4UPLA

Dimeric sulfatase spas2 from silicibacter pomeroyi
Total Genus 201
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
201
sequence length
555
structure length
555
Chain Sequence
TAVMNILFIMFDQLRWDYLSCYGHKTLNTPHIDRLAAKGVRFDRAYIQSPICGSSRMSTYTGRYVHSHGASWNGIPLKVGEMTMGDHLRAAGMGCWLVGKTHMRADEEGMARLGLEPDSLIGARVAECGFDVFERDDGMLPEGPDGYYDPDGAKEYNKFLRAKGYESDNPWHDFANSGLDDEGNVQSGWFLKNATRPANIAEEDSETPYLTSRAMEFIEQQTGPWCCHLSYIKPHWPYIVPEPYASMFGPEHVQDVVRSDSERQNAHPLFKAFMDTKVGEAFSRQEVRDAVIPAYMGLIKQADDQMGRLFKWLEDTGRMQDTMIVLTSDHGDFLGDHWMGEKTFFHDASTRVPLIIYDPRPEADATRGSVCDALVESIDLAPTFVEAAGGKPAMHILEGESLIPILHGARDHTLRDHVICEYDFSASPIAHLNDISVRQAVMFMVADKNWKLIHFEADPRPMLFDLKNDPQELVDLGGDPAHADVIAGMYDKLFRWTRRQSQRTTRSEEQLIAMRTKSRKRGIVLGIYDENETPLELTVKYRDRKARPYKDYLKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Balancing Specificity and Promiscuity in Enzyme Evolution: Multidimensional Activity Transitions in the Alkaline Phosphatase Superfamily.
pubmed doi rcsb
source organism Ruegeria pomeroyi
molecule tags Hydrolase
molecule keywords SULFATASE FAMILY PROTEIN
total genus 201
structure length 555
sequence length 555
chains with identical sequence C
ec nomenclature
pdb deposition date 2014-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00884 Sulfatase Sulfatase
A PF16347 DUF4976 Domain of unknown function (DUF4976)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 4uplA01
1ZEFA 3DYCA 1E33P 2W5WA 2W5SA 3TG0A 1EJJA 2W5VA 1E1ZP 1ELXA 1KHLA 3BDGA 4GTYA 4GTXA 1EQJA 3A52A 2GLQA 2W5QA 3NKPA 5C66A 3IGZB 5DLWA 3T01A 5LQQA 5IJSA 5DLVA 2W8SA 4CYRA 1ANIA 1AUKA 1ZEBA 1URAA 5INHA 4LR7A 4N7TA 1EW9A 4MHXA 4NWXA 4LREA 1AJCA 1FSUA 4CXSA 3DPCA 1SHQA 2IUCB 2ZKTA 5AJ9A 5HRTA 3BDHA 3M8ZA 4UPLA 4CYSA 3UNYA 1KH4A 3NKRA 3ED4A 1AJBA 4LRFA 4LRAA 5GOVA 3LXQA 1ELZA 2W8DA 2RH6A 1B8JA 4LRDA 1ED9A 4KM4A 4QAXA 4NWJA 3UN2A 4ZG7A 3WAVA 1KH7A 3SZYA 1ALHA 5IJQA 4UPKA 4CXUA 3MK0A 2ANHA 2IUCA 1EW8A 3TX0A 1ZEDA 2GA3A 3WAXA 4ZG6A 3CMRA 3M8WA 1Y6VA 3UO0A 3WAWA 5DLTA 5L0BA 5EGHA 5EGEA 1EW2A 4UORA 1Y7AA 4UOPA 1EI6A 4B56A 1ALJA 3NVLA 4YR1A 5LRMA 3E2DA 3TWZA 4UPIA 1O99A 1URBA 4GTZA 1ALKA 1O98A 1KH5A 4ZG9A 3OT9A 5L0EA 1E3CP 2D1GA 1ELYA 2X98A 4KAVA 3KD8A 4LRBA 1KH9A 1HJKA 1HQAA 3NKMA 