1UCBH 4TULH 4FF7A 1UBKS 2QY9A 4UNRA 1SZRA 2OGJA 3RSCA 2WILA 4WCDA 4MH0R 2GJ6B 2C94A 3JWDC 1Y5WA 4BQ9A 3WNKA 2B5WA 3MROA 3GJFA 3W84A 1RQGA 4BQ3A 3FUCA 3O7WA 4G63A 2FEDD 2PA0A 2VC5A 2ACEA 1SA0A 3EWWA 3HKZA 5DRXB 1GSHA 4FMKA 1PQYA 2V2TA 1DBVO 3CHRA 3IKMB 3PXHA 4EWND 5LXTB 3UYRH 1JIIA 5E1DA 4ZVJA 3O8XC 1I6NA 1NCCH 5G0SA 2AOUB 5H94B 2IP4A 3VAEA 1IB6A 4NPCA 3V36A 1QYIA 1N0LB 4QG9A 1SBTA 1N3IA 3VILA 1FP6A 4F4DA 4KVCH 1JAZA 3FWKA 4KDCA 1X13A 5HNKA 1U2SA 1ZX1A 1DORA 3HE6A 3N15A 5KTNA 4PUNA 1UFOA 2I7GA 1TW2A 5DS1A 4RJTA 2QSCH 1RPZA 3L4EA 2RGBA 2BVOB 3TNMB 4KVAA 3H2CA 5GS3A 4PJAA 1DBPA 3P2JA 4AH2A 4E2OA 4QGYA 4V24A 3WKNA 1W15A 4XN2A 4A10A 2IE8A 5HBGA 5TVGA 4JG1H 3CUEF 2VWQA 1I9RL 3AINA 5CIQA 3DXAA 4G1EA 4W6XB 3PFHA 3LYLA 4CQMA 4CCSA 1XTTA 4WZHA 3MSXA 2O3QA 3VR5D 4W8BA 1TQTA 2IOOA 4O6VA 1HTWA 5BXYA 1XCTB 4LF9B 4PGCA 1GZPB 4P2OC 3MS8A 4LS0A 5AHLA 3BAZA 1UKAA 1WRBA 4YHGA 4TMZA 1YK1A 5ALHA 3ESRA 3FFDB 3AOGA 1X1EA 1FRQA 4ALAH 2YSTA 4URKA 2H0QA 3G2KA 1O60A 4BF9A 1EE2A 4ES9A 1OP4A 2NN3C 4G89A 2FMFA 1OWQA 3MXOA 4FFNA 2OAAA 1W0JA 1MDAA 4I5EA 4DA8A 5JG7A 1YJXA 1JWUA 3IDAA 3T7EA 3C45A 3TC6A 3MJYA 1F06A 2JI9A 2QJRA 3OJEA 2QRNA 3WYEA 3AR7A 1E73M 1T5LA 4Y2WA 2JJWA 1JDVA 3QJXA 3C1TA 3Q45A 3Q7EA 1EAYA 4NK5A 1SOUA 1MTOA 4PYHA 1PX8A 2WKLA 5AI0A 4W8AA 2HJPA 4XBMA 3W7EA 1CQPA 2P4EA 3CZGA 2EDTA 1E79D 3WQOA 2PX6A 1VIWA 4A82A 1YMQA 3H9BA 4YAWA 2TRSA 2D2EA 1NI4B 3QA9A 3TC9A 1B74A 1RMFL 5LNVA 4DMCA 4MD5B 1F8MA 5BYJA 3QPXL 1WEKA 1P9LA 1AUSL 5ADPL 3CR3C 1U5JA 3NRFA 3DEQA 4DSTA 2GYUA 2QDGA 2IX3A 1XDBA 1LDYA 2WC1A 3VH8B 1G20A 2NU7B 2NYUA 4W9NA 2QUMA 2AV1B 3MB9A 2VJKA 4JTIA 2KZ1B 5F0PB 4X2PA 5K3EA 3FB8B 3L1IA 4FJYA 4AYTA 4AYFA 5M94B 3JVIA 3GAFA 5GOTA 5E1OA 3PB2A 5CEXA 1EP3B 3SE4A 5EZOL 2QDEA 4ODHH 3H2SA 4FQLL 4WY8A 5G1TA 5SX5H 1ZVQA 3SDXF 2IBTA 1MSPA 5E0QA 4OHKA 1QDLB 1BYCA 4E3TA 4HEA6 2AKRA 4QTZA 5A9SA 5IW8A 1MHEA 2XBLA 4EPVA 1S2EA 4Z9XA 4GW4A 4GJIA 4EBBA 2PL3A 3DO5A 3PS7A 3RASA 1WW3A 2NY4C 3S34L 1SH7A 3ANMA 5K0NA 3PWKA 3AEKB 4IIQA 5FFFA 5F0MB 1LF0A 1HU8A 3DGGA 3AADB 3UUWA 1DUSA 1D5ZB 1AA1B 2W2KA 2C99A 2QVYX 1L7EA 2XXBA 1R3JB 3P4YA 1U2CA 5HQJA 4LWZA 1HKMA 4AE1A 4AIOA 4LLDA 5FM5O 1QCYA 1LWJA 2YSWA 1Q6RA 5JZSA 1QWNA 1FX6A 3L0GA 1U91B 4RM3A 1I9EA 2ICEC 4YDMA 1XD9A 2VFAA 4AGNA 3O41A 1JMYA 3ZWNA 4QRPB 3HA2A 3LBCA 2RHRA 5C07E 4B3IA 2YLKA 1T4KA 5C0IB 3SE9H 1WUEA 3O4JA 4ESKA 5HCNA 1DQQA 5I9LA 3GJYA 1G0YR 3DF9A 2FJGB 4L5FL 5C3LD 2R96A 1XGRA 3E8SA 4HGYA 4G8IA 1RA5A 4BFWA 3WN5A 3UC0L 1XTMA 2GUUA 4MQLA 4INOA 4RLIA 2FQEA 4W63A 1VCBC 5CAHA 5EF1A 4Z0PA 1TUEA 2O5NA 1IGTB 4YO0A 3CF4G 2AJDA 2PV7A 4JANA 3WJSA 5A06A 4RRPM 3CDFA 3PQEA 4LMRA 3QVTA 4OI9A 3M4JA 4N47A 2B6HA 3GDFA 4P48A 5CP3A 2ARWA 2G9VA 4EHLA 5D1QC 4MM1A 2UV3A 2JFGA 2D3TA 1LMKA 3KS0J 5FEMA 4FVTA 3NHMA 3SR3A 1IXZA 2FSIA 1D5BA 3H7BB 1X70A 1UBNA 2H2GA 3E9ZA 4U4BA 2J5LC 3H9SE 4WKPA 4RGOH 1N6QL 2IYAA 5CINL 3U36A 4P86A 3BH0A 4GT0A 1MWAA 1CYDA 5CLZA 