4UOZA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 nucleophile mutant e324a in complex with galactose
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
688
structure length
688
Chain Sequence
b'RAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BETA-GALACTOSIDASE
publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Hydrolase
total genus 242
structure length 688
sequence length 688
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uozA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uozA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uozA02
4D71A 1E9LA 1W1YA 2VCCA 3BSHA 1BFNA 2PWHA 1M03A 4A3HA 5I78A 1HKJA 3ARXA 4OBRA 1XSJA 3MUZ1 4QCFA 1Q2UA 3TTQA 1CYGA 4GE0A 1B2YA 2YBTA 2CXGA 2QHAA 1JFXA 5A1AA 3EWNA 5A6BD 1UZ4A 1UD5A 3W38A 4IISA 3TTUA 2A3CA 3OZOA 4W85A 4P7OA 4AUNA 3MANA 4CU7A 1SYTA 3WN6A 3IGUA 3UK7A 2YWJA 3SCTA 3N7TA 4NZCA 3K4DA 4GINA 1XHGA 1NWUA 5CGTA 4LGXA 2F2HA 1GQIA 3AS3A 2F1BA 3NSNA 1SOAA 3CUJA 1U33A 1BYAA 4MB5A 2VQTA 3LRKA 3HG5A 5AY7A 4ENUA 1NARA 4P7QA 4Y1RB 1HTYA 4TX6A 2X8RA 3KWXA 4P8VA 2W61A 5A8PA 1RP9A 2XN0A 3F5DA 2Z1SA 3T0AA 1BVZA 3BLKA 3A3HA 2PBGA 4KRUA 1KBKA 2XN2A 1EHNA 2W7TA 2G3JA 3ZT6A 7TAAA 1V6XA 1XSIA 1TE1A 3GNRA 1J0YA 1DP0A 3WH9A 3HG4A 4AZGA 4XV0A 2O9OA 1H4PA 5A94A 2JIEA 4FNQA 1VENA 2X2IA 3WF2A 3MMWA 4U31A 4AZBA 1NQ6A 2XM2A 4D6JA 4MNKA 4GUDA 1GOMA 1OX4B 4MNLA 1WDPA 4BA0A 2RK3A 4DUWA 3F71A 3THCA 1G1YA 1LWJA 2XVKA 3N1AA 4U5KA 6CGTA 2YWCA 4PTMA 3VUPA 2AOSA 3NDYA 1GQJA 5I0DA 2J4GA 3CUIA 3R74A 1FOBA 3WQVA 4CD4A 4W86A 3VTRA 1WPCA 4BQ2A 4CN1A 3DX2A 5EFFA 2D23A 1PX3A 3KL5A 3LXCA 4GXPA 1BQCA 4JL2A 1SFSA 4GI8A 4P8WA 5ECUA 4GQRA 4HZ8A 4J7RA 1P5FA 3SUSA 2VZUA 1ISYA 2CCRA 2YWBA 2FDMA 2VNCA 3IANA 3BXWA 1V03A 5E70A 4JCMA 4JZ5A 1HKKA 3UG5A 2ZOXA 4H8VA 1PAMA 4CVWA 3GBEA 1K9VF 1UKPA 1V6WA 3VSVA 1FH8A 1C90A 2CBJA 2XTKA 3WELA 2WVUA 5SY9A 3EDEA 3BAJA 3LPOA 4WSKA 4ATWA 4HMDA 1E56A 2XVLA 5FIPA 2YFOA 4JKLA 1LQ0A 4PMQA 3BH4A 2YIHA 4BQ5A 1UKSA 4NF7A 5CLTA 4TVCA 4PSPA 4MNMA 3EJUA 1MQRA 1RH9A 4E8CA 2DDXA 1WZAA 2FHBA 3K8MA 3RM8A 2XHYA 2ZUTA 1GJWA 3MMDA 1TCMA 4PMZA 4HOXA 4FNPA 4R7GA 1J0IA 2ZUUA 2X0HA 3PZIA 2ZUNA 4W7VA 1V3LA 3UETA 5A6MA 1XCWA 2ZXDA 2V3FA 4D6EA 4P7RA 2BHYA 3VIJA 1B0IA 2WVTA 3PZOA 5EB8A 1B90A 1VJZA 3VDHA 5BXTA 1KGXA 4D6CA 2W92A 1VFOA 1HKMA 1MYRA 2NV0A 1JL8A 2CPUA 2EEXA 2J47A 3PZTA 2PWEA 3VILA 3WF3A 3ZJ6A 4X0NA 2OYKA 1OT1A 5A8MA 4ACYA 5A6SA 3KL3A 3UESA 2GJPA 1TMQA 4NX0A 3SUUA 1KFWA 3CIVA 1H0GA 2J74A 1JAKA 3SCUA 1HT6A 3VIMA 3NONA 4HZ7A 1GORA 3ZJ7A 4WJXA 1M53A 3BAKA 1QW8A 3SF8B 1V0KA 4W8AA 1FYEA 3K8LA 4Y0NA 5LA1A 1GGKA 1W9DM 2EPKX 3LRLA 4OOUA 3ZSTA 3VIFA 4BTEA 2OYLA 4KWUA 2VTFA 2Y24A 3BAIA 3RIKA 4FMVA 1NOWA 5D8ZA 4B16A 3LXAA 1Q7RA 4W8LA 1OWQA 3FY1A 1AMYA 1BYCA 5SY6A 4NSBA 4OUEA 1J12A 5A2CA 3AHZA 3O2LA 5HPCA 3WF4A 3ARZA 1V6VA 2MANA 1XC6A 2D24A 1E4NA 2GJXB 4D6DA 2YA2A 1BAGA 4D6FA 2WVSA 3UOWA 2BXYA 1MQQA 1JYWA 4Y1GA 4D6HA 1OSEA 3WDPP 4FNRA 4AJ9A 2UY2A 1DWFM 4JFTA 3B9AA 3KLLA 2D73A 5HDRA 1WB0A 4MNJA 3OGRA 1XYFA 1G01A 2CNCA 1NH6A 3LPFA 1CXLA 3VDCA 2VURA 1KCLA 1LL6A 3G6MA 5D9OA 1E6PA 5JBEA 2R1UA 2X2JA 3MUY1 3SURA 1J42A 3WF1A 1WAWA 2VCBA 1GPMA 1KXJA 1VEPA 3SUVA 2XG9A 4PMUA 3ZM8A 1R75A 4JHOA 2G41A 2ALWA 1GHRA 1B31A 2FEXA 1HJWA 3OLDA 2CETA 1R87A 1KGUA 3B8SA 4BF7A 4Y1RA 1FHLA 5E6YA 5E0CA 5I2UA 3AZTA 4MTVA 3ZT7A 1XH0A 2R1TB 3AQUA 1FP9A 3GZAA 1JAEA 4X9YA 1FFQA 3CZSA 3L2MA 4AEEA 5BCAA 3L7NA 3KZSA 1X6LA 1GHSA 1O6IA 1DTUA 4IUGA 4MJ4A 4HU0A 3ZO9A 4V28A 4ZEPA 3P9QA 3ARUA 3W29A 5E9AA 1BG4A 1L8NA 1P7YA 3ZJKA 1SMAA 4RE4A 3P9RA 4MB4A 4OOZA 2ZIDA 2YKKA 1MW1A 1LL4A 4L8FA 2XSAA 1OX4A 1JNEA 2VX6A 1HL9A 1EGZA 3LX9A 1C92A 2CKRA 3SCNA 5IP5A 1B3VA 3AMDA 2W4XA 3DX0A 3A24A 3GXDA 2XM1A 4RL3A 1JYVA 3WH6A 1QVZA 1D7FA 2YFNA 2DSZA 1J11A 2DH2A 1NOUA 3U5YA 1W3LA 1E70M 4C7FA 3RM4A 5A8OA 2UY4A 3WNMA 5LA0A 1AVAA 3IJ8A 4J3WA 2YBUA 1ZBCA 1E4IA 5FOOA 3G6LA 1CGYA 3WEMA 1CS0B 2VJXA 1JDCA 4RE3A 1BYBA 2JEPA 1GJUA 1UCFA 2WMJA 4OQ4A 2ZX5A 3PZGA 4HOZA 1BG9A 3R76A 2V4UA 3M7SA 3A47A 4PMXA 1JXKA 1KXTA 1O7DC 4P8UA 2XFFA 5AC4A 2E3ZA 5JUVA 1QNRA 3PQ2A 3CGTA 2EPNA 3E1F1 4JIEA 3WF0A 4DM2A 4TVDA 4BZYA 2BY1A 5BROA 1HL8A 3A4WA 2CYGA 3CLWA 4DO5A 2BVYA 1T36B 4B3KA 5D9PA 1TQSA 3EJSA 5IDIA 4LGYA 1C8XA 2O9PA 3THDA 1CF9A 1BYDA 4RKWA 5DT5A 1U9CA 4CUCA 3TTWA 3SCOA 1ODUA 2V5CA 3PZMA 4PN2A 1BSIA 1LG1A 2XWEA 1I7SB 3L4VA 3M46A 3POHA 4AEFA 4XZBA 4DUXA 4JKMA 2AB0A 3CV5A 2XIBA 1E0WA 3NSMA 2ZUSA 3UR8A 2F7PA 3CUHA 2CITA 2A9VA 1W2PA 2QPSA 1GGJA 2YWDA 4M82A 4AIUA 3S2CA 3MU7A 3B3AA 1TA3A 1ZBKA 3H54A 3N18A 3NVAA 4QYTA 2DSKA 1UWQA 1VFFA 2EBNA 1JD7A 1KR1A 1S1MA 1B9ZA 4J27A 3VINA 3VM5A 4DWSB 3SCRA 1H41A 2HISA 3MSDA 3NJ3A 1KQYA 3WL0A 2FGLA 2J75A 3CHDA 3AS0A 1FH7A 3GRAA 1UD8A 4MDPA 1I1QB 2WBKA 3LXBA 1UWRA 3W6LA 3PBGA 2BHUA 4NI3A 1I1WA 3AIEA 4E8DA 6A3HA 2YA0A 2YOCA 1V08A 3WY4A 4M80A 4TOQA 1ZBVA 4OBSA 1JZ7A 2CHOA 5CZKA 1Q6EA 1H1NA 2ZX8A 4UFMA 3BC9A 2Y5EA 1U30A 3ZMRA 4KMQA 3SIMA 3FW6A 2GDUA 3FXYA 1GPWB 3DC0A 2WSPA 4XZWA 3CUFA 5CPTA 3M6DA 1VEOA 3GM8A 2O92A 2BHZA 2VX4A 3A4XA 1GCYA 2GK1B 4JFUA 3ZQ9A 