3UN5A 2QZUA 3BDFA 5KXAA 5L0KA 1ANJA 4MY4A 2XR9A 1K7HA 2W5RA 1KHKA 2W5TA 4KJDA 3WBHA 3NKOA 3SZZA 2W5XA 4FDIA 4UOOA 3Q3QA 2GSNA 1N2LA 4MIVA 5GRRA 3M7VA 3NKNA 2GSUA 2VQRA 2XRGA 4KAYA 3NKQA 1HDHA 1P49A 3MK1A 4GTWA 4UPHA 4CXKA 1AJDA 3M8YA 3T00A 4LR2A 1ED8A 1KHNA 4LQYA 3BDGB 4KJGA 1ALIA 4LR9A 5K4PA 1N2KA 3IDDA 1E2SP 2G9YA 2IFYA 4TN0A 3WAYA 3IGYB 4ZGAA 5LIAA 2GSOA 1AJAA 3T02A 3UN3A 5TJ3A 4LR8A 5LRNA 1SHNA 3B5QA 1KHJA 3MK2A 4LRCA 4FDJA
chains in the Genus database with same CATH superfamily
1ZEFA 3DYCA 1E33P 2W5WA 2W5SA 3TG0A 1EJJA 2W5VA 1E1ZP 1ELXA 1KHLA 3BDGA 4GTYA 4GTXA 1EQJA 3A52A 2GLQA 2W5QA 3NKPA 5C66A 3IGZB 5DLWA 3T01A 5LQQA 5IJSA 5DLVA 2W8SA 4CYRA 1ANIA 1AUKA 1ZEBA 1URAA 5INHA 4LR7A 4N7TA 1EW9A 4MHXA 4NWXA 4LREA 1AJCA 1FSUA 4CXSA 3DPCA 1SHQA 2IUCB 2ZKTA 5AJ9A 5HRTA 3BDHA 3M8ZA 4UPLA 4CYSA 3UNYA 1KH4A 3NKRA 3ED4A 1AJBA 4LRFA 4LRAA 5GOVA 3LXQA 1ELZA 2W8DA 2RH6A 1B8JA 4LRDA 1ED9A 4KM4A 4QAXA 4NWJA 3UN2A 4ZG7A 3WAVA 1KH7A 3SZYA 1ALHA 5IJQA 4UPKA 4CXUA 3MK0A 2ANHA 2IUCA 1EW8A 3TX0A 1ZEDA 2GA3A 3WAXA 4ZG6A 3CMRA 3M8WA 1Y6VA 3UO0A 3WAWA 5DLTA 5L0BA 5EGHA 5EGEA 1EW2A 4UORA 1Y7AA 4UOPA 1EI6A 4B56A 1ALJA 3NVLA 4YR1A 5LRMA 3E2DA 3TWZA 4UPIA 1O99A 1URBA 4GTZA 1ALKA 1O98A 1KH5A 4ZG9A 3OT9A 5L0EA 1E3CP 2D1GA 1ELYA 2X98A 4KAVA 3KD8A 4LRBA 1KH9A 1HJKA 1HQAA 3NKMA 3UN5A 2QZUA 3BDFA 5KXAA 5L0KA 1ANJA 4MY4A 2XR9A 1K7HA 2W5RA 1KHKA 2W5TA 4KJDA 3WBHA 3NKOA 3SZZA 2W5XA 4FDIA 4UOOA 3Q3QA 2GSNA 1N2LA 4MIVA 5GRRA 3M7VA 3NKNA 2GSUA 2VQRA 2XRGA 4KAYA 3NKQA 1HDHA 1P49A 3MK1A 4GTWA 4UPHA 4CXKA 1AJDA 3M8YA 3T00A 4LR2A 1ED8A 1KHNA 4LQYA 3BDGB 4KJGA 1ALIA 4LR9A 5K4PA 1N2KA 3IDDA 1E2SP 2G9YA 2IFYA 4TN0A 3WAYA 3IGYB 4ZGAA 5LIAA 2GSOA 1AJAA 3T02A 3UN3A 5TJ3A 4LR8A 5LRNA 1SHNA 3B5QA 1KHJA 3MK2A 4LRCA 4FDJA
chains in the Genus database with same CATH topology
1ZEFA 3DYCA 1E33P 2W5WA 2W5SA 3TG0A 1EJJA 2W5VA 1E1ZP 1ELXA 1KHLA 3BDGA 4GTYA 4GTXA 1EQJA 3A52A 2GLQA 2W5QA 3NKPA 5C66A 3IGZB 5DLWA 3T01A 5LQQA 5IJSA 5DLVA 2W8SA 4CYRA 1ANIA 1AUKA 1ZEBA 1URAA 5INHA 4LR7A 4N7TA 1EW9A 4MHXA 4NWXA 4LREA 1AJCA 1FSUA 4CXSA 3DPCA 1SHQA 2IUCB 2ZKTA 5AJ9A 5HRTA 3BDHA 3M8ZA 4UPLA 4CYSA 3UNYA 1KH4A 3NKRA 3ED4A 1AJBA 4LRFA 4LRAA 5GOVA 3LXQA 1ELZA 2W8DA 2RH6A 1B8JA 4LRDA 1ED9A 