3I4FA 4RKYA 1DFGA 3AFOA 2VISA 5DU7A 3JD0A 3T05A 3AM8C 1SVSA 1L5KA 1HSZA 5AK0A 2PN5A 2EUXA 3GDCA 1QNPA 5LCVA 4PPFA 1XKYA 3BPCA 4Y9GA 2A58A 3CF6R 4HT1H 2POCA 2POZA 1PBYA 5DZOA 3PE9A 1Q8JA 3NJ4A 5CEZD 2VN5A 4TUUA 3NPUA 4FB4A 3RR4A 2Y7NA 4U4MA 1OCRB 4BFUA 4PMNA 2DETA 2XKJE 1Q9WA 4OD1L 1NZRA 5ABGA 3VYUB 5K33A 2N0MA 5G2NA 2ZBQA 1Y18B 4IBOA 1F3RB 3RC8A 3PC0A 2DVXA 1TAGA 3B8DA 3H3JA 4D8XA 3KVVA 3SCMD 3D3VE 1CR4A 4E51A 4E07A 3WLPA 3CE6A 1MO0A 4K6FA 3AY4C 1Z2KA 2HLDD 4J3OD 4L9AA 2WN2A 4OF5A 5D2WA 1ISXA 5T9BG 5FYLD 1Z5PA 1OQFA 1U3DA 5TRTA 4RDXA 2XG9A 4ZQTA 3DVLA 4WIWA 3T7RA 4KGZA 5EE5B 3RMJA 4D25A 4QXIA 4KPHL 1XEAA 2PR7A 3CX5K 5BO1H 3ILQD 1SKBA 1PFWA 5JR1L 1FWAC 2AK2A 1K4CA 1JTFA 4BHTA 3WYGA 3FN3A 5GZ6A 4D0SA 4UM7A 3THXA 1E1MA 3SO3C 4E4TA 4L07A 2OXRA 4ZDKA 3U1SL 3EZYA 2XHNA 5IGXL 4QL3A 1GDTA 2ZZ4A 2OGYA 3LKRA 4N2HA 1DL5A 5DWUL 3AI3A 4HW6A 2UZ4A 1V8ZA 3VFRA 2QSZA 2VABA 2QJJA 4X4XA 4M21A 5KBLA 2CCLA 1VMAA 1W3NA 5IG2A 4QSHA 1R3QA 3PHAA 1TMKA 1A9EA 4HRYA 2OQJA 5DZAA 3P4OA 2X77A 3GLZA 3NTOA 9PCYA 1TEYA 4O4JF 4BMPB 4A8IA 3IDIB 1OSZA 4OGQC 5AM5A 3KETA 5TEWA 1U8EA 4X80L 3FB6A 4IOFD 1UOEA 3TOXA 2NZXA 4GX1A 4QYOA 2CU0A 3IBYA 3RFFA 4KX3A 4L0PB 1X19A 4P4KA 3R1IA 5HZHA 5CIYA 3RCYA 1CB7A 4NZNA 4BJ6A 3AOFA 1SXJD 1JHDA 5H4ZA 1A7QL 4LUYA 4PN3A 1T1XA 2FBJH 5K0TA 1HQRB 1CLYL 1BD3A 1YJCA 2QV2A 3RZWA 5JBIA 2NR6C 4YDIH 3SDBA 4AQ1B 1KGIA 4KAJA 1M7OA 2Z7GA 3NATA 3P2YA 1WKVA 2OYRA 4AX6A 1S9WA 5IOBA 4LCIH 1E5BA 5LQMA 4LJ8A 3T3PB 3WMQA 2O6EA 4PAOA 1OAKL 4MWCA 2GI4A 1FVCB 3QEZA 4RX4D 1KYZA 3RVKA 1PT7A 2XCRB 4IBTA 1T1IA 2VXUH 3CRZA 4HJXA 4YDQA 4F4UA 4B15A 3HC0B 4A0SA 2WV8A 2YZ2A 2WJAA 2WUVA 2W80C 3KYDB 1MWAH 4J03A 1FDZA 4R7NB 3HQ1A 2PXYC 2C31A 3P4MA 5EWIL 1Q7EA 1YE8A 3MFQA 3CS2A 3OCJA 4LX4A 4UM9A 3I74A 1M2KA 3TJEH 1UXGA 2WF9A 5HM8A 4IW4C 221PA 5DURB 2IRWA 1JAKA 3DHNA 1L3NA 4LSDA 1OF6A 4F8TA 3H6JA 4ODXB 4J16C 1NC4A 2C8JA 1TE6A 4UI2A 5BOOA 3W9EB 1MXFA 2NGRA 3COYA 1X6VA 3O3CA 3CC5B 3DZHA 3V16A 1ZIDA 4GKKB 3QJ5A 1X9LA 1KYQA 3QI9A 5E8OA 4EHFA 4AJHA 3VKHA 3HMXA 3OWRA 4NO5B 2GF2A 3ECAA 2DV6A 4Z2HA 1XZNA 4HALA 2HWZH 1ROWA 3O9VA 4RVUA 2YS7A 4QISA 3F7JA 3ODGA 1Z28A 3WO4B 4KOAA 5CCJA 4M1SA 4FDUA 2Z09A 4X7SL 3BE4A 5CIWA 1ASPA 3QXAB 4TZKA 2QKIC 4HNQA 2ZSBA 3NDBB 2FO8A 1CJMA 3EBLA 1EPFA 2HIGA 2W22A 1SCKA 2LKCA 3I6BA 4DDWA 1MFBH 3TBYB 1QS0B 2OA9A 3IFPB 4JY6A 4EPKA 2E4ZA 5DJ0B 1CJCA 4RQBA 3B52X 2VOEA 2YAQA 3DMMA 1E18A 2ASVA 1PO9A 1Q20A 1M2JA 3CVUA 1OBHA 5BMVF 4AENA 4PFEA 3P3BA 3QWBA 4RHTA 1URZA 4LXYA 4PGDB 4ER3A 3BP6A 5TBOA 1MIEL 3QJTB 5EUBA 1S8AA 1BQRA 3CVHA 1HE5A 1UZ6E 1TYDE 3V7MA 3WHE1 4GX0A 1UK6A 4I50F 1TV4A 3CRVA 2Q86B 4A7UA 2OILA 3VSUA 4CIAA 1HHIB 3U7QB 2W0FB 3RKDD 4B2IA 2SKCA 1PI3A 4CKEB 4FXGB 5EU7C 1S7GA 2VNHA 4XMLL 2IW0A 5GHWH 5D8ZA 2WHVA 1MW8X 3VSVA 5HKAA 1MG3C 1AA9A 4I3HA 1F14A 1V8HA 4UNUA 4RVCA 5IJZA 4Y6QA 1VF5C 3LP6A 2OMVB 4K7YA 4UAHA 3ZVHA 2J0VA 3OESA 3QXSA 3SE9L 4ENWA 2PSSA 2GCNA 