4UQAA 2GJXA 2V38A 1OGSA 3RPMA 5JBDA 1K9FA 1MXGA 3FHQA 1VHQA 1EOKA 5CPSA 1J18A 2E9LA 2E9MA 1H09A 1W1TA 2NT1A 1AQHA 4GI6A 1V0LA 5CG0A 5HXMA 1VEMA 2ZUWA 5M03A 3GXPA 3FIJA 3EJ6A 3GXNA 3M07A 1V6UA 1C93A 1CXFA 3K8KA 1PEZA 3AHXA 3RCNA 1LLOA 4YN5A 1UKTA 4TVUA 3RDKA 1ZS2A 2XWDA 2PWFA 4UQCA 5HPOA 1GGFA 2ZX6A 1JD9A 1KA9H 3WNOA 4WLCA 5BXPA 3KEHA 4Y7EA 4PSRA 2VC9A 3DHPA 3BVXA 1E1EA 2BFGA 3ARQA 4AIOA 5ABEA 7A3HA 1R33A 3SCVA 3B38A 3D52A 4UZUA 3A23A 1UYQA 1HN1A 2PC8A 4YHEA 1QNPA 1E4MM 4PBGA 2E8ZA 2J7GA 4WKFA 3AS2A 3UMMA 3ER6A 3KE0A 2DQXA 2RK4A 2EQDA 3M3PA 3MS8A 3VD7A 2VMFA 2VX7A 4DM1A 4C7GA 3VVGA 2D7JA 2FGZA 2UY3A 4RE2A 2BY0A 2D3NA 4UNIA 3DDGA 1SZNA 4B31A 3FN9A 4QFUA 3CPUA 1OT2A 4OIFA 4IPLA 3BUDA 1PDVA 1R85A 2EPMX 4OGFA 1VCNA 3GXIA 4ENRA 2XVGA 5JZMA 4F9DA 1JXJA 1G0CA 2GVYA 1MW2A 3N11A 5DO8A 1FY2A 1UWUA 1V3MA 4PEEA 4AULA 1PS3A 3WNKA 4XX6A 1QWUA 1R8LA 3W6MA 1GOIA 4DUVA 2V3DA 2CBUA 1JIBA 3A6OA 3WD1A 2B31A 3VIIA 2WC7A 4AD2A 1Q4NX 1PX8A 3WDIA 3IJ9A 3RMEA 4MAVA 3W25A 5IFTA 3MGKA 5I79A 3UCQA 4HA1A 5IXEA 1XSKA 2G3IA 4AZ5A 1OBAA 4WK9A 4ENVA 3D5HA 3BAWA 1EDGA 2QMKA 2WK2A 5A6LA 1EO7A 4D1JA 1NP0A 1ZBWA 3GNPA 4JL1A 4TTUA 4Z2JA 3CZ9A 1MFUA 1TQUA 3QGVA 2XGBA 4C7DA 4P35A 4AUMA 1UKQA 3AISA 4OKDA 2XF2A 4AMWA 2WMIB 2AMGA 4J28A 1QPKA 3BUIA 4AD5A 1B3XA 1CWYA 4XB3A 3ZT5A 3CYFA 3WDRA 4K68A 4AISA 4CCEA 2ZXQA 4B9ZA 4UOJA 4AWEA 2G4FA 1QBBA 3VGGA 1UR8A 1VFMA 2NT0A 1JZ8A 1T0OA 1E0VA 1UH3A 1GUVA 4U3AA 1J9YA 2WMHA 1PDWA 1V3IA 4Z2HA 3WQ8A 1E5NA 4MTCA 1L9XA 4BQ3A 3WMSA 2E4TA 1ZB5A 3P9SA 3VD4A 1C91A 2D0HA 2VI0A 1WZLA 3EMCA 1H11A 3CZLA 1E0XA 5LA2A 3ALFA 1UR9A 2JEQA 4H7VA 3WENA 4FLSA 5DFAA 2J25A 1WCGA 3SCQA 4EKJA 3VO0A 3OLIA 4WKAA 4DWSA 1J10A 1QOXA 2PB1A 3TP4A 2WNWA 1JDAA 4CN6A 2WAGA 2E8YA 3JUGA 1I7QB 1EH9A 2JF7A 3AIBA 1GOOA 3EJRA 1VRXA 1P6WA 3GH4A 1HXKA 1YQ2A 4W84A 2VRNA 2XUCA 3DX3A 4MDOA 2DIEA 2QMJA 3FAWA 5M17A 1PE0A 3AXXA 4UQ9A 3PZNA 4P8XA 5BV2P 1J0HA 1US2A 2ZWZA 2DT0A 4W5UA 2XN1A 5BXRA 2C8NA 5GQBA 3QHMA 3W82A 5M3WA 1GGEA 1RD6A 3K46A 4Y1EA 2WCGA 5BRPA 5IFPA 1M01A 3WUEA 5ABHA 1W91A 3SCWA 1CZ1A 3VNZA 3CMJA 4AMXA 2OWXA 2WHLA 1KTBA 3KKLA 4JFSA 2WCSA 2GK1A 4EAMA 1QWNA 2ZX7A 4PCSA 2WJZB 1UA7A 3W53A 1SY7A 3WDJA 1IZKA 1R9GA 1HNYA 3AXHA 3ARSA 3D50A 3IAPA 1UD3A 5FCZA 3T0BA 4IPNB 1M7XA 3HU7A 1TA3B 1PIFA 5I77A 1HJUA 4MAZA 3CZAA 4J3TA 4S3JA 2XFRA 1PZ3A 3WUBA 2EACA 4BS0A 1CGXA 1KGWA 1UASA 1CLXA 4DWSD 4LRUA 2VPIA 4ACZB 4LQ1A 2QV4A 2ZUVA 5CGMA 1WDQA 1QWSA 2CIPA 1TQTA 1QNSA 2ABWA 1Q6DA 3WD3A 2W91A 4I46A 4AZCB 6TAAA 2V3EA 1CGWA 4TTGA 1OB0A 5JIPA 2EADA 1KWKA 3SEPA 1OX6A 4I2NA 2R1VB 1HKIA 2G3MA 2VRQA 2VL4A 3AI0A 4CU6A 1P81A 3WQ6A 3PZQA 3D51A 1OCQA 2DSVA 4A4AA 1CGTA 3UGJA 3RJXA 4AYGA 3L4UA 4LYRA 1PX4A 2ZX9A 3NIYA 3WNPA 4Z2IA 1QI0A 3ECQA 3MMUA 4ENSA 1E71M 1W32A 2YL5A 3NOQA 4L95C 1LG2A 1GONA 2BY3A 1EIBA 1FP8A 4UFKA 1JZ5A 5GNXA 2YDRA 3B9EA 4B2YA 2W66A 4ATLA 1XD0A 3WNNA 1EQCA 2ZUMA 4IM4A 1WDRA 1EQPA 3L4YA 3TTTA 4OJYA 1UQZA 3OZPA 2WM0A 4GZIA 1W2VA 2GHRA 2DH3A 1VFUA 4JFVA 1CEOA 1WZMA 1QI3A 2WSKA 5C71A 2UY5A 3U57A 1UHVA 2WWCA 1XH1A 3OGVA 4U5IA 4KGLA 4D6GA 3BUPA 4P5PA 3VGDA 4UFHA 3W24A 1TG7A 2OW6A 3CHEA 1CNVA 4U2YA 1ITXA 2D1ZA 3PZUA 1JG9A 4HPHA 2VUYA 2CKSA 2O9TA 3CZKA 4W88A 5DMYA 4B9YA 1QI4A 1FFRA 2HVMA 5HNNA 1WO2A 2J7HA 1SR0A 4MB1A 4JKKA 1WL8A 1QW9A 4MGHA 4NXKA 1JZ4A 3CNEA 1BTCA 1U2YA 1EOMA 5CSYA 1NWSA 2OSXA 4ENPA 3HN3A 3WL1A 3NORA 2CBVA 3VU2A 1CGVA 4E5VA 2JALA 3I3EA 1CXEA 1ISVA 1D3CA 1ONSA 1JNDA 4X0VA 4HU8A 1L0PA 2ISSD 3WBEA 1UWIA 2CESA 9CGTA 3IJ7A 3PQ4A 3WQ5A 1US3A 1WKYA 2LXNA 3TA9A 2YL8A 2WMIA 1A47A 4W7WA 1GVYA 1DWGM 4CN4A 1RP8A 4ADSG 2VR5A 3EFEA 3OLEA 2WMGA 1W1PA 5HBFA 1C3FA 3ZR5A 1W1VA 3F5KA 3VGFA 1E6ZA 1G2IA 3WSUA 4A3YA 3HMCA 2OW7A 2D22A 3WNLA 1IZYA 2J7EA 3POCA 1H3GA 3HZ3A 3MKKA 3BVWA 1R46A 2PBOA 1CGUA 1XH2A 1XRVA 4H2CA 3BWEA 5ABFB 4U2ZA 1TQVA 1WP6A 2BVTA 3LMYA 1Z32X 2VZOA 3VIHA 4FLQA 4UR9A 1PJ9A 2J7CA 4Z2KA 3OT1B 4P7LA 5K4AA 3FNDA 2X2YA 4V2XA 3BAXA 4ENQA 3H53A 1TFVA 1VBUA 4JQSA 3DDFA 5JZOA 2BS9A 3N04A 4ZXLA 1V3JA 4D1YA 3K1DA 2DIJA 4UFLA 3RHTA 1DWHM 1IT0A 2D0FA 3UR7A 3OG2A 1CENA 2IUZA 3A21A 1QDLB 1E3XA 1GQLA 2WPGA 4OFWA 1NWRA 4WIWA 1IZZA 3O6AA 3QOMA 3S5ZA 3DX4A 1B3WA 1YHTA 4ML4A 2WVVB 4HP5A 4UZSA 3PTKA 2GDVA 1QVWA 3BSGA 1GW1A 1J0ZA 4PMDA 4FLRA 2C0HA 2QF8A 1EO5A 1GOWA 2VT0A 5JIWA 3EDDA 1CXKA 2DEPA 1E55A 2CEQA 5CPQA 2NV2B 3WMCA 2XVNA 2V5DA 1E43A 1ISXA 3AMKA 5EFDA 4PMYA 4HA4A 2WKGA 4QLJA 4UFJA 3WY2A 4B40A 2X1IA 5A6KA 3AZRA 1UD4A 2YLLA 4J3UA 4HMEA 3AFBA 5FL0A 4CD6A 3EZGA 3MI6A 1XYZA 4KGJA 4ACZA 3PQ7A 1W9BM 2A3AA 2UWFA 3D3AA 3W28A 1OGBA 1C7TA 4AZCA 2WC3A 1HVXA 5BWFA 1IV8A 3WFZA 2IUFA 4QLLA 5BRQA 3VMPA 4L4OA 4JAWA 2R1VA 1C7SA 2ESCA 2VKTA 2DSWA 1UG6A 4CU8A 4QLKA 3K4AA 3QR3A 3CZGA 4RKYA 4I4NA 3ZOAA 4DO6A 8CGTA 2XVPA 3SUTA 5F7UA 1JI1A 4DO4A 3WDQA 4AD3A 4GE3A 2FHFA 1FH9A 4UCFA 3A5VA 1QF7A 4UOZA 2Z1KA 3MV01 4N0MA 3IK2A 1TQWA 3VIOA 4NZJA 1FHDA 2VCAA 2PWDA 3AIVA 1B3YA 1J0JA 2RK6A 3GXMA 1T3TA 1JF6A 4M24A 2DT1A 2E0PA 3RM9A 1X6NA 3WD0A 1KWGA 1VIWA 1ZL1A 3CZ8A 1M6VB 4V27A 3SCSA 2A3HA 3NCOA 4FK9A 4CVUA 1Q6FA 1R7AA 1WZKA 2EABA 