4UOZA

Beta-(1,6)-galactosidase from bifidobacterium animalis subsp. lactis bl-04 nucleophile mutant e324a in complex with galactose
Total Genus 242
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
242
sequence length
688
structure length
688
Chain Sequence
RAHRWPQPLPGNDRKIWFGADYNPDQWPEDVQDEDIRLMKQAGVNIVSLAIFSWANIETSDGNFEFDWLDRVIDKLYKAGIAVDLASATASPPMWLTSAHPEVLRRDEQGHVIWPGARQHWRPTSPTFRTYALRLCREMAEHYKDNPAIVSWHVGNEYGCHNYFDYSDDAVQAFREWCRDRYGTIDKVNAAWGTNFWSQRLNSFEEILPPRYVGGEGNFTNPGRLLDFKHFCSDALKEFFCAERDVLSEVTPNIPLTTNFMVSASQNTLDYDDWAHEVDFVSNDHYFTPGSWHIDELAYSASLVDGISRKKPWFLMAQSTSAVNWREINPRKEPGELIRDSMLHLAMGADAICYFQWRQSRSGAEKFHSAMLPLAGEHSQIYRDVCALGADLDTLSDAGILRSKLSKARVAIVQDIQSEWATEHTATPTQHIREWTEPLDWFAAFANRGVTADVTPIHAQWDTYDAVVIPCVYLFSEEMAERLRTFVRNGGKAFVTYYSALADEHDRLHTEGWPGLIGDVVGVRIEEHCPLGTLFPGMLDHLDVSNGTVVHDLADVIDAIADDTTVLATFEADPATGMDGRAAITVHPYHEGGVAYIAGKLGRDGISQSLPEICAALGFELDADPRAGDVLRVVREQEDGAIFEFLFNRTRNTVTADRPAGDMLICSLATDSTDKVTLEPNGVLAFRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A beta 1-6/ beta 1-3 galactosidase from Bifidobacterium animalis subsp. lactis Bl-04 gives insight into sub-specificities of beta-galactoside catabolism within Bifidobacterium.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Hydrolase
molecule keywords BETA-GALACTOSIDASE
total genus 242
structure length 688
sequence length 688
chains with identical sequence B, C
ec nomenclature ec 3.2.1.23: Beta-galactosidase.
pdb deposition date 2014-06-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 4uozA03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4uozA01
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4uozA02
2CERA 1UD4A 4PSPA 4UTFA 3LPPA 5JBDA 1E6XM 5DMYA 3ZSSA 3AS2A 2BY0A 4FMVA 3M6DA 3U5YA 3UETA 2D7JA 3EJQA 4I2NA 1WZMA 4WF7A 1V0LA 2ZUSA 3WENA 3LRKA 1EOMA 1ISYA 3WY1A 3PTMA 1BGAA 3A21A 4D6HA 3GBDA 3WEZA 1ZBWA 1UH4A 1C7SA 3W0KA 5DO8A 5KEZA 3E1F1 2YIHA 4L78A 1VF8A 3GXTA 1KQZA 1UR9A 1JDCA 1RH9A 2VR4A 3BGAA 4CD5A 2FHFA 3L18A 2ZUUA 2Y2WA 1JDBC 4GI9A 1JXKA 3ZT7A 5I77A 2W92A 3QR3A 4HPGA 3UR8A 3EDJA 1W3JA 5IXEA 1E4LA 3VSTA 3IAPA 4DM1A 3WF1A 2OR3A 1EGZA 2YDRA 1GGEA 2CKSA 2VZSA 1NWSA 1XH1A 1DWJM 2XJ7A 1L0PA 1W32A 4AIUA 2UY4A 4AUMA 1XYZA 2VOTA 1EDQA 5K4AA 5CSUA 1N82A 3EN0A 4DUVA 3ALFA 2GJPA 2E3ZA 2VTFA 2WMIA 5DT7A 3MSGA 3CO4A 2WYSA 5ECUA 1JZ8A 1V6XA 1R85A 1WCGA 1OCQA 3IAQA 1GQLA 1Q6GA 4HMDA 2V38A 2WBGA 3GM8A 3F5DA 3FNDA 4K68A 2EPKX 4AMXA 2HISA 3ZT5A 4MNLA 3P9QA 4XLLA 1MQRA 2PBOA 3F5LA 2A9VA 4JL2A 2O9PA 2PBGA 4UZUA 3WN6A 2CCRA 3WY3A 4U3AA 4CCDA 3WQWA 1UR1A 4UFJA 4JFUA 2QPUA 5M3WA 2XUCA 1T0BA 3WY4A 1BQCA 2E40A 3NUKA 4CUCA 4GXPA 2VPIA 3CLWA 3F5JA 3FSEA 5LIRA 1O7DC 1NP2A 3VINA 1QVZA 1E55A 2A3CA 3OLDA 3DX0A 1AVAA 4GI6A 1GOQA 1J0IA 2OYKA 3LRLA 4A4AA 1UG6A 2ALWA 4W93A 3CZLA 1QWUA 1CF9A 5I0DA 4ZGGA 4PEEA 2YL9A 2RGLA 2CEQA 4Y1GA 3UG4A 1CLVA 3AZSA 4B31A 3AROA 3DHPA 2PWHA 2F61A 3TTXA 3RM9A 3B9EA 3OT1B 3KL5A 1PDWA 3WNMA 2J7EA 3BLKA 1R86A 3LMYA 3WL1A 1XSIA 1HJVA 4UFLA 2YKKA 5BWFA 2WZEA 2VDJA 1DWFM 2XSAA 1NOFA 1PIGA 1O1YA 3AFBA 1KBKA 1UD3A 3ZOAA 3FN9A 3PTQA 5A6BA 1GJUA 2DSVA 3TTTA 1EXPA 2WMKA 3PQ4A 3N9KA 4AZHA 2DQXA 4MDOA 5CPTA 1JZ2A 1W1PA 4B2YA 4ZDKA 3WIJA 3UOWA 1TQWA 2NV0A 3A23A 1C93A 4AZGA 1K9VF 1W9VA 3FHQA 4P34A 1PX4A 5I79A 3MV01 2CKRA 3B9DA 2OLHA 1UR0A 3VSVA 4RKWA 4CCEA 5A6MA 1WB0A 4BQ5A 4LYQA 3SEPA 3T2QA 3WUGA 2PB1A 3L4VA 1JZ6A 1CXLA 4QYTA 2WK2A 3CGTA 1I1XA 3CYFA 4QDMA 2C7FA 5A8QA 1VFMA 3W25A 3K46A 2GK1B 3MUIA 2JF6A 1GCYA 3HG2A 4PCSA 1LF1A 3BHNA 1FA2A 4KWUA 2Y4SA 2Q8XA 1FP8A 4S3JA 4S3KA 3CZEA 4PMOA 4BTEA 4B16A 1QX1A 3W4RA 2J77A 3O2LA 2ZUMA 2XYLA 3PQ2A 3DECA 1QF7A 4X0NA 2WNWA 1W9DM 4QLLA 4EE9A 5C71A 3OZOA 3WQ6A 1QHOA 2ZXQA 4W7VA 2YL5A 3QGVA 2DDXA 3TTOA 2D1ZA 4ENWA 4H04A 4K2HA 3AICA 3AS1A 1EHAA 2H2WA 4DO5A 3NDYA 4GPNA 3F71A 2W61A 3VM5A 3EJRA 1UYQA 3GBEA 3A47A 2BHYA 1GZJA 4M1RA 3KLKA 3ARYA 1J0KA 3L4TA 1UHVA 1WO2A 1UWIA 1PEZA 3W26A 4F8XA 3TQIA 1V3KA 4S0ZA 3BXWA 4KMQA 3VSUA 3RHTA 1C8XA 1WPCA 4PTVA 4CU6A 4L95C 3PZIA 3ARPA 1EDGA 1TCMA 1OI4A 3MI6A 4MGHA 4J3SA 4D71A 4U33A 3MO4A 2FH8A 4PXYA 4Z2KA 1MW0A 4ZXLA 5E0FA 1CPUA 4NZJA 4UOZA 2V5CA 1BPLB 3AMDA 1M7XA 5IFTA 2XVPA 3VPLA 1KCKA 1CXFA 2BHUA 5JIWA 3LXBA 1MW2A 3W6MA 3ZMRA 1GQIA 4M56A 1ISVA 3CMGA 2X0YA 2AAAA 1TUXA 1BVNP 1MW3A 1ESWA 4Y1EA 2CBIA 1H41A 2W91A 3AOFA 1KXJA 1Z32X 3BUQA 3U57A 1KGWA 1KWGA 2G41A 3UR7A 8CGTA 5I2UA 1V0KA 3K1DA 4UQ9A 2XVLA 1V6YA 2VQTA 2VURA 3D3AA 3CV5A 1V0NA 3AHXA 4ENVA 3FAXA 2WVUA 3II1A 4HOZA 3NOQA 2VXOA 4PMUA 3OT1A 3R74A 4UOJA 2UWFA 1B3ZA 3GNOA 1UH3A 4PUEA 2PF0A 1H3GA 3DX4A 3WF4A 5A8OA 4P7OA 3LXAA 3VVGA 4Q22A 1RP9A 3L4XA 2Y24A 2J79A 3CBWA 2EXOA 2WHLA 4W84A 4B3LA 3PQ7A 1FH9A 1FYEA 2VC9A 1CIUA 1J10A 3TTVA 4L8WB 1WDPA 3RO8A 5E9AA 2WMHA 1B9ZA 3AHVA 4P5PA 2OYLA 1VBRA 3WDRA 1VEPA 4W8LA 3D51A 1JFHA 2F1AA 3AJ7A 3UERA 1VHQA 5A6JA 4ACYA 4GZIA 1K9FA 4CN6A 1J01A 4CN1A 1GORA 2D24A 5CGMA 4TX8A 2VUYA 3CZKA 3HG5A 1C3FA 3K4AA 3ARUA 4CD4A 3W38A 1UWUA 2PI6A 1V3JA 3AIVA 2HVMA 3OA5A 1PZ2A 3OZPA 5A1AA 1HJUA 4C7DA 2V3DA 4MJ2A 4QLJA 1KCLA 1P5FA 1QWSA 1G94A 3VGHA 4LGYA 3NSNA 2BV9A 3AXIA 4TTGA 1M6VB 1B3VA 2ZX5A 3UG3A 4AY1A 4NRSA 3GH4A 3AISA 1TQVA 2AOSA 1C91A 