4KM4A 4QAXA 4NWJA 3UN2A 4ZG7A 3WAVA 1KH7A 3SZYA 1ALHA 5IJQA 4UPKA 4CXUA 3MK0A 2ANHA 2IUCA 1EW8A 3TX0A 1ZEDA 2GA3A 3WAXA 4ZG6A 3CMRA 3M8WA 1Y6VA 3UO0A 3WAWA 5DLTA 5L0BA 5EGHA 5EGEA 1EW2A 4UORA 1Y7AA 4UOPA 1EI6A 4B56A 1ALJA 3NVLA 4YR1A 5LRMA 3E2DA 3TWZA 4UPIA 1O99A 1URBA 4GTZA 1ALKA 1O98A 1KH5A 4ZG9A 3OT9A 5L0EA 1E3CP 2D1GA 1ELYA 2X98A 4KAVA 3KD8A 4LRBA 1KH9A 1HJKA 1HQAA 3NKMA 3UN5A 2QZUA 3BDFA 5KXAA 5L0KA 1ANJA 4MY4A 2XR9A 1K7HA 2W5RA 1KHKA 2W5TA 4KJDA 3WBHA 3NKOA 3SZZA 2W5XA 4FDIA 4UOOA 3Q3QA 2GSNA 1N2LA 4MIVA 5GRRA 3M7VA 3NKNA 2GSUA 2VQRA 2XRGA 4KAYA 3NKQA 1HDHA 1P49A 3MK1A 4GTWA 4UPHA 4CXKA 1AJDA 3M8YA 3T00A 4LR2A 1ED8A 1KHNA 4LQYA 3BDGB 4KJGA 1ALIA 4LR9A 5K4PA 1N2KA 3IDDA 1E2SP 2G9YA 2IFYA 4TN0A 3WAYA 3IGYB 4ZGAA 5LIAA 2GSOA 1AJAA 3T02A 3UN3A 5TJ3A 4LR8A 5LRNA 1SHNA 3B5QA 1KHJA 3MK2A 4LRCA 4FDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZEF A;  3DYC A;  1E33 P;  2W5W A;  2W5S A;  3TG0 A;  1EJJ A;  2W5V A;  1E1Z P;  1ELX A;  1KHL A;  3BDG A;  4GTY A;  4GTX A;  1EQJ A;  3A52 A;  2GLQ A;  2W5Q A;  3NKP A;  5C66 A;  3IGZ B;  5DLW A;  3T01 A;  5LQQ A;  5IJS A;  5DLV A;  2W8S A;  4CYR A;  1ANI A;  1AUK A;  1ZEB A;  1URA A;  5INH A;  4LR7 A;  4N7T A;  1EW9 A;  4MHX A;  4NWX A;  4LRE A;  1AJC A;  1FSU A;  4CXS A;  3DPC A;  1SHQ A;  2IUC B;  2ZKT A;  5AJ9 A;  5HRT A;  3BDH A;  3M8Z A;  4UPL A;  4CYS A;  3UNY A;  1KH4 A;  3NKR A;  3ED4 A;  1AJB A;  4LRF A;  4LRA A;  5GOV A;  3LXQ A;  1ELZ A;  2W8D A;  2RH6 A;  1B8J A;  4LRD A;  1ED9 A;  4KM4 A;  4QAX A;  4NWJ A;  3UN2 A;  4ZG7 A;  3WAV A;  1KH7 A;  3SZY A;  1ALH A;  5IJQ A;  4UPK A;  4CXU A;  3MK0 A;  2ANH A;  2IUC A;  1EW8 A;  3TX0 A;  1ZED A;  2GA3 A;  3WAX A;  4ZG6 A;  3CMR A;  3M8W A;  1Y6V A;  3UO0 A;  3WAW A;  5DLT A;  5L0B A;  5EGH A;  5EGE A;  1EW2 A;  4UOR A;  1Y7A A;  4UOP A;  1EI6 A;  4B56 A;  1ALJ A;  3NVL A;  4YR1 A;  5LRM A;  3E2D A;  3TWZ A;  4UPI A;  1O99 A;  1URB A;  4GTZ A;  1ALK A;  1O98 A;  1KH5 A;  4ZG9 A;  3OT9 A;  5L0E A;  1E3C P;  2D1G A;  1ELY A;  2X98 A;  4KAV A;  3KD8 A;  4LRB A;  1KH9 A;  1HJK A;  1HQA A;  3NKM A;  3UN5 A;  2QZU A;  3BDF A;  5KXA A;  5L0K A;  1ANJ A;  4MY4 A;  2XR9 A;  1K7H A;  2W5R A;  1KHK A;  2W5T A;  4KJD A;  3WBH A;  3NKO