1PV2A 4QAWA 2EAEA 2GFTA 2XPKA 1QVVA 5GNZA 4AD0A 3EDJA 1NP2A 4W8BA 2RGLA 3T2OA 4JFWA 1MQPA 4NRSA 1XD1A 4H04A 4L4PA 3WUGA 2CERA 2X05A 1UQYA 2OWCA 4TUFA 3GH7A 1K9TA 1HIZA 4QCEA 4FNSA 1W3JA 2H2WA 4P36A 5D9MA 1KXQA 3R75A 1Q6CA 3MUIA 1MVYA 2WHMA 3L3BA 3ZJ4A 4F9JA 2PI6A 3W4RA 2Q8XA 3L4ZA 4E2OA 4ZDKA 3EYPA 3WBAA 1P7ZA 3CC1A 2FE0A 3VX0A 1GOKA 5KEZA 4GZEA 2WZHA 2WLYA 4CCCA 5C8BB 4OGGA 3OLGA 5CXPA 3PQ5A 5ABGA 1GPFA 3ZIZA 2E40A 1HJQA 2WYSA 3QHNA 1C8QA 2E9BA 1DWJM 3ARYA 4H8HA 2W5FA 4AIEA 2DGAA 2AD5A 1ODZA 3J7HA 3T08A 5GPRA 1H49A 2G8ZA 5D8WA 3ARPA 1CPUA 3UERA 3HG2A 2NSXA 1G5AA 4P2GA 2J77A 4GO9A 3D54D 2EPLX 4F66A 3SCPA 4U33A 4TXEA 3EN0A 3BVUA 3N12A 2WBGA 3T09A 3TTSA 1ISZA 2BVDA 1MW3A 2VRJA 7CGTA 1B30A 4R5EA 5CQ1A 2D20A 3UG4A 5IHRA 1ZJAA 1R7OA 4M56A 1H5VA 2WXDM 4WKHA 5ABFA 2DSUA 2YDQA 1UR4A 3CZEA 4M1RA 3GH5A 1E3ZA 3AIRA 1NM9A 3GTNA 5TD4A 3CUGA 2J8FA 2VQUA 4AD1A 3B9DA 3OT1A 3VGHA 2IGTA 3CBWA 3SOZA 3VSTA 2WB5A 5BXSA 3ZR6A 1BF2A 2EPOA 4ZDIA 1JZ2A 1KXVA 2W67A 3EDFA 2QLYA 1JDDA 3MUAA 5C70A 4J3XA 4AD4A 2F61A 4LPCA 4FF5A 1JZ3A 4PRWA 1EDTA 1JYNA 2Y4SA 4BCEA 1UWTA 1JGIA 1W9XA 1GZJA 1LWHA 4EK7A 4PMOA 3BUBA 4L7QA 4S3KA 3VM7A 3WH5A 2YLAA 3BGAA 3MV11 3CHFA 1V0NA 3EMQA 2JFEX 4B15A 3L4TA 2WVVA 3CY6A 1T0BA 4PMRA 2X09A 3D4ZA 1UR0A 1IPHA 3BLPX 1QI2A 1JFHA 1WDSA 3AMLA 4CD8A 1K9DA 4HMCA 1ECEA 2JIWA 4GQQA 4FNTA 1HP4A 1UOKA 3BLBA 4P34A 5SYAA 2WHKA 3MSGA 5LYRA 3VGEA 3QOKA 1E6QM 1JI2A 1E6NA 1UKOA 1PBGA 4F8XA 4N42A 1XCXA 1BXRB 4GZJA 4LYPA 1P80A 3P9PA 3WY3A 5I23A 1W9VA 2WLZA 3TONA 5BYWA 1BLIA 2F7RA 1XV8A 2OSYA 3VMOA 5E6ZA 1PZ2A 5AYBA 2J62A 3BCDA 1OD8A 3AHYA 3DYOA 2AAAA 3CZJA 4AUEA 1UD6A 4ZE5A 3W26A 4KRTA 1MW0A 2DPEA 2ZE0A 3PQ3A 4ZGGA 4HCJA 1QX1A 1OGGA 2OR3A 4FLOA 2VZTA 4WINA 1ESWA 2XIIA 3U7VA 4LYQA 5EMYA 3PQ6A 4QP0A 3BHNA 2XJ7A 3N15A 4UQBA 4UQEA 5E0FA 5AYIA 4Y1FA 2EO7A 1CLVA 3RJYA 1H2JA 4L78A 1HVQA 2VXOA 4AC1X 2WHJA 5A2AA 3CO4A 4CD7A 1OIFA 5JBFA 2Y8VA 4PUEA 3W27A 5A3HA 4F79A 4NXSA 3BMVA 3ALGA 2J7FA 2PWGA 1LL7A 4PUDA 1D2KA 1JZ6A 3VX1A 1QNOA 1E5JA 3PTQA 1VB9A 4E08A 1E72M 1TVPA 2WW5A 3TV8A 1JYXA 2YL6A 4PTXA 2F1AA 5FKYA 4JHZA 3CHCA 1OD0A 3VDBA 3AYRA 4W7UA 1CE8B 5CSUA 2VO5A 3T2PA 1KXHA 4E4PA 3TTOA 1HX0A 1WE5A 2V3GA 4ENWA 3BVTA 4WF7A 1ITCA 5E09A 5A6JA 4GIAA 2XGIA 5CLWA 3F5LA 4XUYA 1VBRA 4MNTA 1AQMA 2J78A 1SMDA 2BY2A 3TTYA 3WQWA 1BGAA 4UQDA 3WUFA 2ZWYA 1K6AA 2WANA 3W37A 1G9HA 3AIQA 3W81A 1EHAA 3WMBA 3U5UA 3NSXA 1KR0A 1KEEB 1ZJBA 1EA9C 2F7OA 1O7AA 4W5ZA 3H55A 4GKLA 2YL9A 3VGBA 1H0IA 1C3OB 3ARTA 1HJVA 1XGZA 3L4WA 3VD3A 1JVNA 4M8UA 4M29A 3ZJ5A 1ISWA 1UR1A 1C8YA 2XYLA 2C7FA 2VVNA 1TR1A 3BAYA 1KTCA 2J8GA 3WD2A 3LRMA 3DYPA 1DHKA 3SUWA 4D72A 2VRKA 3N13A 1GGHA 3TOPA 3MIIA 4L8WB 3PZ9A 3NOOA 1GNXA 3CZNA 4AW7A 2WZIA 3CH9A 5I6SA 3NOVA 1W3HA 3I3BA 1N57A 4GO8A 1QHPA 1V3HA 4AXNA 3T0DA 3I3DA 1TUXA 3L2LA 1JDBC 2EXOA 4ZENA 4EANA 3ZR4B 2D0GA 2GUYA 1VJSA 1DEDA 2W63A 3VSUA 4CKQA 1MWOA 5A69A 4AYSA 1LJYA 2F7QA 3PN8A 4B3LA 3WFLA 3F4VA 4CD5A 5A95A 1OINA 1UD2A 1E6XM 4U3CA 4MADA 4PYSA 5CJ5A 2J7BA 2VR4A 1G94A 5LIRA 1Y7VA 1V6YA 3L4XA 3AMCA 3VNYA 4TX8A 3OIHA 3WIJA 4ZFMA 4J3SA 3IAQA 4Z2LA 1GQKA 2Y8KA 1QI5A 3AXIA 5DT7A 3NDZA 1PPIA 1F4AA 4ZDJA 3VD9A 3GBDA 1A3HA 1X1NA 2OLHA 1OIMA 1EXPA 1DWAM 3TQIA 4OZOA 4ATDA 2X2HA 1HJSA 5DF0A 3AICA 4NRRA 1DWIM 1E73M 1BVNP 2DT3A 2OWWA 3WKZA 2IXVA 1J0KA 3KL0A 1Q6GA 4Q22A 1S46A 1R34A 3TTXA 2J7DA 1E1FA 4W89A 1FA2A 2VZVA 4PMNA 4S0ZA 3PTMA 3VPLA 3VMNA 1E6SM 4PMVA 4LX4A 5D9NA 1CXHA 3VKKA 1TVNA 1V0MA 3BVVA 3EMZA 1VCOA 4HOWA 1UH4A 3AHTA 1W9UA 1OX5A 5SY4A 2CHNA 2QPUA 2GJRA 1PIGA 4HTYA 1HWWA 1CBGA 1OY1A 4QYXA 2FHCA 2FH6A 4N12A 4R27A 3II1A 3GYCA 3WEOA 5E1QA 4QDMA 1W3KA 2VZSA 2VDJA 3BUQA 1VF8A 3AZSA 3AROA 4BFLA 1OM0A 3WH8A 3TTVA 5A8NA 3HJEA 4EE9A 2A3BA 3N17A 4HA3A 3U7BA 1J01A 1V02A 4Z2GA 4AZHA 1E15A 4WSJA 4YHGA 4ZE4A 3L4EA 4BQ4A 1K9EA 3AIUA 3N9KA 5A2BA 4OGZA 3AHVA 1KBBA 3DYMA 1GVIA 4N0RA 2VX5A 2J79A 1QBAA 4UOQA 3BCFA 3D4YA 5D4YA 3OA5A 3OB8A 4AZ7A 2ZICA 3VIGA 3QHOA 4W87A 3GXFA 3ARRA 5FL1A 1JF5A 5FD0A 1CECA 1NWTA 2X0YA 3APGA 2F18A 3FAXA 4BIMA 5I5RA 4P7NA 1HP5A 1IZJA 3VOCA 2DT2A 3ARWA 3FSEA 3S5YA 3ZJ8A 3VIKA 1GOQA 4NZFA 3LPPA 4ZXOA 1I1XA 1N82A 2O9RA 3WDHA 1UR2A 3T2QA 3AMGA 2OSWA 2WKLA 5DEZA 2ZXBA 3FHAA 2WMFA 1E40A 1E4LA 4AY1A 3EDKA 2FYVA 3AIWA 3NUKA 3BMWA 3EJPA 3VIPA 1VAHA 2WMKA 4XLLA 5EBAA 1QVBA 3DX1A 5I24A 1C30B 3PZVA 4PCTA 3DECA 4UTFA 5KZ6A 4URIA 1HXJA 4H41A 3O9NA 1KQZA 4H8UA 2JF6A 1RPKA 1ZU8A 3OBAA 1WNOA 2VVSA 1MXDA 1QNQA 3B36A 2BXZA 5M5DA 3CMGA 1TZ7A 3WEZA 3UG3A 1UZ1A 1CIUA 3SF8A 1CTNA 5IHSA 1BHGA 1R86A 1M04A 8A3HA 5A8QA 1CXIA 1B3ZA 2WZEA 4KH2A 2Y2WA 5A6AA 3S6TA 3UJNA 2YJQA 4UFIA 4PXYA 3MO4A 4MB3A 4J3VA 1UA3A 1KCKA 1QHOA 4Q7NA 2IXUA 2XFYA 4YPJA 2WC4A 1O1YA 3F5JA 3ARVA 3ZSSA 1I75A 1UWSA 5I3DA 3VD5A 1BPLB 3WH7A 2FH8A 3VU3A 5GNYA 1V3KA 1NOFA 2BNJA 3GXTA 2WWDA 3AJ7A 1EDQA 1HF6A 4K2HA 2JE8A 5AC5A 4AZIA 3W0KA 2D3LA 4LXFA 4W93A 3UEQA 3CTTA 4CCDA 4WXYB 3OGSA 4CGTA 2YDSA 4B5KA 3KLKA 5A6BA 3NYDA 3DHUA 1BGGA 1OI4A 3GNOA 3GDBA 1QHZA 2RGMA 4HPGA 4MJ2A 2VOTA 4ENTA 1GG9A 1R47A 2TAAA 2ZXAA 2YA1A 3A22A 4FNUA 2D2OA 4JCLA 3LPGA 1F4HA 2GSJA 4M81A 4GI9A 1KB3A 1VCMA 1V02E 3WY1A 4PTWA 2WCAA 1CDGA 2XSBA 1HJXA 1B1YA 3HG3A 3RO8A 3WD4A 1A9XB 3L18A 3PHAA 3VDAA 3AOFA 1LF1A 2EJ1A 5HOSA 1AQ0A 4DWSC 3EJQA 2F8QA 2BV9A 4D6IA 4MPKA 2G3NA 3WQ4A 2CBIA 1E6RA 4B7AA 2PF0A 2NW0A 2GK3A 4AMCA 2R1TA 3RILA 2A3EA 4GPNA 3EJTA 3A4AA 1UUQA 3AS1A 4HZ6A 1MFVA 4L8YA 4PTVA 2OYMA 4AZ6A 3EBVA 1W9PA 2W62A 3AYSA 4D1IA 1UH2A 3PQ8A