4MB4A 3SCWA 3PZNA 1VJSA 5I6SA 3AIEA 3AS3A 1V3HA 2J7FA 3EZGA 3BLBA 3LX9A 1B1YA 1ZL1A 4LYPA 5ABFB 1SOAA 2RK4A 2A3HA 4OFWA 3D4YA 3MGKA 4W8AA 1B30A 5CXPA 4ENPA 3UMMA 1HX0A 4TOQA 1H2JA 5EMYA 1XH0A 4GE0A 2DSKA 1HL8A 2EPNA 2FGZA 4B3KA 4R27A 1B31A 3FXYA 1QNPA 4J7RA 4WIWA 5I3DA 1PS3A 2CYGA 4ADSG 4W7UA 3AXHA 1JIBA 3EYPA 3L4WA 5HPOA 2J25A 3CTTA 4PMDA 1AMYA 1LWJA 4FLSA 2ZX6A 1P7YA 4C7FA 1ITXA 1Q6FA 2EBNA 2WWCA 2WMFA 1PE0A 4CN4A 4HOWA 1CECA 1KFWA 3N7TA 3LRMA 1HP5A 2VO5A 3WH6A 2G3JA 3AQUA 3WQ5A 1HWWA 5A69A 2JIEA 4UFHA 5A6BD 2YA2A 1J42A 1MXDA 2DSZA 4V28A 5EFFA 1TZ7A 1CXHA 1J0YA 1WAWA 3H55A 1H5VA 1NP0A 3KL3A 4D6JA 3HZ3A 2JEQA 1T36B 4ZXOA 1OX6A 4NXSA 4DWSD 1ZS2A 3THDA 1CZ1A 1I1WA 1KGXA 2FE0A 5HNNA 4D1YA 4I4NA 4FNRA 3CZ9A 3AHYA 1TQTA 4HU0A 4JFVA 1EDTA 3AMCA 1UWQA 2WVTA 3SUTA 1ISXA 4Y1RA 2J75A 2J47A 3DHUA 1OGSA 1R47A 2VI0A 1TVNA 2YA1A 1EQCA 4CVUA 1TR1A 4Z2GA 4AZBA 3SUWA 2ZUTA 4Z2LA 1PV2A 4FNUA 3GYCA 1K6AA 5BXTA 1B3XA 1I7SB 3N12A 4UFKA 2PWDA 4DO6A 1KEEB 2E9BA 2GVYA 5EBAA 3P9PA 1DWGM 5BROA 1QHPA 4U3CA 2D73A 3MS8A 4MADA 1OWQA 1UR8A 2F7PA 3P9RA 4AC1X 1VFUA 1LL7A 3CUFA 3QHOA 2Z1SA 2O9RA 3VMNA 2YDSA 4B5KA 4PUDA 1WDSA 2XSBA 3AYSA 4D6IA 5E0CA 2FEXA 1MYRA 1OSEA 2VJXA 2YDQA 5JBFA 4IUGA 1GJWA 1QHZA 2VKTA 1XCXA 1UWTA 1E4NA 3GNPA 5BV2P 2X0HA 8A3HA 1NOWA 1D3CA 1V3IA 3R76A 1BGGA 2EPOA 3N11A 2VR5A 5D9MA 3N04A 2WW5A 4GE3A 3PQ5A 3VMPA 3DYPA 5GNYA 1ZBKA 5GPRA 1VFOA 3MANA 1P81A 1W3HA 2W62A 4WKFA 4BFLA 1HXKA 2J7DA 3N17A 2WCGA 1V6WA 3RCNA 2E0PA 1UOKA 1UKTA 4HZ8A 4LYRA 4UQAA 3ZJ4A 1CGWA 4ENRA 3SCUA 1JZ3A 4N12A 4D6EA 2VCBA 3SCSA 3DDFA 1QOXA 2VRQA 4RL3A 1QW9A 3A4XA 4OBRA 3SCQA 3EWNA 3BVTA 3HJEA 3F4VA 5BCAA 3IJ8A 4UQDA 3WD2A 3D4ZA 2GDVA 3GDBA 5A6KA 1UKOA 1HF6A 4OJYA 4NF7A 3WQVA 4P36A 3WUEA 3APGA 1JVNA 1B3WA 5DEZA 2CBJA 3OLIA 3HN3A 5IFPA 2JFEX 1W3KA 3M07A 1ZB5A 2J62A 4ENSA 4ZE5A 2IXVA 1MW1A 4NX0A 1R33A 3AYRA 3BSGA 3WSUA 3G6LA 1KXVA 5A2AA 2DGAA 2VT0A 4HA3A 2FYVA 3AZTA 1GGFA 2NV2B 2IUZA 4D6CA 5AC5A 4WKHA 3A6OA 3AMLA 1V02A 3TTSA 3TTYA 2XGIA 4KGLA 5I5RA 3L4YA 4Y1RB 5M03A 4U5KA 2CXGA 1SY7A 3POCA 1FH8A 1HKIA 3VDBA 4NZFA 2VZUA 1F4AA 4UFMA 3M3PA 1T3TA 4BQ3A 1PDVA 5AY7A 3SCPA 5EB8A 2VMFA 3CZSA 2X1IA 1J11A 1JGIA 4CKQA 3CHCA 4AISA 5CQ1A 1L9XA 3MUAA 3UG5A 3EDKA 1DP0A 1E4IA 4OZOA 1GQJA 4TVCA 2J74A 2GJRA 6A3HA 4NSBA 4L4PA 3CH9A 2IUFA 4U31A 1U33A 1LJYA 2V3EA 2DSWA 4XB3A 2QHAA 1QNSA 3L3BA 1EHNA 4W85A 3T0BA 3ZR4B 4MPKA 3BMWA 3OLGA 4NRRA 3VIIA 1E6SM 3WL0A 3W81A 2WHJA 4AJ9A 1UASA 5ABEA 1CXEA 3NONA 1MFVA 2ZXDA 1TVPA 9CGTA 3CHFA 4P7RA 4WSJA 3P9SA 3VU2A 2XIIA 1VEMA 2YLAA 1QW8A 4MNJA 4URIA 4PSRA 4Z2HA 2GJXA 3VDAA 2WZIA 1C8YA 4P8VA 1ISWA 5JUVA 4XUYA 6TAAA 2YL8A 1E9LA 3A22A 4JCLA 3VUPA 1E0VA 1DHKA 3WUFA 2QMJA 3UCQA 2XF2A 3MIIA 3ARTA 1NOUA 3O9NA 2ABWA 3CHDA 3PZTA 3WQ4A 2OSYA 1W3LA 2WM0A 1CGUA 2QV4A 1E6QM 1GPFA 4AEFA 2J4GA 3CIVA 3T2OA 1A3HA 1TE1A 2CBVA 5ABFA 1HXJA 3OGVA 2CPUA 3H53A 3BVVA 4HOXA 3ARXA 3BAKA 4YHEA 1QVBA 2O92A 2DIJA 3NORA 1P80A 2ZE0A 2CNCA 3EJUA 1LWHA 1E6NA 1JF6A 1G01A 3POHA 4J3XA 2WC3A 3CZAA 2ZICA 3CZGA 4AD2A 4P35A 4RKYA 1QI0A 2XFYA 2GUYA 1HVXA 3EDDA 1JZ4A 1U2YA 4X0VA 4IISA 2WJZB 3CUIA 1B2YA 4AYGA 4BIMA 1NH6A 1GOMA 1QPKA 2LXNA 1JYNA 2GK1A 4KGJA 3PBGA 4AD5A 1F4HA 4HPHA 1JYWA 5BXSA 3S2CA 3WMBA 2D0HA 1E6ZA 5A8MA 1CXIA 1XHGA 3GXDA 3NSMA 4WSKA 2WKLA 1V0MA 4UQCA 4ATDA 1OD8A 2VNCA 2XVNA 1DWIM 3SUUA 4WJXA 1C30B 5BXPA 2OW7A 3K4DA 3QOKA 1HKMA 1YQ2A 1Q6EA 4D6GA 1HTYA 1K9TA 1K9DA 2VX6A 2BHZA 5E6YA 1FP9A 1LG1A 1VFFA 2XWEA 3VD3A 3VIHA 2RK3A 3CY6A 1IT0A 2X8RA 5KZ6A 1WDRA 1GOWA 3LPFA 1CWYA 2E4TA 1JNDA 4TTUA 5CLTA 2F1BA 3EDEA 3UEQA 3GH7A 3WMCA 2AD5A 3ZR5A 3T2PA 2G8ZA 5JZOA 1OD0A 4AXNA 1C8QA 3NOVA 4OKDA 3NSXA 1XH2A 3GZAA 1KB3A 4PN2A 3W6LA 2DIEA 5BRPA 4PMRA 1JYVA 3MKKA 3ZM8A 2YWCA 4W5ZA 1KR1A 5AYBA 1XD0A 1QI2A 2DSUA 3TV8A 1JAKA 1HJQA 3KKLA 3NDZA 4CGTA 2C8NA 4Y1FA 1UA7A 4AMCA 2RGMA 4M80A 3W28A 3D54D 4A3YA 1UQYA 1QWNA 2VQUA 1OT2A 3UK7A 3BWEA 1TQUA 1UD6A 1PBGA 2OSXA 2B31A 4AIOA 3CHEA 1AQHA 5EFDA 1CTNA 3SUSA 1DWHM 3W29A 3KLLA 3A5VA 1JFXA 3VU3A 2XFFA 4AZCB 2VRJA 4B15A 2FHCA 1OT1A 5HXMA 2XGBA 1ZU8A 3HG3A 3U7BA 4FF5A 1AQ0A 4MNMA 4C7GA 3BAJA 3D52A 4M81A 3VM7A 7TAAA 4JHZA 2XN1A 5FKYA 2EO7A 5GNXA 3ER6A 1E5JA 3ECQA 2ZX9A 3BUDA 2YLLA 3WDIA 2ZXAA 1UH2A 2DPEA 1HP4A 1XC6A 4PBGA 1M53A 2FGLA 2D2OA 1J0HA 4W88A 1SZNA 3A4AA 1EO5A 1I1QB 4LPCA 4A3HA 2X05A 1XD1A 3A4WA 3VD4A 3J7HA 3VDCA 4TVUA 5A94A 3LPGA 1QBAA 4ZENA 1BSIA 5DF0A 1QI3A 1JAEA 1OX4B 2IGTA 1E0WA 1BHGA 5LA0A 1JZ7A 2NT1A 4QCEA 3AMGA 4AD0A 1OIMA 1CXKA 3ZT6A 1XGZA 3OB8A 4MB5A 3TTWA 2PWEA 5E1QA 1EOKA 1E4MM 2V4UA 2WMIB 2BNJA 2J7CA 3MUZ1 5FOOA 1C7TA 4TXEA 2ZWYA 1FY2A 2J7HA 1M04A 3VX1A 2E9MA 4AULA 5BRQA 1SR0A 1NARA 5A2BA 3A24A 1L8NA 1CGTA 2EQDA 3UJNA 3B38A 3S5ZA 7A3HA 4EKJA 2V3GA 4W8BA 2YA0A 1JNEA 4EK7A 1UD5A 5A8PA 2Y8VA 4TUFA 3BVWA 3VIMA 4YN5A 2DT2A 4OUEA 4CU8A 1KXQA 4WLCA 1NWRA 1W1TA 3VGFA 3WH8A 3HU7A 1WZAA 1H49A 1UD2A 1ISZA 1JG9A 4P7NA 4XZWA 4AWEA 5SY9A 3WD1A 5FCZA 1CBGA 4PCTA 3MMUA 4TX6A 1GGKA 3N18A 1BF2A 5TD4A 1UKPA 1QNQA 3NVAA 3OGRA 2A3AA 2J78A 3VOCA 4FLOA 3TP4A 4DWSC 4LX4A 1A47A 2X2IA 4MAVA 1ECEA 3CMJA 1IZZA 1VCOA 4R7GA 1I75A 1TA3B 2X2YA 1KXTA 5E70A 1E5NA 3VD5A 3MSDA 2BY2A 3L4ZA 2XN0A 1O7AA 4Q7NA 2ZOXA 