4MV9A 4LKXB 1E8MA 4S3CA 2YRXA 1JG3A 2J30A 3HU5A 1CZ1A 4O5AA 5K8JB 1X5FA 2VNCA 2YGQA 3IB4A 1YNKH 1P1ZA 4HB2A 2GHWB 3JYOA 3ZWMA 4RE0A 1FWRA 2C5DC 4DMHA 3JZEA 2R4TA 3R1GL 4OFIA 5AFDA 1QRKA 2BGNA 1D04A 1XLFA 5E99H 3GC6A 1KE2A 4WN3A 2I24N 1E28B 3V42A 4JIRA 2J0SA 1NBQA 2QTVA 1JDSA 3I3EA 4KXLA 3KX2A 2VLJD 4B6PA 2V9QA 2RH9A 5A62A 1M6NA 2XQJA 3O21A 3DC2A 1KTJA 3HCDA 5DRXA 2C18A 1IGYA 3WK8A 2OP4L 4OG2A 4OI7A 5C0AD 1EUTA 2P80A 2ZE0A 3OEEA 4X7TA 3A1VA 3CZFA 5HJYA 3P9IA 3W81A 5G1PA 4DIMA 3IEAA 2FTAA 3VGAC 3H2OA 1XFCA 2R8SL 2XG4A 3L2IA 1EBFA 1I5RA 3UGTA 2VC2L 2OKOA 1I6MA 4LSBA 2DFLA 5ESDA 3E9AA 4AZCB 4F1WA 3KWLA 2G4EA 1EXPA 3RUEA 4AG0A 3MLWH 2ZRPA 3AWGA 1ZTXE 5E00B 2HG5A 3TR9A 1G3QA 5L9FA 4QT5A 2C8KA 3CX8A 1AJ7H 1H8OA 3IODA 4HC1A 3KPRA 1NGSA 1RQEA 3M1ZA 5I7AA 4YK4C 5E6YA 5ARDA 4N8UA 1GNXA 3QXGA 1F6AB 5DXAA 4P0TA 4JBIA 4TT8A 2H26A 1GU1A 3EPMA 4H5SA 3KFVA 1OPOA 1BWPA 1JSCA 4GR5A 1XB3A 3OMIB 3GBPA 4G7YL 2WWKO 3MJSA 1ANUA 2CDGB 3M47A 5DCBA 4PVMA 4O0LA 3V7WA 1TOAA 1U7XA 4NAHA 3EYFB 1B14A 4KXNA 4W86A 3ZWAA 1WXEA 1R5VB 1U04A 4WBXC 6LDHA 4WHCA 2PPGA 2QCDA 1AD0A 1PJLA 2RHTA 2B39A 4UNNA 2BM8A 1N5RA 4TOYL 1LP9A 3CX5J 3FOEC 2OJEA 2HMIC 4FPXA 3R18A 2AR9A 2IU0A 1ZYUA 4PMOA 1CMOA 3OZYA 4R84A 2WC7A 1U8XX 2GCEA 4BQ4A 3W38A 1OZ0A 1SOXA 4XQGA 3CCFA 1HIML 2G5BB 1P0SE 1LRTA 3PF9A 4OXKA 5J4YA 4PPYA 2W8CA 1XAKA 1U3UA 2FH6A 2Q2QA 4YGVB 5D8DA 4Q14A 3W39A 3CNYA 2XSAA 3GWGA 3Q2IA 4FS8A 4DKEH 3ZD7A 5DHFA 3VBCA 3GINA 2RGNA 2VLRE 4UQPA 2QHXA 1PQ4A 4P8XA 4ZV7A 3HJZA 2AJ3A 1OF8A 3QRLA 4D0DA 4IOIA 4R2GC 4YH6A 1EM6A 3KQYA 2Q6IA 3BIBX 3NXLA 1XI3A 1R3IL 4UAGA 2IFGA 2B8WA 1MJUL 3L45A 2VUIB 1N9GB 2B78A 1YZFA 4F0SA 4QGFA 4ZK6A 2AK1L 2P4QA 4IRJB 3ZMRA 5HHOB 2B2CA 4K87A 1A7AA 3PWSA 4ALKA 3IF1A 5BXPA 4I8YA 3VKFA 1ZU8A 5IDYA 2BNQE 2N0SA 5M2FX 2IAND 2B2XH 2GN1A 1O9HA 1S02A 1IY9A 3T2NL 5JUEH 5EPUA 3ABSB 4H01A 3PBGA 4IQ0A 2CSXA 4E0RB 3B0PA 4XJXA 4ZX4A 4BTEA 1A6UH 2O50A 4B9JA 3ARDC 4R0NA 3K4AA 1CEYA 3ZYIA 4I9UA 3G17A 3KUCA 3DHWC 4A03A 5EZYB 1UC5A 3MGTA 4B41A 3L9BA 1F6LL 1H0IA 1ZK0A 3CUVA 2PEZA 3QE5A 2WCPA 2CLSA 1UAYA 4DA4A 4K8GA 4BLWA 4JQCA 2R0WH 3GNML 5FF0A 2XUFA 3RO8A 2PL9A 5AVWA 5J2UF 4O4YL 3R44A 2CM5A 2J5RA 2PCPB 1ZP3A 4ZI3A 1BLNA 3VFSB 3JCZA 5I5MA 4LX0A 4NJKA 5DNUA 4GYFA 3OB0K 2OSBA 4MIMA 4NJGA 2X12A 3W4KA 1X5ZA 2BOBA 1NJ6A 3OKDB 2K0RA 3QGKC 1QQDA 4B3LA 5DHVH 1NMBH 4MNLA 3U3HA 1ISHA 1X0XA 4GXNA 1GR0A 1LO2H 5E2IA 1ZGDA 4XWTA 3VQ1C 3PG9A 1LLFA 3R77A 4M6WA 4DJEC 4Q7IA 2YGNA 3E3AA 1NRXA 1B3WA 2CLIB 2BZGA 2YS6A 1R33A 4XH2A 3AWOA 9MHTA 5HHNB 3L8EA 1FZKB 3L7RA 4PJDA 4UR8A 2XB9A 4RNRB 2DZDA 5EKSA 1EXWA 1GZHC 1NSNH 2PMBA 1V5GA 2VUKA 1D9XA 2Q5BA 5HHMB 5D8JL 1VYSX 4B3CA 1IGSA 3LJKA 1GOWA 1KQNA 2IPXA 1ULBA 3ZVIA 1G63A 3OQHA 1A5LC 4GI7A 4AJOA 2FPOA 3IQGX 3DBHA 3PG2A 5C8ZA 1Z17A 2PDXA 1OGAE 3T7SA 4PRPD 3CUZA 1QKJA 5A1AA 4IGBA 1TU2B 5B53A 4AEOA 4FSHA 4JJ5B 1P7ZA 3ASZA 2OR9H 3NP7A 3VXKA 5BZZA 3CV7A 4UQ2A 4B6OA 2QRHA 