A;  3SZZ A;  2W5X A;  4FDI A;  4UOO A;  3Q3Q A;  2GSN A;  1N2L A;  4MIV A;  5GRR A;  3M7V A;  3NKN A;  2GSU A;  2VQR A;  2XRG A;  4KAY A;  3NKQ A;  1HDH A;  1P49 A;  3MK1 A;  4GTW A;  4UPH A;  4CXK A;  1AJD A;  3M8Y A;  3T00 A;  4LR2 A;  1ED8 A;  1KHN A;  4LQY A;  3BDG B;  4KJG A;  1ALI A;  4LR9 A;  5K4P A;  1N2K A;  3IDD A;  1E2S P;  2G9Y A;  2IFY A;  4TN0 A;  3WAY A;  3IGY B;  4ZGA A;  5LIA A;  2GSO A;  1AJA A;  3T02 A;  3UN3 A;  5TJ3 A;  4LR8 A;  5LRN A;  1SHN A;  3B5Q A;  1KHJ A;  3MK2 A;  4LRC A;  4FDJ A; 
#chains in the Genus database with same CATH topology
 1ZEF A;  3DYC A;  1E33 P;  2W5W A;  2W5S A;  3TG0 A;  1EJJ A;  2W5V A;  1E1Z P;  1ELX A;  1KHL A;  3BDG A;  4GTY A;  4GTX A;  1EQJ A;  3A52 A;  2GLQ A;  2W5Q A;  3NKP A;  5C66 A;  3IGZ B;  5DLW A;  3T01 A;  5LQQ A;  5IJS A;  5DLV A;  2W8S A;  4CYR A;  1ANI A;  1AUK A;  1ZEB A;  1URA A;  5INH A;  4LR7 A;  4N7T A;  1EW9 A;  4MHX A;  4NWX A;  4LRE A;  1AJC A;  1FSU A;  4CXS A;  3DPC A;  1SHQ A;  2IUC B;  2ZKT A;  5AJ9 A;  5HRT A;  3BDH A;  3M8Z A;  4UPL A;  4CYS A;  3UNY A;  1KH4 A;  3NKR A;  3ED4 A;  1AJB A;  4LRF A;  4LRA A;  5GOV A;  3LXQ A;  1ELZ A;  2W8D A;  2RH6 A;  1B8J A;  4LRD A;  1ED9 A;  4KM4 A;  4QAX A;  4NWJ A;  3UN2 A;  4ZG7 A;  3WAV A;  1KH7 A;  3SZY A;  1ALH A;  5IJQ A;  4UPK A;  4CXU A;  3MK0 A;  2ANH A;  2IUC A;  1EW8 A;  3TX0 A;  1ZED A;  2GA3 A;  3WAX A;  4ZG6 A;  3CMR A;  3M8W A;  1Y6V A;  3UO0 A;  3WAW A;  5DLT A;  5L0B A;  5EGH A;  5EGE A;  1EW2 A;  4UOR A;  1Y7A A;  4UOP A;  1EI6 A;  4B56 A;  1ALJ A;  3NVL A;  4YR1 A;  5LRM A;  3E2D A;  3TWZ A;  4UPI A;  1O99 A;  1URB A;  4GTZ A;  1ALK A;  1O98 A;  1KH5 A;  4ZG9 A;  3OT9 A;  5L0E A;  1E3C P;  2D1G A;  1ELY A;  2X98 A;  4KAV A;  3KD8 A;  4LRB A;  1KH9 A;  1HJK A;  1HQA A;  3NKM A;  3UN5 A;  2QZU A;  3BDF A;  5KXA A;  5L0K A;  1ANJ A;  4MY4 A;  2XR9 A;  1K7H A;  2W5R A;  1KHK A;  2W5T A;  4KJD A;  3WBH A;  3NKO A;  3SZZ A;  2W5X A;  4FDI A;  4UOO A;  3Q3Q A;  2GSN A;  1N2L A;  4MIV A;  5GRR A;  3M7V A;  3NKN A;  2GSU A;  2VQR A;  2XRG A;  4KAY A;  3NKQ A;  1HDH A;  1P49 A;  3MK1 A;  4GTW A;  4UPH A;  4CXK A;  1AJD A;  3M8Y A;  3T00 A;  4LR2 A;  1ED8 A;  1KHN A;  4LQY A;  3BDG B;  4KJG A;  1ALI A;  4LR9 A;  5K4P A;  1N2K A;  3IDD A;  1E2S P;  2G9Y A;  2IFY A;  4TN0 A;  3WAY A;  3IGY B;  4ZGA A;  5LIA A;  2GSO A;  1AJA A;  3T02 A;  3UN3 A;  5TJ3 A;  4LR8 A;  5LRN A;  1SHN A;  3B5Q A;  1KHJ A;  3MK2 A;  4LRC A;  4FDJ A; 