chains in the Genus database with same CATH superfamily
4D71A 1E9LA 1GT8A 1JA9A 3IT3A 5CU9A 3STXA 1P7BA 1G8AA 1Z45A 2AXFA 4HTAA 3NJIA 3MXWH 4QRIA 2ADGA 5BPPA 3GR6A 3ZD8A 1HZZA 4C2BA 3CX6A 4N2HA 3QE2A 2HJWA 2R0LL 1NXQA 4B09A 3W38A 3RIHA 3CAQA 3MRSA 1C5DB 1TSIA 3OKOB 3SJ7A 3TASA 1ZMOA 3LDAA 3U9UB 1WFOA 2ZRKA 4L08A 1HDZA 4ODXB 1YUNA 2LD4A 5CB6A 4JZJA 1PF7E 1JGDA 2V1XA 2WJ4A 4NQVA 1TRHA 4HIEA 4FW8A 1OLSB 1P2DA 3P9CA 1CFBA 3LO5A 5G41A 4JASB 3B7GA 3CLFH 3VB8A 3QUAA 1I0ZA 3FHTA 2RGNA 4R5XA 2CXHA 3ARFD 4MP6A 4BQ9A 3X13B 2R6CA 3IMKA 1BVZA 2C00A 2QLFA 1G21B 4KRUA 3HE6A 1UJ3A 3QHFL 3QNXA 1A6UL 2V63A 3RRQA 4YT8A 4F33B 3GNRA 2E4AA 4GZ5A 3H9JA 4RTOA 4K1WA 3M4YA 5G4OA 2GVDC 4YMSA 5D1HA 3LX6A 4XH2A 1B41A 3DZ1A 2XM2A 1VSBA 3B9KB 1C5KA 2BKEA 3QUQA 1QBLL 2QMZA 4EJMA 1NW4A 2CLHB 4HZLA 4K3DH 3NDYA 4XRCB 4AWJC 5HVWA 1WFJA 4CD4A 1M2JA 2YYTA 3PP4L 2CDFB 3STFA 2MQCA 1PX3A 4OD3H 3UAOA 2UYLA 1AG1O 2ECFA 4J6IA 2MCMA 4GSLA 4I87A 4N47A 3FI9A 1Q8AA 3UFXA 2MUCA 3QWQB 3P9WB 3CYVA 1ZT7A 3V8QA 5GSRB 3GO1H 2AXGB 2FDMA 4Z9FA 3ZTNL 2WU8A 3IDYB 3H04A 1A4KA 5DS1A 5D4IA 4JZ5A 4HQLA 3NA8A 1PAMA 5INCA 3L4BC 5SICE 1V6WA 4XW2A 3TBVB 2CBJA 2EFYA 4BZ1H 2J41A 4B3BA 4ORIA 1SK9A 2D74A 3DBHB 1DSFL 4K3UA 1E56A 4Y2LA 2XA8L 2YXLA 1NCDH 2WHYA 3PGA1 3UUGA 3QGMA 4JDZA 4GOND 2QUZA 1JSYA 3QUMA 4A8LA 1U0LA 1TUGA 4NP9A 4WT7A 1RBMA 4FHKA 2V17H 2DDXA 1D7OA 4KTYA 2WQVA 4FR6A 5K39A 2UUDK 4HOXA 5JSQA 3IKJA 2X0HA 3L7CA 2ZSDA 1N33B 2NO9A 5IAKA 4HVBA 3ZHOA 4Y9NA 5A6MA 1T13A 1NBIA 4L3FA 2CNYA 1AK2A 4UUPA 1GL7A 2E6UX 3IPFA 1WF6A 3VJMA 4MGKR 3P73A 2FMNA 3WCYA 2VF8A 4YZFF 2ZUBA 3JZFA 2FX9L 4DV1B 1K4KA 2P8JA 4BUJA 4ZIRB 5C0AD 2QJRA 3GNDA 4LSQH 3C3DA 4HSHA 2H2SC 3RS8A 3I8OA 3R12A 1OT1A 1ZO8A 4UE3S 5DLEA 3Q6NA 4NDNE 1RPNA 3KD4A 3UJHA 2EJAA 2HT1A 2CKBH 5I16B 3IMBA 3NCMA 4B3JA 1A9XA 2W79A 2D1RA 2E21A 4N0DA 5DCUA 4L5IA 4WI0A 3K8LA 4C90A 4PTUA 1WS8A 1T6YA 3LHYA 1B4TA 3LRLA 2VDGA 4OUIA 5IX8A 4OOUA 4CMHB 2P5WD 1W6WA 1J8HE 1CQYA 3ZHZA 4QRPB 4N90D 3WJWA 4GR5A 5D8ZA 4GYWA 1YZVA 5FXMA 1TF5A 1AXIB 3QFJA 4YCMA 4P4KB 1NCOA 3X1BA 2VAXA 2ACUA 5KSUA 4OUEA 2VN8A 2N42A 3O3NB 2A7RA 5A2CA 1YBMA 4XASA 2GBLC 2Q1WA 3AUJA 4FLFA 1K72A 4RA9A 3GB7B 4GX9A 5FB3A 4N22A 4JY5L 3RWOA 3UOWA 2FLVA 2CO2A 2RGXA 4JBNA 3EZ6A 4LEIA 3CHSA 3MROA 1XIJA 1PCXA 3D6AA 2R7KA 3RSFA 1OTSC 2UY2A 1EFPA 2F9LA 4JFTA 3B7YA 4KPHL 1FX1A 3V3KA 3FQ1A 3BRWA 3PJSB 3SSGA 3LPFA 3G6MA 2VDOH 4XBGB 1WQ4A 3FROA 1PBNA 4K23H 1J42A 1GPMA 1DRVA 2XISA 3BD8A 4PMUA 1JFFB 2HA3A 2OKGA 3UC5A 5DJZA 4FL4C 5INDA 1HORA 1OXXK 1J90A 5F97E 3GQVA 3ZT7A 1T3FA 4H8QA 4QL3A 4F1WA 2RI6A 4IMJB 3DO7A 1FP9A 1JAEA 4W1QA 4XP1L 1K6QH 3A7EA 1T1WB 5FWXA 3I68A 2PCLA 5IBTL 3RUGA 3W29A 1VLQA 1BG4A 2ZBQA 3A4YA 1RYFA 4IUCS 4RZQA 5DD1H 3O21A 3DGBA 4XFKA 4EBFA 4K88A 4XVSL 2QEZA 4LXHA 4ZR8A 4KQJA 1CGSL 4GZ7A 1C92A 1JGLH 3I58A 2R27A 4RL3A 1WT5C 3PAOA 4K05A 3OTTA 4HQOA 4JDUA 4R3WA 3SGJA 4X93A 1IAMA 4J6EA 2ZPKL 3L7KA 3Q85A 1JEOA 4PM4A 3DDNA 2YV5A 3FH7A 2DMCA 4J3WA 3CGWA 3PAYA 1RHJA 5SWSB 3AESA 5TAOA 1KTDA 5HDWA 1HT2E 2YAQA 4L5YA 1JDCA 4APQA 1X3LA 2EKSA 1F8XA 4XFJA 4LBUA 4BGVA 3ASUA 4PJEF 4O4YL 4X6DB 4DJFC 2OUIA 3M1YA 1MV5A 5T1LD 4YRGA 1HE7A 1F14A 3DC2A 2I03A 4MUFA 9XIAA 4FI4A 2YXMA 3R5JA 3B70A 4CF3A 4E13A 4Z4QA 1ZEAH 5E8DL 3R06A 2BPOA 4DM2A 4MYDA 1KCVL 1HSZA 1HEZA 3A4MA 5CAEB 4AX3A 3QPQD 1RXCA 3K70C 5C1OA 1T2QH 2AQ8A 4A6YA 5AAMA 2GWGA 2H4YA 1FL5B 4YS1A 1QM5A 3CVXA 1MH1A 4R90L 4BEWA 2Z0IA 4XD3A 2YZ2A 2CHWA 4YHIB 1LO4L 1IFHH 4RFSB 3NM4A 3VO1A 1I6WA 3S3JA 3W2EA 2BNQA 1FRNA 1M9SA 5ICUA 1RJ9B 3KZMA 4YCDA 2FRGP 5D4JA 3JD0A 3RIYA 4LMAA 1Z6AA 2B9AA 4PB3A 5TF1H 1RJDA 5ITVA 1LBIA 3KHJA 3N3BC 3NCEB 3SDYH 3HACA 3TIEB 1X1RA 2F74A 2B2XH 2HIGA 3TAUA 1AQNA 3OQEA 2VDKL 1EHLL 1TJ1A 1TD1A 3GCXA 4LDCA 4IVQA 5CZXC 3RGTA 3VFPB 3WYCA 1O0BA 2G6BA 4FEMA 4LGPB 4UYQA 5FHRA 3Q6FB 4QYTA 1VA4A 1EGQA 4I4CA 1OILA 1KOFA 2N7AA 1B9ZA 2ZAGA 4IL0A 2GAIA 3M9XA 1M83A 1K68A 3BQUA 2YPIA 5MEOA 1FNNA 4LLQB 3BISA 4BFZA 1L7QA 3C98A 1JKFA 1JWSA 3IM1A 3QWRA 2W8CA 1EFRA 1CFNA 4MP3A 3JD3A 1DBBL 3AI3A 3AAZA 4X00A 1KN2L 3PZRA 4JD4A 3HFRA 2Z6JA 1Y18B 5GRVL 1R4MB 3V46A 1CNMA 1T20B 4ZZ2A 1JZ7A 2H26A 2CLCX 3NJNA 1Q15A 4C4KT 3NIGF 5KB3A 3BK2A 1QE0A 3PENA 3FXYA 3O3AB 4ZSUA 4YXWD 1JHZA 1DC7A 3M4NA 2F15A 3K35A 4IWNA 3OPNA 1GRVA 4WY5A 2A1TS 4XSMA 1IBYA 2P0IA 3B03A 3QEQD 5GXBB 3W9SA 4TULH 5C7XH 1SHJA 4N0YL 4IU3A 1AKJD 1E96A 2Y2UA 5AVXA 2UWEE 1A9BB 4AJVA 4OFKA 3DZKA 5FIUA 4JK0D 1AQHA 1T7ZA 2VLIA 3UJ7A 4Q4CA 1TFHA 3HZRA 1VEMA 2XNAB 2ZUWA 3V7WA 2VKQA 3K9HA 3EJ6A 1NBME 3RLSA 2RH8A 2DQFA 2D03L 3LY7A 2OK0H 1MEXL 2JAHA 4G71B 3TLGB 4C56D 2VXSL 3DLIA 1NVWQ 1BKYA 1BBJB 5DLLA 1BBDH 1Y1UA 4IRSD 5DCCA 1HUQA 1TW3A 