2WANA 1TFVA 2J8FA 1MFUA 1ONSA 4RE4A 4W7WA 2Z1KA 4M8UA 4GO9A 3BMVA 3T0DA 4MNTA 5C70A 1UQZA 2GFTA 2AMGA 3VD9A 3KE0A 1HJXA 1O6IA 4P2GA 1UZ4A 3IGUA 2NW0A 1E3XA 5JIPA 1VENA 4F9DA 4D6DA 2CBUA 4M29A 1BYCA 1UWRA 3WD4A 4HTYA 1PX3A 1E6PA 3WEMA 3K8MA 1EH9A 4Y7EA 2WSPA 1JI1A 1QNOA 3VIKA 2YFOA 3SIMA 1R34A 1XRVA 2XWDA 3NCOA 2NT0A 4D1JA 4GINA 2WMJA 2GHRA 3RPMA 5CSYA 2VRKA 2CHNA 3GH5A 1BVZA 4IM4A 4W5UA 3KEHA 1D2KA 2JF7A 3ZQ9A 5HOSA 2F7QA 2ZX8A 2WB5A 1GPMA 5A6AA 3SURA 5CGTA 2OWXA 4BZYA 2W66A 2XM2A 2WSKA 5SYAA 2F7RA 1CLXA 3I3BA 3NYDA 3CUJA 4GQRA 3BC9A 3FW6A 2CETA 4ML4A 1ODZA 1NWUA 2YOCA 1BAGA 2QPSA 2UY3A 3DX1A 1UZ1A 2IXUA 2G3MA 3SF8B 2PC8A 3BCDA 1E73M 1V3MA 1UCFA 1IZKA 4DWSA 4JFTA 4FK9A 4PMQA 1J18A 4QYXA 3ARVA 2X2JA 2EABA 3ZJ6A 3DX3A 2ZXBA 2BFGA 3VGEA 4GKLA 2EEXA 3B8SA 3PZMA 3BCFA 1X1NA 1V3LA 4U2ZA 4U5IA 3NOOA 4ZFMA 3K8KA 3PZUA 4DO4A 3OGSA 5JBEA 2CIPA 4PMVA 1LLOA 1NM9A 5A6SA 3AHTA 4CD7A 5HPCA 2E9LA 3L4UA 2WHMA 1CDGA 4KH2A 2WWDA 2AB0A 4GQQA 3FIJA 4JL1A 2EJ1A 4UNIA 3MMDA 1HKJA 3VIGA 3WFLA 1HN1A 1GQKA 2TAAA 5A8NA 1OX5A 1GPWB 1QVVA 1GOKA 4E4PA 3SCNA 4R5EA 3T09A 3WDJA 4BQ4A 3VDHA 4AZ5A 1OINA 2YJQA 4WXYB 1PZ3A 1HL9A 3MU7A 4P8WA 1QBBA 3SCOA 4HU8A 4OOUA 1UD8A 4PMXA 3PHAA 1G2IA 4B40A 2FDMA 1E43A 2W5FA 2XVGA 3GXNA 2ISSD 1TA3A 2VVSA 2OSWA 4UQEA 2OWWA 1VIWA 4MDPA 3M46A 3IJ9A 4MB3A 3T0AA 3WNOA 3AIQA 5E09A 3EJTA 2R1TB 1E70M 4JQSA 2R1VA 4CD8A 3WH7A 2VZTA 1J0ZA 1XYFA 1S1MA 5HDRA 1ODUA 4AZCA 3SCTA 3CZNA 5GQBA 2XIBA 1NQ6A 5D8WA 1EIBA 1KA9H 4GIAA 5D8ZA 4AUEA 1OB0A 1UA3A 4LRUA 3QHNA 2F18A 4Z2JA 3DDGA 4LGXA 3D50A 3U5UA 4L8FA 1W9XA 5ABGA 4AMWA 1H1NA 4QP0A 3WF0A 1CEOA 1GOIA 1H0IA 5A3HA 4RE3A 1C90A 1GGJA 4ATWA 3DX2A 1VCMA 1C92A 4D1IA 1HVQA 1R87A 3RM8A 3TTUA 1BYDA 1H0GA 3ZJ7A 3PQ6A 3LXCA 4FNPA 4M82A 1WE5A 3OIHA 4UFIA 1CENA 2F7OA 2O9OA 1IZJA 1SMAA 3ZSTA 3OLEA 3AHZA 1R46A 2WKGA 2GSJA 4YHGA 3PZVA 2O9TA 4ZDIA 2ESCA 3MMWA 4AZIA 2C0HA 1VBUA 2ZX7A 5SY6A 1X6LA 2VZOA 5CG0A 4DWSB 2J7BA 4LQ1A 2D23A 3ALGA 2E8ZA 1BFNA 4BS0A 2GJXB 2R1UA 2WAGA 3W82A 1JYXA 3EDFA 4P8XA 4W87A 3BSHA 3RIKA 3GXPA 1FHDA 4L7QA 2GDUA 1WP6A 1V6UA 2WPGA 1KTBA 3WUBA 1U30A 2Y5EA 3FAWA 1WDQA 3WH5A 3SF8A 1HKKA 5I78A 2EAEA 4JCMA 1WNOA 3PZOA 4ENUA 5A6LA 3VIJA 1UR2A 4JKKA 3B9AA 1SYTA 4B7AA 1G1YA 4UOQA 1KWKA 4OQ4A 3RDKA 3D5HA 1S46A 4OGFA 5M17A 4PTWA 3ZJ8A 3M7SA 1VAHA 1CGYA 5I23A 3CUGA 5I24A 2WVVA 4ACZB 5LA2A 1DWAM 1OGBA 2YBUA 3FHAA 1BG4A 4J3UA 3BAYA 1GONA 4EANA 5D4YA 1EA9C 3LPOA 1OY1A 4OBSA 3MV11 2VL4A 4FNSA 1FH7A 3WH9A 1R8LA 4EAMA 1W2VA 4P7LA 1H09A 1FOBA 3VD7A 1M03A 1LQ0A 2W4XA 4DM2A 1FFQA 5HBFA 1CYGA 2UY5A 3CZJA 5CZKA 2F2HA 4AYSA 1Q2UA 5FL0A 2WCAA 4MTVA 3B3AA 2EPLX 4J3VA 3GXFA 3GRAA 3WNPA 4HMCA 1GHSA 2R1VB 5E6ZA 4NI3A 1H4PA 5DT5A 2PWFA 2X09A 1Q6DA 4ATLA 3K8LA 4IPLA 4H8HA 3WD3A 3WNLA 1GGHA 4AW7A 1TG7A 3W27A 1V08A 4E2OA 3VKKA 1SMDA 3N13A 3BAIA 2DT0A 1JI2A 4J28A 1PIFA 3VNZA 1CNVA 2DH3A 3SUVA 1LG2A 5IHRA 2WXDM 1VB9A 5LA1A 4QCFA 3OG2A 1B90A 1E71M 2ZUVA 4W89A 1BYAA 3IJ7A 1GG9A 3UESA 2VX4A 1HJWA 1G0CA 1KTCA 1MQQA 5FIPA 1OBAA 3SOZA 2VX5A 4JKLA 1R9GA 4MB1A 2BS9A 4I46A 3T08A 1GHRA 2D22A 3WF2A 4N0MA 1BYBA 4J27A 3KWXA 3VGDA 1UWSA 3IANA 1I7QB 2XN2A 1FHLA 4PMNA 1UKSA 1KXHA 3B36A 4HA4A 1R75A 1J12A 1WKYA 2MANA 1ZBVA 2DT1A 1J9YA 4PMZA 3WD0A 3L2LA 2OYMA 1LL6A 4QAWA 4JAWA 4H2CA 1V03A 4L4OA 4N0RA 4XX6A 3WNNA 4F9JA 1V6VA 1C3OB 2QMKA 1JD9A 1HIZA 4JFWA 3N1AA 4AD3A 4AUNA 4F66A 2WLZA 4AIEA 1PX8A 3WQ8A 3AZRA 3VILA 2QLYA 2VCCA 1WZKA 4OOZA 1EO7A 5CPSA 5IDIA 1GW1A 1JL8A 3RILA 2FH6A 4GZJA 4GZEA 4HZ6A 3TTQA 2ZWZA 3THCA 2XHYA 4HCJA 5M5DA 1T0OA 2JALA 1HT6A 3VO0A 3BAXA 3EFEA 1AQMA 3EBVA 2V5DA 1GOOA 2WC4A 1ZBCA 1XSJA 3F5KA 4CD6A 4CCCA 1X6NA 3VNYA 4NZCA 2Y8KA 1MWOA 4V2XA 5BYWA 4MNKA 3VIPA 2GK3A 4WKAA 3NIYA 2EPMX 3L4EA 2UY2A 3WDQA 2BVDA 3OBAA 1QDLB 1OX4A 5FD0A 3L2MA 4ENQA 3BVUA 2WVVB 4ACZA 4BCEA 5AYIA 3AS0A 2J7GA 3AI0A 4KRTA 3AIBA 6CGTA 4DUXA 4WINA 2D3NA 1E3ZA 5F7UA 3ZO9A 1W1YA 3RM4A 4HMEA 4AD4A 1Q4NX 1P7ZA 1GVYA 3VMOA 3KL0A 1UUQA 2VRNA 4NXKA 3EJPA 3DYMA 1BXRB 3AIWA 4IPNB 4W86A 3ZJKA 1QI4A 4V27A 2A3EA 2XVKA 3W53A 1JDAA 4CU7A 1V02E 3R75A 3GTNA 1GVIA 4J3WA 1W2PA 2XG9A 2XM1A 4AD1A 5IHSA 1WZLA 3WNKA 1FFRA 3WF3A 1KGUA 1W91A 3VGBA 3HG4A 5JZMA 4UZSA 3I3DA 3QOMA 2JIWA 4MJ4A 1QVWA 3CNEA 3IK2A 4E8CA 5D9NA 5IP5A 2WHKA 1P6WA 4UCFA 3PTKA 4AZ6A 1R7AA 1CE8B 3BLPX 3AMKA 4BF7A 2BY3A 4U2YA 4UR9A 2WCSA 1HNYA 1Q6CA 4H41A 2E8YA 4QFUA 3SCRA 2VCAA 3CC1A 1PJ9A 4PTMA 1M01A 4PTXA 1B0IA 2VX7A 1K9EA 4Z2IA 4J3TA 2D20A 4H8VA 3VIFA 1DEDA 3WDPP 3PQ8A 1G5AA 3JUGA 3EJ6A 3I3EA 4Y0NA 3ZJ5A 3ARSA 3WDHA 1TMQA 1D7FA 4ZDJA 1UKQA 3N15A 4X9YA 2BY1A 4OGGA 1E72M 5D9OA 4XZBA 1E15A 4B9ZA 3CUHA 4P8UA 3DYOA 3BUBA 3G6MA 5C8BB 5CPQA 1YHTA 1H11A 4MTCA 1PAMA 2DH2A 1BLIA 3TOPA 3WFZA 3ARQA 3WELA 3H54A 1JD7A 3WKZA 3AXXA 3WBAA 3W37A 1U9CA 4L8YA 4UQBA 2G3NA 3VX0A 3TONA 2EADA 4QLKA 2WVSA 1IPHA 4HZ7A 4GUDA 4N42A 3AIUA 1JXJA 1LL4A 1VCNA 4HA1A 1ZJBA 4JFSA 3PN8A 3S6TA 3VTRA 3BH4A 2CHOA 1VEOA 4FLQA 4D6FA 2DEPA 4D72A 2G3IA 3W24A 1US3A 1J0JA 2VVNA 4M24A 4E8DA 3ZIZA 3DC0A 1W9UA 2YWJA 3AIRA 4E5VA 2D3LA 5AC4A 3WBEA 4GO8A 1E56A 1VJZA 1BTCA 4PRWA 3CPUA 1G9HA 5LYRA 3HMCA 1BG9A 4YPJA 2JE8A 2A3BA 1ITCA 3PZ9A 1JF5A 1W9PA 1ZJAA 3PZGA 3GNRA 3WMSA 4RE2A 4ZEPA 4JKMA 5DFAA 