1AO7A 5JNSA 3HDHA 5DC4B 3ETNA 4YC7A 1R74A 2Q7AA 4WKZB 2NZVG 1VSTA 1T9HA 1Y9ZA 2DOKA 1F07A 2Y71A 1GQNA 2CVPA 3FONB 2NUPA 4Q8WA 1EUZA 2VX7A 5JU6A 3SYAA 1CULC 3H3KA 5LXEA 4YUXA 3EEGA 2KWIA 3BGIA 4N9OB 3WYBA 1T5XA 4YRIA 3D31A 4CL7A 3IRCA 4OO3A 2EDBA 1EZVY 1VLMA 4GG1A 4GAYB 5FOBB 3SRFA 2R97A 3EOAI 4TV8F 1V1MA 4PSKA 1NP7A 1KPRA 2GG1A 3N3MA 4J4HA 4JY4A 4ALAL 2ICEA 5HE8A 3SCMA 1F6YA 2PPFA 1SXBA 3I2FA 5BO5A 4FALA 5K3BA 2J67A 1SXNA 2ERCA 3TI9A 3WQRA 3PGDA 4KQEA 2PANA 4JCMA 2GJ4A 1ZW1A 1GG1A 3ZDYE 5ESWA 3EDJA 3E2IA 4MOWA 3M1BB 2YGVA 1VBFA 3DSRA 3OX4A 4NWIA 4QDMA 2QKSA 3FOWA 2OOKA 1P6BA 4XLTA 2WO5A 4YDLB 2HNBA 3N8HA 3AJXA 3FVDA 5FIPA 3O6ML 3ZTJH 1NQWA 4OLHA 3RJZA 2VSNA 4EA8A 4EJFA 4DWSA 4TTGA 4OGAC 3ZE8A 1DFIA 4LASL 1QKKA 4HD9A 4RIRB 3ADCA 4GBJA 3WGUA 4LFBB 2V7HB 1RPXA 4UAOB 4KXWA 5D6CB 3L4XA 3W9DB 1Y18A 4J2OA 7TIMA 4ZTYA 1K4KA 4NJ9H 3CSTA 3HPRA 1BDMA 15C8H 3UCFA 1BGGA 3F3MA 4AYEC 4JB9H 4GKBA 2B1AL 1E8WA 5AC8A 1ZOLA 3D4BA 3FDKA 2IBMA 1ZLYA 2VAPA 5D71H 5AKEA 3DQZA 3BARA 3TLEA 5I77A 2AN5A 1PG2A 4P32A 3MLAA 4XNUL 4PVBA 1E5LA 4QAMB 1QVZA 4ZPVB 4DP0X 1LPBB 4ND6A 2V68A 4GI3A 4PO9A 2BN4A 3DTVB 2OCJA 4YDKL 3ICEA 1V6AA 3MHTA 1E9OB 2JD0A 1XGZA 2IYFA 2ZF8A 4NVRA 2FUG1 3E22B 1FBIH 1NOFA 1K4CB 5JOPD 2PH1A 4XDGA 2VXUL 1U8PA 1U8LA 4F33A 5SY4A 2ALWA 2VTEA 1I94B 3WKMH 2QD3A 2WYZA 3DAQA 3HCVA 3OCWA 3PFQA 1M10A 3LUJA 3T1TA 1FTYA 4QUEA 1YAJA 1NJFA 5DMLA 4X91A 3O3DB 3DKPA 1B1YA 3LZCA 4GPEA 1EIXA 1YDHA 3T1OA 4D26A 4JFDE 4WCJA 4YX9A 2YWZA 2OXHA 4BWWA 1YEHH 3PHLA 3F7MA 4NEGA 3A3PA 3GEDA 5GJBA 1R0SA 1ZNWA 2OP0A 3LC7O 2ZRQA 3P4OB 4AUYA 3AUJB 2PSFA 4UJ3A 3IB3A 4AN1A 3GWQA 3SFKA 1HKLL 1XDSA 4YVNA 1Z2NX 3KB1A 5C35A 3E49A 1I33A 2QTLA 5FBWB 1HK7A 3D3VA 3HC3L 4V1CA 2J85A 4R83A 1Z6ZA 1R3VA 5K8IA 3TN0C 1AN9A 3GW3A 1CBVH 5I6KA 1O9GA 3SVZA 4YXWA 1Y8QB 4A7GA 2D2GA 1EUDA 4ZHQF 2ECPA 1FYTE 3IDNA 2PGWA 3CUSA 3EWAA 1CXIA 3WQCA 1TFHA 1UJ6A 1OSPL 3TZ6A 3QFJB 3VE9A 2Z1WA 2N3ZA 5ITFA 5AL8A 3GI1A 5JUWA 4L51A 2ZK7A 2FTYA 3LNIA 1BDYA 4GIYA 4FEZA 4PZPA 1EJVC 2E9WA 4PPTA 4LSGA 5FYKH 4Z7OB 1SBHA 3DGRA 3GDOA 2VEGA 4UTUA 1A14H 1WXWA 5KVDE 1NAKH 4HH3C 3AT0A 4G1FA 2Y24A 1A0QH 3JVFC 4R9OA 1JZQA 4DUWA 4AIBA 4S11A 3C7CB 3RB7A 4L08A 3AREC 3VGAB 1RY8A 4Y9UA 3VDXA 5AOBA 2CO3A 1NQOA 3A8TA 4QHRA 2BSSA 5PAZA 1HIMH 5L9DH 4HKJA 4WW1B 4ZMZA 4JYMA 1FLVA 2Y1CA 1WQ5A 2Q5HA 3AUXA 1XFDA 1GP2A 1A3LL 2GAFA 2EKDA 3GYRA 1WBDA 4F7KA 5TAOA 4JDBA 1SVWA 3G5LA 1W4ZA 3IANA 1NIJA 3KZXA 3EGSA 1UR4A 5COQA 4KCWA 2RHHA 4F56A 2YJ6A 2XWJI 4RU1A 2O56A 4PCUA 2IU3A 2J6EL 5CAYB 4U49A 3LKQB 1EZ2A 5GOZA 4RZBA 1A71A 3DX8A 4M1KA 4TKWA 4F9DA 2Y5TB 3T0FA 5CMAB 3RANA 5JH7F 4UXDA 3UR8A 2P40A 2OBLA 4I9FA 1I60A 5FO0A 3LPOA 3C6YA 1PNCA 4S1FA 1MV5A 4F11A 3EOBB 2EF9A 1CIJA 1IAOB 4ODUA 4WI9A 3WS3B 1VPWA 4LHUA 1JMZA 1GXEA 4AB4A 3OV6A 4PWFA 5ALBL 4M0KA 2PX8A 5JQHC 1TKBA 3OAYK 3ATEA 2IYQA 2XACC 4JJZA 1E9PB 1UJQA 3Q9QA 5FA3A 2EBUA 2GVYA 3TN5A 1NN5A 3WFDH 1F11A 