2RGUA 3G0DA 1E1EA 1OF2B 3FCSA 2PXXA 3DC8A 3VKDA 2CYCA 5I9SA 1F7UA 2FN8A 3EXIB 3A10A 2DPXA 2YICA 4DY4A 4ILSA 1D3GA 2ET6A 3BLOA 2QJJA 1B2LA 4YP6A 4PG9B 3B1ZA 1HTBA 2EE0A 2B5VA 4KXBA 3IO3A 5HKOA 3EBLA 4AHOA 1HYGA 1DVQA 3SBOA 3BDXA 3HNPA 4CKWB 3LLVA 3VZQA 4QPNA 1WAUA 2ZT9C 5HR5A 2V68A 1XLDA 2LIPA 2F3QA 4C4UA 3GLHA 3V6ZB 4PRTA 3MTJA 2PMQA 1VCNA 2E9IA 2XVGA 4DIMA 2X4OA 4F9DA 2HAEA 4XDGA 2YFHA 1OYAA 4RCXA 1TDJA 5AI0A 4EHNA 4MCNA 5T6BA 2JJSA 1B0UA 5BYKA 2CHDA 4PEEA 5AZ0A 1XHLA 1UK8A 3B7RL 1DBJH 3A9VA 1Q0SA 2Q02A 2E5CA 2XDFA 2B31A 1ORDA 5IB2A 5L9DH 3GS7A 3YPIA 5I18H 3JQRA 2J8TA 3FUTA 4RL6A 4L3AA 1PSCA 3RMEA 3HS3A 2IOFA 5GSVA 3WJ1A 3MGKA 1PWEA 4M7ZC 1AGEB 3KWFA 1XTLA 1T1XB 3L1VA 3EXFA 4YWSA 3PUXA 3QTGA 1EDGA 2B7NA 1Z5NA 1F4YL 1GD1O 1I85A 1HWGB 3FTCA 2EG9A 3BV4A 4DGYH 1JOIA 1IUKA 1UFVA 4RPGA 3BHBA 1FL3A 1KBPA 4FZJA 4FFZA 4O1IA 2AABL 3RWFB 3CYFA 4ELMF 5CBEA 5E9DE 4EMBA 4KBFA 4PEKA 4K71C 3PNWB 5T1KA 2XF8A 4IOLA 1J48A 4P31A 1RJGA 2ARWA 5LZ7A 2NDGA 1SB9A 1WQVT 2C4MA 3RY6A 5DRNB 5GZNA 1I8JA 3DUSA 5C8YB 1H7OA 4MS6A 3EGVA 1JV2B 2CLZB 1X8JA 1E5NA 4NKMB 1YBQA 3K8OE 3UPMA 4D92A 3WMSA 1H63A 1PNTA 4GUGA 2VI0A 3MCMA 4Z4CA 3RTDA 2VRAA 5J9FA 3ALFA 1X19A 1LF0A 1RMFH 2AXNA 5FF6A 4PBRA 4R9NA 1G7MB 4AE1A 2XUWA 5DZSA 3W3AA 5G5DB 5B55A 1U99A 5KAQG 3PNKA 2BONA 1KDRA 4L7ZA 1E61A 2RHTA 5AFSA 2JF7A 4D74A 3SPJA 2P9JA 2EVFA 4MA8L 5IREA 3UMCA 4Y2TA 1P6WA 2UZPA 3FQRB 4LPYA 4KXAA 3PGDB 3C41J 5HA5A 3D59A 1IT9L 5CT8A 3LX8A 1CICD 3DTTA 1YDPA 1PR6A 1OIOA 8XIMA 3VTFA 2QD2A 4WZ6A 4JG5A 4W5UA 4PI0A 3QV6A 2YNMC 4LGMA 4EHKA 3CU5A 5JFGA 3T5GA 4BO1A 4F8QA 1V3VA 3KAKA 3OM9A 4R0LA 1NFFA 3MUHL 1FP4A 3FJTA 1CCZA 3ICPA 4KWHA 5AP9A 1W91A 1K2VN 3R3ZA 3GVQA 4ZVOA 2WLMA 5K0GA 3L5XL 2CDAA 1KLFB 1OFGA 4DSYA 1PTDA 4GBJA 4E5PA 1BQLL 3ICOA 3EOTL 3NNTA 1R9GA 3KPVA 4LOHA 2Q8BH 3IAPA 6FABH 3EF4A 1Y3FE 3AB8A 4OU4A 4ZX5A 5LNSA 2F43B 1W4CA 4K3VA 5B4UA 3CSPA 3S4YA 2YS4A 4KKCD 1ID1A 2Z7WA 1NM5A 1YS6A 1T8TA 1V79A 3MO7A 5C1MB 4NDMA 3DX6A 4XOEA 3HJGA 2VHTA 5EY5A 5H70A 3ILPB 1R2TA 1N4DA 5CGMA 1WDQA 3EXJA 1DJHA 4GYPA 3SE3C 1CRZA 4WWPA 1U28C 2CXOA 3IMTA 3G0CA 3BQ5A 2ZRMA 5EUCA 1DBSA 4FHJA 2AW3A 3VNBA 1XNRB 2R8ZA 1YO4A 5E2VL 1X14A 3QT2A 5TQVA 3ABXA 1E2HA 4Q8PA 1TZIB 2R1YA 3AI0A 1WPQA 3NHKA 3CK0L 2EG8A 5G4WA 2FJKA 1FLDA 4LYRA 1T03L 4H1LB 5KSAA 2FEDD 1E71M 1W32A 5H3LA 3B4NA 1Q57A 1EIBA 1TAHA 3SM9A 1PE1A 3B9EA 2XTZA 4XPHH 3E82A 4RLFA 4FMCB 3IFOA 3TRKA 3ELUA 3AK4A 5AB1A 1UC4A 5DHYB 2BVWA 4OF3A 1RJQA 4Z42C 3U0PB 5A2IH 1VIVA 5T4HA 1JPSH 2WWCA 4M7KL 3Q7SA 5CILL 3UAAA 2H2DA 3KCLA 2WNKA 4I7VA 1JDTA 4A1OA 2PGEA 2YCLB 3RUPA 2Z8VC 2QUJA 3EDRA 5ITWA 1J8DA 4KUGA 3CHEA 1RKQA 1N6UA 4MHSA 3PZUA 1M67A 1O87A 5AI6A 3B12A 3O6YX 1Z08A 3SZUA 2QVKA 4WW1B 2F84A 3WV5A 1QLJA 1FFRA 4DNQA 4JYZA 2VDWB 3TRJA 2OXHB 2PYED 3F96A 1VPWA 1EVEA 4X6CF 3CNEA 2UZIL 4P5RA 4JFDE 4DTIA 4ENPA 4Z51A 1T5OA 4HUKB 3HN3A 2J46A 2QN2A 4J16A 2IS4A 3VU2A 2P52A 3O4JA 1NVVR 2J4CA 1DVFC 3LK6A 1XQYA 5F1KA 3WN5C 4IJWA 2R0LH 1H50A 3EDQA 5IHLB 5CB8A 4X0VA 3K4HA 4PNZA 5JDSA 4UTWC 2F00A 1H5YA 1IFGA 3TZHA 1DLJA 2GF0A 2BTQB 3VZZA 5EI5A 2QN6A 1R3SA 3Q72A 1WBZB 1P1RA 4OX9B 4CM4B 1ISJA 5DRTA 4NBNA 4NG5A 2MSEB 3EKCA 1PUIA 4GRSA 5LXTB 5LB2A 4ZMNA 1V3UA 4N48A 2V7HB 4RXMA 4PZVA 4PAMA 3SR4A 2HO5A 3O8OB 3K0YA 4M88A 3RHWF 1QHEA 2AN1A 4QXPA 2WD8A 2G28A 2D22A 3Q3HA 4X4XA 3QG5A 3W1XA 5DEIA 4QRBA 4IWWA 3QHFH 4MYRA 4NKQB 1A6UH 1H3GA 3NQFA 1JF1A 4XN5A 3P8IA 2I99A 4X7TA 3CVYA 3V1YA 3RBGA 2Y0CA 1P4LA 4N0CC 2XBDA 4FOTA 3T3PF 2EIDA 4MAFA 5EXSA 1IGCL 5ABFB 4YDRA 5ADUS 1NMCB 2AJZA 4U2ZA 2BVTA 3UGKA 3MJ8B 3FNDA 4DPPA 1QBLH 3K0BA 1A65A 1CUAA 3E18A 4V2IA 4ARZB 2WZ0A 4G09A 3JAWA 1ZJZA 3HUFA 5AVHA 3N04A 5DYTA 4BXVA 4Z2YA 1V3JA 2AMLA 5C34B 2CJ3A 4RV9A 4HA0A 1DKOA 5C2JB 3PP4H 1Q63A 4PUUA 4LWOA 3H6KA 4UUNA 2PUGA 4EB8A 3QQ1A 2BMJA 1PFOA 1B6RA 1E1QA 3A6LA 5HZMA 4HIXH 3ZVVA 3KJGA 3LCRA 1E2NA 3UW6A 3P4NB 1JRLA 3KCJA 3TNNA 3AF5A 4LC6A 1UZMA 2QJOA 3ZTNH 1WKFA 3AQXA 2H3NA 5GJTL 4JICA 1VZ3A 3W2FA 2G2RB 4MQSB 2OKTA 1TR7A 3UBMA 5EJEA 2UVPB 1C9MA 4MVAA 4IDJL 3EJYC 1M3JA 2EICA 1QO7A 4E0BA 2ZSAA 1DSFH 1MN4A 2XA8H 3OJOA 4GA8A 2ICEA 4QEKA 4XYMA 5IK2D 2WKGA 1WBHA 5TJHA 2AK4D 5FA4A 3A67L 3MCZA 2QM7A 3O90A 1R0XA 2H2GA 4J1QA 1R5WB 2GCOB 4QQUA 4F56A 1G6RL 3VAAA 4TQPA 4JRXB 1W9BM 3OQPA 3IEIA 3B1XA 3CEJA 4MD4B 1QZUA 4PP1D 4LRQA 1N0HA 1CYEA 2ZULA 3WFZA 3AU6A 5DXJA 3LVBA 3WI7A 1O60A 2HJHA 4HO1X 4F0SA 4BDVA 2CV2A 2XU9A 2VKTA 4TMYA 1Y34E 4BQFA 3UXMA 4U4BA 3CZGA 3PQYB 5KNDH 5BWBA 5HMLA 1R74A 5DHSA 5B4MC 1N2RA 2E6FA 4HLQB 2X12A 2FX9H 4OIAA 2W6JA 4DLYA 3GDMA 2HSEA 5LKNA 3HYCA 3BP7B 5J56B 5IUJC 1JI1A 3G2LA 4FA8A 1P45A 3V0AC 1RY0A 3PTDA 3QVOA 3N0XA 4UHFA 3UKDA 4EX7A 1NYRA 1K77A 3ZOZA 4EW1A 4U1JA 1TQWA 2PDMA 4PB5A 4UEQA 3RWJA 2EU8A 1E99A 2HA0A 3REWA 4LAQL 3O1HB 3VHXA 1KIPA 4GY4A 1TJPA 1FPQA 5ARCA 3FTFA 3C2EA 3ORQA 1A9EB 2EAEA 2X3CA 3QPCA 5EC2B 3A1NA 1EXVA 2YKGA 1N9KA 3USCS 4Z7UF 2AE2A 4ZFFA 3DU0A 3HJFA 4LF7B 4QQFA 3TW8A 1F8MA 3VKJA 1D5IL 1EXMA 1V11B 4N40A 4QIRA 3GJ3A 5J5CA 4YO7A 1IBZA 3AP2A 1R0AL 2O3TA 2O5YL 2J85A 4Q4JB 4UVGA 4XTRA 4BWLA 