2BVTA 4WK9A 3PQ3A 4P7QA 1IZYA 4FLRA 2JEPA 5ABHA 5CJ5A 1N57A 1IV8A 1CS0B 2CESA 3QHMA 4JHOA 4KRUA 2ZIDA 3O6AA 1WL8A 1KBBA 2OW6A 4CVWA 3ZR6A 4PYSA 5FL1A 1RP8A 4B9YA 2YBTA 7CGTA 1VRXA 1KR0A 4AZ7A 1E1FA 1OIFA 1A9XB 3U7VA 2ZUNA 3CZ8A 2XPKA 1GNXA 1TQSA 2DT3A 4FNQA 2J8GA 1MVYA 3VGGA 4AEEA 1KQYA 1SFSA 2BXZA 1MQPA 4H7VA 1Y7VA 2W7TA 5BXRA 2W63A 1MXGA 2BXYA 5SY4A 2XFRA 1US2A 2EACA 4PMYA 2YFNA 1CGXA 2YL6A 4BA0A 2ZUWA 3S5YA 2OWCA 3SCVA 1EQPA 2D0GA 3BAWA 1CGVA 3NJ3A 1RPKA 2WC7A 1QI5A 1HJSA 1JZ5A 1XSKA 1E6RA 3WY2A 3ARWA 3RMEA 5A2CA 1OGGA 2YWBA 3EJSA 2X2HA 3FY1A 3EMZA 5GNZA 2YWDA 3RJYA 4FNTA 1E1EA 4F79A 2FHBA 2QF8A 3A3HA 3UGJA 1UR4A 5A95A 4H8UA 2D0FA 1E0XA 1XCWA 1QNRA 2G4FA 2WZHA 1XV8A 2WBKA 2RK6A 1R7OA 2W67A 4LXFA 3PZQA 4BQ2A 1Q7RA 1OM0A 2F8QA 4MAZA 2VZVA 2V3FA 2NSXA 1W9BM 4OIFA 4HP5A 1DTUA 2BVYA 3TA9A 1W1VA 1GUVA 5CLWA 2WLYA 3BUPA 2CITA 4XV0A 3KZSA 1B3YA 4TVDA 3WEOA 1PPIA 3ARRA 4DUWA 2PWGA 3VIOA 3GXMA 1E40A 3BUIA 4OGZA 3EMCA 3GXIA 1NWTA 3MUY1 3L7NA 4ENTA 3EMQA 4JIEA 2R1TA 2XTKA 4JZ5A 4GI8A 1RD6A 1JDDA 3BVXA 4E08A 5D9PA 3ARZA 4ZE4A 3RJXA 2WMGA
chains in the Genus database with same CATH superfamily
4PYHA 4L07A 3EAQA 1FMTA 3EWXA 4JLDA 3AS2A 3CK5A 3PD7A 3X1BA 4GM0A 2PXYC 1S2IA 3GR6A 3ZZNA 3GQBA 3FDIA 1EOMA 4WX2A 3NFNA 4Q7LA 2A1IA 1VE3A 3JQRA 3CAKA 4GI5A 1XGUA 2VQ3A 3UOAB 5KKNB 2XRZA 3L9BA 2UZIR 3N1PC 2ZUUA 2OEMA 2HEGA 5J2TA 2V0GA 5JO5A 2PTTA 3JVFC 3QEBZ 4K6KA 4GPD1 5IXEA 3GZKA 2YQBA 4X0KB 1A7RL 4CKXA 1TVHB 1DUYA 1IJFA 4EXKA 2GI4A 4E5PA 3RRAA 4PWYA 3K3QA 2WUGA 2OG9A 4U05A 5ED0A 1ZMYA 4PNZA 4WZ6A 4FHCA 4KKLC 2FWPA 1XMPA 4NKRA 5ALDA 5KMGB 4WOQA 5CSUA 5LIKX 2VFHA 1GZQA 2FP4B 3EN0A 3MWKA 5KYXB 2H3NA 4V1YA 2AC4A 2C3MA 3E35A 4XNXL 4NAEA 3RODA 2QSYA 5JAHA 2HDOA 1GV1A 4Y4FB 2X2UA 1NJSA 2WYSA 1LVUA 3TH3T 4ADUA 4HVXA 4UQ3B 4AY0A 3R06B 1TNNA 4PJAF 3WK1A 1QIKA 4Y9NA 1IWAA 3DP7A 3FNDA 3K7EA 1MGPA 3IBCA 2A5LA 1SSDA 4L73A 4NCKA 4YMLA 1AR1B 2PBOA 1J24A 3O2SB 1XTZA 2CGRL 1V4VA 4O1AA 3SSMA 2AVDA 7AT1A 3C6SA 2PBGA 3LUDA 1AZRA 1PTGA 4KLCA 2UYYA 5J5DA 1Z5LA 1XBDA 4P7KA 1J1IA 4ZO9A 2YS6A 4YT2A 3TO2B 4KMSA 1FDSA 4GXPA 1SBHA 3LIIA 3IEVA 3U6XA 3UWMA 1T20A 1QRND 3MV7E 1HTBA 2F6UA 3KXIA 3KYOA 3TEWA 4A4AA 3S7ZA 4X3PA 2BXVA 1ADWA 1WUNT 5GVJA 2DZAA 2QL7A 3LL7A 5T4EA 4JLPA 4D7BA 3OKKA 1GKOA 2YPLD 4LI3X 4U2GA 1BIIA 3K5SA 5G4EA 1M2GA 4G67A 3AROA 2OXNA 5I82A 3KL5A 2QULA 5KVEH 3HYCA 3EYOB 1BYOA 1TV2A 3WL1A 2Z6UA 4MD5A 5FNZA 1UBMS 5BWFA 4DG5A 2JKSA 3PWPA 3P5YA 4KTYA 1O1YA 3TRFA 1MUWA 1KBKA 3AWDA 4FEYA 1DQML 2J32A 3K9LA 3RFUA 4QDWA 3GIDA 1MCHA 2WTUA 1DC5A 4QEZA 1GGOA 4WO4C 1TX2A 4LGCA 1TTGA 4DWDA 3IS0X 3IMEA 3B9DA 4CUKA 3CBQA 1A02N 3PDOA 2XUKA 5B6PA 4NQXA 4ZVTA 1CS4C 5JYMA 3BPCA 1UBNA 4C29A 1NGSA 5A6MA 2H5EA 3K4ZA 5IARA 3SEPA 1ZHFA 1J2UA 2R7EB 2IHVA 5FQNA 4J1NA 1TZBA 4U1MB 1PYFA 1XF1A 1I1XA 4L1WA 1E9EA 2K6YA 3FRPG 2V0TA 4RMBA 4W6XB 4X3ZA 4FP9A 1UXSA 2B1HH 3V3TA 5IZCC 4E3ZA 3ER8A 1J49A 1XZEA 5KS9B 5A4DA 2OZ0A 4IKNA 2HRLA 4QT5B 1O5DT 3ZKMD 2HNAA 3IJEB 3LVFO 1O7SA 3Q65A 5AAWC 3DO5A 4RK5A 4F4FA 1QF7A 3C2EA 3DDCA 5JXED 2Q1XA 1QH1A 1MLDA 4DJTA 3ZS8A 3H9SD 3HKBB 2FSIA 4TXMA 2XWXA 3ES7A 5I28A 3EVEA 3PAVA 1XK7A 2HO4A 4PJIB 1H6UA 3RU7A 3O1NA 4QG9A 5DUBB 4LNRB 1U3WA 1FH5H 1MFCL 3IAXA 3R7QA 5D2NC 3DGRA 1QZ3A 4GSXA 1K0UA 1ZCZA 2C3YA 3H7IA 4DJDC 1W85B 2BP1A 2XGMA 1I1YA 2AZUA 4PU2A 3S5OA 3L3GA 1EDBA 3WIEA 5F89B 4MZYA 5BVPH 1EXGA 4LOEA 2GBFA 2HC9A 2CJYA 1MCPH 5F7KC 2JI6A 4CKZA 5IVNA 2PDMA 3L04A 2Q7NA 3L0KA 4OTXL 3N8NA 2OCKA 3OMIB 4PTUA 4J3SA 1U7DA 4O1HA 3VSAA 1C8PA 4AQYB 4KRPB 5JYEA 1W2GA 4HWTA 2I6SA 4XZMX 4ZTPL 4V11A 4XPHL 3N85H 4YY3B 3W56A 2WA1A 1CD9B 2LCFA 4OZHB 1CY0A 4IJ6A 1I2DA 4IDNA 3E22A 2AGJL 4MRSA 1XAGA 3NIWA 1M2EA 5IB5A 3NAGA 3C2VA 1Q0XH 4HNOA 3VXRB 2WG2A 2ZYWX 4C1BA 4CV0A 2X22A 1H3XA 4X41A 3S0JA 3I10A 4AI7A 3BUQA 1MI5E 1BU8A 4G0WA 2G41A 1NMSA 2ZWPA 3C2YA 3MS2A 5SICE 3O45B 3OY2A 2CGZA 4BGVA 1Z08A 4YHKL 4E7PA 5I4CA 2VXOA 3C60C 2D8KA 4Q3EA 5IVXE 2ATVA 2C8JA 4JDTL 1P1RA 4HRVA 4XUCA 5DX0A 2J79A 5JAMA 3ENEA 4JX8A 3I6KA 4B3LA 4JE4B 5F7OA 8ATCA 3OEEA 2JKWA 2VC9A 3HCAA 4EN3D 3K0AB 4QT0A 5CP7B 1BW8A 4K40A 1L7DA 2OCZA 1H0KA 4WGWB 4P5PA 2XDQB 3D51A 3TW8A 1G20B 2AGVA 3KXQA 3KVYA 2AEFA 1N2RB 5HF9A 1NI5A 3WV0A 1XF2A 4YSDA 1J01A 1TJIL 1H0SA 4IFBA 3CZKA 2E82A 1U4OA 2BLNA 1DAOA 3QQ9D 5FUXA 4C6PA 1UWUA 1LXCA 1OV8A 3BKCH 3DBOB 1ISHA 3L1GA 2QLNA 1IHDA 1I7UA 3ESUF 2VENA 4MJ2A 4ODTL 2YPVH 1K7FB 2VCOA 2C9MA 1XD8A 3VNDA 3K6SA 4O2EA 3KXKA 3PRJA 1NWPA 4JW3A 5B3LA 1LO0L 1J00A 2EE6A 1SUPA 3AS3A 3MA7A 4YAEA 1MRSA 3N44F 3IJYB 4A7SA 2PO5A 5MEOA 4JS7A 2K3TA 4IBLT 4TMKA 4ARBA 3KE8A 4Q33A 2G75B 2EQBA 2H2AA 2EQ5A 2LTQB 1BMWA 1F5NA 3BD7A 2PKCA 3G6JA 3KWUA 3B52X 1QPOA 4MAYB 4EK9A 5C7HA 1EMDA 1QMGA 4JEQA 1GZ3A 3L4WA 1GMEA 3VNQA 5AUMB 4I1NB 3RVOA 2ED8A 3R7NA 1N34B 5WRFA 4JI3B 2G9HA 4R26H 1RAEA 4DJEA 2FT6A 3B06A 5NLLA 4NI8A 1W0VB 4WI0B 1O5QA 3AUJB 3GHTA 1KFWA 2ICEA 4F4HA 3I1YA 3LRMA 3KFLA 1JHMA 3AQUA 1USKA 1WNTA 3HXKA 3QDJD 3K6DA 3ZL4H 1WA5A 3H1BA 3VSCA 2R1YA 4OF7A 4RS3A 4JY7A 4MQFB 4HSEA 3K20A 4GXFA 1NGWB 5B3AA 1F3JA 5HGHA 4B9FA 4O5AA 5CAHA 5C6WH 1E4XL 1OVZA 3IDYC 3NANA 3EBPA 2R1XB 5JXAL 4Z7WA 1UBOS 5JZSA 1F6KA 4BK9A 2YCLB 4EGCB 3MRKA 4LUSB 1T83C 3G3EA 3ZDRA 3RY6A 