4JO2L 1R86A 5F96H 4LJ4A 2DJIA 5DM70 2PDLA 5CH9A 1C1XA 1J8DA 4X1KB 2GZXA 1Z29A 3HB3C 2FB3A 2XQVA 1NC3A 2JKXA 1WB9A 1TZGH 1IPEA 1I1OA 5KINB 1PBTA 4QJ1A 3B1YA 1AS7A 1JNLL 5IQ9A 4TV9A 4ZIRA 2FXIA 5FW8A 2WJVA 3L01A 5EULV 2KHZA 5HR5A 4TV8B 4WFJA 3INUH 2JJTC 4HWOA 3QEQA 5CYGA 4EJ2A 1IPFA 2QBWA 3ZHQA 2Q0QA 1NMBL 4GEJA 3CC1A 3HNRA 1OVDA 4NDAA 1FFPA 3FUJA 4Y9PA 3JPWA 4D8ZA 4MB3A 1VADB 2R14A 3DAGA 1E71M 1N34B 4TYMA 4TV6A 1AS0A 2BTQA 3TLBA 2W0FA 2A7NA 5PTDA 2Y66A 4CQJA 2QKIB 3A26A 2Q20A 3U2EA 1X8XA 4AOFA 4MWAE 3UCDA 1CE6A 4L3ED 1EJOH 5JLZB 3GT3A 2A74B 4ZRDA 3U4DA 4P06A 3IAFA 1I8TA 2CLZB 3Q88A 3AXHA 5CPMA 2QN6A 1WZ1L 3D3VD 2ZDHA 5I5RA 3KS6A 4GZ5A 4Y9OA 3FCAA 1IYZA 2G04A 5J4VA 3GXMA 3WYDA 3FRUA 5E93A 1DMRA 4U2KA 1M57B 4F2PA 3HMCA 3N04A 5KVEH 2CUMA 1W1ZA 4DZ5A 2IWRA 4CCYB 4RXUA 2YPLB 4H9MA 3RDTD 1F9EA 1OV8A 1DBJL 1I1YB 4W5ZA 4OCMC 3I6EA 3OLWA 2YAFA 2PRIA 2NQ5A 1FMFA 3T1VA 2RH9B 3PFWO 1NIFA 2DN7A 2Y2WA 5J5DA 5K9QI 3S2EA 4B5KA 4W5NA 4PC7A 3S2FA 2HVJA 2VLKA 3ZXYA 5KUKA 1W96A 2O9RA 1VM6A 3NZHL 4FQ1H 2XCMC 1HYSC 1KY7A 3TRIA 2P8LB 3EDKA 4LSSL 1BKSB 2CLVA 3BDBA 1QAQA 4MJHA 3DMMD 5I1AB 4A2SA 3DDNA 2PDKA 4YS4A 4TKVB 2EQBA 3FYEB 1QFZA 1T0UA 4XPGL 5AI5A 2J0UA 2YBRB 4P7GA 2NZ8A 3MMEA 3IU3B 2YKGA 2RAUA 3OCCA 4O10A 4O2LA 4N82A 3W2GA 1Y6KR 4FNMA 1Z41A 1HDGO 3HE6D 4PZEA 1QZNA 2AJXH 1MJHA 2P6MA 2CBPA 3WNBA 3ZDQA 5DZLA 5AVTB 1XTVA 3L5WA 5BSEA 3N53A 3SDDD 1FZTA 1E1FA 3V3WA 3S37X 4JN2B 2OWEA 5GGQL 2KB0A 3QQ3A 4FZIA 3UAZA 3KXFE 4DR5B 4ZYKB 3RLGA 4HUKB 4GI8A 4DAEA 4G3YL 4MKHA 1KJVA 3G5EA 5D02A 3C8HA 4XVDA 3DKIA 1DMSA 3KLMX 1XT5A 4M6NL 2VZVA 2BGQA 1QTIA 1Z13A 1LK3H 4DREA 4D4KA 2UY2A 4B60A 1KH3A 2OMZB 3K8LA 4ZGGA 4PXYA 4Z17A 4H3SA 4WKCA 2I07B 2V0NA 3DKVA 2PLAA 3HC4L 2EO9A 3V6ZA 5I1DA 3KB8A 1S5PA 4EXKA 2BNQA 4FI6A 4GIRA 2PRHA 4G7EB 1DIAA 1NAIA 2D7CA 4O53A 2BSCA 2UVEA 4JDZB 1RWQA 5KJ1A 4CEUC 1GVNB 1BE0A 5G1NA 4GQBA 5TH2B 1TQ6A 3O93A 3N9SA 4GLBA 4DDTA 3SY6A 4A63A 2WB5A 5EPEA 2OC4A 4KR7A 3I1JA 1NGZA 2YD8A 1DQJA 3UG6A 3U46B 3TXYA 4BVAA 2QCGA 3GSOA 2IOHA 5DC0A 1YKFA 5B8CB 2OMYA 3N42F 1O96B 3UO1L 4N9QA 3NBNA 2ZBGA 5LGHH 1P75A 5TE6H 3ICQB 1M76A 5B39B 4MPJA 3P9RA 3CWHA 4KDTA 4JLMA 4A2QA 4EYSA 4FQQA 2J4WH 3E1SA 1E5UI 2GUOB 2AIRA 1QBLL 5E8EB 4AEHL 3ZDCA 1QRAA 3RUDA 1QSGA 5ICGA 3TZVA 4WIQA 4NKOA 3OO2A 2Q4BA 5DRWB 5AVVA 1ECFA 1Z4JA 2EHHA 3PQYD 5IM5A 1X9GA 4WDTA 3MNVB 2ZT8A 4LRIC 4BIMA 1C8VA 4I4TF 4BVJA 3GHBL 2PU5A 4QX6A 1TM7E 3ZYCA 2A3CA 3FS2A 1NW5A 4DEWA 2Q1EA 4JLPA 1UVQB 4OLWH 1BG1A 3NMUF 3U9IA 4LLMB 7REQA 1RDFA 1LK3L 3TN0A 3KYCB 3WYAA 4DJMA 2JELH 1J07A 1ZOXA 4NQ1A 4BCXA 4HISA 4HZ6A 1E4LA 4Z18A 3VHQA 5NULA 5A1JA 2WKRA 3UJFA 3TLAA 5ECWA 2MSLA 1TQBB 2BISA 4N2IA 1U2HA 1IQRA 3B1JA 5EFDA 3GXDA 5ERXA 5AAMC 3BL5A 1SJVA 1Q1AA 5LZ4A 2BOBB 2FETA 4JLJA 1MH1A 3LL4A 4I7EA 3N43B 2MCPL 4PMJA 2B34A 2WSSA 1ZC3A 5I9MA 1TJNA 4Y2XA 4OB8A 4CSTA 2GEVA 6TAAA 3ED1A 1JRCA 5DNAA 1P81A 2ZIGA 4P23D 5TNVA 3DVGA 1D2CA 4F0KA 