1FLRL 3KHTA 3IUMA 4RR4A 4EUNA 1JGEB 3KYJB 3HR5B 3D8RA 4WNJA 3G5VB 3GMDA 2FFCA 1MABB 1NL3A 3A36A 4TLAA 5CBKA 2W2MA 2W42A 5JORA 2FE0A 3UTPD 3FONA 4YWGL 3VX0A 2WLYA 4DHLA 4KPHH 4OGGA 5T4FA 5A5WA 4C1KA 1QHHB 1WQ5A 3KHOA 3GNQA 2D3WA 2V59A 2BFEA 2WD7A 4ZB2A 5DI8A 5I17B 2QTBA 2I9PA 4AIEA 1ACCA 4RM2A 3T52A 4LAUA 2R85A 1X7XA 4M8NE 2XA9A 3ANVA 3GSNL 5M29A 4OVVA 5AVYB 5EOTA 1JILA 3D54D 1TVEA 4F66A 5AK0A 4ZYWA 2DKNA 2ZSHA 5L7WA 4TXEA 4PVBA 2FP3A 3EAKA 1D2MA 2X15A 4XP1H 3DD1A 3IIEA 3K94A 3LH8A 1TV5A 1OLXB 3RZWA 2TYSA 1R7OA 3NHAA 2DTEA 3ZVKA 3EYQD 1XVLA 2E87A 4LYFA 4G9PA 4XVSH 2P68A 4ERXA 5LJIA 1A7OL 4KLCA 4TQIA 4DRYA 5F4BA 3I75B 3SOZA 3FPFA 5JAQA 5BPHA 5ECDA 3PHGA 2ZPKH 2W67A 1U0NA 2QCDB 1C8KA 4PJXB 1NLYA 5J1SC 4M03A 3HL0A 4PRWA 4N8VB 1QKKA 4FR0A 4RHEA 1JYNA 2Q3CA 1QGYA 2JEZA 4QRQB 4ITRC 3BW2A 3N34A 3FJ1A 1OFEA 3AO0A 1JGIA 3KCPA 3B6SB 1A4MA 5TGBA 3WH5A 2CXRA 3GTHA 4HT3B 3G3DA 1IN1A 3CY6A 3DEIA 1M6UA 1T0BA 1DEEA 5TIIA 4NNXB 4O4YH 1AGBB 1QK4A 2YBEA 4MR9A 4BLSA 4AEOA 4F3KA 2C58A 4YLBA 1WDSA 3AEZA 4FKMA 1K9DA 2D5CA 1O9GA 4DT1A 4XKYB 3U9PL 5SZKB 4NIYE 3W6UA 1RURL 4FNTA 3KIPA 5KSBE 5E8DH 4PQYA 4P34A 2OYSA 1W75A 1KSFX 1KCVH 1B23P 1F11A 2F54E 5LYRA 1DEHA 3A27A 4ZMZA 1T2CA 1YAZA 4BWWA 1IJKA 4J3ZA 1Q7MA 2XWBB 3I6TA 3ONDA 2UY7B 3ZE7A 3ZX1A 5EE1A 1WITA 1E9DA 2PUBA 4WXZA 3GC5A 1QYGL 4R90H 5AVRB 2JKEA 2R7MA 4ATNA 3O2DL 5G1NA 3S36L 3VI3E 4LAJH 2XG5A 2WTPA 1LO4H 4FCHA 1RHQA 1GPOL 2EDQA 4E9RA 3AWFA 5I6NA 1JBKA 1AKEA 1F8FA 4KMTL 5EOQL 3TQFA 3DYOA 3AY2A 1K4DA 4LJRA 1Z9PA 2JLAA 3DV4A 1G1AA 2DPEA 1XPRA 2J6CA 3NJ8A 3U1QA 1AI1H 2B81A 3DEZA 2XIIA 2NTNA 2X77A 4NV1A 2BT4A 3AW5A 2RQ8A 4UQBA 5E0FA 2VDKH 3GDKA 4TQTA 1NC2A 3C0JA 1EHLH 5DM1A 821PA 1EFKA 4R7NA 3U46A 1SY6L 2VXOA 4AX7A 4MRAA 4WY0B 2XB9A 2GEUA 3QQ3A 3EJZC 1QR1A 4P46C 2XNDD 3FKSD 4X6EB 5LBUA 3TIIA 2BFNA 5CG2A 2VJMA 3BQ9A 2OORC 3UK0A 3ZPDA 3C14C 4YVVA 3JD4A 5EYPB 3DDCA 4BWTA 4J39A 5AH0A 2LPMA 1L7RA 3M0EA 2OWEA 3KSZO 4JDVA 2F53D 2H3XC 4ZSOE 1RCQA 1DBBH 2Q1EA 2A4EA 4PTXA 1KN2H 5ALRA 4EUPA 2X7JA 4JA0A 1M68A 1WE5A 5BQOA 3S4SB 3WGTA 5EIBD 3EX1A 4RELA 2FTAA 4GIAA 1KO1A 2OFFA 4U6HA 4YY3B 3C8HA 3SD5A 1U0TA 2GEEA 4UQDA 5LDUA 1A9SA 1KE1A 4B92A 3GRWL 4UHJA 3W81A 4U3JB 1K1EA 3RC7A 4NIMA 4JFXB 2G9NA 4JTRA 4LSZA 1KJZA 1Z7WA 3EWXA 1ZXQA 4IIQC 4N0YH 4MH0R 3KAAA 3FUHA 4DFHA 1MW8X 2YQ3A 1BGWA 1WS6A 4J3OD 7REQA 1BRMA 1ATZA 3QEGL 2DQIL 1ISWA 1G7QA 2LDXA 3U2EA 4DLBA 1F1GA 1ZCAA 2WD9A 1CBUA 4CLRA 2J8OA 1AHWB 4Q6XA 3ET4A 3SUWA 3HV0A 3K6JA 2D03H 1MEXH 3LKPA 4C29A 4KFSA 1TZ2A 2RI1A 2VXSH 5T5NG 4X0KB 2I7CA 5D1XB 1YZKA 2NX5B 4WHDA 2PU0A 4L27A 5F2IA 5DIFA 1KKRA 4OI1A 3RU3A 3JCZA 3QXTA 3W84A 3FOAA 1RQPA 1Y1LA 5FWYA 3NBYC 3I3DA 5LBGA 4LZKA 5C09B 2WT4A 1V7CA 4LC8A 4JB8A 3DVGB 1VC4A 4JIGA 5HCUA 1N32B 5EIEA 1VFNA 2DM3A 2J7BA 4Y5YA 1EE1A 2OGWA 4AQOA 4AP6A 4OQ1A 3FN4A 2F08A 4FZ3A 1N59A 3STGA 3RK1A 1NP3A 3RX5A 5EU3A 3GWQA 2C2MA 3CSTA 1MCKA 4O0ZA 2A0WA 2W6ID 3H99A 3OM3B 1B73A 1ASPA 4J29A 1N0IA 1X1NA 3K7UA 4F33A 1N3YA 4MMZB 2F1HA 1YADA 1S2IA 3LGEA 2PO7A 1D8WA 3H9SE 1T6ZA 5DMHA 2QE6A 8ABPA 3I10A 3SQWA 3R7SA 3D2TA 1V5WA 1KI3A 1J0KA 5AK3A 3B6MA 2ADGB 5CYFA 1R34A 3GI1A 3FT2A 1NNLA 4LXTA 4PLKD 1F51E 1U9ZA 1GFZA 3B2EA 5AKZA 1W1IA 5IQMA 4RLSA 5BZDA 1SW7A 2R15A 4DIDA 1IFRA 3I6LE 3PL6D 4Y67A 2MJLA 1DG3A 3Q4GA 4B0OA 1BQKA 2LDBA 4NR0A 4DC0A 3WK6A 4XMZA 3NPXA 3NT4A 1Z34A 4DGIL 4JZJB 1F4YH 3BVVA 1JGDB 1XEUA 3CLTC 3MZ2A 4ZTEA 4HIEB 2EIJB 4AY7A 3O8QA 4QHPA 1W9UA 3PFKA 4MULA 4MJHA 1JTTA 4TS9A 3THSA 1QG6A 2PRZA 3SIKA 2WUVA 2AABH 3COOA 3KM1A 5EU6D 3ZHLA 3AWDA 1MCIA 2ACVA 1YVRA 3HE6B 3K4QA 1UJ3B 4XXCA 2Q8AL 3S47A 3QNXB 1OM0A 3WH8A 1NWPA 2WO3B 3IEUA 1XNJA 4AIBA 2X0UA 4R84A 3AUKA 2FPOA 3DBHA 4UPDA 1J01A 1V02A 1KY7A 1MVOA 2JKVA 5KMYA 1Y6JA 1NGXA 3TA3C 4DI8A 2H3EA 1CW2B 3AHVA 1FFYA 4JPVL 1W5AA 1DE6A 3KLSA 2VX5A 1WWKA 4K9NA 3SJCA 3AVOA 4PC8A 4WY8A 3G3MA 1MEJA 4HIJA 3PFFA 4R8MA 5F6IC 3CWHA 5J58A 3A4IA 2X4RA 2R6AA 1NUFA 4UQPA 4R2JA 3NFPA 2YK1H 5DC9B 2QKYA 4JYEA 3NDIA 2O2SA 3JV5A 2EJCA 1H3NA 3S5YA 1NPNA 2FZCA 2GOYA 2IH9A 1N82A 1UKEA 3O2JA 2FJUB 3T2QA 1J07A 4JQOA 3UFXB 2PKYX 1GNTA 4ZT7A 1C1EL 2X6RA 1IT9H 2D7PA 1ZT7B 5HUHA 1CR0A 4KE6A 4BYHA 5C0RL 1CUHA 1A4KB 1PLCA 4WI2A 4H41A 5JQGF 4ELKA 3VTMA 1AH4A 3AG6A 5INCB 1GOHA 3AHGA 4U9IS 3TB4A 4ZJUA 3I42A 4P3KA 4PJ5E 2CUIA 2GYVA 3JWNH 2ZVRA 2AJUL 1XJQA 5KKNB 1TRDA 4G4GA 3GUUA 5EEWA 2Y36L 4PIBA 3UXHA 1XVSA 2W0SA 3C60B 4IHOA 1Q90A 1F56A 3L5XH 2PDBA 2WV8A 5L2KD 2I3BA 1TZ7A 1FP2A 5F2EA 4AZ8A 2JZNA 2HWWA 4IFKA 1BQLH 1I8AA 3EOTH 1A96A 3HPJA 2K0RA 2OXEA 1JZGA 4UHKA 1SUAA 4BX0A 3FBQA 3QUMB 3A6CL 4HFWA 4ND7A 1M2NA 4CMAA 3K6IA 4ZXBD 1OZTG 4J8RA 3TBTA 4MB3A 3NQ41 5K39B 2JF0A 2QCCA 2PF6A 3IT2A 2DQ6A 3ETSA 5DURB 3W5CA 3VH4A 3COWA 1X1OA 5IXJA 4L4VA 1A0OA 3S2ZA 4MAYD 4YPJA 3ARVA 3BLEA 2Y1OA 1TM3E 3SQXA 4BBWA 3HSSA 1E5XA 3EZJB 2EQAA 3KWWB 1FAIL 4AFNA 1U0JA 1SHWA 2IANA 1HOCB 1W73A 3ZDFA 4UQIM 3P73B 1JPDX 5E2VH 1IY9A 4OLZL 3KBWA 1KO5A 2IVZA 2GD2A 3HCVA 5KVSA 4MJ2A 1V5IA 1BOGA 1MPTA 3IO5A 4Q0MA 2TAAA 1PF3A 4FT4A 1V9CA 2NYUA 4Y5XC 3CK0H 5LNDA 1EAJA 2ZOOA 1M1SA 3PJSA 