1IIHA 4LT9A 3VC3A 2DQSA 4GM1A 2XICA 4O2BB 2PCPB 4RHXA 3EEIA 2FR4B 2JD1A 4R0VA 3QV8A 1G4MA 4GSLA 4E2ZA 4ZW8A 5IMOA 5CPMA 1TR1A 4AQDA 3OEHD 3FPJA 1KCXA 3RDTD 1KNOB 2X3UA 2YZ8A 1UZDA 1WBXB 5F1OB 3I23A 1H9VA 4JEUA 2NLJA 3OTWA 5K6AC 4IHQA 5F2OA 3P9PA 3I0ZA 1I7RB 2FX7L 1Q1AA 4F12A 4N0FB 1YZVA 5BS0B 2QJDA 4AC1X 2Y5QA 2HT6A 4XX0A 4I1YA 2YDSA 3WQCA 3DBHA 4PJDA 4B95C 5BMXA 1V8DA 1MKFA 4KVCL 1CQXA 3R4IA 2B4KA 2FSGA 2DAPA 1WEJL 3U7YL 5AZUA 1LZLA 2Y4NA 8A3HA 2RCYA 1OK8A 1O89A 1TECE 2AOUA 3BIKA 4O16A 4Y0GA 3QIBB 4Z17A 5CB4B 2XITA 1KBOA 2QMZA 5KX5A 2CHRA 1UWXH 2BHSA 1KTNA 3SX2A 2J7DA 2V5KA 3KX2A 3VWJD 3T1QA 5C5DA 3U30B 2C78A 2XCRB 1E99A 2B7BA 1UKTA 1KARA 4I48A 1VIMA 2P27A 3FA2A 3K72B 4HHAB 3G1SA 4UOW1 3H9QA 4D6EA 3OVQA 4QGBA 5BVPL 1PVNA 2BHNA 4HH9B 1RUPL 4KO7A 2FJHA 5L6LB 4JNXA 2ZPAA 4CNSA 3NCCB 3HJEA 4MW7A 4J8RB 5KYGA 5F78A 5ABDE 4JB2A 1AUOA 2VYCA 5H37H 1HF6A 5AC7A 5IQLA 1K8DB 1KZHA 43CAA 4ZALA 3TW0A 2CV2A 3KSZO 2ZIWB 2BGNA 4MUIA 3HE3A 3TIMA 1ZZMA 2OE2A 1CB0A 2HRQA 4MCYB 3IUJA 2WN3A 1IO4C 3NAAH 1V9CA 2R6DA 5CU7A 1OZTG 4K7YA 4EW6A 4B27A 5J0BA 1QGUA 5I7FA 1NE2A 3ZZSA 3AFHA 2E2WA 3WSTA 5DULA 3BANA 3O4VA 1PEKE 4DGQA 1WISA 3CLHA 2WXOA 4W63A 5I8WA 2ITEA 4GU5A 4UPVA 2R0LL 3ONBA 2AOTA 2Y1FA 3RYSA 3AOEC 4WKHA 5L95A 4GT7A 2O2HA 4HNSA 4U6QA 4NDZA 2R1MA 1BQHA 2B5OA 3HR4A 1SQMA 3C86A 2QZ9A 5IBLC 4GFDA 1NKGA 5D1XA 3MWJA 5J56B 3SLRA 4Z1MA 4UC5A 3DEKA 4NZFA 4L18A 2J8TA 4GAYB 5BOJA 1QYWA 3IP5A 4K3EL 5DZOA 1T3TA 2X0DA 3L7IA 2CY0A 3NCBB 3O03A 2EDRA 1YEDB 4HSCX 1Q7QA 4X4ME 2X1IA 1QIGA 2JJQA 3E4DA 1RJQA 4IMRA 4A22A 1E4IA 1RAFA 2DYKA 1ZW6A 3RYMA 1I5EA 4JN7A 1YEJH 2AV7B 5JXEA 2QTTA 4TVCA 4BJHB 4MA7L 1D6NA 4LCWA 2PYFB 1KI9A 5BV7B 2CUMA 1G3RA 3JQBC 4BQIA 4YCNA 3OBBA 5AW5B 5IJ0B 3OLGA 4N9BA 1Y1LA 3H9ZA 1AS3A 4KKCC 3UXIA 4R1SA 3CVUA 1OF2A 1UASA 3IEAA 5REQA 2NO5A 2XNHA 1NGPL 1FCBA 4N6RA 1S9WB 3MJYA 1E90A 3F1KA 3BZEA 3WFAA 4DC0A 2C3VA 3FQYA 4U1IB 4LRSA 3GTTA 3SC6A 3KGTA 1THZA 1ND0A 5AVNA 3VH1A 3S1UA 3GGPA 3ROOB 4HQKA 4URUR 1NBIA 1K3TA 2WE7A 4YR9A 1V71A 5GV8A 1N77A 4D9GA 2XYHA 3EX3A 3JZMA 3AAZA 4F8TA 4J3ZA 1S2TA 1W37A 3T1NA 4BNIA 2BCKB 3GOHA 3CU5A 2XUDA 2CPUA 3H53A 5EZIH 2ZA3A 4E2XA 2ZYUX 1BFOA 4HNHA 4G8GA 3OOJA 4IDHA 1ODLA 4LLMB 1FSGA 4A55A 2PA6A 1UFKA 1CEQA 1NL3A 4G7YL 2WY3B 3POHA 4HYVA 3CZAA 2MRYA 1U8NB 2DWEA 2DBZA 3X12B 2FNBA 1QGZA 2PIAA 3VHXB 3EDDA 1KDYA 3AHIA 2QJRA 1MW8X 1EERB 1A6PA 4YDMA 4GOSA 4P59L 5LB1A 1DFBL 4M0MA 1L5OA 1AA9A 3STGA 4O50A 4KDEA 1R15A 4ZRNA 1E3IA 3QJFA 3MRJB 2X6AA 1UMBA 5THKA 4MUPA 1I4FB 4JHBA 1A4MA 3BN3A 3I9IA 4BGDA 2BFFA 2BUAA 3TR0A 4D0SA 2XBTA 4JE0A 4PH6A 3LKQA 1BMQA 4DLUA 1QIDA 3U36A 3TT3H 1DHPA 3QQNA 2Q2OA 2NZLA 4Q93A 5CJPA 2DQCL 3AM3A 2GARA 3B3QA 1IT0A 2NY6D 4JA0A 5ECYA 2F53A 3OOWA 1ZVYA 2Z8ZA 5ICGA 4C4XA 3R7MA 2C2KA 2X5KO 2F1BA 2Z8SA 5A9SB 1IQWL 4O18A 1M6UA 5HM8A 1XA4A 4TX1A 1YHNA 3GZAA 4GY1A 3GKZA 5T33H 4LTNA 3LVBA 4MA8L 3Q98A 1JYVA 2A9BA 4N68A 2P5WB 3VQTA 4Q4JA 3C5SA 3RTEA 1ZHNA 5AZ1A 4G7FA 1ZMRA 4HU4A 1FL3B 2YMPA 4JCOA 1RZJC 4N20A 4AZVA 1B41A 3D0VA 1OAOC 4JVNA 3WLBA 3QUZD 3V5HB 5CSSA 3WSQH 2CD0A 4WKOA 4XCXA 3IS4A 4BD4A 4N18A 3TH4T 1JAIA 2PN1A 1KFEA 3NBFA 3BP7B 3Q40A 3OHMA 3U7QA 1GPUA 4YTRA 5HY9A 4XGQA 1KN4L 5EP1A 4WO4A 4I18A 3FMFA 2IDQA 1XKLA 3A5VA 1M56B 4DXXA 3BQNB 3F9IA 3VU3A 4EUEA 2HBZA 1GCOA 2PCJA 1AKJB 1Y81A 5K51A 2PYDA 4DJDA 4WNQB 3GRYA 2QAFA 2FX8L 2DI9A 2FLKA 3K30A 5D72H 3TA4D 1LDGA 3Q58A 1VRWA 1Y8CA 4RD3A 1G98A 1YD7A 5C07B 3QXUA 5AOBA 1E5JA 2AEEA 3T7CA 2R2HB 1XTLA 1CUEA 4NY1A 3VRJB 2X9YA 1Y8ZA 3T3OA 4YTTA 5HWJA 3QQ9C 35C8L 3HRZB 4XP9L 2P1DA 3WKEA 221PA 3KO8A 3D9AH 2XB9A 2C0CA 3BLIA 3QVAA 3P77B 3K1JA 4O14A 3Q5EA 4ORGB 3KDPA 4BY9E 4N76A 5E2VH 5GZ3A 3B9KA 1XIFA 4J6IA 1ONQB 2GHWB 4YBLC 4NYJR 4KPHL 3EODA 2Q07A 5JQ6L 1KC5H 4Y88A 3GG1A 4Q3NA 4TXEA 4K28A 3Q5YA 4JJEA 4ND8B 1NFGA 4BKMA 1A1SA 3I45A 1B0UA 4IMPA 4WENB 3WO8A 5EU9A 2EQDA 1JPFA 5IB4B 3ZHSA 1YDPB 4EK7A 3OOYA 1ZSYA 5LB2A 1AHWC 4UV7H 3CHYA 1Z3IX 1P91A 1QG3A 1X1CA 2HKAA 3FO2B 4MWAB 2ODEA 3MNWA 2XTZA 2VDPH 1DU4A 1M6WA 2HEJA 2WCPA 4DHLA 4ZQPA 1S2EA 4YQZA 4OFVA 1AP2A 3C15C 1SKMA 4GAEA 3O0RL 3L92A 3MJ4A 1S1CA 2VGGA 3BP6A 2FOIA 2JWYA 2DM2A 2NZVG 2NU9B 3JZDA 3O41B 3HI4A 5D9SA 3GA7A 1YEEH 3ABSA 3OGRA 1XU4A 4PS1A 4RZ4A 1SCUA 2BHTA 5I1JL 4HYRA 3EKZA 4B6FA 5FPIA 4MAVA 3UZYA 1HINL 4OLYL 3FMVA 1J8HA 5F6IC 1OLSB 3FSWA 3DKKA 1KXTA 3DZFA 1V5JA 3G68A 3VD5A 2GM3A 4IK6A 5ICZB 3H18A 1FU4A 2J8FA 3QRGH 3KRTA 4ZSUA 5TGZA 5J3HD 2CDRA 3SQBA 1EBHA 2HOQA 4Y67A 4X66B 2CXHA 2CFOA 4MNTA 5C70A 1NDVA 3P32A 5H9WA 2AC2A 1E5QA 3IVAA 2Y89A 4E2WA 3IVXA 2ARWA 2O4UX 4KCUA 3LXRA 3R6WA 2FXIA 4ZD3H 1IGFL 3K9QO 3PNMA 4XPGH 3WTTA 1ID8A 2AK1L 5AK0A 2HP4A 1P2GA 1I8TA 1KK2A 4JJ4A 1UWRA 1UP7A 2KM1A 1BXVA 2YEZB 2W11A 3GOQA 4HFWB 4I66A 2H7CA 5F7MC 1AQYA 1JI1A 3MQFA 2Y7OA 2QDXA 4HT3B 5C3IA 4OEHA 1SB8A 4Q24A 1YZGA 1JG4A 2Y06H 4Q4LA 2EX1A 4OLWH 3QO0A 3OFVA 4IRSD 5I3ZA 4JS3A 4K71B 1HNXB 1E5AA 3MAAC 1VF5C 4KFCA 4PVBA 1HHKA 4X7TA 4L22A 1JGUL 4DBLC 1F58L 4NQCA 2CKBL 1RPZA 3MAWA 4QAIA 5IWCA 3IDXL 4LHYA 3NG1A 4IRZL 1MB9A 1BWKA 1JG7A 4I87A 5HHOA 1RRGA 4Y18A 3CUJA 2ZRCA 2CETA 4IVPA 1EE2A 1BWLA 1YADA 5DGQA 4Y30A 1LBMA 1JU4A 2AEIT 3OZRA 2A6KB 3VRIA 4UT7H 3PB2A 3AF2A 5D87A 3BUYA 