3BIWA 4CMEC 1DO6A 3DUSA 4IUYA 1H65A 4ODBD 3THYA 3NH9A 4NP4L 1DE4A 2SICE 2PBGA 1R16A 4IHCA 5AI9A 4K26A 1C30A 2WUCH 3G3MA 1MCSA 2DBRA 3CVWA 4N9CA 2W4QA 1S3HA 2AZMA 2G50A 4TLTA 5JDSB 2QOEA 3V0FA 3AAMA 4BNYA 4F96A 2DCMA 3KXFB 1IILE 4Z78A 5A6BA 3I6LE 1YJQA 4IRSB 1RAIA 3MRIB 2JCCF 5ESVB 1K5GA 2QZ9A 5CB4B 3LRKA 4K2UL 1NFRA 4WLEA 4JQXA 4L8SB 1OJLA 4MB5A 2Q3JA 5ACLA 2XZPA 3ENZA 5DJ5A 2WKGA 3ZZTA 3W57A 1V48A 3WB9A 2PDQA 1BW8A 5HJ7A 4FQCL 2IEIA 2O26U 1OIMA 4PFKA 2C9XA 5FW6A 3DT6A 5DW0A 2EERA 4ANFA 1P4GA 2AYZA 3S2SA 2DI8A 4QFUA 2OULB 1NU6A 1B4TA 1KRWA 3KL3A 3N2BA 4G82A 3W4RA 3IT2A 4BNGA 3IDGA 4RK5A 4BQBA 3HB3B 4GIAA 1A02N 4WJEA 3ROKA 4MUNA 5T3XD 4W89A 4HAZA 3ZIAD 4CPDA 2RB8A 3LG2A 1NUNB 2DJ4A 1SVKA 1FE8A 2QTEA 2UYQA 1FWNA 3UPTA 5GZ3A 4A8JB 2J72A 4F2WA 1EH9A 3FSRA 1EGJH 1RL1A 4QYSA 4RFLA 2ZJ6A 4IOSA 1A8HA 5GS0H 3TNBA 3IIVA 1OLUB 3HR7A 5AVJA 3GT0A 3UK7A 1LORA 2Z5GA 1W9BM 1WXYA 3GLEA 3QUTA 3FCPA 4RJIA 4ESHA 3FRJA 3I1IA 1YMVA 4MIYA 4XZ9A 4OI0A 4OBEA 3QFSA 3GCZA 2PB1A 2R1TA 5EB8A 4ZP1A 1J25A 5E2WH 3DAPA 5I6PA 2NNCA 2YHSA 1V41E 2AYXA 3ROGA 4A2PA 1QE3A 1EX7A 1UJ2A 1YCHA 2AI2A 2QLNA 1IM3D 1S9VA 3A6ZA 3G8RA 4M93C 3DPDA 3REQB 3MRKB 2OAQ1 4P3XA 3M89A 4MCYB 3TTSA 3PB0A 4BUHA 1MW2A 3EIUA 5J0BA 4GUCA 4KI5C 5BNZA 1R7AA 1YTEA 2J41A 3EASA 3Q0IA 1FU7A 1BXXA 4G1EB 5CPFA 1FH2A 2WQZA 2GEKA 3E1F1 2YQ4A 4PRNB 5HY9A 2NXGA 2GJXB 2G2PA 2VHTA 2H8KA 3AREB 4OH7A 4CUJA 3CV3A 5A3SA 5JUVA 4WN9B 4DN1A 1DDOA 1S6NA 5D1QB 1FRVA 2P24B 5C09A 1XWIA 1BVLA 4L3VA 1CHNA 5C08D 3CUKA 1NMCB 1G8PA 1GA1A 3B6SA 4TX8A 4DVOA 4RKAA 2NY3D 1NWHA 4AC2A 5TJWK 4FLEA 2R1XB 1XV5A 5A94A 3QVKA 1AGYA 5IV2A 5DPMA 5I3KA 1E1CA 4OF3A 3T61A 5F8RC 2RMNA 1I5EA 4IZIA 5F1KC 4P4SA 4HKXA 1I1QB 2NU9B 5BOFA 4FTVA 3GPLA 4HQLA 3MPUA 2R85A 1PKXA 2XFYA 1N8TA 3FCEA 1Z8HA 3DCIA 4RRPA 2EOAA 3TBKA 2Q0HA 4IL0A 3O3AB 1KBVA 4MPTA 2YRZA 1SHMA 4YCAA 5DBGA 4LC8A 1FP2A 2MFNA 1JCVA 1ZA2A 3WH5A 4HDKB 1MZVA 4QXTA 4Z7WF 5CX1A 4GE8A 1HBJA 1F6PA 3QFEA 4G72B 3P7MA 1C92A 1YEYA 2BP7A 5A6BD 1R0AL 3RBXA 1MHPA 5K9ZA 2FUEA 4US2R 1QZ3A 5CDYA 1H5QA 4PP1D 4P2YA 4KQFA 3SY0B 2X53A 3M7FB 4NQVA 2UY6B 1WPXA 4P2VA 2WPDD 2MSNA 4G4IA 5LN8A 2BHRA 1AXEA 2X0UA 3IDMB 5I2IA 2NU7A 4R4FL 1FJ1A 4J7XA 1X39A 3NO4A 3FB8A 2AMYA 3LHWA 1L9MA 2BBFA 2WK1A 1KORA 3WYZA 1W5AA 3LH2H 5G41A 1F2JA 1UWGL 1G8KA 3MBOA 3MLZL 3UAVA 5IBRA 4GI1A 5DI3A 3FU3A 3SE8L 4DK3A 2C98A 2ZUQC 1DZ0A 1OK0A 1P3Y1 4QBIA 2F5BH 4Y2RA 2CLFA 2Y85A 1ULTA 3VIGA 4JT8A 1E5TA 1H4SA 3OX2A 4IJ3C 1VKFA 4M0EA 3WXVH 1BFSA 4J4KA 3GFPA 4FQIL 4YX2H 3HJ0A 4LC1A 5G3YA 2C5HA 4CMMB 4DV6B 3Q43A 3TD6A 4WCFC 3A4JA 5FFMA 4BN4A 4UEJA 1NW7A 4R96A 4TTDC 3OAYH 3EOSA 3MO7A 4TO8A 1IWAA 3N2JA 2WYOA 3AEKA 3DAFA 3KHUA 1B3ZA 1C8XA 2Z7YA 1JZGA 4E41B 2HDHA 2XMZA 2WB7A 5HK4A 4NZJA 3WNJA 4P08A 4KHZA 1QW9A 8FABB 4KFCA 4Z0BH 5LXGH 1E4WL 4IEIA 5JW3L 3GFBA 5EXPA 3TTXA 1Z4LA 2PUTA 4O2AB 2PWBA 1KVSA 3HCFA 2BSEA 1RI4A 4LOVA 2XCOA 1MKYA 1DXYA 4BASA 5JSHA 5BNFA 