5IC5A 2VSFA 4X3PA 4GI9A 4M22A 4A8IA 4L4TE 2GETA 1I8TA 2DQYA 4M1WA 1G6VK 1HRKA 1HU8A 4MY9A 1A9XB 3GUHA 3UKOA 3HURA 2X0KA 2IKSA 2GK7A 4DCSA 1D9XA 5K8CA 1JFFA 2HZBA 2O0TA 1KV5A 2EIBA 5EIIG 3G3EA 4EFKA 4WI0B 4PTUB 3GFYA 3L81A 5HSGA 1HYBA 1YJDL 2V0TA 4DKEH 5EEGA 3FAKA 2A79A 3SECA 4HZ6A 4M7KH 4PTVA 1R9MA 5CILH 4OV9A 4ES8A 3BW4A 1JLSA 2BLFA 4YS6A 2Q09A 1W9PA 2VLLA 2W6QA 3QFJB 4PTTA 3N43F 5G1OA 4US5A 3KWLA 3ES9A 1LSOA 5KSUB 2WQRA 1K3ZA 5F9MA 2VCCA 2CR0A 4F86A 1RUQL 1ZRNA 3AUJB 1BZYA 4X42A 4RA9B 3TX2A 4WJLA 5IS2A 3GNML 2GPTA 2JFUA 3R7FA 4DV5B 2Z4QA 2A9RA 2AKMA 2J48A 2UZIH 5LXEA 4N8PA 4K0RA 3HBLA 1NMBL 3MROB 5LKRA 1UZ4A 4XNZB 4JL6A 4DWJA 3H7LA 3CX5J 5JVDA 1WDWA 5EUOE 3NEAA 4A0QA 1TV2A 4YHOL 1XRRA 4FZ8H 1NF0A 1UFQA 4EVNA 3H8AA 2WSIA 2D7MA 3RJMA 2DKOA 1XHGA 2FD6L 3CIQA 3ORYA 4L50A 4XPFL 3PJDA 5SWSA 3K92A 5FPIA 3JTMA 2YJGA 1EVUA 1YY9C 4MB5A 4LTSA 3SJUA 1Z8FA 1BS1A 3R8RA 5DJZB 2PF8A 2IMRA 3FTVA 2PN5A 5INDB 4TX6A 1YPZF 1CP2A 4YDZA 1WBBA 4GMKA 1DKNA 1T3FB 3UZXA 1G7VA 2WIFA 3CW8X 5I5JA 1SLUA 3DO7B 4YAWA 1RPQA 5DVOA 7TAAA 1K5HA 3GGWA 3HRZA 3PWTA 3WH9A 1OOAA 3GZJA 5CIQA 3V6OE 4NWTL 1TCDA 4ISCA 3ASVA 2ORBL 5CAEA 3RUGB 3U4QA 2LIVA 2FEWB 2C5EA 5JLAA 4TL9A 2FBJL 4XMTA 2E5WA 1VECA 3H2EA 4YVXA 3CCFA 4MI1A 1BZOA 1MFPA 2GJJA 2EH8L 1OK6A 1IGCH 2R65A 3GN2A 5KVEL 1ELOA 4MS4A 5DEGA 1QK5A 5CXSA 3U2JA 3MRRA 2ZI9A 5T1DL 5KVMC 3AI2A 4CIXA 1JE1A 3HCNA 3LOWA 2WSDA 1AB6A 4FXGC 1EWKA 4BCBA 3VYOA 3N06B 3VTRA 4KJZA 3SKXA 3W7MA 4Q0XL 2D23A 3MKCA 4Q9IA 2P7IA 4YJ2A 2QX4A 3UNTA 2HT2C 3TAKA 4N2KA 1NFQA 3BH9A 4TXJA 1CV2A 1BQCA 1MA0A 3SFVA 4HSGA 1KTDB 3U1BA 4RA0C 3EUAA 1QXLA 3AIIA 2ODHA 4G6ML 2EKSB 4PUKA 2GERA 1EFDN 4WUUD 2GD6A 3H5OA 3SY5A 1ZISA 4MNQE 1EAYA 4HHGA 3KJIA 1UB6B 1YA5A 4I0PC 4DY6A 5B6IA 5EIIA 5GINE 1CIDA 3W2DL 3GKZA 2BFPA 4TU1A 4BTLA 5GJTH 3H4XA 4LLQA 3EZYA 3R06B 4P61A 2XG4B 2X7HA 2G1JA 1HEZB 2XQIA 1PS0A 2ZRLA 3IMVA 4IDJH 1M0EA 3IYLW 2RJOA 5F2OA 1NAMA 3NJLA 1QAOA 2ISFA 5HD8D 2H4FA 4JPIA 3B5EA 1IEXA 3QPVA 2WHPA 5GY7A 5LU8A 2AZDA 1W5BA 1U8CB 2H47C 4B6FA 3A67H 2IYVA 3OC0A 4CKVX 1F3LA 2JEOA 5CSRA 3E1KA 5JMWA 1A7AA 5GGYA 4CNSA 1G4MA 1G6RH 4Z3TA 1NGZB 1SW3A 3Q2IA 3GTFA 1PTZA 4J3FA 1VJZA 3HDHA 2C4NA 2F74B 4FXFA 2FEMA 4OXQA 2BMEA 1HKMA 4JDPA 1D3HA 1YYCA 2EEXA 1UUOA 1QBMH 1R0MA 4G0WA 2PXYC 4JGBA 3WF3A 1PGOA 3KRBA 3LHZA 5U9CA 4G0NA 1USWA 2YEZA 1J9GA 4M9ZA 2GJPA 5DO2C 2C34A 3WMWA 4D4JA 3LGSA 2OV8A 1MAWA 2J74A 5MEOB 2YAPA 1UIMA 2D5LA 4MQTB 5FBZA 1CSEE 1UMDA 4WI3A 2WYZA 2GDQA 3HV2A 1CFNB 1Z73A 5AJVB 1OC7A 1US8A 3AAZB 2ZZ4A 3D8TA 5CK4A 2I25N 3IRSA 5LA1A 3VOAA 1BVWA 3ONFA 3VDGA 3HS0C 3PJXA 1NWHA 2MIZA 4U0KA 1FSFA 3T5BA 4QLWA 2BFWA 3BO9A 5FM5M 3OG6B 5BV0A 4BNKA 1OO2A 5FV4A 2BNRD 3UMYA 4KO7A 4I2XE 3JS3A 5JCJA 1G1KA 1WZ1L 4M1KA 1O4VA 2QT6A 3VC2A 3SDAC 1VG0B 1D5IH 5J11C 1R0AH 1E1LA 2BW0A 4D6HA 1S2VA 2C0QA 4CKWA 4HK7A 5AVXB 1GVFA 4RPIA 1L9RA 3CEMA 3MQTA 3G17A 1S7TA 1U8EA 3Q3GE 2EWVA 2D9QB 4CMKA 1R9ZA 2I27N 5GRVK 4JTEA 4NZ8A 4Y16D 1LL6A 2HU8A 3CM4A 3TQPA 2OZ4L 2PTTB 2GM4A 1A77A 3JRNA 2XG9A 3LHTA 4R0VA 2Q4DA 5CJ8A 2DY0A 1Q17A 3ZX4A 2CETA 3MXWL 4ZCSA 1XDZA 3Q15C 4XN7A 1PUDA 3UNXA 3GSNH 3SMQA 1T99A 3EFBA 4WK2B 1X0XA 1T1XA 1IIHA 4HU0A 3KXFA 2YUZA 3LI1A 4C5CA 1YCSA 1Z5YD 2RKWA 3DBXA 1PO9A 4NQDD 2XNKA 4RE4A 1N0LA 4GEJA 4YO0A 4FI3C 1LLDA 4EY6A 1PKNA 4E5MA 1XGEA 3KLNA 3EWYA 5K3EA 4PGHA 1EBBA 2NY4D 3L79A 5AD1A 1A7OH 1VD6A 2A4AA 1H0RA 3INYA 1SUFA 2OA0A 2H0FA 5IHUL 2JGIA 3GLHB 2FWOA 4AU0A 1AVAA 5CEZE 2PLTA 2P46B 2X4OB 1Z5WA 4F21A 4P5SA 4F5EA 1H05A 1T7VA 4BB0A 2PT6A 2LR4A 1HHJB 1XT6A 4AAYA 3OC6A 4TTTS 5JHDE 4NKMA 4DUGA 2QL1A 2JEPA 1GJUA 4K6HA 5JO5A 4DUOA 2ZX5A 4UT7L 2H2PC 3KS0J 1KXZA 3SEFA 3UJ6A 5IB2B 3F7VB 2NY6C 4HXEB 5GSVB 1XRQA 1C4OA 4P8UA 5G5DA 4JG0L 5CN2A 5IFJA 1XE3A 3HHRB 3W9ZA 1LJLA 3PQ2A 1VESA 3KNZA 2DW6A 5EHIA 3NJ4A 4X8CA 3LQ4A 3EXFB 3TEZA 4ICNA 2GK6A 3NAMA 5KAPA 4Y6QA 3U9PH 1SFTA 4MMWA 1Z5VA 4TT3D 1X9QA 3N05A 1XQLA 3D7PA 4MS8C 2B36A 3EJSA 4PFKA 2GGIA 2EKLA 2WLHA 3PGDA 2P40A 3BHBB 5CLFA 2G9RA 1FL3B 3F5WA 3LYUA 3EAFA 1C7JA 4DSAA 2Y2YA 4HH9A 3NA4A 3E22A 3AXLB 5CBEB 2BGNA 3O2DH 5T1KB 4QNPF 1WO8A 3S36H 2XWEA 4Z4GA 2ZRJA 1E59A 4Z1OA 1GPOH 2H6UA 3L4VA 1J9TA 3VOIA 3IKMB 3FJLA 4KMTH 5EOQH 3DUSB 3ZU5A 3HFYA 5DTJA 5GJVC 4BVLA 4JU8A 2J8HA 2V8BA 4KQIA 4G1UC 2ZUSA 2PS0A 2A74C 1TYDE 2Z6IA 4TTSA 2A9VA 2BX7A 2YJTD 4CL0A 4P2OC 1ZGDA 2I2BA 3VOHA 2D8MA 3EARA 3W8NA 5FF6B 1CR2A 1VSQA 2PPVA 2V17L 1UC8A 2IOQA 3G23A 1VFFA 1R8SA 5DS8B 2Z93A 4UMGA 4FGWA 3QSRA 4JKPL 3VINA 4BWVA 5EBUA 3ILPA 2E1DA 4K6CA 1XGTA 1E67A 4RS4A 1U9YA 3V9PA 1DTEA 1LO0L 2PYIA 1ETJA 3FU3A 1NDQA 3Q8XB 2G88A 2X38A 3DCJA 2IIPA 2A33A 5K59E 2DQZA 4GXRA 4H9XA 3GLUA 1I0LA 2KPWA 2VDNH 3CFMA 2ZFAA 3WY4A 1YDPB 1BS9A 3TLMA 2IXEA 1Y6ZA 3DZ8A 3PC2A 3NC4A 1U30A 2WYUA 1OXKB 1M2WA 4JFEA 4R0LB 4BPBA 3RB7A 1TV4A 1FP4B 4PSAA 1STOA 5CPTA 2I5IA 3ESMA 2XMZA 3PNVA 1M75A 1D07A 1LDGA 5C5YA 2JI3A 3ZQ9A 3OCYA 2IWFA 1FYVA 1MXGA 3GRWH 1P61B 4F7KA 3C52A 2HMAA 1DANT 3AILA 2PRHA 1EQUA 2NY7H 3ZL4L 1P7QD 2GB4A 2QYTA 3U0PA 5BN3B 3IV9A 4J1TC 1VFHA 5JOPD 3VOTA 3JY6A 1SC3A 4GKJB 1ZSNA 