2ENQA 1MUJB 1TETL 4ZEVA 4QUDA 3KT3A 5M29A 2BHLA 1JZGA 5I0WA 5EO1B 4M1QA 4FK9A 4U3JB 4Z51A 3ARVA 1CY2A 2ZXBA 3D6MA 5DMMA 2DQCH 1KC3A 3L93A 1ETZB 5E7BA 2IUYA 2B1AH 3M88A 2KLTA 2JBAB 4UD6A 2VPXA 3C5ZA 3QTBA 4JTSA 2G60H 5M7QA 4X4XB 1FUEA 3CJPA 4LMPA 4FCTA 1TOXA 2QVCA 4IFTA 3UDWA 4MA4A 2F1JA 4H88L 5A6SA 4M21A 4JTUA 3QQ4A 4K8RL 1KCVL 3A3XA 3S42A 3QZMA 4TUYA 4NAEB 2JFHA 5EXTA 3FO0L 1VFAB 1CP2A 1OAUL 4QWWD 4ZYUA 2RR3A 5ACMA 5SWQB 4FONA 4EOWH 1E2MA 3NPUA 4KV5E 1HN1A 3NR0A 3S28A 1L6FA 2Q7AA 2C14A 5JCPA 4N8SA 4E4PA 2W2QA 3WRXA 1B6UA 3T09A 3EGDB 4RJ2A 1J48A 4JYZA 3RBGA 2E25A 4C4KT 4R7WA 2DPXA 4JPIA 5DUPL 1HSBA 4ETQB 1MORA 1RKBA 3PJEA 2Q3FA 1PLJA 1QBBA 3SCOA 1MAML 4C1NA 5JMRA 4HU8A 4OOUA 4DKDC 2GCPA 1UD8A 4QUIA 5KTKA 3SGEH 1FYTD 4MRMA 3AX6A 2GPYA 4NJMB 2P9HA 4H1LG 2XF8A 2PO6A 2MPAH 4DMRA 5EE3A 3EIHA 3WIAA 1DBRA 3G9UA 4GZ5A 4XCEB 3M86A 1Y4UA 4D9CA 3OEXA 2DU8A 3BH6A 2O6EA 3BIBX 4IXHA 4XD7A 4P23B 1AGCB 4ZO6A 4HZUB 2QP3A 2PZ0A 2SEBB 3MWYW 2R39A 1TWIA 2KMLA 5FV7A 4BZPA 4LGXA 4N2YA 2C3WA 4E9RA 1D4OA 1XZ8A 3L3OA 1MJJA 4C30A 3PWPB 1JPTH 3PHOA 4YFLF 1OP4A 3CZ5A 3FGNA 4C6IA 4G4SO 1MOSA 2YUIA 5HANA 1E3EA 1CPYA 4NLAA 1PKQB 3CHRA 1BYDA 4XYLA 1VZGA 3HHSA 3R7FA 5EIFA 1ENOA 4ODXA 5DO9A 4XP1L 4LZJA 4WTQA 2I9LB 5GVSA 2JHAA 1EJ6A 2MMGA 3JX9A 5DHTA 1EK5A 3S36X 4C0SA 2AA3A 4AM8A 1YAIA 4YHGA 3EG9A 2O2DA 2VLIA 3VZZA 3T5PA 4L3VA 3QUMB 3NG3A 2C7RA 4PY8I 2GUGA 1U0RA 2L0XA 5DYFA 2R94A 5LHDA 2LUOA 3BPCB 2X89D 4NFCA 1KUMA 4E07A 3OD3A 1I33A 1KG0B 5AESA 4LWQA 1WB9A 4GWKA 3P71T 1QANA 4JWKA 4ELKB 2GJXB 4DF9A 2BP5M 4MXVE 3W82A 4Q8TA 5HGAB 4QGHA 3DWTA 2J08A 1CCWA 2OMWA 5T4BA 1FHDA 3VGAC 4GO6B 3DIVA 4TSCH 5B7NA 2PDHA 4EAAA 3HPLA 1MO2A 4WNAB 3PNKA 1W3TA 2IY8A 3FNHA 4X5QA 3IU4H 1NDZA 4HN9A 2DTML 3TOXA 2WO4A 4W5QA 1QMUA 5IZ7A 3STCA 2BEWA 1IBHA 4TM8A 2E37A 3G9QA 2G0LA 4Z9XA 4CGYA 4P2RB 3RS8A 1C1XA 5GIPE 4IH9A 5AI9A 1K8IB 3TIVA 2VTKA 5D7LB 4PTWA 5IAKA 3U9UA 3FFSA 1GXSA 3H4MA 5IQOA 4OIIH 1SXCA 3QUKA 2WVVA 4LAQH 4PJXA 3U7FB 3IE2A 1SW7A 2WSMA 1UBFA 4X4MA 1FXWA 3B78A 4MKGA 2B59A 4X54A 2CGEA 1LK2B 2ASHA 4XODA 5CNHA 1L6ZA 4D8PA 4F2GA 2IOMA 3DOFA 5EWLA 3EH5B 1CUCA 3CXDH 3U60B 3L9RB 2LABA 3O07A 2XMZA 2QVHA 1PL9A 3QMSA 4L1XA 1I0IA 4JP8A 1FFQA 2DPMA 4CM4A 3VISA 4KJPC 5HBFA 4BMDA 5CLQA 3DAGA 2Q3JA 2F2HA 4QL3A 5FL0A 2LCIA 2ZBDA 4UKDA 4FW9A 2B2CA 4CJ1A 1LQSR 1XD2B 1BZQK 5HRUA 5A5DA 3TIDA 2QCLA 1OH7A 2X09A 3MN8A 4TRRA 1VFPA 4Z2YA 1IGFH 4YWIA 2GJ4A 4I2XB 3TE9A 1N6QL 1QFJA 1EDEA 2J3EA 2CO6B 4GIOA 1JDBB 3DT6A 4G5FA 1JI2A 2J9FA 4IVQA 3K71B 4H8NA 1UQUA 4HPWA 4AJIA 3IPEA 5C0BD 4UM8A 1HRKA 4ZUUA 3JQPA 3KPMB 2BJHA 5L51A 3BUTA 5K9KB 3VXRA 1SBSH 1HL2A 1YS9A 3TFCA 5IHRA 4BZ2H 3MLRH 4LTDA 1P5ZB 4NYLB 4DA9A 1U94A 4TU1A 4JJHA 2NAFA 2NVBA 1IY8A 4NOBA 3RTQD 1T21B 4X3OA 3QEQB 4RDCA 1T5WB 1GU7A 2E4UA 1VSVA 4BVHA 1MG3C 2VL5B 3D2TA 4JVWA 4RGVA 3VFSA 4ACPA 1GHRA 1OCZB 1MFBH 2QN7A 1M71A 3GYRA 1Q1GA 5BSVA 3NTLA 1NCCH 2R0QC 1FHLA 2J5KA 1R3LB 2AHIA 3NPMA 5E23A 5C4GB 2YHSA 2FMXA 2E4VA 1YJXA 3VXPA 3LH5A 1COWD 1TF4A 3ORQA 2H85A 4P32A 4GQZA 3UNXA 3WHKA 2VFFA 2VZ9A 4KK6D 3O93A 1HAWA 4K3GA 1IAIL 3A6EA 2C18A 3AXKA 4IUDS 4IJTA 4AHQA 3ZTCC 4F9JA 1R5IB 4EJSA 1NVEA 4D0DA 1YBHA 4ZEOA 3MKVA 1NF3A 1M1UA 3QPAA 5CJXC 1X9RA 2HMSA 3PFCA 4DVBA 4HYEA 4AIEA 3UO8B 4L9RA 2PFGA 3I28A 2OVFA 3NZPA 3IKJA 4ID9A 3GC5A 4QARA 3FYCA 2Y3AA 4BSVB 1AJEA 4WX2B 4JITA 4XXCA 3IDQA 3MOQA 1WDWB 4W9HC 4EP8C 2MJLA 1HHIB 1ZXXA 2FNAA 1L9NA 1QYXA 4HCGA 3RURA 3NTQA 5E9DE 4Z95L 3DKJA 2Q3MA 2I3BA 3C4JA 3OYXA 1NATA 2MEJB 5BWMA 1Z17A 1S3RA 5I9SA 3K0YA 4MNKA 4M2LA 3N41F 1DV1A 5LOVB 3QFFA 4IL5A 1MEHA 3QSRA 4Q4RA 1XVVA 3L4EA 4I7ZC 1G0DA 1I8JA 3E1KA 4R6WA 2UXBB 3H4FA 3IDNA 4Q58C 1HSZA 1G7SA 3ON5A 5CILL 4AVKA 5AL0A 5F9AC 4LBSA 4KTEH 2Y0DA 4KFUA 4NASA 4I18C 5DC4B 6CGTA 2DWUA 3VRLE 3OTRA 2WTXA 6FABH 1E2IA 4W4TA 4L0ZA 1EAOA 4ERIA 4CDGA 5EY5A 3VG9C 1XFCA 2WB1A 1ONOA 1N9ZA 4HLZH 4GAJL 1IN1A 2P9RA 1SJVA 1ZS8A 4O0KA 4F7TA 2FBRA 2JV6A 3M6UA 1U80A 1EFVB 3EYFA 2XVKA 2YV5A 4OLXH 2R69H 4JTJA 3JQ8A 2XG9A 3SO3C 5BN4B 3PAYA 3EXG2 1O66A 2VWQA 4PJHB 4HH0A 1MFNA 4CM8B 2QA5A 1TUFA 3IK2A 5D9NA 5C0DB 4KW2A 1JPTL 1BGXL 3VD1A 1C9WA 3H86A 5D4QA 1XMOB 2ODAA 1DRVA 2LD4A 3ISYA 1P69B 1HNYA 4YP5A 1Q6CA 3AR3A 4XP1H 3PWUA 1M6HA 2F67A 4ARIA 1K7XA 2IBMA 3FO1A 2HK9A 4J3TA 3F5WB 4XG1A 4EL0A 2F1KA 4GYKA 1WG3A 3FPXA 3WUWG 2DMRA 3EQ6A 4FG2A 2IYWA 5K9QG 4FQLH 3ZJ5A 5ITFA 3THML 4JMLA 1DAPA 2VJAA 5DZLA 4X9YA 1MQ8A 4K8RD 4BFVA 1FCJA 3PDOB 3LO5A 3B51X 4TQPA 1ZP3A 4LKCA 2IS4A 1L6SA 5C9XA 1P7TB 4DF1A 2PT6A 2PPEA 1C80A 1JKFA 2QUTA 5EMLA 5JSUA 3NXKA 1VADB 4AG3A 3RTCA 1FGVH 1JQVA 1IPHA 4M0PA 4OJFH 5DK3A 4RKRA 2CLMA 4WWHA 4B97A 3OEHA 1LHZA 1VL5A 4DIUA 3QORD 5IBQA 4HA1A 3QEMB 1WZ2A 5KS9A 4A0SA 4NQXB 4D6FA 3FWZA 4NENA 2C4MA 5DEFB 4B50A 4F7PB 1NBHA 2J85A 1EFRA 3H42L 1T5OA 2H7VA 4OIIL 3WHXB 3HMWL 3OG4B 1ZO8A 4XDZA 2QRLA 2Z5GA 4UHJA 4QKQA 3A0OA 4ZI7A 1X7FA 4FDVA 4GO8A 1VJZA 5T9CE 2XR1A 1BD2E 4DSOA 3EQZA 3OZVA 4B3RB 4Z9BA 1S7XB 5HWNA 3PC7A 2VR8A 4BDVB 2XG4B 5ISZA 4X98A 1I2RA 4F2TA 1F11A 3RWJB 1PG7L 3MLZL 1FZJA 1A49A 2DSNA 2VM9A 3V3WA 2QSVA 3L4BC 4N49A 2HX7A 3ATAA 1J0XO 3IUNA 3PUJA 2Z31C 4ZZ1A 1KBBA 1RK7A 2BNUB 4QHYA 1ZJYA 1RP8A 4LC8A 5IF9A 4OI2A 4L3WA 4JZNA 4NX2A 5DJCB 