#chains in the Genus database with same CATH homology
 1ZEF A;  3DYC A;  1E33 P;  2W5W A;  2W5S A;  3TG0 A;  1EJJ A;  2W5V A;  1E1Z P;  1ELX A;  1KHL A;  3BDG A;  4GTY A;  4GTX A;  1EQJ A;  3A52 A;  2GLQ A;  2W5Q A;  3NKP A;  5C66 A;  3IGZ B;  5DLW A;  3T01 A;  5LQQ A;  5IJS A;  5DLV A;  2W8S A;  4CYR A;  1ANI A;  1AUK A;  1ZEB A;  1URA A;  5INH A;  4LR7 A;  4N7T A;  1EW9 A;  4MHX A;  4NWX A;  4LRE A;  1AJC A;  1FSU A;  4CXS A;  3DPC A;  1SHQ A;  2IUC B;  2ZKT A;  5AJ9 A;  5HRT A;  3BDH A;  3M8Z A;  4UPL A;  4CYS A;  3UNY A;  1KH4 A;  3NKR A;  3ED4 A;  1AJB A;  4LRF A;  4LRA A;  5GOV A;  3LXQ A;  1ELZ A;  2W8D A;  2RH6 A;  1B8J A;  4LRD A;  1ED9 A;  4KM4 A;  4QAX A;  4NWJ A;  3UN2 A;  4ZG7 A;  3WAV A;  1KH7 A;  3SZY A;  1ALH A;  5IJQ A;  4UPK A;  4CXU A;  3MK0 A;  2ANH A;  2IUC A;  1EW8 A;  3TX0 A;  1ZED A;  2GA3 A;  3WAX A;  4ZG6 A;  3CMR A;  3M8W A;  1Y6V A;  3UO0 A;  3WAW A;  5DLT A;  5L0B A;  5EGH A;  5EGE A;  1EW2 A;  4UOR A;  1Y7A A;  4UOP A;  1EI6 A;  4B56 A;  1ALJ A;  3NVL A;  4YR1 A;  5LRM A;  3E2D A;  3TWZ A;  4UPI A;  1O99 A;  1URB A;  4GTZ A;  1ALK A;  1O98 A;  1KH5 A;  4ZG9 A;  3OT9 A;  5L0E A;  1E3C P;  2D1G A;  1ELY A;  2X98 A;  4KAV A;  3KD8 A;  4LRB A;  1KH9 A;  1HJK A;  1HQA A;  3NKM A;  3UN5 A;  2QZU A;  3BDF A;  5KXA A;  5L0K A;  1ANJ A;  4MY4 A;  2XR9 A;  1K7H A;  2W5R A;  1KHK A;  2W5T A;  4KJD A;  3WBH A;  3NKO A;  3SZZ A;  2W5X A;  4FDI A;  4UOO A;  3Q3Q A;  2GSN A;  1N2L A;  4MIV A;  5GRR A;  3M7V A;  3NKN A;  2GSU A;  2VQR A;  2XRG A;  4KAY A;  3NKQ A;  1HDH A;  1P49 A;  3MK1 A;  4GTW A;  4UPH A;  4CXK A;  1AJD A;  3M8Y A;  3T00 A;  4LR2 A;  1ED8 A;  1KHN A;  4LQY A;  3BDG B;  4KJG A;  1ALI A;  4LR9 A;  5K4P A;  1N2K A;  3IDD A;  1E2S P;  2G9Y A;  2IFY A;  4TN0 A;  3WAY A;  3IGY B;  4ZGA A;  5LIA A;  2GSO A;  1AJA A;  3T02 A;  3UN3 A;  5TJ3 A;  4LR8 A;  5LRN A;  1SHN A;  3B5Q A;  1KHJ A;  3MK2 A;  4LRC A;  4FDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...