1UWGL 1VHWA 4NDMB 3O4VA 4TVPL 1XZFA 3DX6B 1HL2A 1L6PA 3QEGH 2DQIH 4U1GB 2YCLA 5EY5B 3OPQA 2ACEA 3K20A 1I82A 3WLLA 1UOOA 1X15A 5AMXA 3DFMA 4QOKD 4NUQA 1VCIA 3KQVA 2DJMA 3RDKA 2GAJA 2VJAA 3U2CA 4I9XA 1RERA 3H4TA 4OGKA 2OXHA 5ECGC 5HUOA 3CUVA 3GQBA 3H87A 4BZWA 3BE1L 2WU0A 1QAQA 4IUDS 2JV6A 2WXLA 4GT0A 2OD9A 3M0MA 2R1YB 3TMAA 1NT4A 4NP4L 3KK0A 1KYYA 2GITB 3EWCA 4UZUA 1YMYA 3MCKA 3V8RA 3NXKA 5GV8A 4P0TA 5KSAB 2QAPA 2VDOL 1IY1A 4HNVA 4PCKA 3TFKD 4GPZA 1GL4B 2GJ6A 3L01A 4FHZA 2QX7A 4TYNA 4AW9A 1P19A 2Y69B 4CM4A 3IFOB 3CV6A 5C31A 1A1SA 1YS1X 3PFRA 3DFIA 2D3NA 2YRZA 3TI7A 1WPXA 1ZCFA 4M7LL 4JB0A 4BWGA 12E8L 4JU9A 4YSDA 5KS9E 5DHTA 1IZCA 5EZPA 1JXJA 1G0CA 4JPGA 4H7PA 3FYCA 1SXCA 1UWUA 1NVVQ 3VDQA 4POAA 1SZFA 3WB9A 4XX6A 1JIJA 3NBZC 5CVUA 4UARA 1ZR2A 5DD1L 2NGRA 2OJPA 1JSXA 5IDWA 1JIBA 1XHEA 3NKVA 3W2TA 3LC2O 1IXOA 1TENA 3Q01A 5EEYA 5EJGA 3IP7A 3S2YA 1Y4UA 3ZY6A 3EZ8A 3ORWA 3WDIA 3IJ9A 5IF9A 3VJKA 2W2TA 2BFBB 3LEPA 2PZEA 5LYYA 3MJ8A 3UCQA 2R25B 4AZ5A 6PAZA 2XV6B 1TPH1 2AEFA 5C46F 2MCAA 2WO2B 2QZZA 3MN8A 5JDSB 2BSTA 3GSQB 2XGBA 3HB3D 5BMVF 3COJA 1OFUA 2FECI 2ID8A 3CRNA 3AISA 3JTTA 4FOUA 4DGIH 5IT2L 1VZWA 4YIWA 2D00A 1B16A 1Z48A 1T0PB 1YJBA 3JQ7A 4PGZA 4ZYXA 4K68A 3T41A 4NJJA 4UC0A 2NCMA 3V4BA 5HWSA 1NCWL 3B5HA 4AIIA 2NT0A 3MMNA 2A2ZA 2PD4A 4MUMA 5EIAA 3EB2A 4AUUA 1GILA 4Z1MA 4X4XB 2V1UA 2QVFB 1SLXA 1BE0A 2PZMA 2Q8AH 2UVPA 1JF1B 2BWDA 4S24A 4X7TB 1FRBA 4OCZA 4EA8A 3VXKA 2EIEA 3N2GA 4K7VA 1UPUA 3UCRA 1VIYA 1AZTA 3PYCA 2JI7A 3EXHC 1OG0A 4JPVH 3UN1A 2AJZB 1DT5A 3AOGA 3SCQA 1TZ8A 1Y8CA 4H3HB 3BKJL 1RI3A 3ZE1E 2N0MA 2C7OA 3JAWB 2BFCA 2YW2A 1ISIA 4MD4A 2ZS9A 1R8QA 4RPQA 2B2XL 1RYMA 2VG8A 1VKFA 1Z3NA 3K74B 1OB5A 4UQ9A 4P8XA 1K06A 3LCIA 1HDYA 4EG4A 3OJWA 4UBLA 1C1EH 1K85A 1M56B 4N0UA 3TNNB 4IVNA 3P0JA 2PIAA 2WKWA 5C0RH 1G63A 3KVDD 3LBMA 1G9SA 2H3NB 3VNZA 4N5MA 4XAFA 4K9KA 4EQ2A 3KD2A 3PX7A 1A1MB 4JFSA 3KYMB 1LNQA 3QOWA 3QPEA 2X6BA 2HHCA 2Y36H 4FG6D 2PDXA 1SY7A 2VPYA 5TE6H 4OVKA 4JHAL 1ONNA 1HNYA 3D50A 2RA1A 3RY4A 3Q2KA 1ZJ5A 1UFGA 3HU7A 2BHNA 3L95A 2ICEB 5C08E 3QKRA 2HBXA 3EGXA 5BOVA 2H16A 4U7TB 3A6CH 1KY3A 2AK3A 2AL7A 4RQTA 3UKJA 1CLXA 2VPIA 1CQKA 5LM3A 4GLRI 4QG8A 3AZQA 1M9HA 5GGRB 1Q6DA 1F1BA 3WQBA 4KKAD 4IPTA 5JG7A 1CGWA 1NBOA 5FYLD 4RTMA 4HH1A 4QDZA 1GR1A 4ZAKC 4BDVB 4Q4JA 1FAIH 4O0LA 2V9ZA 3IJ5A 4IV8A 3D7SA 1N2RB 5DSXA 4TV5A 1PNVA 2OP0A 4OLZH 3CL8A 5EDXA 4LUJA 4A4DA 1O95D 4NK5A 1Q14A 4PRID 4XOIA 1T7LA 2BY3A 1DTNA 1LK7A 1I1AD 2OK0L 4GMFA 1AXGA 1OGJA 3OQBA 4U1JB 4IK7A 1KCRL 2P8SA 2HXTA 4MNHA 5AIBA 2ZCHL 3F7PC 3RWJB 5I17A 5H1YA 5K99A 3REWB 2EXWD 3BT0A 3VHXB 1KIPB 1VFUA 4JOSA 3ZHYA 3LNIA 3FYEB 3V7AG 5DN9A 4HIHA 5I74C 1IN4A 2HWZH 5AVYA 3GFQA 3QPYA 1ZNXA 2ZUFA 4MW6A 2PH7A 1BWMA 1BMTA 1YJDH 2QL7A 3UO1L 4MWSA 4YAEA 1CNVA 1QPOA 2DJSA 4XR4A 3VHQA 4F2DA 4ZFFB 5B36A 1Z68A 3FTWA 4WEVX 2XUGA 3H97A 2HE5A 3TW8B 5FAGA 2WNZA 3UYRL 2ZI5A 1BMFA 4MVJA 3A6HA 3HJRA 6XIMA 1RUQH 3KLHC 5IF3A 1EB8A 3GNMH 1Y1DA 1CG9A 5CJXC 2OZ0A 3DYIA 2RE8A 1L3IA 4Z7VF 2A7QA 4QXAA 1DOSA 3ZWVA 1NMBH 4IBTA 3F6BX 1JEEA 5JORB 1AH0A 3FONB 4Y1SA 2QCDA 1H23A 5LA6A 1IQDA 4PJXA 4YHOH 3GJ4A 3WGKA 2PUTA 5JMRA 4L7VA 1OTYA 4F1KA 5KNBD 3BC1A 1G4RA 5IRCD 2BFEB 4XPFH 2WD7B 5TRTA 3BUTA 1KN4L 5DI8B 2VR5A 2K2QB 4TS3A 3M6WA 1SVUA 1SJXA 1W1PA 4PNPA 4G25A 3G0OA 4GSKA 4LCIL 4HT3A 1WB9A 1X7XB 4NNXA 4A3YA 3FZUC 5EOTB 4OQVA 3HMCA 5JRDS 5KMGB 3W6PA 4JMPA 2VS1A 4PONA 2C9VA 1FWXA 1E2BA 2AJTA 3SQSA 4IBWA 3R3VA 3WV4A 1AW5A 3GOHA 3RSQA 3UM9A 2FIKB 4WTWA 2WA2A 4NWTH 4BRZA 2ORBH 4AQLA 1UB3A 1GRWA 1UYWL 3TS1A 2FBJH 1THAA 4D9RD 1D04A 5AYQA 3T3ME 3LMYA 1SURA 4AJ2A 4Z2KA 2RONA 5AVRA 4PY8I 3FOZA 1P6CA 1EZUA 3NFNB 1TQBB 5KVEH 3K31A 3RFTA 4UT9A 2AGJL 3EWSA 2VLKE 5T1DH 2AK1H 1S7UA 4HT1H 4JPKL 3KLAA 1S3TC 1DUYA 2OT1A 3LQYA 1HE1C 2Z1XA 3D4NA 3VFDA 3FO2B 4Q5IA 1IT0A 3MJMA 1Q5PA 5SX4H 4YSUA 3FFBA 3AO0B 5CEYA 3KCPB 5TGBB 5DR5L 2RKOA 3VDRA 2PD6A 4G6MH 5CB0A 1ZK9A 4Y96A 3CNQS 1DEEB 4UZSA 3W73A 2G72A 4MR9B 3IHKA 4Y30A 3WNCA 4DVOA 2OWDA 4FBGA 4RF5A 5TPWA 4LG1A 1J0ZA 1N5LA 5ESWA 4QXOA 4Z7OF 4DT1B 4JM2D 3W2DH 2YJNA 3I4EA 3W7AA 4Q8QA 4C5ZA 4HHAA 1K4CA 4F0MA 3LZPA 3KOWA 4P0DA 2WJZA 2XY1A 2CDBA 3R8HA 3UJTL 1E55A 2AQIA 2O56A 4NAQA 3D87B 4X3CA 3C8DA 1IEWA 3ASZA 4XD6A 3L8GA 1Z9LA 4MAUL 2RG7A 1QR4A 3T5MA 2R4TA 1WTCA 3BGIA 3S4SA 2XG5B 3NPVA 3IERA 3O6KH 1XZDA 3FHJA 4G7SB 1MA3A 4DELA 2AHRA 2ZE6A 5F76A 1K4DB 3DV4B 1THCA 2GK0A 4UQOA 4QLLA 3VRIA 4KAXA 5BRQA 3VMPA 2PFSA 3WR5A 2C15A 4QLKA 4U3JA 3LPNA 6FABL 1ZA2A 5EJ5A 1RE1A 3U46B 3A37A 1HE4A 3L3OA 4XVDA 3QQ3B 3SUTA 3H2GA 4AYTA 5JXEC 3PHHA 4Y1AE 4AD3A 3WDQA 5FDYA 3D2LA 4B5SA 4NT6B 3A5VA 5KVFE 2C20A 3A1FA 2Z1KA 3T4YA 3GKAA 1JUFA 1FE8A 4DSOA 1K8RA 5L53A 1AHWA 1B3YA 1LDBA 1NV8A 1RIVL 5BSHA 4PYHA 2GXSA 4YDHB 2DT1A 4JDVB 1J93A 5DLDA 3WWDA 5MF6A 5D1XA 5AAWA 2NX5A 4PTNA 3DVNB 1P5UA 3VR0A 1FF5A 2P8PB 1IN6A 4FFVD 2VT6A 1NP2A 3KOFA 4EJSC 3QJRB 4PFSA 1WYJA 2R59A 4PUJA 4U6HB 3I0NA 4LRTA 3GZQA 4UB0H 4MRCA 3PNBA 3SDDC 2LT9A 4GP9A 4H4NA 3DLPX 3ITTA 3DVGA 4YIQA 3PGCB 1OWLA 5FQNA 1WRBA 2UZ9A 2I8CA 4QCEA 4AWBA 1L2TA 1CG6A 4PX3A 2H2WA