2UV8G 4P57B 1GNXA 2QL9A 1IY0A 4M6NH 4JFQB 4Q8WA 4NU0A 2Q3AA 3VA7A 3UAJD 4B2DD 4WUUD 2R8YA 4O5OA 2X0EA 2DKSA 4X8JA 4DCCA 2C84A 2EDCA 4N2OA 2XFRA 3O6KL 1YMVA 1JW9B 2EACA 3SODB 4TQHA 2YL6A 3BPNB 2CK3A 3B9OA 3TGPA 3P0YL 4Z7QB 1R38A 1XTKA 5AOJA 2K9FB 5D6CB 4ZT1A 1S5MA 2QLBA 2XRMA 2WIMA 4BQ6A 4MZIA 5JQIB 1JNLH 2I55A 3DKIA 3EX1A 1OTSC 1XMXA 3LIZL 1YY9D 3PPEA 4K8OA 3CINA 4OL0A 4FADA 3AEZA 2BJWA 2BFCA 3TO2A 2BNRB 2UZ3A 1N64H 2QPFA 1L4UA 2WQPA 4OQLA 2UUBB 3V8NA 3QIUD 4NK5A 1XCWA 1QA9A 3EF3A 5BZDA 1MIHA 3DDWA 5J1TB 4BQ2A 2L7EA 4HK6A 1AR1D 1P1HA 5CLLA 1CUOA 3RVUD 3ZHNA 2HFJA 2QS8A 1KJ2B 4RSVA 2QJOA 1H1TA 4ZW6A 1W2HA 4HP5A 2D31A 1JJKA 4NT6A 4X1IA 3TX6A 3HB3B 3E9AA 3E9RA 2NU6B 4BKSC 4XV0A 5AYTA 4RLIA 1O4WA 5E1AA 1OEPA 3HHRB 1X4ZA 3R09A 1P5RA 3C5JA 2HKFL 2ZZ5A 1XB3A 5EHGA 2F9BT 1G20A 2ZAYA 2IDUA 1BWPA 3OX3A 3HNOA 3EXFB 4N6GA 1VLXA 3LEXA 1R5VB 3KSAC 4XMLL 4XMPL 1JGLL 1UD4A 3G9AB 4K9QA 4CTOA 2DZPA 3WWDA 5DMYA 3C8ZA 1A5ZA 5F9HA 1EJ8A 2XZQL 4JDEA 4HNNA 4I2NA 1S9VA 1WZMA 4MEAA 5FB3A 4YJFA 1BGAA 4PL1A 1YDNA 4XGIA 2RJHA 4FG6D 1QO3B 1AIFA 1T9BA 2B9AA 5BQ3A 2CBQA 4FHZA 5GZ6A 1KYXA 4TWAA 4G8GD 2ISWA 3JWNG 5EBWA 1T0HB 1SXGA 1NZJA 3C1UA 4M4SA 3A04A 4F9LC 2JQMA 2EAUA 4YFEA 3QQWA 4ZXBD 1HL5A 3SDAC 1BOGA 4PRPB 2WV9A 2P8PA 2AG6A 2W92A 3KOYA 4PE5B 4JIGA 5MEOB 3GRPA 3WF1A 3LYRA 2VPQA 1IEAA 2D6FA 2VZSA 3NHWA 3Q5TA 4U7JA 1NDGB 5D03A 2UZXB 1KJZA 5EGSA 1UDBA 5K59F 1KPVB 4OKVB 2KLHA 3CB2A 1GW9A 3MTJA 2BVPB 4L5ZA 1W36D 3HB4X 3MX0B 3O4RA 1WW8A 5DT7A 2X5OA 4KN8A 3LBAA 4JHAH 3ZJTA 2R84A 2XB2A 5T5FA 1Y1QA 3DURA 2HXSA 4O2AB 4LKRA 1KETA 5C7OO 2WF5A 2EUZA 3NAVA 1FQWA 1N5OX 3MRDA 1W0VA 4OVVA 4QECA 3G1FA 2ARKA 1JHTB 4X99B 5DVLA 1RQ7A 4N5MA 1T91A 5AOLA 4QGCA 2WJFA 3QUCA 5F2EA 4UTCA 3F5JA 1NF9A 3BUSA 5IHPA 3V0DA 3ZYJA 1PVVA 2W83A 2Z56A 5G5DA 2I4RA 4AIIA 5C0BA 5F8QC 5D7HA 2RGEA 2YWFA 5CDYA 1J0IA 3R3WA 1L3WA 2A67A 3NIDF 2ALWA 1BF6A 4ROQA 1EVZA 1G3IA 3ZWQA 2AMYA 1NBVL 4FQLL 4QOKE 3PGFH 4AP6A 1U91A 2G97A 3ZWAA 3UG4A 5TQ0A 7REQB 1PJBA 3WK6A 5LGYA 1T2CA 5KNCD 1VE5A 2X41A 3TLBA 2QTRA 1XSIA 4RR4A 4Q9RL 2YZGA 4PJ9B 4XTRC 1G19A 1RIHH 1GGTA 3FSGD 3KPTA 4J7UA 3ITOA 1D5RA 3IV9A 1HZHH 4IIJA 1VFSA 1A5BA 2J6EH 2EEDA 1GPJA 4HEA1 4IMEA 1TM4E 3Q9LA 1EVUA 4W82A 3UOWA 1A96A 1C81A 4AZWA 3K0FB 3GV0A 2TRSA 4K26A 5DZ9A 4MNQE 4GP8B 4BUJA 1WZUA 1PX4A 5DHXB 3EWSA 5FEXA 2AFHE 3WDSA 4FTVE 3PDDA 2ZRVA 1T4CB 4LSRH 2XQ0A 1HQKA 1E8YA 1RMFH 4AENA 3FF1A 3STTA 2I56A 4YUYA 2PBFA 2OL3H 3KHQA 3O2WH 2BEVB 4BWYA 4EPRA 5C37A 8TIMA 3AJAA 5F2IA 3AL2A 5IHHA 1OPXA 4FYMA 2Y23A 4GXUM 5IR1A 4GSYA 1QO5A 3BKJH 2PW1A 3LWDA 3T9PA 3U44B 3C2RA 1FP8A 2VR2A 1FC1A 3CZEA 3I4FA 3MC1A 1WMFA 3CRVA 2J8HA 1Q72H 1Q16A 3K15A 1F6DA 1EC7A 5IJZA 3E3HA 1UBPC 2NWSA 3MKGA 2NADA 1HDMA 4D0CA 2PDGA 1EDDA 4OG2A 4Y4KD 3QXAB 1G0OA 1EHCA 4G7QB 3KSDO 1W9DM 1RQHA 4X1OA 1DKMA 5FO8B 4FMBB 3TVMA 2F54B 4ZTPH 2X6RA 3V4RA 1FDRA 2YRLA 4G01B 5LYYA 4LGRB 1M6EX 1A8UA 2ZUQC 5I7HA 1QSGA 4JB9H 1ZJJA 3N43F 3Q2OA 4YCOA 4TV9A 3IUQA 3KQOA 3VNBA 4JMNA 2ZCKH 3UO1H 4KI7A 4WCYH 3WGMA 1XTMA 2BHYA 2VK1A 4OJEH 1QG4A 4NBNA 3O6MH 1KAGA 1N5MA 3RTQA 4BHUA 2BSQA 2QE6A 2VLRD 1HEZA 3BHIA 2FPLA 3RHTA 1YDHA 3D48R 2IYAA 4M36A 3H42B 5JRDS 1OI4A 4WEEA 2AOTB 4P4UA 5DBGA 4BRJA 2E6YA 4MAFA 4RPKA 4G7SB 1EFLA 1OYWA 3IVKB 2J09A 3OJCA 4Z2KA 3CVHB 3C4QA 3QARA 5ERYA 5JQHC 4L4UA 5GZ1A 1OAYH 1XCBA 3QTLA 2X4TB 4QOKB 1OB1B 4TQGA 1CXFA 2QRZA 5JIWA 4LEFA 4JTKA 1N55A 3T5DA 4DNQA 4B41A 2X0YA 4DBZA 4ESVA 3UY7A 1P73A 2QGDA 4YSSA 2CM5A 1XCMA 3JTEA 4DMMA 1CZRA 4BMYA 3SBFA 3DHDA 4YLEA 3W2DH 1V0KA 3IAAA 2VURA 3QQ0A 1VB5A 3FAXA 3QYJA 5D1XB 4IF2A 3II1A 5T4HA 3R74A 3OQNA 4ZMXA 2FW8A 1UH3A 1GY8A 3T0EB 4QJIA 2CE6A 3CQHA 2R1XA 3BKCL 3TL5A 4GBUA 1XGTA 3L4XA 5D5ME 3MYYA 5I07A 2GTPA 1NMXA 2VGIA 1SG0A 4I4LA 3DFYA 1F74A 3JZ7A 3KZKA 4A36A 5DJ8A 2GY7B 3DTXB 2GBCA 4GKNA 1CIUA 3DBSA 1VYTA 1SIWA 2B4AA 2P30A 5KWEA 2CN1A 2OYLA 3RZCB 4MOZA 2BGIA 1XGUB 3URNA 2O2YA 4W9CC 1A5AB 1BS2A 2BWJA 5F1KC 1WZEA 3UU0A 4AS3A 1EIZA 3WA7A 3R7AA 4KUCD 1BSVA 5KSAC 1ICEA 1VXOA 2IOFA 8AT1A 5GP1A 4LWZA 3DK0A 2GS9A 3GRGA 3BQMB 1TVHA 1KV5A 5LNK6 1SOKA 3TNLA 4L4MA 3W1VA 3OA5A 4UBDC 3E0VA 2DIBA 4XNQA 4FM9A 3IAUA 4D79A 2MJWA 1BXXA 2BV9A 1GZQB 2FP4A 5LUMA 3UG3A 5GJMA 1TQXA 2HK7A 1NVUQ 2AXWA 1XRMA 3UKJA 1PR3A 1AANA 1UWGH 2K0RA 2X9NA 2DUMA 1TPH1 2OD9A 3WP1B 1WEHA 2O06A 4GF5A 3EKCA 4Z8FH 2HB0A 3B8UA 1GQSA 4YRMA 4TOQA 3FFTA 3QORA 2OBGA 4RBPK 2ICWJ 3H2PA 1NCGA 3R0QA 3MRQB 4LOJA 4MW9A 4FEMA 3VUEA 4NLHA 4RZBA 4JM2F 1T1YA 5TJWK 3VXQA 1HE1C 3TEFA 1EBAA 3CFDB 2FG7C 4IIZA 4OQFA 2BBTA 5DXFA 4JFXA 2PR4L 2XGSA 4KXLA 4B44A 2CYGA 4Y9UA 1V25A 4MWDA 1YOVA 4JOQA 4GR5A 5B58C 2XXCB 1G9TA 3EYPA 2FWJA 5HPOA 2W4IA 1XYBA 2J25A 3FUIA 3GINA 4RAVB 5GGSB 4GGOA 4LY0A 3K0EA 2OTCA 4GUGA 2CV1A 2A2ZA 3LHIA 2YQ5A 3RKDD 1Y5LA 3I85A 1WFIA 3ZDFA 3VXMB 3NM6B 1HP5A 2VO5A 3RARA 1G4UR 1FNAA 1ZK2A 2VXUH 2W48A 4UFHA 4IFKB 5LU9A 2NTNA 2LHAA 3KAAA 1NJ6A 4M9OA 1D6JA 1PJ2A 3U36B 2O0HA 2ZWLT 4X7RA 3TDKA 4HNAB 3OCCA 4H26A 2I9EA 1CXZA 2P9QA 4FEEA 3MRLB 3PYLA 4FQHB 4JPIB 2CJWB 5JFGA 1UKCA 2DZUA 1WDDA 2C9XA 3OZWA 2G4GA 4LRWA 4I4NA 2H5IA 4AJWA 2QIOA 1GOXA 4G8GE 1ZS9A 2ZJOA 43C9B 3PU7A 2AV6A 5KPJA 5DMIL 4LDLB 1ZA6A 4MDIA 5LAPA 1EFPA 3KBEA 5INCA 1SD1A 