1S78C 3KYKH 2NU8A 4M6VA 1ADQH 4HNAA 4LQDA 5DHQA 3KMDA 4BS0A 3FSOA 4PLJC 3DEKA 5HWMA 1DQQB 4Q8UA 3F97A 3IAEA 3ORYA 4UUJB 5C80A 2OZ0A 4AL8L 3DGBA 1B43A 2IEDA 4H8WC 1XGRB 4YK7A 4KKBC 1X80A 3BH9A 3MTAA 1RURH 5EU6A 4ZDHB 2C4TA 5LZ7A 4ZEPA 3NALA 1FCCA 2XVGA 3DDUA 4UU0A 4PY7B 3N6QA 3BLLA 1UM9A 4LDPA 2K5UA 15C8L 3F6IA 3I3DA 5KVGH 5FA3B 5B38G 4OLWL 4AIEA 4BRUA 1S3KH 3SBOA 1C1XB 1QZ1A 1AIPA 4EEZA 4HJ0C 2B0CA 2Z6VA 4BEIA 2VP4A 4BH8A 1I1NA 2YC1B 7XIMA 2DBLL 3HUTA 3LCVB 2Q6LA 2X14A 5AYTA 2YNMA 4GDFA 2BVEA 2Q02A 2V2HA 5JDCA 2BBTA 3WQQA 4Z2JA 2JA1A 4OZHB 3BDVA 1FVFA 4W1SA 2RALA 3KM8A 4NQDB 2VDGA 1MCZA 4Q6IB 2BHLA 3OQ3B 1EM8B 1MQKH 2XFGB 1X1SA 3V8QA 5J3HC 4X1IB 2ZCZA 3U7VA 2G09A 3G5TA 5IAJA 2NX5D 2QSJA 4JXCA 1PL0A 5GS1B 4Z2AA 5JLJA 1BWLA 4G7SB 2RHGA 3STWA 2PTWA 4EITA 4YDJA 2XZ9A 3TEUA 2FLRT 1PG5A 3JYQA 1LV7A 3WDRA 2CHEA 5A6MA 1IBCA 2YN3A 1JD9A 4PO1A 3LUDA 1MXDA 4QHKJ 3V5OA 4HLJA 1FDLL 5DMGC 3IFOB 2BZCA 1TMHA 2OMTA 3P0WA 3KDPB 2W2MA 4F2MB 4GY0A 3HLAA 4AL8H 1N2RA 4FFYL 4MDHA 4B34A 3ARGD 3SUWA 1KMIY 5H37H 2FWUA 1ORRA 5FWAA 2AHIA 4CCYA 5KS9F 3DTXA 4WI0B 3LGEA 1JXFA 2VVNA 4NBRA 3EH5B 5A4IS 2F3PA 4WWKB 5IC4A 4REOA 4C4ZA 4G43A 4Z51A 4LB8A 4K6GA 2GZMA 4RD3A 4KKLD 2F1IA 3EPRA 4MNGA 5IF0A 3ZKMC 4UT7L 1UKPA 1XGPA 1DUIA 5HGXA 5IYZF 3ICVA 1E4WH 2ZOSA 4QRSB 4MYAA 2QHLA 4RQAA 3NESA 3N55A 1R6TA 4ICIA 2JFFA 2NY0B 1BKSA 2HK1A 2J4CA 4BFAA 2QGEA 5CYPA 4C4BA 1SXCA 4YUEH 3NWEA 1JEQB 3AYVA 2TS1A 1Z6JT 2J0UB 3W2DH 2QS9A 3THXB 5BOJA 3QFCA 4OXRA 4ICWA 4XPIB 2AE1A 2XVKA 4DZBB 3GFYA 3ZDXE 5JHMA 3F6CA 4Z0NA 4AFYA 1P73A 3OG2A 2VRCD 3FVTA 1FWGC 3QHNA 4F6RA 1Y63A 2XWSA 3F9CA 4X9SA 1TNDA 3ZVRA 4W5QA 4DRSA 4OVVA 5G40A 5KNCD 5E6ZA 1S9KC 3ARFC 5E2JA 1T6YA 3TO4C 4N0DA 4UARA 4V0KA 4HPHA 4F8YA 1ESZA 3B0UX 3SICE 4WF7A 3ZTJG 3FH0A 4BBJA 2DTML 3DC8A 1TUFA 2Z5VA 2ZOKB 3PZQA 3LPDA 3TD2A 5C0RH 1HORA 3ZRFC 2FZEA 5D70H 2WWDA 1UPXA 3RLIA 3PPEA 5FCUL 1D7BA 2BFCB 1JUFA 4XFKA 1MCWM 2AX3A 4RK7A 5AI4A 3GHPA 2C3MA 1XTQA 4RR4A 5CG7A 4W7IA 5AHXA 3T0EB 2ZRAA 4KQNA 3U3DA 2XTJE 4GG6E 2AG0A 5AOMA 2V7EA 3NTYA 3V6ZB 4JIHA 5F1IA 1PVDA 3GW8A 5GVSA 3CBJB 3AACA 3ZWWA 3PIDA 4IDGA 1LUCB 4BFKA 5H37A 1XB2A 4GG6A 4LARH 2W11A 1FVOA 1I13A 4ROQA 1NOIA 1Q14A 4AQ1A 2E25A 4DRYA 5F9OL 3WGOA 2Y1VA 3VCCA 1GW0A 1P2TA 3UY4A 3TCEA 3DOPA 3CWNA 3FTGB 5K69A 4MMYA 4L8GA 1S9WB 2Z83A 5CPNA 3ODPA 2OO5C 2CQVA 4YJHB 4CGUB 1GCGA 5JJCA 1HXYB 4B5WA 1DBBH 2HYDA 5LC1A 5AQ0A 3D3WA 2BS8A 1GDHA 1IT0A 3EJQA 2R48A 5DNYB 3WKML 4KPUA 4JNMA 1GVHA 4KWVA 3O8CA 5HULA 3J80A 1QXLA 1SULA 4RMBA 3IS3A 4U0RC 1TWDA 4CHGA 5IJBC 3QJHB 3FCGA 3ITEA 4EKDA 1OZMA 2VD8A 3AKDA 3VVGA 3OPMA 2WWYA 4BX9A 1O5QA 2ZSWA 4EAQA 1KPVB 5EKYA 3SRDA 1NKOA 2QLTA 1MVLA 4PMEA 4Q7DA 4WBSA 3EF3A 1TAHA 2HWYA 2V17L 4ABYA 4GAGH 5AKRA 1NNLA 2ZZMA 3MMPA 3IJHB 3FCSA 5FO9A 1WO2A 3VR6A 2PZ8A 2VDPL 2Y36H 2WQ8A 4M5YH 1FKWA 4S2EA 5K0SA 3QLJA 3FJLA 2OBGA 4Q3LA 1RBAA 5I8ZA 3REWA 2UWFA 4FMDB 5DRIA 4JKNA 5JFOA 