4MW0A 3MJSA 2GAFA 3C2FA 1SRRA 3RROA 3VDMA 3HDQA 1PV2A 3KWWB 1G64A 1TGYA 1IBCA 2OL3L 3O2WL 5KUMA 4BELD 1R88A 3D0VB 1PG0A 3C3AA 2WTBA 3LLFA 5G4OA 2F08A 1QHPA 4MADA 4HUUA 4ZHQF 3GA0A 4ZPTB 2CVQA 3AIKA 2OORA 5H4YA 1GYWA 4KUZH 5EFIB 4ZU6X 3SPXA 5IM7A 3NHMA 1IUOA 1DC3A 3KVPA 4NNBA 2EIHA 4BO6A 3ARGB 4IHAA 2YQGA 1IL0A 2XV6B 1UOLA 4WY0A 1UC6A 1V9LA 4EZKA 4ODVL 3MM4A 5FPKA 2O0JA 3PCRB 4PWZA 4HIJA 1LDPH 1WCIA 2WU0A 4NN7B 3KZVA 5LUBA 1A7NH 1KOFA 1KMGA 3BZEB 1QK0A 1QRAA 2AWOA 3LGDA 3W86A 1A64A 4F2MB 4QJBA 3ZWOA 2RH5A 2VDWB 1MQKL 2DYPA 3VUFA 4OU1A 2Q6WA 3EYSH 4G0QA 2VFDA 4GBGA 4MAAA 1HXKA 1UT1A 3EO0B 1M05B 2QZ4A 3F96A 2HK1A 1UXWB 2Z35A 1U9IA 5FLXA 4JB0A 2H9GA 2AEWA 4P23D 1BV8A 1KSHA 3PGCA 5AUNB 2IDKA 2NTVA 5BPFA 3MUFA 2IQAA 1JVBA 2BP7A 1YASA 3CFUA 4YP0A 4HJWA 4MJ6B 3I42A 5BCAA 4GXWA 5HDQL 2GDVA 2ZJFA 4B9GA 5KYWB 2NY6B 1OQAA 5HYJB 1A3QA 3EJZD 2XGZA 4OXKA 3BWUC 4DJJA 3DTVA 3EHEA 2XCQA 5DKFA 2PH1A 1XR8B 5A6TC 2QT0A 4NCHA 2ZXUA 4P2RA 4JEHA 3VU9A 1SCDA 4DRXA 5B2FA 1MF2H 1QE0A 1R9MA 3QOFA 3DERA 3H8WA 3DUSB 1DTWA 4FGUA 4U7FA 3FB8A 3T9DA 4KX8A 1CJYA 4GUCA 4X6UA 3BL8A 1AQFA 1Q0SA 4PJGE 5D9SB 3JZEA 2IV9A 2DUWA 5AKLA 4H4EA 3PG8A 4AKIA 3UROR 3DPUA 4S1SH 2HWYA 3MZ0A 2EXSA 1YPFA 2Y1WA 2ZSWA 1NFIA 3K9FC 3CNYA 4JPGA 1K0FA 3WLFA 4DDMA 2V4LA 3IOEA 3D05A 1XD2A 1AZSC 4AURA 4IXNA 1F2TA 1TTQB 3M83A 4POOA 4XNXH 1JF1B 2FZNA 3DEIA 3CHCA 3HC4H 1GZ6A 3NDBB 3PG2A 2IBTA 1JZQA 2EG7A 2G9KA 2GQ8A 4Y16D 5K0JA 2PDUA 1J97A 3S2ZA 4TV8B 1W19A 1JDPA 4MRCA 4JO2H 5FIEA 1N2VA 4WUIA 3IUMA 1LQ2A 3VVVA 2C8KA 3W81A 2B3TA 2JRLA 1O7DE 1IJNA 4ZQKB 1NOLA 1EBGA 1CUXA 4JZYA 2XIIA 1UURA 5HFNA 4XC3H 1KQ3A 4IIQC 2XKNA 1FL9A 3VXTA 4LEEA 4F1ZA 4M19A 3BXNB 3LGGA 4YJ3F 1E0VA 4UTPA 4AKOA 4FXGC 2N1MA 4F5ZA 1PWEA 1ZENA 1OAOA 4ECEA 4HJTA 5KBKA 4L1DA 3NL2A 2A7RA 3QYMA 2UVQA 5DEIA 4RA0C 1LGYA 1DEEB 3WLIA 2EBHX 3FFBA 1N68A 2YD0A 4FFWA 2AL7A 5H59A 5B3JE 3GDWA 3IPFA 4FL4C 4KJYA 2PYEA 4F2ME 2CH8A 1NWHA 4N28A 3KT8A 2ZE0A 5FF6A 5IJAA 2V6MA 1XW8A 4MWBA 5LGJB 1AH1A 4M49A 2YR1A 4LQ4A 2NPLX 1Z18A 3HUJF 1MUCA 1YLVA 4IL2A 3L5AA 4ZT7A 4E5YA 4GMTH 3FOZA 3G8RA 4N4PA 1RURH 4R83A 2H51A 2DX7A 4JFEB 3EWCA 3P3RA 2W6ZA 4DVRH 5HAOA 4ZT6A 4GJ1A 3LPDA 2JKPA 3UNTA 2XXFA 1RZVA 1LBHA 2WVGA 3NFPA 4HPHA 1JG3A 2A6KA 3VRIB 3B8DA 3AW5A 4YSQA 1I10A 5FF0A 4NUMA 1DRUA 3PI6A 3OCYA 4WSKA 1VLJA 2NV6A 1JHQA 1WH0A 2XE8A 2Z4RA 5BOOA 3IACA 4B3EA 3FLAA 3UUEA 3RTDA 2IFGA 5EEHA 2HZGA 4JFZL 4RDIA 2WTNA 4MQFA 4DCOA 2QROA 1R0YA 1BOOA 5AW1A 2BHZA 1VFFA 1CZLA 3MJ7A 1LBTA 1SEBA 2DYRB 1R0WA 2ID9A 3ROMA 1NULA 2PMBA 1DBSA 2AD5A 1Q1QA 3ZR5A 4Z0XB 5TQ2L 5IT5A 3WDMA 4OZ4B 4KV9A 3IMUA 3QENA 4P2CG 4F5CE 4AXNA 1T4BA 3GMQA 2FSHA 1KBJA 3HGJA 2FSSA 3RNOA 3KKPA 2XCLA 4I3RL 1NFDA 4OZFB 5E9DB 3T1FA 1U9JA 2A9NL 4NFSA 4C6KA 5DY3A 4PCAA 3TGLA 5ANMB 3CO5A 1JH8A 3G04A 3ET5A 4A7QA 1B8OA 1CLUA 2PZBA 5C0DA 2VZ3A 2CZQA 3RSOA 4G7VL 2WB2A 1Q8AA 1A5UA 2QY6A 2R56L 1YY8B 1TM1E 4Z7UB 3QC3A 5FAGA 3H6AA 2B31A 4BN5A 1HORA 4DV7B 3MGCA 2OTUA 1DVFB 1PZGA 1XV5A 4YR6B 3AT1A 5C7IO 2H63A 4IOIB 5EU6D 2PWAA 4UJ3A 1W4AA 5CJQL 2PX8A 3KH3A 5E2VL 3RGTA 3U7BA 3NP9A 2R7MA 1YUKB 3H4TA 1EPVA 1QAQA 2Q09A 1CE8A 3GMPB 3MODL 3HV2A 4ZBCA 4XMKH 1KC5L 2ICWI 2OLJA 4AX7A 4TN5A 4JHZA 4GM4A 4JLBA 5L4FA 1USZA 3AESA 4M53A 1DZ3A 3QXTA 2Y71A 3DK2A 4CQMB 5YASA 2E59A 2DM7A 3OXRB 1CLZL 2ZXAA 4IY1A 4MQ5A 1XG3A 3A1SA 4UV7L 3FPHA 2DVMA 2Q7DA 2AWNA 5HYSB 3V1LA 3C60A 4C76A 4JDTH 1QBAA 4UTKA 3KJEA 1JAEA 2H1VA 2IGTA 3EZ9A 1FP7A 1B57A 4PJIA 4HX5A 3MGTB 3FO9A 2JGEA 3D4GA 2C4HA 3RI5F 2WSBA 5EJ2A 3GEMA 4I5EA 1R17A 2RMNA 2CXRA 4MVAA 4ZJYA 4OHKA 5E2WL 2ZWYA 4QATA 2CLLA 2P2GA 3CSDA 4KO3S 3KAKA 3VNIA 1WKCA 4XQ0A 4OLYH 4PJXB 4K8RB 2FAXA 3EGWA 2PBZA 3UAFA 3WLSA 1EK3A 1JK9A 1JPJA 2X6CA 3KQHA 3OTOB 2XSXA 1K6MA 2WJIA 3RX2A 3UGEA 2JGFA 4TF4A 1KXQA 3O9WD 1NWRA 3M3DA 1LSJA 4NZOA 4OZHF 1H49A 1L5FA 1U0HC 1XVIA 3BZUA 4A6YB 1IAKA 2H5UA 3SRHA 1KEGH 1P4LB 2OJ1A 5A5WA 3SDXE 5JOFA 2F8LA 4K5PA 3GK8L 4O4YH 4Q02A 1EUYA 1DQDH 3GMNB 3ULUC 3D6HA 1BF2A 5CFPA 3EK2A 3T7VA 4XPGL 5HR7A 1OZHA 2CLHA 4GY7A 3KM2A 3L9YA 1L8QA 4YCJA 5FBRB 3KPPA 5ISZD 2A6DB 4LF5B 1W8SA 1ECEA 4HS9A 5L7WA 3P4LA 3ZWVA 2XHEA 3LFHA 5IQ9B 2Q71A 2CUKA 5LBSH 2YXOA 4I50B 4ZQOA 2XN0A 3RU8L 4Q7NA 3ZQWA 2QWXA 4ZYXA 3E84A 1I1HA 3X1JA 4G9FE 1TFVA 4G7EA 1AB5A 3IXLA 3QUYD 4PZ0A 1IWPB 3ESCA 1KIAA 1OF2B 4OLWL 1KFKA 2CDEB 3N06B 2BFOA 1M68A 5AVVB 4MVJM 4WZBA 3P0VL 3GD6A 5IVZB 2I6QA 2HL6A 1A9EB 5LMZA 1FBNA 4LNUA 5DD5L 4UVDA 5ALOA 5LQMA 2XVZA 3U39A 4JTEA 1E0SA 5F7BA 3L3HA 4OI9A 5C55A 1YR1A 4JTIA 4KHXL 2BYTA 4H7JA 4AIZA 2GJ9A 3L4CA 4NABA 1WLSA 2UZPA 3USES 3LKBA 4BQCA 3DGGB 1EH9A 1ZITA 4FGMA 2IPWA 1N0WA 1VPWA 3CO0S 3IQGX 1FNGA 1XYCA 5EUOB 1ESNA 3AM8A 4ES8A 3VXSE 4S35A 5EF3A 5FFFA 1SCJA 1X1DA 1AD9A 2MYTA 2PGAA 1IY9A 2FPSA 1W46A 4R34A 3QTGA 4NR0A 4XISA 2VSQA 5DB4A 1QFXA 3W4JA 2WP3O 4R84A 1U63A 2B1AL 2EYRA 3ESZA 3I52A 4ARZB 2QNEA 3H7VA 3ZQ9A 2BI8A 5IFLA 3PXUA 3CMFA 1KZQA 2OWXA 3RTBA 4MZRA 4QPJC 5GRYA 2W0LA 2IYPA 2XAAA 1HXMB 3S48A 3I3BA 4RANA 2KERA 4IEFA 4MI9A 4W8OA 1OAUH 1UEMA 3Q45A 1H8HA 2BRUA 3HGSA 3TI9A 3CIOA 1RHHA 1TKAA 3TK1A 1DQKA 3OQ1A 3R44A 1UCFA 1U5HA 3OFNA 4DGIL 1XB8A 4LXQA 1C7IA 3QUYB 3W9EB 5FA4B 2ONCA 1WFNA 2BFGA 4GKLA 4CSPA 3DDOA 2XINA 1E4VA