4AY0A 4N2OA 1DWHM 2VL4A 3EB2A 4HHPA 2HUNA 5C0OE 4IX2A 5HUJA 3FA2A 2Z92A 1X9UA 3MB5A 5EU6D 1E58A 3IJ8A 3KWXA 3AIQA 1QTRA 3H84A 4IHJF 1DWIM 1I7NA 3TQRA 4GXUN 3Q2CA 1GTFA 1Z4MA 1T34A 1STOA 3PZ9A 5B1HA 4MCIA 4U8GA 1QVBA 2H47C 3LZDA 4G86A 3N2NA 3V9CA 1ILWA 3U16A 5CBBA 3IFPA 2W8BB 2BSTA 3GPIA 4XNBA 3BKJL 4JI6B 1U99A 4CQAA 3DMMB 2W7TA 1V7PC 4ILKA 1PHWA 3PBMA 2ATVA 1QUPA 3K6OA 4X0NA 4AENB 2WWRA 4KTTE 1X1TA 3H05A 1BWSA 1RJZB 4QRQB 4GXWA 4K9EH 5EOTB 2GR9A 4MDIB 3SCWA 4W1QA 4CMKA 3F0TA 5E9DE 2KX9A 4XASA 5EXTA 1Z22A 5IH7A 1Y3IA 2C7VA 3KPJA 3T0AA 1Z4QA 5G2HA 4RIFA 4ZI8A 4HS6B 4R2JA 5IMKB 1B3BA 3MRIA 4IIHA 2OPCA 3HYNA 2I34A 3HG1A 1LS1A 1A8PA 5KOVC 4R4NC 2J08A 2MCAA 3OA5A 1PJQA 3PQ3A 3SXUB 1WBXA 3U82B 1T36B 3N7TA 2H3BA 1MKFA 3B9BA 4EN3B 4H9TA 4DJFC 1K8RA 3LRSB 1WXZA 1EBUA 3ILPA 4JVUA 3MPGA 4OUEA 2WQSA 5EN2A 2D5LA 4F79A 1E51A 2A4EA 2LR0A 4FI8A 3K6FA 1DAIA 2QZRA 2PZJA 2VZTA 4LDNA 1QNSA 4X6BB 2CHZA 1TKKA 1UDCA 3WQ8A 4KMTL 4D4MA 1RURL 3MYJB 1KYVA 2CNWD 1JL8A 2HCJB 5AVSB 4IZOA 3IARA 3KRZA 3TJEL 2CXKA 1XRMA 4QPPA 5CBEB 5KVDH 3HPSA 3O83A 3WYFA 5I1IL 3QOKA 3DL4A 4KTVE 4BVBA 3JVEA 4CFSA 1YFJA 5E95A 1C8PA 1AD1A 1OH6A 4YHZH 1ECCA 1BA3A 4M6UA 3EX7C 5LA2A 4U6YB 3V1TC 2G5WA 4EUEA 1YADA 4FDAA 3VMMA 4OFZA 3O9NA 4HDSA 1RUQH 3H4WA 1ZCBA 3HU2A 4F3CA 3B7SA 1SBYA 1T13A 3OVGA 1MQRA 4NC9A 3VZXA 5CGQA 2Q5LA 1L5WA 4Q9LA 2IDSA 2LTAA 2ZITA 4GPZA 3M7WA 3Q67A 4NBUA 1PV1A 4PBXA 3CINA 1P0DA 3Q2OA 3ITNA 4UTTA 4PJ7F 4DB4A 4BFIA 1ECZA 5MFPA 5G5IA 4Q7LA 3SKOB 2GK1B 2G3JA 5M17A 1F6AA 4GINA 4UQ3B 3MRKA 5BWOA 2J1WA 3A1EA 2YGOA 2D7TL 4L4TB 2YXLA 2Q8PA 4GKNB 3NIGF 1DJZA 1QH9A 2OUKA 1OGJA 4N6NA 5E9JA 3VUAA 3UR2A 2WBJB 4D1IA 3WZ2A 2VP9A 1ZIOA 1HQ4A 1RCTE 2J6IA 1EXUB 4W6QA 5TDPA 1JWAB 2QCDB 3O0KA 3AREA 4XPHL 3NYIA 4H0IA 4J0HA 4LWWA 2F1JA 5DYTA 1Z7YA 3RUGF 4YCOA 5IMOB 3DESA 2GTZB 5FF7A 4OD2A 3KBNA 3X14A 5CG1A 3GUCA 2JK1A 4M53A 2AQNA 3SYNA 2BFBB 1S2MA 3FD8A 2DQCL 1YDVA 1QOKA 4KI1A 4RW0A 1IZKA 3ZHSA 1KIPB 2IH1B 4NXNB 2JV6A 3M1YA 4ZI5A 1BW9B 1E1CB 2APVA 3CVIH 3QGMA 3UT5A 2XXJA 1LI4A 2XFWA 2GXSA 2C1GA 5KSZA 1ADWA 4N2LA 3QYFA 4QY8B 4MQ6A 4ZU1X 1RIUH 2H2IA 2J3HA 1DLHB 4RDCA 5DUBB 2HT3C 3U83A 1W8NA 3L07A 5CZTA 4HLDA 1Z8NA 1NF3A 2O8CA 4NO0B 3S3BB 2X1VA 4U1NB 1RJQA 4K3HA 5BNXD 3ZQJA 4GFXA 3BE6A 3MRDB 3DNPA 4I4LA 4GI6A 3L08A 2I9LA 2JQAA 1D5CA 4CLDA 3VD0A 3K35A 3RWGA 1RIVL 3B0VC 5SZHB 3EOTH 1NGXB 4UV4L 3LHKA 2HTFA 5DR5H 1Y7TA 2O4EA 4YREA 2Q28A 4NG3A 4YWJA 3ABSA 4UDUB 5C1IA 4OD0A 4M3HA 3MN1A 1OCJA 1NVAA 3N2YA 3VFUB 3CQIA 4UXJA 2AD1A 3K6RA 3RBVA 3DO6A 4XMKL 2WYHA 1UJ3B 4FG6D 4WY0A 2A3NA 4BV9A 3SO3B 3TO2A 1RH9A 2E21A 4FFBA 1U92B 4EN3D 5KSYA 2YJ3A 1HWYA 1ZEMA 3ZG6A 4I89A 1AXIB 3L5JA 2JK0A 2CLFB 3ZLJA 3QW3A 2CDEA 4LY3A 4YDSA 1P6XA 1F3DJ 4UAOC 1A6WH 8XIMA 3P96A 4NYMR 3FQYA 2ZCUA 3OKDA 2FRDC 2DMHA 2C1PA 4YQFA 2F61A 5JFTA 6PCYA 1NSNL 4Y4HB 4HPOH 4ETWA 2EH8L 3O6AA 5D7EA 4JTSA 5L4IA 2RJ3A 4OIAA 2E5WA 3N4FA 5DZVA 3O45B 4IWXA